ELF(Ê4¤óæ4 (444€€´´´ºººÊÊ;w;w õ  \&R\&R€â€Kâ€KâäÕì õ   °â°9â°9âèèRåtd õ  \&Rà*RQåtdÈÈÈüüp€±€±€±((/system/bin/linker„Androidr26b10909125SGoLvQTZQiGvNp47wKMoHiS/AepBUAWNOduWZE_0r9Pg/4i0ICe6XNV0_IiusR7mm/j3h1F16d50hIkm7icZzU \ckwƒˆ•¢­´½ÃØŞåìòú !0:IRZm”«¶ÆØò'.8AKU^,8Ï ( <@ì80 G¨ì8˜ R„õ$ e s c nc n0 ‚$0º}ËæJr<®š½½ˆÂ¦__libc_init__cxa_atexit__register_atfork_cgo_topofstack_cgo_paniccrosscall2main.mainmalloc__errnogetnameinfogetaddrinfofreefreeaddrinfogai_strerrorres_searchfwritevfprintffputc__android_log_vprintabortstderrdlopendlsymdlclosepthread_key_createpthread_setspecificpthread_createnanosleeppthread_detachstrerrorfprintfpthread_mutex_lockpthread_cond_waitpthread_mutex_unlockpthread_cond_broadcastsigfillsetpthread_sigmaskpthread_attr_initpthread_attr_getstacksizepthread_attr_destroysetenvunsetenvsetegidseteuidsetgidsetgroupssetregidsetresgidsetresuidsetreuidsetuidlibdl.soLIBClibc.soliblog.soĞÔØÜàäèìğôøü  $(,048<@DHLPTX\`dhlptx€¤¨¬°´¸¼ôøü  $(,48<@DHLPTXhlptx€„ˆŒ”˜œ ¤¨¬°´¸¼ÀÄÈÌÔØÜàìğôø (,048<@DHPTX\`d¼ÀÄÈÌĞÔØÜàäèìğôøü  $(,04@DHLTX\`dhlptx|€„ˆŒ”˜œ ¤¨¬°´¸¼ÀÄÌĞÔØÜàäèìğôøü $48<@\`dhlptx|€”˜œ ¤¨  $(,048<@DHLPTX\`dht€„ˆ”˜¤¨¬°´¸¼ÀÈÌĞÔØÜàäèìğôøü  $(,08<@LPTX\`dhlp|€„ˆŒ”˜œ ¤¨¬°´¸¼ÀÄÈÌĞÔØÜàäèìğôøü  $(,48<@DHLPTXlptx|€„ˆŒ”˜œ ¤¨¬°´¸¼ÀÄÈÌĞÔØÜàäèìğôøü  $(,048<@DHLPTX\`dhlptx|€„ˆŒ˜œ ¤¨¬°´¸¼ÀÔØÜàäèìğøü  $(,048<@DHLPTX\`dhltx|€„ˆŒ”˜œ ¤¨¬°´¸¼ÀÄÈÌĞÔØÜàäèğôøü         $ ( D L P T X \ ` d h l p x | € „ ˆ Œ  ” ˜ œ   ¬ ° ´ ¸ ¼ À Ä È Ì Ü à ä è ì ğ ô ø ü !!! !!!!!(!,!0!4!8!x>€>ˆ>à>è>ø>?x?€?ˆ?0A8A@ABBBØCàCèCĞDØDàDğDXEhExEFFFFFèGğGøGHHHH H(H0H8H@HHHPHXH¨HHII˜I I¨IøJ@KĞKØKLL L8LpMxM€MˆMM˜M M¨M°MN¸NPXP`PxP€PˆQQØP“ÜP“èP“Q“Q“Q“(Q“,Q“8Q“PQ“TQ“`Q“xQ“|Q“ˆQ“ Q“¤Q“°Q“ÈQ“ÌQ“ØQ“ğQ“ôQ“R“R“R“(R“@R“DR“PR“hR“lR“xR“R“”R“ R“¸R“¼R“ÈR“àR“äR“ğR“S“ S“S“0S“4S“@S“XS“\S“hS“€S“„S“S“¨S“¬S“¸S“ĞS“ÔS“àS“øS“üS“T“ T“$T“0T“HT“LT“XT“pT“tT“€T“˜T“œT“¨T“ÀT“ÄT“ĞT“èT“ìT“øT“U“U“ U“8U“” >”\>”h>”„>”>”¬>”¸>”Ô>”à>”ü>”?”$?”0?”L?”X?”t?”€?”œ?”¨?”Ä?”Ğ?”ì?”ø?”@” @”8@”<@”H@”d@”p@”Œ@”˜@”Ô@”à@”ü@”A”$A”0A”LA”XA”tA”€A”œA”¨A”ÄA”ĞA”ìA”øA”B” B”•>•$>•0>•4>•T>•`>•d>•„>•>•”>•´>•À>•Ä>•ä>•ğ>•ô>•?• ?•$?•D?•P?•T?•t?•„?•ˆ?•¤?•°?•´?•Ô?•à?•ä?•@•@•@•4@•@@•D@•d@•t@•x@•”@•¤@•¨@•Ä@•Ô@•Ø@•ô@•A•A• A•$A•0A•4A•PA•TA•`A•dA•€A•„A•A•”A•°A•´A•ÀA•ÄA•äA•ğA•ôA•B• B•$B•DB•PB•TB•tB•€B•„B•¤B•°B•´B•ÔB•àB•äB•C•C•C•4C•@C•DC•dC•pC•tC•”C• C•¤C•ÄC•ÔC•ØC•ôC•D•D•$D•4D•8D•¬D•¼D•ÀD•ÜD•ìD•ğD• E•E•E•–>–>–,>–<>–@>–D>–\>–l>–p>–t>–Œ>–œ>– >–¤>–¼>–Ì>–Ğ>–Ô>–ì>–ü>–?–?–L?–\?–`?–d?–|?–Œ?–?–”?–¬?–¼?–À?–Ä?–Ü?–ì?–ğ?–ô?– @–@– @–$@–l@–|@–€@–„@–œ@–¬@–°@–´@–Ì@–Ü@–à@–ä@–4X–@X–lX–xX–¤X–ÜX–èX–Y–Y– Y–LY–XY–„Y–Y–¼Y–ÈY–ôY–Z–,Z–8Z–dZ–pZ–œZ–¨Z–[–[–[–[– [–<[–L[–P[–T[–X[–t[–„[–ˆ[–Œ[–[–D\–T\–X\–\\–`\–|\–Œ\–\–”\–˜\–´\–Ä\–È\–Ì\–Ğ\–ì\–ü\–]–]–]–$]–4]–8]–<]–@]–\]–l]–p]–t]–x]–”]–¤]–¨]–¬]–°]–Ì]–Ü]–à]–ä]–è]–^–^–^–^– ^–<^–L^–P^–T^–X^–t^–„^–ˆ^–Œ^–^–¬^–¼^–À^–Ä^–È^–ä^–ô^–ø^–ü^–_–_–,_–0_–4_–8_–T_–d_–h_–l_–p_–Œ_–œ_– _–¤_–¨_–Ä_–Ô_–Ø_–Ü_–à_–ü_– `–`–`–`–4`–@`–l`–x`–¤`–°`–Ü`–ì`–ğ`–ô`–ø`–a–$a–(a–,a–0a–La–\a–`a–da–ha–„a–”a–˜a–œa– a–¼a–Ìa–Ğa–Ôa–Øa–ôa–b–b– b–b–,b–—>—X>—\>—˜>—œ>—¬>—Ø>—Ü>—?—?—X?—\?—˜?—œ?—Ø?—Ü?—@—<@—@@—D@—X@—\@—˜@—œ@—Ø@—Ü@—A—A—,A—XA—\A—˜A—œA—ØA—ÜA—B—B—XB—\B—˜B—œB—¬B—ØB—ÜB—ìB—C—C—,C—XC—\C—œC—¼C—ÀC—ÄC—ØC—ÜC—D—D—,D—XD—\D—˜D—œD—ØD—ÜD—E—E—XE—\E—˜E—œE—ØE—ÜE—F—F—XF—\F—˜F—œF—ØF—ÜF—G—G—XG—\G—œG—¼G—ÀG—ÄG—ØG—ÜG—ìG—H—H—,H—XH—\H—lH—˜H—œH—¨H—¬H—ØH—ÜH—èH—ìH—I—I—(I—,I—XI—\I—lI—˜I—œI—¬I—ØI—ÜI—ìI—J—J—,J—XJ—\J—˜J—œJ—ØJ—ÜJ—K—K—,K—XK—\K—˜K—œK—ØK—ÜK—L—L—,L—XL—\L—˜L—œL—ØL—ÜL—ìL—M—M—XM—\M—lM—˜M—œM—ØM—ÜM—N—N—,N—XN—\N—lN—˜N—œN—¬N—ØN—ÜN—ìN—O—O—,O—XO—\O—lO—˜O—œO—ØO—ÜO—èO—ìO—P—P—XP—\P—˜P—œP—¬P—ØP—ÜP—ìP—Q—Q—XQ—\Q—lQ—˜Q—œQ—ØQ—ÜQ—R—R—XR—\R—lR—˜R—œR—ØR—ÜR—S—S—XS—\S—˜S—œS—¬S—ØS—ÜS—T—T—XT—\T—lT—˜T—œT—¬T—ØT—ÜT—ìT—U—U—XU—\U—˜U—œU—ØU—ÜU—V—V—XV—\V—œV—¼V—ÀV—ÄV—ØV—ÜV—W—W—XW—\W—˜W—œW—ØW—ÜW—X—X—XX—\X—hX—lX—˜X—œX—¬X—ØX—ÜX—ìX—Y—Y—,Y—XY—\Y—lY—˜Y—œY—ØY—ÜY—ìY—Z—Z—XZ—\Z—˜Z—œZ—ØZ—ÜZ—[—<[—@[—D[—X[—\[—˜[—œ[—Ø[—Ü[—\—\—X\—\\—˜\—œ\—Ø\—Ü\—]—<]—@]—D]—\]—|]—€]—„]—˜]—œ]—¬]—Ø]—Ü]—^—^—,^—X^—\^—l^—œ^—¼^—À^—Ä^—Ø^—Ü^—_—_—X_—\_—\`—l`—p`—t`—x`—|`—€`—„`—\a—la—pa—ta—xa—|a—€a—„a—œa—¬a—°a—´a—¸a—¼a—Àa—Äa—Üa—ìa—ğa—ôa—øa—üa—b—b—b—,b—0b—4b—8b—˜>˜>˜>˜ >˜8>˜<>˜L>˜X>˜\>˜d>˜h>˜€>˜„>˜”>˜ >˜¤>˜¬>˜°>˜È>˜Ì>˜Ü>˜è>˜ì>˜ô>˜ø>˜?˜$?˜0?˜4?˜™,>™8>™Ô>™ä>™ğ>™ô>™ü>™?™?™ ?™,?™š>š>š>š>š >š<>šH>šL>šX>š\>šd>šh>šp>št>š|>š€>šœ>š¨>š¬>š¸>š¼>šÄ>šÈ>šĞ>šÔ>šÜ>šà>šü>š?š ?š?š?š$?š(?š0?š4?š›T>›`>›d>›€>›„>›Œ>›>›˜>›œ>›¼>›È>›Ì>›è>›ì>›ô>›ø>›?›?› ?›$?›0?›4?›P?›T?›\?›`?›h?›l?›ˆ?›Œ?›˜?›œ?›¸?›¼?›Ä?›È?›Ğ?›Ô?›ğ?›ô?›@›X@›\@›h@›À@›Ä@›Ğ@›(A›,A›8A›”A›¤A›ÀA›ÄA›ÌA›ĞA›ØA›ÜA›øA›üA›B›`B›dB›tB›B›”B›œB› B›¨B›¬B›ÌB›ØB›ÜB›øB›üB›C›C›C›C›0C›4C›@C›œC›¨C›¬C›ÈC›ÌC›ÔC›ØC›àC›äC›D›D›D›D›0D›4D›œ>œ>œ>œ>œ >œ(>œ,>œH>œL>œX>œ\>œx>œ|>œ„>œˆ>œ>œ”>œœ>œ >œ¨>œ¬>œÌ>œÜ>œø>œü>œ?œ?œ?œ?œ?œ ?œ(?œ,?œH?œL?œ\?œx?œ|?œ„?œˆ?œ?œ”?œœ?œ ?œ¨?œ¬?œÌ?œÜ?œø?œü?œ@œ@œ@œ@œ@œ @œ(@œ,@œH@œL@œX@œ\@œx@œ|@œ„@œˆ@œ@œ”@œœ@œ @œ¨@œ¬@œÌ@œØ@œÜ@œø@œü@œAœAœAœAœAœ Aœ(Aœ,AœHAœLAœ\AœxAœ|Aœ„AœˆAœAœ”AœœAœ Aœ¨Aœ¬AœÈAœÌAœÜAœøAœüAœLBœXBœ\BœxBœ|Bœ„BœˆBœBœ”BœœBœ Bœ¨Bœ¬BœÌBœØBœÜBœøBœüBœCœCœCœCœCœ Cœ(Cœ,CœHCœLCœXCœ\CœxCœ|Cœ„CœˆCœCœ”CœœCœ Cœ¨Cœ¬CœÌCœØCœÜCœøCœüCœDœDœDœDœDœ Dœ(Dœ,DœHDœLDœXDœ\DœxDœ|Dœ„DœˆDœDœ”DœœDœ Dœ¨Dœ¬DœÌDœØDœÜDœøDœüDœEœEœEœEœEœ Eœ(Eœ,EœLEœXEœ\EœxEœ|Eœ„EœˆEœEœ”EœœEœ Eœ¨Eœ¬EœÌEœØEœÜEœøEœüEœFœFœFœFœFœ Fœ(Fœ,FœHFœLFœ\FœxFœ|Fœ„FœˆFœFœ”FœœFœ Fœ¨Fœ¬FœÌFœØFœÜFœøFœüFœGœGœGœGœGœ Gœ(Gœ,GœHGœLGœXGœ\GœxGœ|Gœ„GœˆGœGœ”GœœGœ Gœ¨Gœ¬GœÌGœÜGœøGœüGœHœHœHœHœHœ Hœ(Hœ,HœLHœXHœ\HœxHœ|Hœ„HœˆHœHœ”HœœHœ Hœ¨Hœ¬HœÌHœØHœÜHœøHœüHœIœIœIœIœIœ Iœ(Iœ,IœLIœXIœ\IœxIœ|Iœ„IœˆIœIœ”IœœIœ Iœ¨Iœ¬IœÌIœÜIœøIœüIœJœJœJœJœJœ Jœ(Jœ,JœLJœXJœ\JœxJœ|Jœ„JœˆJœJœ”JœœJœ Jœ¨Jœ¬JœÈJœÌJœÜJœøJœüJœLKœXKœ\KœxKœ|Kœ„KœˆKœKœ”KœœKœ Kœ¨Kœ¬KœÈKœÌKœÜKœøKœüKœLœLœLœLœLœ Lœ(Lœ,LœLLœXLœ\LœxLœ|Lœ„LœˆLœLœ”LœœLœ Lœ¨Lœ¬LœÈLœÌLœÜLœøLœüLœMœMœMœMœMœ Mœ(Mœ,MœHMœLMœXMœ\MœxMœ|Mœ„MœˆMœMœ”MœœMœ Mœ¨Mœ¬MœÈMœÌMœØMœÜMœøMœüMœNœNœNœNœNœ Nœ(Nœ,NœHNœLNœXNœ\NœxNœ|Nœ„NœˆNœNœ”NœœNœ Nœ¨Nœ¬NœÌNœØNœÜNœøNœüNœOœOœOœOœOœ Oœ(Oœ,OœLOœ\OœxOœ|Oœ„OœˆOœOœ”OœœOœ Oœ¨Oœ¬OœÈOœÌOœÜOœøOœüOœLPœXPœ\PœxPœ|Pœ„PœˆPœPœ”PœœPœ Pœ¨Pœ¬PœÈPœÌPœØPœÜPœøPœüPœQœQœQœQœQœ Qœ(Qœ,QœHQœLQœXQœ\QœxQœ|Qœ„QœˆQœQœ”QœœQœ Qœ¨Qœ¬QœÈQœÌQœØQœÜQœøQœüQœRœRœRœRœRœ Rœ(Rœ,RœHRœLRœXRœ\RœxRœ|Rœ„RœˆRœRœ”RœœRœ Rœ¨Rœ¬RœÈRœÌRœØRœÜRœøRœüRœSœSœSœSœSœ Sœ(Sœ,SœHSœLSœ\SœxSœ|Sœ„SœˆSœSœ”SœœSœ Sœ¨Sœ¬SœÈSœÌSœÜSœøSœüSœTœTœTœTœTœ Tœ(Tœ,TœHTœLTœ\TœxTœ|Tœ„TœˆTœTœ”TœœTœ Tœ¨Tœ¬TœÌTœØTœÜTœøTœüTœUœUœUœUœUœ Uœ(Uœ,UœHUœLUœXUœ\UœxUœ|Uœ„UœˆUœUœ”UœœUœ Uœ¨Uœ¬UœÈUœÌUœØUœÜUœøUœüUœLVœ\VœxVœ|Vœ„VœˆVœVœ”VœœVœ Vœ¨Vœ¬VœÈVœÌVœÜVœøVœüVœWœWœWœWœWœ Wœ(Wœ,WœLWœXWœ\WœxWœ|Wœ„WœˆWœWœ”WœœWœ Wœ¨Wœ¬WœÌWœØWœÜWœøWœüWœXœXœXœXœXœ Xœ(Xœ,XœHXœLXœXXœ\XœxXœ|XœÈXœÌXœØXœÜXœøXœüXœYœYœYœYœYœ Yœ(Yœ,YœLYœ\YœxYœ|Yœ„YœˆYœYœ”YœœYœ Yœ¨Yœ¬YœÌYœØYœÜYœøYœüYœZœZœZœZœZœ Zœ(Zœ,ZœLZœXZœ\ZœxZœ|Zœ„ZœˆZœZœ”ZœœZœ Zœ¨Zœ¬ZœÌZœØZœÜZœøZœüZœ[œ[œ[œ[œ[œ [œ([œ,[œL[œX[œ\[œx[œ|[œ„[œˆ[œ[œ”[œœ[œ [œ¨[œ¬[œÌ[œØ[œÜ[œø[œü[œ\œ\œ\œ\œ\œ \œ(\œ,\œL\œX\œ\\œx\œ|\œ„\œˆ\œ\œ”\œœ\œ \œ¨\œ¬\œÌ\œØ\œÜ\œø\œü\œ]œ]œ]œ]œ]œ ]œ(]œ,]œL]œ\]œx]œ|]œ„]œˆ]œ]œ”]œœ]œ ]œ¨]œ¬]œÈ]œÌ]œØ]œÜ]œø]œü]œ^œ^œ^œ^œ^œ ^œ(^œ,^œL^œX^œ\^œx^œ|^œ„^œˆ^œ^œ”^œœ^œ ^œ¨^œ¬^œÌ^œÜ^œø^œü^œ_œ_œ_œ_œ_œ _œ(_œ,_œH_œL_œ\_œx_œ|_œ„_œˆ_œ_œ”_œœ_œ _œ¨_œ¬_œÈ_œÌ_œÜ_œø_œü_œ`œ`œ`œ`œ`œ `œ(`œ,`œH`œL`œ\`œx`œ|`œ„`œˆ`œ`œ”`œœ`œ `œ¨`œ¬`œÈ`œÌ`œÜ`œø`œü`œaœaœaœaœaœ aœ(aœ,aœHaœLaœ\aœxaœ|aœ„aœˆaœaœ”aœœaœ aœ¨aœ¬aœÈaœÌaœÜaœøaœüaœbœbœbœbœbœ bœ(bœ,bœHbœLbœ\bœxbœ|bœ„bœˆbœbœ”bœœbœ bœ¨bœ¬bœÈbœÌbœÜbœøbœübœcœcœcœcœcœ cœ(cœ,cœHcœLcœ\cœxcœ|cœ„cœˆcœcœ”cœœcœ cœ¨cœ¬cœÌcœÜcœøcœücœdœdœdœdœdœ dœ(dœ,dœLdœ\dœxdœ|dœ„dœˆdœdœ”dœœdœ dœ¨dœ¬dœÌdœØdœÜdœødœüdœeœeœeœeœeœ eœ(eœ,eœHeœLeœXeœ\eœxeœ|eœ„eœˆeœeœ”eœœeœ eœ¨eœ¬eœÈeœÌeœØeœÜeœøeœüeœfœfœfœfœfœ fœ(fœ,fœLfœXfœ\fœxfœ|fœ„fœˆfœfœ”fœœfœ fœ¨fœ¬fœÌfœØfœÜfœøfœüfœgœgœgœgœgœ gœ(gœ,gœHgœLgœ\gœxgœ|gœ„gœˆgœgœ”gœœgœ gœ¨gœ¬gœÈgœÌgœØgœÜgœøgœügœhœhœhœhœhœ hœ(hœ,hœHhœLhœXhœ\hœxhœ|hœ„hœˆhœhœ”hœœhœ hœ¨hœ¬hœÈhœÌhœØhœÜhœøhœühœiœiœiœiœiœ iœ(iœ,iœHiœLiœ\iœxiœ|iœ„iœˆiœiœ”iœœiœ iœ¨iœ¬iœÈiœÌiœØiœÜiœøiœüiœjœjœjœjœjœ jœ(jœ,jœHjœLjœ\jœxjœ|jœ„jœˆjœjœ”jœœjœ jœ¨jœ¬jœÈjœÌjœØjœÜjœøjœüjœkœkœkœkœkœ kœ(kœ,kœHkœLkœXkœ\kœxkœ|kœ„kœˆkœkœ”kœœkœ kœ¨kœ¬kœÌkœØkœÜkœøkœükœlœlœlœlœlœ lœ(lœ,lœLlœXlœ\lœxlœ|lœ„lœˆlœlœ”lœœlœ lœ¨lœ¬lœÈlœÌlœØlœÜlœølœülœmœmœmœmœmœ mœ(mœ,mœLmœ\mœxmœ|mœ„mœˆmœmœ”mœœmœ mœ¨mœ¬mœÈmœÌmœØmœÜmœømœümœnœnœnœnœnœ nœ(nœ,nœHnœLnœXnœ\nœxnœ|nœ„nœˆnœnœ”nœœnœ nœ¨nœ¬nœÌnœØnœÜnœønœünœoœoœoœoœoœ oœ(oœ,oœLoœXoœ\oœxoœ|oœ„oœˆoœoœ”oœœoœ oœ¨oœ¬oœÌoœÜoœøoœüoœpœpœpœpœpœ pœ(pœ,pœLpœXpœ\pœxpœ|pœ„pœˆpœpœ”pœœpœ pœ¨pœ¬pœÌpœØpœÜpœøpœüpœqœqœqœqœqœ qœ(qœ,qœHqœLqœXqœ\qœxqœ|qœÌqœØqœÜqœøqœüqœrœrœrœrœrœ rœ(rœ,rœLrœXrœ\rœxrœ|rœ„rœˆrœrœ”rœœrœ rœ¨rœ¬rœÌrœÜrœørœürœsœsœsœsœsœ sœ(sœ,sœLsœ\sœxsœ|sœ„sœˆsœsœ”sœœsœ sœ¨sœ¬sœÌsœÜsœøsœüsœtœtœtœtœtœ tœ(tœ,tœLtœXtœ\tœxtœ|tœ„tœˆtœtœ”tœœtœ tœ¨tœ¬tœÌtœØtœÜtœøtœütœuœuœuœuœuœ uœ(uœ,uœHuœLuœXuœ\uœxuœ|uœÌuœØuœÜuœøuœüuœvœvœvœvœvœ vœ(vœ,vœHvœLvœXvœ\vœxvœ|vœ„vœˆvœvœ”vœœvœ vœ¨vœ¬vœÌvœØvœÜvœøvœüvœwœwœwœwœwœ wœ(wœ,wœHwœLwœXwœ\wœxwœ|wœÈwœÌwœØwœÜwœøwœüwœDyœTyœpyœtyœ|yœ€yœˆyœŒyœ”yœ˜yœ yœ¤yœÄyœĞyœÔyœğyœôyœüyœzœzœ zœzœzœ zœ$zœDzœTzœpzœtzœ|zœ€zœˆzœŒzœ”zœ˜zœ zœ¤zœÄzœĞzœÔzœğzœôzœüzœ{œ{œ {œ{œ{œ {œ${œ8|œ<|œH|œL|œ¸|œ¼|œÌ|œ8}œ<}œL}œ¸}œ¼}œÈ}œÌ}œè}œì}œô}œø}œ~œ~œ ~œ~œ8~œ<~œH~œL~œ¸~œ¼~œ8œ<œ¸œ¼œÈœÌœ8€œ<€œH€œL€œ¸€œ¼€œÌ€œ8œ<œHœLœ¸œ¼œÈœÌœ8‚œ<‚œH‚œL‚œ¸‚œ¼‚œÈ‚œÌ‚œè‚œì‚œô‚œø‚œƒœƒœ ƒœƒœ8ƒœ<ƒœHƒœLƒœhƒœlƒœtƒœxƒœ€ƒœ„ƒœŒƒœƒœ¸ƒœ¼ƒœ̃œ8„œ<„œH„œL„œ¸„œ¼„œÈ„œÌ„œ<…œL…œh…œl…œt…œx…œ€…œ„…œŒ…œ…œ¸…œ¼…œ¸†œ¼†œȆœ̆œ@ˆœDˆœPˆœ̈œ؈œP‰œT‰œ`‰œ؉œ܉œ艜`ŠœdŠœpŠœ芜슜øŠœp‹œt‹œ€‹œø‹œü‹œŒœ€Œœ„ŒœŒœœ œœœ”œ œœœ(œ œ¤œ°œ(œ,œ8œ°œ´œÀœ8œ<œHœÀœÄœĞœH‘œL‘œX‘œÔ‘œà‘œä‘œ’œ’œ ’œ’œ’œ’œX’œ\’œh’œà’œä’œğ’œh“œl“œx“œğ“œô“œ”œx”œ|”œˆ”œ•œ•œ•œˆ•œŒ•œ˜•œ–œ–œ –œ$–œ@–œD–œL–œP–œX–œ\–œ˜–œœ–œ¨–œ¬–œÈ–œÌ–œÔ–œØ–œà–œä–œ —œ$—œ0—œ¨—œ¬—œ¸—œ0˜œ4˜œ@˜œ¸˜œ¼˜œȘœ@™œD™œP™œÈ™œÌ™œØ™œPšœTšœ`šœØšœÜšœèšœ`›œd›œp›œ蛜웜ø›œpœœtœœ€œœøœœüœœœ€œ„œœœ œœœ”œ œŸœ(Ÿœ Ÿœ¤Ÿœ°Ÿœ, œ8 œ° œ´ œÀ œ8¡œ<¡œH¡œÀ¡œÄ¡œĞ¡œH¢œL¢œX¢œĞ¢œÔ¢œ࢜X£œ\£œh£œࣜ䣜ğ£œh¤œl¤œx¤œğ¤œô¤œ¥œx¥œ|¥œˆ¥œ¦œ¦œ¦œˆ¦œŒ¦œ˜¦œ§œ§œ §œ˜§œœ§œ¨§œ ¨œ$¨œ0¨œ¨¨œ¬¨œ¸¨œ0©œ4©œ@©œ¸©œ¼©œÈ©œ@ªœDªœPªœȪœ̪œتœP«œT«œ`«œØ«œÜ«œè«œ`¬œd¬œp¬œ謜쬜ø¬œp­œt­œ€­œø­œü­œ®œ€®œ„®œ®œ¯œ ¯œ¯œ¯œ”¯œ ¯œ°œ°œ(°œ °œ¤°œ°°œ(±œ,±œ8±œ°±œ´±œÀ±œ8²œ<²œH²œÀ²œIJœвœH³œL³œX³œгœÔ³œ೜X´œ\´œh´œà´œä´œğ´œhµœlµœxµœ|µœ˜µœœµœ¤µœ¨µœ°µœ´µœğµœôµœ¶œx¶œ|¶œˆ¶œ·œ·œ·œˆ·œŒ·œ˜·œ¸œ¸œ ¸œ˜¸œœ¸œ¨¸œ ¹œ$¹œ0¹œ¨¹œ¬¹œ¸¹œ0ºœ4ºœ@ºœ¸ºœ¼ºœȺœ@»œD»œP»œÈ»œÌ»œØ»œT¼œ`¼œd¼œ€¼œ„¼œŒ¼œ¼œ˜¼œœ¼œؼœܼœ輜`½œd½œp½œ轜콜ø½œp¾œt¾œ€¾œü¾œ¿œ ¿œ(¿œ,¿œ4¿œ8¿œ@¿œD¿œ€¿œ„¿œ¿œÀœ ÀœÀœÀœ”Àœ¤ÀœÀÀœÄÀœÌÀœĞÀœØÀœÜÀœÁœÁœ,ÁœHÁœLÁœTÁœXÁœ`ÁœdÁœ Áœ¤Áœ°Áœ¬Âœ¼ÂœÈÂœÌÂœÔÂœØÂœàÂœäÂœìÂœğÂœøÂœüœÜÜÜÜ4ÃœDÃœPÃœTÃœ\Ãœ`ÃœhÃœlÃœtÃœxÃœ€Ãœ„ÃœŒÃœÃœ˜ÃœœÃœ¼ÃœÌÃœØÃœÜÃœäÃœèÃœğÃœôÃœüÜĜĜ ĜĜĜ Äœ$ÄœDÄœTÄœ`ÄœdÄœlÄœpÄœxÄœ|Äœ„ÄœˆÄœÄœ”ÄœœÄœ Äœ¨Äœ¬ÄœÈÄœÌÄœØÄœPÅœTÅœ`ÅœÜÅœèÅœìÅœøÅœüŜƜƜƜƜƜ Æœ(Æœ,Æœ4Æœ8Æœ@ÆœDÆœdÆœtÆœ€Æœ„ÆœŒÆœÆœ˜ÆœœÆœ¤Æœ¨Æœ°Æœ´Æœ¼ÆœÀÆœÈÆœÌÆœìÆœüƜǜ ǜǜǜ Çœ$Çœ,Çœ0Çœ8Çœ<ÇœDÇœHÇœPÇœTÇœtÇœ„ǜǜ”ÇœœÇœ Çœ¨Çœ¬Çœ´Çœ¸ÇœÀÇœÄÇœÌÇœĞÇœØÇœÜÇœüÇœ ȜȜȜ$Èœ(Èœ0Èœ4Èœ<Èœ@ÈœHÈœLÈœTÈœXÈœ`ÈœdȜʜ$Êœ@ÊœDÊœLÊœPÊœXÊœ\ÊœdÊœhÊœpÊœtÊœ|Êœ€Êœ˜ÊœœÊœ¨Êœ¬ÊœÈÊœÌÊœÔÊœØÊœ Ëœ$Ëœ4ËœPËœTËœ\Ëœ`ËœhËœlËœtËœxËœ€Ëœ„ËœŒËœËœ¨Ëœ¬Ëœ¸Ëœ¼ËœØËœÜËœäËœèËœğËœôËœü˜̜̜ ̜̜̜4Ìœ@ÌœDÌœ`ÌœdÌœlÌœpÌœxÌœ|Ìœ„ÌœˆÌœÌœ”ÌœœÌœ Ìœ¼ÌœÈÌœÌÌœèÌœìÌœôÌœø̜͜͜ ͜͜͜͜$Íœ(ÍœDÍœPÍœTÍœpÍœtÍœ|Íœ€ÍœˆÍœŒÍœ”Íœ˜Íœ Íœ¤Íœ¬Íœ°ÍœÈÍœÌÍœØÍœÜÍœøÍœü͜ΜΜΜΜΜ Îœ(Îœ,Îœ4Îœ8ÎœPÎœTÎœdÎœ€Îœ„ÎœŒÎœÎœ˜ÎœœÎœ¤Îœ¨Îœ°Îœ´Îœ¼ÎœÀÎœØÎœÜÎœèÎœìΜϜ ϜϜϜ Ïœ$Ïœ,Ïœ0Ïœ8Ïœ<ÏœDÏœHÏœdÏœtϜϜ”ÏœœÏœ Ïœ¨Ïœ¬Ïœ´Ïœ¸ÏœÀÏœÄÏœÌÏœĞÏœìÏœøÏœüϜММ$Ğœ(Ğœ0Ğœ4Ğœ<Ğœ@ĞœHĞœLĞœTĞœXĞœtĞœ€Ğœ„Ğœ Ğœ¤Ğœ¬Ğœ°Ğœ¸Ğœ¼ĞœÄĞœÈĞœĞĞœÔĞœÜĞœàĞœüМќ Ñœ(Ñœ,Ñœ4Ñœ8Ñœ@ÑœDÑœLÑœPÑœXÑœ\ÑœdÑœhÑœ„ќќ”Ñœ°Ñœ´Ñœ¼ÑœÀÑœÈÑœÌÑœÔÑœØÑœàÑœäÑœìÑœğÑœ ҜҜҜ8Òœ<ÒœDÒœHÒœ”Òœ¤ÒœÀÒœÄÒœÌÒœĞÒœØÒœÜÒœäÒœèÒœğÒœôÒœüҜӜӜ,ÓœHÓœLÓœTÓœXÓœ`ÓœdÓœlÓœpÓœxÓœ|Óœ„ÓœˆÓœ Óœ¤Óœ°Óœ´ÓœĞÓœÔÓœÜÓœàÓœ(Ôœ,Ôœ8Ôœ<ÔœXÔœ\ÔœdÔœhÔœ´ÔœÀÔœÄÔœàÔœäÔœìÔœğÔœ8Õœ<ÕœHÕœLÕœhÕœlÕœtÕœxÕœÄÕœĞÕœÔÕœğÕœôÕœü՜֜֜ ֜֜֜ Öœ$Öœ,Öœ0ÖœLÖœXÖœ\ÖœxÖœ|Öœ„ÖœˆÖœÖœ”ÖœœÖœ Öœ¨Öœ¬Öœ´Öœ¸ÖœÔÖœàÖœäÖœלל לללל$ל(ל0ל4ל<ל@ל\לhלlלˆ×œŒ×œ”ל˜×œäלğלôל؜؜؜ ØœlØœxØœ|Øœ˜ØœœØœ¤Øœ¨Øœ°Øœ´Øœ¼ØœÀØœÈØœÌØœÔØœØØœğØœô؜ٜٜ Ùœ$Ùœ,Ùœ0ÙœxÙœ|ÙœˆÙœŒÙœ¨Ùœ¬Ùœ´Ùœ¸ÙœÀÙœÄÙœÌÙœĞÙœØÙœÜÙœäÙœèٜڜڜڜ0Úœ4Úœ<Úœ@ÚœHÚœLÚœTÚœXÚœ`ÚœdÚœlÚœpÚœŒÚœœÚœ¸Úœ¼ÚœÄÚœÈÚœĞÚœÔÚœÜÚœàÚœèÚœìÚœôÚœøڜۜ Ûœ$Ûœ@ÛœDÛœLÛœPÛœXÛœ\ÛœdÛœhÛœpÛœtÛœ|Ûœ€Ûœ˜ÛœœÛœ¨Ûœ¬ÛœÈÛœÌÛœÔÛœØÛœàÛœäÛœìÛœğÛœøÛœüۜܜܜ Üœ$Üœ0Üœ4ÜœPÜœTÜœ\Üœ`ÜœhÜœlÜœtÜœxÜœ€Üœ„ÜœŒÜœÜœ¨Üœ¬Üœ¸Üœ¼ÜœØÜœÜÜœäÜœèÜœ0İœ4İœ@İœDİœ`İœdİœlİœpİœxİœ|İœ„İœˆİœİœ”İœœİœ İœ¸İœ¼İœÈİœÌİœèİœìİœôİœøݜޜޜ ޜޜޜޜ$Şœ(ŞœDŞœPŞœTŞœpŞœtŞœ|Şœ€ŞœˆŞœŒŞœ”Şœ˜Şœ Şœ¤Şœ¬Şœ°ŞœÌŞœÜŞœøŞœüޜߜߜPßœTßœ`ßœdßœ€ßœ„ßœŒßœßœ˜ßœœßœ¤ßœ¨ßœ°ßœ´ßœ¼ßœÀßœÜßœìßœàœ àœàœàœ àœ$àœ,àœ0àœ8àœ<àœDàœHàœdàœtàœàœ”àœœàœ àœ¨àœ¬àœ´àœ¸àœÀàœÄàœÌàœĞàœìàœüàœáœáœ$áœ(áœ0áœ4áœ<áœ@áœHáœLáœTáœXáœtᜀᜄᜠᜤᜬᜰ᜸᜼áœÄáœÈáœĞáœÔáœÜáœàáœüᜠâœ(âœ,âœ4âœ8âœ@âœDâœLâœPâœXâœ\âœdâœh✄âœâœ”✰✴✼âœÀâœÈâœÌâœÔâœØâœàâœäâœìâœğ✠ãœãœãœ8ãœ<ãœDãœHãœPãœTãœ\ãœ`ãœhãœlãœtãœx㜔㜠㜤ãœÀãœÄãœÌãœĞãœØãœÜãœäãœèãœğãœôãœüãœäœäœ(äœ,äœHäœLäœTäœXäœ`äœdäœläœpäœxäœ|䜄䜈䜤䜰䜴äœĞäœÔäœÜäœàäœèäœìäœôäœøäœåœåœ åœåœ,åœ8åœ<åœXåœ\åœdåœhåœpåœtåœ|圀圈圌圔團地圴åœÀåœÄåœ<æœHæœLæœhæœlæœtæœx最朄朌æœæœ˜æœœæœ¤æœ¨æœÄæœÔæœğæœôæœüæœçœçœ çœçœçœ çœ$çœ,çœ0çœHçœLçœXçœ\çœxçœ|眄眈çœÔçœàçœäçœèœèœ èœèœèœèœ$èœ(èœ0èœ4èœ<èœ@èœ\èœhèœl蜈蜌蜔蜘蜠蜤蜬蜰蜸蜼èœÄèœÈèœäèœğèœôèœéœéœéœ éœhéœléœxéœ|霘霜霤霨霰霴霼éœÀéœÈéœÌéœÔéœØéœôéœêœ êœ$êœ,êœ0êœ8êœ<êœDêœHêœPêœTêœ\êœ`êœxêœ|꜌ꜨꜬꜴꜸêœÀêœÄêœÌêœĞêœØêœÜêœäêœèêœëœëœëœ0ëœ4ëœ<ëœ@ëœHëœLëœTëœXëœ`ëœdëœlëœp뜈뜌뜜뜸뜼ëœÄëœÈëœĞëœÔëœÜëœàëœèëœìëœôëœøëœìœìœ ìœ$ìœ@ìœDìœLìœPìœXìœ\ìœdìœhìœpìœtìœ|윀윜율윬ìœÈìœÌìœÔìœØìœàìœäìœììœğìœøìœüìœíœíœ íœ$íœ4íœPíœTíœ\íœ`íœhíœlíœtíœx휀휄휌íœíœ¨íœ¬íœ¼íœØíœÜíœäíœèíœğíœôíœüíœîœîœ îœîœîœ0îœ4îœ@îœDîœ`îœdîœlîœpîœxîœ|îœîœ”îœÌîœèîœìîœôîœøîœïœïœ ïœïœïœïœ$ïœ(ïœ@ïœDïœTïœpïœtïœ|ïœÌïœØïœÜïœøïœüïœğœğœğœğœğœ ğœ(ğœ,ğœ4ğœ8ğœTğœ`ğœdğœ€ğœ„ğœŒğœğœ˜ğœœğœ¤ğœ¨ğœ°ğœ´ğœ¼ğœÀğœÜğœìğœñœ ñœñœñœ ñœ$ñœ,ñœ0ñœ8ñœ<ñœDñœHñœ`ñœdñœpñœtñœèñœìñœøñœüñœpòœtòœ€òœ„òœ òœ¤òœ¬òœ°òœ¸òœ¼òœÄòœÈòœĞòœÔòœÜòœàòœøòœüòœóœ óœ(óœ,óœ4óœ8óœ@óœDóœLóœPóœXóœ\óœdóœhóœ€óœ„óœóœ”óœ°óœ´óœ¼óœÀóœÈóœÌóœÔóœØóœàóœäóœìóœğóœôœ ôœôœôœ8ôœ<ôœDôœHôœôœ”ôœ ôœ¤ôœõœõœ,õœHõœLõœTõœXõœ õœ¤õœ°õœ´õœĞõœÔõœÜõœàõœèõœìõœôõœøõœöœöœ öœöœ,öœ8öœ<öœXöœ\öœdöœhöœpöœtöœ|öœ€öœˆöœŒöœ”öœ˜öœ´öœÀöœÄöœàöœäöœìöœğöœøöœüöœ÷œ÷œ÷œ÷œ÷œ ÷œ<÷œL÷œh÷œl÷œt÷œx÷œ€÷œ„÷œŒ÷œ÷œ˜÷œœ÷œ¤÷œ¨÷œÀ÷œÄ÷œĞ÷œÔ÷œğ÷œô÷œü÷œøœøœ øœøœøœ øœ$øœ,øœ0øœHøœLøœXøœ\øœÔøœàøœäøœùœùœ ùœùœùœùœ$ùœ(ùœ0ùœ4ùœ<ùœ@ùœ\ùœhùœlùœˆùœŒùœ”ùœ˜ùœ ùœ¤ùœ¬ùœ°ùœ¸ùœ¼ùœÄùœÈùœäùœğùœôùœúœúœúœ úœ(úœ,úœ4úœ8úœ@úœDúœLúœPúœhúœlúœxúœ|úœ˜úœœúœ¤úœ¨úœ°úœ´úœ¼úœÀúœÈúœÌúœÔúœØúœôúœûœûœ ûœ$ûœ,ûœ0ûœ8ûœ<ûœDûœHûœPûœTûœ\ûœ`ûœ|ûœˆûœŒûœ¨ûœ¬ûœ´ûœ¸ûœÀûœÄûœÌûœĞûœØûœÜûœäûœèûœüœüœüœ0üœ4üœ<üœ@üœHüœLüœTüœXüœ`üœdüœlüœpüœŒüœ˜üœœüœ¸üœ¼üœÄüœÈüœĞüœÔüœÜüœàüœèüœìüœôüœøüœıœıœ ıœ$ıœ@ıœDıœLıœPıœXıœ\ıœdıœhıœpıœtıœ|ıœ€ıœœıœ¨ıœ¬ıœÈıœÌıœÔıœØıœàıœäıœìıœğıœøıœüıœşœşœ$şœ4şœPşœTşœ\şœ`şœhşœlşœtşœxşœ€şœ„şœŒşœşœ¬şœ¸şœ¼şœØşœÜşœäşœèşœğşœôşœüşœÿœÿœ ÿœÿœÿœ0ÿœ4ÿœ@ÿœDÿœ`ÿœdÿœlÿœpÿœxÿœ|ÿœ„ÿœˆÿœÿœ”ÿœœÿœ ÿœ¸ÿœ¼ÿœÌÿœèÿœìÿœôÿœøÿœ HL\x|„ˆ”œ ¨¬Üì  $,08<hlx|˜œ ¤´04DÀÄĞÔğôü PT`d€„Œ˜œ¤¨àäpt€„” ¤ÀÄÌĞØÜäè$04PT\`hltx´ÀÄàäìğøü  @ D P T p t | € ˆ Œ ” ˜ Ğ Ô à ä       $ ( ` d p t  ” œ   ¨ ¬ ´ ¸ ğ ô    $ , 0 8 < D H „  ” ° ´ ¼ À È Ì Ô Ø   $ @ D L P X \ d h   ¤ ° ´ Ğ Ô Ü à è ì ô ø 0 4 D ` d l p x | „ ˆ À Ä Ğ Ô PTd€„Œ˜œ¤¨àäô (,48 $,08<DHPT\`hltxØÜèpt„ ¤¬°¸¼ÄÈĞÔÜàèì 8<DHPT\`hltx€„¤´ĞÔÜàèìôø 8<HLhltx€„Œ˜œ¤¨°´ĞÔàhlx04<@HLTX`dlpx|˜œ¨04@ÌØÜøü (,48@D`dt”œ ¨¬´¸ÀÄÌĞØÜü (,48@DLPX\dhpt” (,8ÀÄĞÔğôü X\hô $,08<ˆŒ˜ $0¸¼ÈPT`èìø€ „  !!,!H!L!T!X!`!d!l!p!x!|!„!ˆ!!”!´!À!Ä!à!ä!ì!ğ!ø!ü!""""" "(","L"X"\"x"|"„"ˆ""”"ä"ğ"ô"### #(#,#4#8#@#D#L#P#X#\#x#|#ˆ#$$ $¬$¸$¼$Ø$Ü$ä$è$ğ$ô$ü$%% %%% %$%D%P%T%p%t%|%€%ˆ%Œ%”%˜% %¤%¬%°%¸%¼%Ø%Ü%ì%& &&& &$&,&0&8&<&D&H&P&T&t&„& &¤&¬&°&¸&¼&Ä&È&Ğ&Ô&Ü&à&è&ì&' ''8'<'D'H'P'T'\'`'h'l't'x'€'„' '¤'°'8(<(H(Ğ(Ô(à(h)l)|)˜)œ)¤)¨)°)´)¼)À)È)Ì)Ô)Ø)à)ä)***0*4*<*@*H*L*T*X*`*d*l*p*x*|*˜*œ*¨*¬*È*Ì*Ô*Ø*à*ä*ì*ğ*ø*ü*++++0+4+@+È+Ì+Ø+`,d,p,ø,ü,--”- -(.,.8.À.Ä.Ğ.Ô.ğ.ô.ü.// /// /$/,/0/8/4>@>Ì>Ø>Ü>ø>ü>????? ?(?,?4?8?@?D?`?d?p?ü? @(@,@4@8@@@D@L@P@X@\@d@h@p@t@@”@¤@À@Ä@Ì@Ğ@Ø@Ü@ä@è@ğ@ô@ü@AA A,A4>@>è>ì>ø> ?¤?°?X@\@h@AA AÈAÌAØA€B„BB8CŸ >Ÿ>Ÿ>Ÿ >Ÿ$>Ÿ,>Ÿ0>Ÿ8>Ÿ<>ŸD>ŸH>ŸP>ŸT>Ÿ\>Ÿ`>Ÿh>Ÿl>Ÿt>Ÿx>Ÿ€>Ÿ„>ŸŒ>Ÿ>Ÿ˜>Ÿœ>Ÿ¤>Ÿ¨>Ÿ°>Ÿ´>Ÿ¼>ŸÀ>ŸÈ>ŸÌ>Ÿì>Ÿø>Ÿü>Ÿ?Ÿ?Ÿ$?Ÿ(?Ÿ0?Ÿ4?Ÿ¢>¢>¢ >¢>¢>¢ >¢$>¢0>¢4>¢8>¢<>¢H>¢L>¢P>¢T>¢`>¢d>¢h>¢l>¢x>¢|>¢€>¢„>¢>¢”>¢˜>¢œ>¢¨>¢¬>¢°>¢´>¢À>¢Ä>¢È>¢Ì>¢Ø>¢Ü>¢à>¢ä>¢ğ>¢ô>¢ø>¢ü>¢?¢ ?¢?¢?¢ ?¢$?¢(?¢,?¢8?¢._: |0|125i)\f\n\r\t000sµnsusms__--gteq[]to%v""tv%sts80TE//./)(rRuUeEaAlLsS01bBoOxX+-nNiIfFpP [])iv{}": ,W/..h2%wteTe%T ">OKca*.EC%x%ph3 =#OUCNST0b0x0X0o ( ("")) ) @s Pn=][} ] > +LlLtLuMnCcCfCoCsLmLoMcMeNdNlNoPcPdPePfPiPoPsScSkSmSoZlZpZsYi}}NSMX%X+1%f%d%%%qjsorgeleltne] ${ " \\\"ToA4V1V6V2V3V5A3 zDS="" m INCSCHHSDHKXLPMBMDMFMGMRPXRPRTTA{{/**/if\dÍ$1=: `#; # ;\;\#:= :, !! `<>&^+=-=*=/=%=&=|=^=&&||++==!=<=>=go udpsniuritcp443ymltlsaclurlmsgRSADSAURIdns::1setcgoftpsshPWD125625nanNaNSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUTC m=µsμs") } top -zsh%s hclenvinikey///%25nil01_%+v'"'GETGet../agevia200404://1000 ,h1newACKTXTarm853MD4MD5SETEOFintmapptr...�finobjgc %: gp *(in n= - P MPC=], < end > and]: ???pc= GHanLaoMroNkoVai): TTLSOAPTRSRVOPT"}}dup lennot" Via?*[.jsIf-204206304400500â€â€Œ:0x%0X qr aa tc rd ra ad cdKEYDLVCDS\# ANYechPGPOIDAPLAVCCAAEIDGIDHIPL32L64LOCNIDNXTSIGSPFUIDX25netfor""" = inf-0b-0o %#xackanyPUT103503*/*302403421425get: ` ADDSUBKey'''Endneg#%djeqjgtjlejgejlttxataxINT<<=>>=&^=varoptreqrepobfsaddrtimeinfoyaml:443acmePOSThostquicarchwarnjson) = mdnsdial readfile on bindunixicmpigmpftpshttppop3smtpwaitseekHOMEstatsyncopenlink3125trueAtoi-Inf+InfJuneJuly as hour in %s%s %v helpbool", "bashfish:%d trimrpadtomlproppathmap[eEpPINFOWARNnull'\''IdleOpenHEADEtag0x%xdateetagfromvaryHostDateconngzip%x Gone<>idle1080DATAPINGp256.keyhashsans127.ocsp.crtLinktypeConnusertcp4tcp6udp4udp6asn1tag:int8uintchanfunccallkindArgsCall != allgallprootitabsbrkdead is LEAFbase of <==GOGC] = s + ,r2= pc=none: p=cas1cas2cas3cas4cas5cas6 at m= sp= sp: lr: fp=) m=AhomChamKawiLisuMiaoModiNewaThaiToto...:quitbitsNameTypeAAAAMX: PrefMBoxtextPortCodeData--%sintshtml* %sOsFsFullautoname --From.png.css.gif.htm.jpg.mjs.pdf.svg.xmlxn---tlsTYPESHA1NONEalpnportPKIXSPKIIPIXIPGPATMAAXFRCERTGPOSISDNIXFRNSECNULLNoneRKEYSVCBTKEYTLSATSIGPWD=PATH<%s> withelselistspancaseNodeFile %s .exe-inf...`.inf.nanTrueTRUENull.NaN.NAN.Inf.INFenumlazyweakechopostflagcap -> fail*%#vBOOLBooldrop[]%sXXX_LMQHor xjneqIMAGCHARgotoPathKindEnumdef=0000errorcountemaildebuglevelECDSAhostsCNAMEwriteroute : closefileshttpsimap2imap3imapspop3schdirmkdirchmodchowngetwdpipe2lstat1562578125falseMarchAprilmonth [P] [L]%s %sSliceArraypropsaliaspathsvalueparsexxxxx/auth(nil)ErrorsvqxX"NaN"panicfatalDEBUGERRORPANICFATALtls: Earlyarray:***@bytesRangerange:path%s %q%s=%sHTTP/:httpsocksFound&"'.jsonuserschain%s_%srenewlocks.locksharenamescachestack%v %vHS256RS256ES256ES384ES512titleclearSHA-1P-256P-384P-521P-224int16int32int64uint8slicefunc( and kind=defersweepschedhchansudoggscanmheaptracesleepgcing MB, got= ... max=scav ptr ] = (trap:init ms, fault tab= top=[...], fp:GreekAdlamBamumBatakBuhidDograKhmerLatinLimbuNushuOghamOriyaOsageRunicTakriTamil (at no IPdenyTTL: ClassRetryTypeAfcntlfloatuintsbools[=%s]test.ValueipNetbreak.eEpPindexprintTRACE%s:%d -%sPlainRegexlocalmuxervfpv4idivautf-8%s*%dtext/.avif.html.jpeg.wasm.webpRealmbad norderauthzCLASSdns: udp: %d %d (%s)QUERYED448OtherISPKIAFSDBCSYNCDHCIDDNAMEEUI48EUI64HINFOHTTPSMAILAMAILBMINFONAPTRNINFONSEC3RRSIGSSHFPUINFOInts:Ptrs:inputblockstylelabelstart%s.%s.test%s%s --- .%09dline !!str!!seq!!map%YAML-.infFalseFALSE+.inf+.Inf+.INF-.Inf-.INF!!intgroupfieldctype0-RTT1-RTTmatchrune IDENTFLOATCOMMA%d:%dFlushTableFloattablegob: not EntryStartadd xsub xmul xdiv xmod xand xxor xlsh xrsh xja %dret aCOLONconstNamesOneofEnumsIsMapInput\%03oname=enum=json=weak=oneofclientservertls.calistenremotereqURLconfigstderrmethodurgentlogger, not netdns.localreturn.onionndots:sendtoip+netsocketacceptdomaingophertelnetreadatTMPDIRrenameremovewaitid390625SundayMondayFridayAugustminutesecond fi%%-%dsError: [LP]tfvarsdotenv$HOME/callerBasic udphopStringFormat[]byte' for stringCauses"+Inf""-Inf"\ufffddpanicDPANIC, val 0x%04XX25519%w%.0wtls13 objectnumberClosedCookie
bytes=allowcookieexpectoriginclosedschemeExpectstreamstatusPragma.
:httpssocks Lockedactivesocks5CANCELGOAWAYPADDED

%s.
dns-01_truncrenew_obtainissuerforcedreason_plus_detaildirectreject-----
STREETuint16uint32uint64structchan<-<-chan Valuesysmontimersefenceselectscalar next= jobs= goid sweep  B -> % util alloc free  span= prev= list=, i =  code= addr= m->p= p->m=SCHED  curg=], sp= ctxt: min=  max= (...)
 base CommonArabicBrahmiCarianChakmaCopticGothicHangulHatranHebrewKaithiKhojkiLepchaLycianLydianRejangSyriacTai_LeTangsaTangutTeluguThaanaWanchoYezidihangupkilled/proc/errno Type: LengthMBox: SerialExpireMinTTLPort: WeightTargetheaderAnswerTypeNSTypeMXspliceipMaskprintf'"&<>\u%04X3:04PMsquash%v=%v

    	geoip:height--%s
AcceptServer%s: %wnil rr, id: DNSKEY\\\044\\\0920.%02d%.2fm %.0fm %0.16x%0.16XSHA256GOST94SHA384SHA512IQUERYSTATUSNOTIFYUPDATERSAMD5NOTIMPBADSIGBADKEYBADALGACPKIXNIMLOCSMIMEATALINKUNSPECZONEMDexec: cmd/godefinescriptexport%s[%d]layout%s=%s
\u%04xtoml: yaml: !!bool!!nullproto2proto3Proto2Proto3sint32sint64doublesyntaxpackedjstypeClientECT(1)ECT(0)DELETEempty rune1 NUMBERSTRINGLBRACKLBRACEPERIODRBRACKRBRACEASSIGNtoken(%s: %s[%d]%s%v: %v.protold #%dor #%dimportswitchIsWeakSyntaxMapKeyFieldsGoTypeOneofsNumberIsListValuesOutputvarintUnknownversionreqAddrconsolezerosslacme.cadefaulttcp-tlscommandchannelEd25519MD2-RSAMD5-RSAserial:androidrunningwindowsopenbsdsolarissuccessunavailoptionsrecvmsgsendmsgconnectlookup  (trap writeatchtimessymlinkfstatat19531259765625TuesdayJanuaryOctober-070000Z070000, time.[flags]ignoredinvalidCONNECTUpgrade(PANIC=booleanbdoUxXvintegercomplexfloat32float64capitalISO8601RFC3339iso8601rfc3339Verbose%sErrornil keyderivedInitialnumber RefererCookie2expiresmax-age; Path=
flags= len=%d:method:scheme:status (conn) %v=%v,refererrefreshtrailerGODEBUGTrailerchunkedupgradehttp://OPTIONSnosniffCreatedIM UsedHTTP/1.HEADERSprivatemailto:http-01accountattemptelapsedmanagedrenewalissuersED25519storagersa2048rsa4096ed25519rsa8192expiredrevokedpendingheaders, url: Alt-SvcSHA-224SHA-256SHA-384SHA-5122.5.4.62.5.4.32.5.4.52.5.4.72.5.4.82.5.4.9numeric:eventsuintptrSwapperChanDirbucket( using , type=closure Value>ConvertforcegccpuprofunknowngctraceIO waitsyscallwaitingUNKNOWN, goid= s=nil (scan MB in pacer: % CPU ( zombie, j0 = head = ,errno=panic: nmsys= locks= dying= allocsSignal signal m->g0= pad1= pad2= text= minpc= value= (scan) types : type AvestanBengaliBrailleCypriotDeseretElbasanElymaicGranthaHanunooKannadaMakasarMandaicMarchenMultaniMyanmarOsmanyaSharadaShavianSiddhamSinhalaSogdianSoyomboTagalogTibetanTirhuta::ffff:no portabortedstoppedanswersClass: recordRetry: RefreshTypeSOATypePTRTypeTXTTypeSRVTypeOPTTypeWKSTypeALLaccept4strings[="%s"]ipSliceprintlnLOG: nsuµmhUsage: suffix:closingbalance%s %s%sExpiresSubject%03d %sutf-8''charsetproblem[%s] %wbad keycreatedmoduluspublishbad offQUERY: NOTIMPL$ORIGINCDNSKEY%16.16x%12.12xRSASHA1BlockedNOERRORFORMERRREFUSEDYXRRSETNXRRSETNOTAUTHNOTZONEBADTIMEBADMODEBADNAMEdohpathIACPKIXRefusedos/execruntimeFloats:#intern{{end}} actionoperandDEFAULTBOM: %vcomment := :=fnrt%s%s%s !!merge!!float (with map keyfixed32fixed64messagepackageservice(empty)Not-ECT%s (%s) %s %#vquic ivquic hpquic kualt-svcpurposeInstAltInstNopalt -> nop -> any -> ILLEGALCOMMENTHEREDOCillegalInvalidCommentInteger%s %s; proto: ldx #%dld [%d]ld #lenld #nlald #cpuadd #%dsub #%dmul #%ddiv #%dmod #%dand #%dxor #%dlsh #%drsh #%dret #%d%s: %s PackageMessageImportsDefaultMethodsbad loghysteriainsecureHysteriaacl.filepassworduserpassfilenameplatformSHA1-RSADSA-SHA1x509sha1DNS name[::1]:53loopbacknotfoundtryagaincontinue_gatewayunixgramtimeout:trust-adshutdownrecvfromfile+netinvalid address raw-readsendfilereadfromsignal: truncatereadlinkunlinkatopenfdat48828125infinitystrconv.parsing ParseIntThursdaySaturdayFebruaryNovemberDecembertime.UTC%!Month(_filedir_%s() { [flags]%s %v=%vintSlicepositionTrailersGoString01234567beEfFgGvPANIC=%vCurveID(DOWNGRDDOWNGRDhttp/1.1finishedexporterfont/ttffont/otfLocationhttponlysamesite; SecureHTTP/1.0If-MatchIf-Range data=%q incr=%v ping=%qif-matchlocationbad_flowprioritybad_pathHTTP/2.0Trailer:trailers%s_%s_%sboundaryHTTP/1.1no-cachePROPFINDidentityhttp/1.0ContinueAcceptedConflicthijackedNO_ERRORPRIORITYSETTINGShttps://subjectsfc00::/7lock_keycert_key[^\w@.-]instancerejected%s|%s|%s/trafficMD5+SHA1SHA3-224SHA3-256SHA3-384SHA3-5122.5.4.102.5.4.112.5.4.17optionalexplicitdefault:FuncTypestruct {scavengepollDescrwmutexWrwmutexRtraceBufdeadlockraceFinipanicnilcgocheckrunnable is not pointerBAD RANK status unknown(trigger= npages= nalloc= nfreed=) errno=runtime.[signal reflect. newval= mcount= bytes, , errno=trap error oldmask r0 r1 r2 r3 r4 r5 r6 r7 r8 r9 r10 fp ip sp lr pc cpsr fault ----- stack=[ minLC= maxpc= stack=[ minutes etypes ArmenianBalineseBopomofoBugineseCherokeeCyrillicDuployanEthiopicGeorgianGujaratiGurmukhiHiraganaJavaneseKatakanaKayah_LiLinear_ALinear_BMahajaniOl_ChikiPhags_PaTagbanwaTai_ThamTai_VietTifinaghUgariticVithkuqi[::ffff:no anode/uid_map/gid_mapLength: Serial: Expire: MinTTL: Weight: Target: PriorityClassANYQuestionTypeAAAATypeAXFRbytesHexdurationurlqueryCRITICALgeosite:elementsROOT ** GET_0RTT (local)HTTP/3.0distinct --%s %s: %s Receivedus-asciiif-rangeNO_PROXYno_proxybad timeactivatePrime1: Prime2: flags:; ; EDE: ; ESU: %s: (%s)ANSWER: $INCLUDEECC-GOSTINDIRECTCensoredFilteredSERVFAILNXDOMAINYXDOMAINBADTRUNCipv4hintipv6hintAMTRELAYIPSECKEYReservedNSAP-PTRbad instnet/httpgo/build%.10q...{{else}}%s:%d:%dtemplatetextarearequired\\([^$])2006-1-2!!binaryrepeatedOptionalRequiredRepeatedsfixed32sfixed64BoolKindEnumKindKind(%d)extendee15:04:05draft-29gQUIC %d[%d, %d]quic keyredirectphoturisno-storetext/cssbytes=0-prefetchMessagesInstFailInstRune[:word:]%s %s %sKeyValueDateTimeproto: %d to %d_UNKNOWNprotobufXXX_weakNum(%#q)dst mathquic-go1recvmmsgsendmmsgld M[%d]ldb [%d]ldh [%d]ld #typeld #poffld #nlanld #markld #randst M[%d]%s %s,%dIsPublicFullNameMapValueExtendeeServicesJSONNameIsPackedzigzag32zigzag6400000000Ping modeobfs.typepinSHA256hysteria2ParseBoolping modeconnectedlog-levellog levelauth.typeTCP errorsessionIDUDP errord.nx != 0Proc-Typebroadcastmulticast_outboundlocalhostip6.arpa.attempts:no-reloadraw-writefiles,dnsdns,filesipv6-icmpfork/execcontinuedRemoveAll244140625ParseUintWednesdaySeptember-07:00:00Z07:00:00two_word_help for %s %q: %sempty urlgeoip.dat method: (MISSING)%!(EXTRA 01234567_undefinedLevel(%d)LEVEL(%d)%s %x %x Handshake of type omitemptyimage/bmpimage/gifimage/pngvideo/avifont/woff; Domain=[%v = %d]data_flowauthoritywebsocketnet/http.HTTP/1.1 HTTP/1.0 curg=(unknown)traceback} stack=[ lockedm=InheritedBassa_VahBhaiksukiCuneiformKhudawadiMalayalamMongolianNabataeanPalmyreneSamaritanSundanesemissing ] parsing ): no '/'interruptbus errorquestions, Body: &Refresh: ClassINETAuthorityTypeCNAMETypeHINFOTypeMINFOboolSlice-%s, --%suintSliceBad Replyh3 client:protocolform-datanil tracefirst_urlauthz_urlmalformedtry laterbad rcodebad rdatabad rrsetalgorithmexponent1exponent2Modulus: ; NSID: ;; flags:$GENERATERSASHA256RSASHA512Not ReadyBADCOOKIEmandatoryunhandled#execwait/dev/nullmath/rand{{break}} %d: %qmultilineInt32KindInt64KindFloatKindBytesKindGroupKindenum_typeextensiontype_namejson_namemap_entryname_partno framesquicv2 ivquicv2 hpclient inserver intimestampmax-age=0expect-ctforwardedInstMatchInstRune1[:alnum:][:alpha:][:ascii:][:blank:][:cntrl:][:digit:][:graph:][:lower:][:print:][:punct:][:space:][:upper:][:^word:]At %s: %sParseType%5d:%3d: LocalDateLocalTimemap[%s]%snot foundsizeCacheldx M[%d]ld #protold #ifidxld #queuestx M[%d]jlt %s,%djle %s,%dProtoType-infinitysalamanderudpEnabledHTTP errorconnectinglog-formatlog formatunknown CAUser-Agentacl.inlineTCP closedUDP closedSHA256-RSASHA384-RSASHA512-RSADSA-SHA256ECDSA-SHA1IP address/etc/hostsmyhostname.localhostunixpacketnameservergetsockoptnetlinkribsetsockopt netGo = readdirent (deleted)invalid FDcreatetemp/dev/stdin12207031256103515625ParseFloattime.Date(time.Local%!Weekday(short read__completecobra.testpowershellcompletion[Debug] %s[Error] %spropertiesprocessingfound filestacktracekeep-aliveConnectionKeep-Alivetimeout=60ServerAddr(BADINDEX)%!(NOVERB)0123456789res binderres masterresumptionexp master for type local-addrimage/webpimage/jpegaudio/aiffaudio/mpegaudio/midiaudio/wavevideo/webmfont/woff2Set-Cookie; Expires=; Max-Age=; HttpOnlybytes */%d stream=%d:authorityset-cookieuser-agentconnectionHost: %s socks bindProcessingNo Content%s|%s%s|%sRST_STREAMEND_STREAMpreferencejob failedwill retryexpirationissuer_keycache_sizeacme-tls/110.0.0.0/8identifierissue_certrw_test_%drevoked_attext/plain,"url":%q}subproblemRIPEMD-160POSTALCODEimpossiblecomplex128t.Kind == notifyListprofInsertstackLargemSpanInUseGOMAXPROCSstop traceinvalidptrschedtracesemacquiredebug call flushGen MB goal, s.state = s.base()= heapGoal=GOMEMLIMIT KiB now, pages at sweepgen= sweepgen , bound = , limit = tracefree(tracegc() returned ,errno=0} Bad varintGC forced runqueue= stopwait= runqsize= gfreecnt= throwing= spinning=atomicand8float64nanfloat32nan/dev/null ptrSize= targetpc= until pc=unknown pcruntime: ggoroutine ChorasmianDevanagariGlagoliticKharoshthiManichaeanOld_ItalicOld_PermicOld_TurkicOld_UyghurPhoenicianSaurashtraParseAddr(invalid IPowner diedterminated/setgroupsunpacking skipping: ClassCSNETClassCHAOSAdditional --%sint32Sliceint64Slicevalue for arg %d: %w2006-01-02RootDomainmultipart- --%s-- Content-IdMessage-Idimage/avifHTTP_PROXYhttp_proxyFeatureID(dns: privatekey, status: at line: hmac-sha1.PRIVATEDNSPRIVATEOIDProhibitedNSEC3PARAMOPENPGPKEYexecerrdotName errorhttp2debugcrypto/tlsdefinitionunusedKeysObjectListObjectType%s%s = %s stream endSyntax(%d)Sint32KindUint32KindSint64KindUint64KindDoubleKindStringKinddependencyoneof_declgo_packagedeprecatedinput_typequicv2 keyecho replyearly-datasameoriginrune [:^alnum:][:^alpha:][:^ascii:][:^blank:][:^cntrl:][:^digit:][:^graph:][:^lower:][:^print:][:^punct:][:^space:][:^upper:][:xdigit:]ArrayTable_reserved1%v See %v UnknownX%XUNKNOWN_%dweakFieldsAlpha(%#q)ld #hatypeld #rxhashjneq %s,%djset %s,%dEnumRangesExtensionsIsMapEntryHasDefaultClient modeServer modeclient mode  HTTP closedconfig fileletsencryptserver modeTCP requestUDP requestCERTIFICATEnil contextsetnonblocki/o timeoutraw-controlunreachable/dev/stdout/dev/stderr30517578125_filedir -dstringArraystringSlicegeosite.datmust be set%!(BADPREC)bad verb '%0123456789_[%dm%sRFC3339Nanorfc3339nano.WithCanceltls: alert(local errorc e traffictraffic updApplicationPRIVATE KEYMarshalJSONMarshalTexthttp-serverhttp2serverhttp2clientCookie.Path; Max-Age=0/index.html ErrCode=%v, settings:retry-afterstream_idleack_mysterybad_connectTTL expiredEarly HintsBad RequestBad GatewayENABLE_PUSHEND_HEADERSacme_clienttls-alpn-01identifiersretrying_incert_failedstorage_keyserver_namedistributednum_choicesocsp_statusthis_updatenext_updateremote_portmaintenancecertificatedeactivatedHTTP %d: %sstatus_codeRetry-After,"nonce":%qsubproblemsSHA-512/224SHA-512/256BLAKE2s-256BLAKE2b-256BLAKE2b-384BLAKE2b-512generalizedapplicationshort writebad argSizemethodargs(reflect.SetassistQueuenetpollInitreflectOffsglobalAllocmSpanManualstart traceclobberfreegccheckmarkscheddetailcgocall nil s.nelems= of size ) returned runtime: p ms clock, nBSSRoots=runtime: P exp.) for minTrigger=GOMEMLIMIT=bad m value, elemsize= freeindex= span.list=not reached, npages = tracealloc(, a123456=[ p->status= in status idleprocs= gcwaiting= schedtick= timerslen= mallocing=bad timedivfloat64nan1float64nan2float64nan3float32nan2GOTRACEBACK) at entry+ (targetpc= , plugin: runtime: g : frame.sp=created by Dives_AkuruMedefaidrinNag_MundariNandinagariNew_Tai_LueOld_PersianOld_SogdianPau_Cin_HauSignWritingWarang_Citibad addressfile existsbroken pipebad messagealarm clockstack faultdnsmessage.authoritiesadditionalsClassHESIODbytesBase64 -%s, --%s%d.%d.%d.%dstringToIntcall of nil02 Jan 2006parse errorfinal tokenleft child:H3_NO_ERRORH3_ID_ERRORIn-Reply-ToReturn-PathHTTPS_PROXYhttps_proxymissing CSRid mismatchcoefficientExponent1: Exponent2: flags: do; ; SUBNET: ; COOKIE: ; EXPIRE: ;; opcode: AUTHORITY: bytes ... gocachehashgocachetestarchive/tarcrypto/x509archive/zipexpected :=empty field{{template array tablemapping endyYnNtTfFoO~!!timestampFixed32KindFixed64KindMessageKindnested_typeoneof_indexallow_aliasoutput_typeInstCaptureInstRuneAny[:^xdigit:]InlineTableEnumOptionsFileOptionsString(%#q)ld [x + %d]%s %s,%d,%dfallthroughFieldRangesFileImportsCardinalityHasJSONNameHasPresenceIsExtensionTESTING KEYping addresscheck-updateShow versionbandwidth.upTCP redirectHTTP requestacme.domainsContent-Typeauth.command%s %s %s %sECDSA-SHA256ECDSA-SHA384ECDSA-SHA512SSL_CERT_DIRmultipathtcp127.0.0.1:53pointtopointno such hostunknown portCIDR addressinvalid portexit status readdirnames152587890625762939453125_ACTIVE_HELPthis commandversion for Subcommand 'reading file%!(BADWIDTH)capitalColorcontext.TODOremote errorc hs traffics hs trafficc ap traffics ap traffic PRIVATE KEYclose notifyimage/x-iconCookie.Valuecontent-typemax-forwardshttp2debug=1http2debug=2out of rangepush_promisedata_on_idleheaders_evendup_trailers100-continuerecv_goaway_status code Multi-StatusNot ModifiedUnauthorizedI'm a teapotNot ExtendedproxyconnectPUSH_PROMISECONTINUATIONregistrationmax_durationFileStorage:client_hellocert_managercertificates.compromisedstorage_pathReplay-Noncehttp requestunauthorizedLittleEndianSERIALNUMBERinvalid baseshort buffer has no name has no typereflect.CopysweepWaiterstraceStringsspanSetSpinemspanSpecialgcBitsArenasmheapSpecialgcpacertracemadvdontneedharddecommitdumping heapchan receivecan't happen span.limit= span.state=bad flushGen MB stacks, worker mode nDataRoots= nSpanRoots= wbuf1= wbuf2= gcscandone runtime: gp= found at *( s.elemsize= B (∆goal , cons/mark maxTrigger= pages/byte s.sweepgen= allocCount end tracegc timer_deletens} value: {}, want {r1= [recovered]bad recoverybad g statusentersyscallwirep: p->m=) p->status=releasep: m= sysmonwait= preemptoff=cas64 failedGOTRACEBACK= m->gsignal=-byte limit runtime: sp=abi mismatchCypro_MinoanMeetei_MayekPahawh_HmongSora_SompengSyloti_Nagriillegal seekinvalid slothost is downchild exitedI/O possibleRCodeSuccessRCodeRefusednot pollableinvalid pathfloat32Slicefloat64Sliceinvalid kindmapstructuredial error: Hysteria-UDPempty packetGSO disabledright child:http3-serverrandautoseed/dev/urandomMime-VersionX-ImforwardsX-Powered-ByMax-Forwards (sensitive)max_attemptsauthz_statusbad key sizePrivateKey: ; PADDING: bad rdlength MsgHdrADDITIONAL: bad SVCB keyhmac-sha224.hmac-sha256.hmac-sha384.hmac-sha512.Stale AnswerDNSSEC BogusNSEC MissingCached ErrorInvalid DataFormat error{{continue}}block clausecaller errorstream startdocument endsequence endtail commentnot a number' in struct Sfixed32KindSfixed64Kindmessage_typejava_packageoptimize_forswift_prefixruby_packagedouble_valuestring_valueis_extensionToken: %#x, Doing 0-RTT.InstAltMatchunexpected )altmatch -> anynotnl -> ParseLiteralunknown type = struct { FieldOptionsOneofOptionsprotobuf_keyprotobuf_valldb [x + %d]ldh [x + %d]ld #vlan_tciillegal charFieldNumbersShow version.obfs-passwordSOCKS5 serverempty domainsresolver.typeauth.passwordauth.userpassauth.http.urlSHA256-RSAPSSSHA384-RSAPSSSHA512-RSAPSStrailing dataSSL_CERT_FILEemail addresslame referral/etc/servicesstop signal: 3814697265625invalid base unimplementedparsing time out of range in duration _activeHelp_ __start_%s() missing Level in host namenot supportedtlsmaxrsasizePKCS1WithSHA1ECDSAWithSHA1key expansionmaster secretCLIENT_RANDOMaccess denieduser canceledAuthorizationContent-RangeAccept-RangesIf-None-MatchLast-Modified403 Forbiddeninvalid range[FrameHeader accept-rangesauthorizationcache-controlcontent-rangeif-none-matchlast-modifiedunknown timersend_too_muchCache-ControlFQDN too longsocks connectReset ContentLoop DetectedSTREAM_CLOSEDCONNECT_ERRORWINDOW_UPDATE%v %w (ca=%s)removing_hashstapling OCSP172.16.0.0/12lock acquiredcert_obtainedXDG_DATA_HOMEcipher_suitesAuthenticatorresolve errorinvalid ASN.1empty integerunsupported: dalTLDpSugct? relative to profMemActiveprofMemFuturetraceStackTabGC sweep waitSIGQUIT: quitSIGKILL: killout of memory is nil, not value method bad map state span.base()=bad flushGen , not pointer != sweepgen MB globals, work.nproc= work.nwait= nStackRoots= flushedWork double unlock s.spanclass= MB) workers=min too large-byte block (runtime: val=runtime: seq= failed with timer_settimefatal error: idlethreads= syscalltick=load64 failedxadd64 failedxchg64 failedmp.g0 stack [nil stackbase} sched={pc:, gp->status= pluginpath= : unknown pc called from Gunjala_GondiMasaram_GondiMende_KikakuiOld_Hungarianinvalid port level 3 resetexchange fulltimer expiredsrmount errorpower failurename too longData: []byte{durationSlice (default %q) (default %s)Usage of %s: stringToInt64encoding/json (default %v)Hysteria-Authtree is empty right child:no children |image/svg+xmlgzip, deflatecpu features:bad algorithmbad signaturein-addr.arpa.Coefficient: MBZ: 0x%04x, unknown classForged AnswerNot SupportedNetwork Errorgocacheverifyinstallgoroothtml/templateunexpected %sdefine clauseempty commanddecodedFields%\(([^)]+)\)scannot set %spremature EOFmissing tablemissing fieldmapping startinput error: write error: reserved_namedefault_valuephp_namespaceINVALID_TOKENpto (Initial)remove failedtime exceeded1; mode=blockinvalid UTF-8ParseListTypeLocalDateTimegetTypeInfo: MethodOptionsXXX_sizecacheunknownFields for message short messageshort addressld #vlan_tpidjset %s,%d,%dIsPlaceholderReservedNamestransport.typebandwidth.downTCP forwardingUDP forwardingfailed to run /etc/hysteria/outbounds.nameoutbounds.type/etc/ssl/certsboringcrypto: internal error.in-addr.arpa.single-request/proc/net/igmp/etc/protocolsunknown mode: (core dumped)/proc/self/exeinvalid syntax1907348632812595367431640625time.Location(: extra text: help [command]trimRightSpacestringToStringBasic realm=%qinvalid format.WithDeadline(bad record MACContent-Length; SameSite=Laxbytes %d-%d/%dERR_UNKNOWN_%daccept-charsetcontent-lengthfirst_settingsping_on_streamtrailers_bogusread_frame_eofinvalid methodunknown error unknown code: Not AcceptableMAX_FRAME_SIZEPROTOCOL_ERRORINTERNAL_ERRORREFUSED_STREAM %s at: %s inserting_hashcache_capacitynew_expiration192.168.0.0/16acquiring lockcert_obtainingreleasing lock[%s] Renew: %wstatus unknownacmez (%s; %s)UDPIdleTimeoutzero parameterdata truncatedunexpected EOFunsafe.Pointer on zero Valuereflect.Value.unknown methoduserArenaStateread mem statsallocfreetracegcstoptheworldGC assist waitfinalizer waitsync.Cond.WaitSIGABRT: aborts.allocCount= key size wrongruntime: mmap(nil elem type! to finalizer GC worker initruntime: full=runtime: want=MB; allocated bad restart PC-thread limit stopm spinning nmidlelocked= needspinning=store64 failedmemprofileratesemaRoot queuebad allocCountbad span statestack overflow untyped args out of range no module data in goroutine prefix length not an ip:portinvalid Prefixno such deviceis a directorytext file busyfile too largetoo many linkslevel 3 haltedlevel 2 haltedprotocol errortoo many userswindow changedResourceHeaderRCodeNameErrorunreachable: len of type %sHysteria-CC-RX0-RTT rejectedH3_FRAME_ERRORH3 error (%#x)quic-go HTTP/3Accept-CharsetDkim-Signatureneed more dataREQUEST_METHODchallenge_typeACME challengeEC PRIVATE KEYpublicexponent ; KEEPALIVE: ; LOCAL OPT: , timeout %dms20060102150405DSA-NSEC3-SHA1DNSKEY MissingRRSIGs Missing\.+*?()|[]{}^$ ... omitting Server failuremime/multipartunknown node: missing quotesObjectItem: %s%04d-%02d-%02d%02d:%02d:%02ddocument startsequence startreserved_rangeNO_VIABLE_PATHpacing limitedmax-age=604800InstEmptyWidthexpected 'inf'expected 'nan'protobuf errorMessageOptionsServiceOptionsinvalid kind: protobuf_oneofXXX_OneofFuncsXXX_extensionsinvalid optionld #vlan_availhttptest.serveillegal char: ReservedRanges$HOME/.hysteriaempty auth typeempty proxy urlmasquerade.typefailed to servemissing addressunknown networkinvalid address/etc/mdns.allow/proc/net/igmp6negative offset/data/local/tmpcopy_file_range476837158203125: cannot parse ,M3.2.0,M11.1.0flags+=("-%s") no-descriptionskey is an aliasUDP not enabledPKCS1WithSHA256PKCS1WithSHA384PKCS1WithSHA512ClientAuthType(client finishedserver finishedunknown versionrecord overflowbad certificateHalfClosedLocalapplication/pdfapplication/oggfont/collectionapplication/zip; SameSite=Nonenegative updateaccept-encodingaccept-languagex-forwarded-fortrailers_pseudobad_path_methodAccept-Encodingrecv_rststream_multipart/mixedIdempotency-Key400 Bad RequestPartial ContentRequest TimeoutLength RequiredNot ImplementedGateway Timeoutunexpected typebad trailer keywrite error: %wX-Forwarded-For[%s] Obtain: %wcert_cache_fillempty authz urlHTTP %d %s - %sidentifier_typehttps://%s:%d%sresolve error: is unavailableinvalid integerinvalid boolean0601021504Z0700non-minimal tagunknown Go typeBelowExactAboveinvalid argSizewrite heap dumpasyncpreemptoffforce gc (idle)sync.Mutex.Lockmalloc deadlockruntime error: elem size wrong with GC prog scan missed a gmisaligned maskruntime: min = runtime: inUse=runtime: max = recovery failedstopm holding pstartm: m has ppreempt SPWRITEmissing mcache?ms: gomaxprocs=] morebuf={pc:: no frame (sp=runtime: frame runtimer: bad ptraceback stuckruntime.gopanicHanifi_RohingyaPsalter_Pahlavireflectlite.Setno such processnot a directoryadvertise errornetwork is downno medium foundkey has expiredbad system callinvalid pointer not a functionJan _2 15:04:05invalid paddingInvalid Versionsocket open: %ssocket bind: %snet-tcp-dial-%snet-udp-dial-%sconnect error: nothing to packIgnoring Retry.ECN unsupported#multipartfilesAccept-Language/etc/mime.types()<>@,;:\"/[]?=bad private keyprivateexponentunknown RR typeECDSAP256SHA256ECDSAP384SHA384no-default-alpnNot implementedjstmpllitinterptarinsecurepathzipinsecurepathunclosed actionno dot in fieldtemplate clause^([\t\f ]+)(.*)impossible dateinvalid kind %vCardinality(%d)weak_dependencyextension_rangeproto3_optionalaggregate_value0-RTT Protectedpto (Handshake)timestamp replymax-age=2592000x-frame-optionsEOF token foundParseObjectListParseObjectItemParseObjectTypeexpected 'true'google.protobufextensionFieldsfractional bytedata/check mathContainingOneofRequiredNumbersExtensionRanges0123456789abcdefSOCKS5 TCP errorSOCKS5 UDP errorunsupported modeoutbounds.directclient connectedupdate availableinvalid address hostLookupOrder=/etc/resolv.confnon-IPv4 addressnon-IPv6 addressunknown network no colon on line23841857910156250123456789ABCDEFtime: bad [0-9]*__completeNoDesc commands=() open sink %q: %wProxy-Connectionunsupported unitexpected integerexpected newlinecontext canceled.WithValue(type SignatureScheme(no renegotiationafter object keyHalfClosedRemoteapplication/wasm*http2.TransportWww-Authenticatehttp: nil CookieContent-Encodingcontent-encodingcontent-languagecontent-locationwww-authenticatenil *http.Serverinvalid settingssetting_win_sizestream_went_downover_max_streamsproxy-connectionread_frame_other%s %s HTTP/1.1 User-Agent: %s unexpected type host unreachableAlready ReportedMultiple ChoicesPayment RequiredUpgrade RequiredContent-Length: SETTINGS_TIMEOUTFRAME_SIZE_ERRORX-Forwarded-Hostacme.zerossl.comunable to unlock_acme-challenge.challenge_tokensauthorization %sapplication/jsonresponse_headers, problem %q: %sbinary.BigEndianIV for ECDSA CTRlength too largeinvalid rune %#Udivision by zeroRel: can't make reflect.MakeFunc: value of type integer overflowgcshrinkstackofftracefpunwindoffGC scavenge waitGC worker (idle)SIGNONE: no trap/gc/gogc:percent, not a functiongc: unswept span KiB work (bg), mheap.sweepgen=runtime: nelems=workbuf is emptymSpanList.removemSpanList.insertbad special kindbad summary dataruntime: addr = runtime: base = runtime: head = already; errno= runtime stack: invalid g statuscastogscanstatusbad g transitionschedule: in cgoGOTRACEBACK=nonereflect mismatch untyped locals missing stackmapbad symbol tablenon-Go function not in ranges: sigaction failedImperial_AramaicMeroitic_CursiveZanabazar_Squareinvalid ip:port invalid AddrPortinvalid argumentinvalid exchangeobject is remotemessage too longno route to hostremote I/O errorstopped (signal)invalid dns nameunpacking headerRCodeFormatErrorno such flag -%vtemplate: %s: %sunknown node: %s%s overflows intprotocol error: Hysteria-Padding-> Sending RetryH3_MESSAGE_ERRORH3_CONNECT_ERRORGODEBUG: value "quoted-printable()<>@,;:\"/[]?= short response: Content-Languageinvalid encodingchallenge failedPublicExponent: dns: bad netmaskdns: bad addressunbalanced braceregexp: Compile(exec: no command[bisect-match 0xunclosed commentunexpected tokenextra charactersunknown event %dduplicated key 'source_code_infocc_enable_arenascsharp_namespacephp_class_prefixclient_streamingserver_streamingidentifier_valueleading_commentsFINAL_SIZE_ERRORKEY_UPDATE_ERRORCRYPTO_ERROR %#xToken: (empty), unexpected writeno dynamic tablemax-age=31536000x-xss-protectionInstRuneAnyNotNLParseObjectValueexpected 'false'google/protobuf/EnumValueOptionsXXX_unrecognizedmust be positiveldx 4*([%d]&0xf)-httptest.serve= for polynomial Check for updatesHTTP proxy serverno mode specifiedSOCKS5 TCP closedSOCKS5 UDP closedfailed to connectHYSTERIA_ACME_DIRresolver.tcp.addrresolver.udp.addrresolver.tls.addr/etc/ssl/cert.peminvalid BMPStringinvalid IA5String1192092895507812559604644775390625invalid bit size fractional secondCOBRA_ACTIVE_HELP flags+=("--%sreflect.Value.Int%s [command-line]Transfer-Encoding0123456789ABCDEFX0123456789abcdefxillegal hex digitcan't scan type: decryption failedhandshake failureillegal parametermissing extensionunrecognized namein string literalseeker can't seekinvalid stream ID; SameSite=StrictIf-Modified-Sinceframe_ping_lengthtruncated headersif-modified-sincetransfer-encodingx-forwarded-protobogus greeting %qreset_idle_streamsetParent to selfmissing form bodyX-Idempotency-Keyhttp: nil handlerMoved PermanentlyFailed DependencyToo Many RequestsHEADER_TABLE_SIZECOMPRESSION_ERRORENHANCE_YOUR_CALMHTTP_1_1_REQUIREDX-Forwarded-Prototext/event-stream Email address: removing_subjectsload_if_necessarycert_ocsp_revokedinteger too large060102150405Z0700%%!%c(big.Int=%s)unknown type kind has invalid namereflect: call of reflect.Value.Capreflect.Value.Lenreflect: New(nil)goroutine profileAllThreadsSyscallGC assist markingselect (no cases)sync.RWMutex.Lockwait for GC cycleSIGINT: interruptSIGBUS: bus errorSIGCONT: continue: missing method notetsleepg on g0bad TinySizeClasskey align too bigruntime: pointer g already scannedmark - bad statusscanobject n == 0swept cached spanmarkBits overflowruntime: summary[runtime: level = , p.searchAddr = futexwakeup addr=, 0, {interval: {ns}}, nil) errno=results: got {r1=runtime/internal/thread exhaustionlocked m0 woke upentersyscallblock spinningthreads=cannot secure fdsgp.waiting != nilunknown caller pcstack: frame={sp:runtime: nameOff runtime: typeOff runtime: textOff Old_North_ArabianOld_South_Arabianexec format errorpermission deniedno data availablewrong medium typeunknown error 133 (DEPRECATED: %s)invalid IP lengthconnection closeddeadline exceededH3_INTERNAL_ERRORH3_EXCESSIVE_LOADH3_SETTINGS_ERRORH3_DATAGRAM_ERRORmultipartmaxpartsmessage too largesolving challengebad key algorithmPrivateExponent: ; UPDATE LEASE: , timeout omittedSignature ExpiredNot Authoritative os/exec.Command(exec: killing Cmdexec: not startedbad character %#U%s at position %dpublic_dependencyobjc_class_prefixtrailing_commentsidempotency_levelQUIC_GO_LOG_LEVELAPPLICATION_ERRORnot a QUIC packetinvalid conn typeparameter problemgzip, deflate, br^.*\._Ctype_char$missing closing )missing closing ]unknown type: %T illegal characternon-hex characterincomplete numberinvalid characternextId too large:invalid range: %vXXX_OneofWrappersqr: too much data--httptest.serve=ContainingMessageIsStreamingClientIsStreamingServerCheck for updates.SOCKS5 TCP requestSOCKS5 UDP requestHTTP CONNECT errorTCP redirect errorHYSTERIA_LOG_LEVELempty http addressoutbounds.http.urlempty auth commandmasquerade request/etc/pki/tls/certsserver misbehavinginvalid IP address/etc/nsswitch.confinvalid criteria: value out of range298023223876953125: day out of rangeTime.MarshalJSON: Time.MarshalText: appendIfNotPresentmay not contain %qProxy-Authenticateinvalid character reflect.Value.Uintunexpected newlinecontext.Backgroundunexpected messageexport restrictionexceeded max depthin numeric literalreceived from peerhttp: no such fileapplication/x-gzip404 page not foundframe_goaway_shortproxy-authenticateUNKNOWN_SETTING_%dconnection is idleunexpected type %Ttrailers_not_endedGo-http-client/2.0Go-http-client/1.1connection refusedTemporary RedirectPermanent RedirectMethod Not AllowedExpectation Failedbad Content-LengthFLOW_CONTROL_ERRORresponse write: %vresponse flush: %vinserting_subjectsissuer %d (%s): %vtls-alpn challengeattempt %d: %s: %wmust be at least 8non-minimal lengthtruncated sequencesequence truncatednegative bit indexreflect.Value.Callreflect.Value.Elemreflect.Value.Sendreflect.Value.Typereflect: Zero(nil)dontfreezetheworldtracebackancestorsadaptivestackstartgarbage collectionsync.RWMutex.RLockGC worker (active)stopping the worldsystem page size (elem align too big but memory size /gc/pauses:seconds because dotdotdotruntime: npages = runtime: range = {index out of rangeruntime: gp: gp=runtime: getg: g=forEachP: not done in async preempt instruction bytes:mp.gsignal stack [bad manualFreeListruntime: textAddr cleantimers: bad p frames elided... , locked to threadCaucasian_Albanianunable to parse IPnetip.ParsePrefix(input/output errorno child processesfile name too longno locks availableidentifier removedmultihop attemptedRFS specific errorstreams pipe erroroperation canceledsegmentation faultRCodeServerFailureuse of closed fileunknown flag: --%slen of nil pointerfield is not validflag %q contains =flag redefined: %sbufio: buffer fullsocket connect: %sempty GeoSite name<- Received Retry:Responding with %ddecoding error: %vcleaning up solverchallenge acceptedsignature requiredbad authenticationbad extended rcodeno signature foundno secrets definedprivate-key-formatuse tcp keep-aliveoverflow packing aRSASHA1-NSEC3-SHA1 unknown type: %T empty key name: %sempty section nameexpansion too deepunhandled part: %stag:yaml.org,2002:positive_int_valuenegative_int_valueCONNECTION_REFUSEDSTREAM_LIMIT_ERRORSTREAM_STATE_ERRORPROTOCOL_VIOLATIONAEAD_LIMIT_REACHED (frame type: %#x)unknown frame typefailed to read RTTinvalid connectionget, post, options^(.+)\[([0-9]+)\]$Unknown token: %+vunquote %s err: %sneed a \n after \rduplicate name: %qqr: internal errorconnected to serverHTTP CONNECT closedTCP redirect closedHYSTERIA_LOG_FORMATempty outbound nameresolver.https.addrempty auth passwordempty auth userpassempty auth http urlmasquerade.file.dirclient disconnectedno update availablex509: malformed OIDx509: trailing datax509: unknown errorres_nsearch failureparsenetlinkmessagecriterion too short14901161193847656257450580596923828125bad value for fieldtime: unknown unit commands+=(%q) Proxy-Authorizationinvalid URL escape missing ']' in hostreflect.Value.IsNilreflect.Value.Floatbad unicode format %v write error: %v unknown cipher typerevoked certificateexpired certificateunknown certificateafter array elementhttp: Server closedIf-Unmodified-Sinceframe_data_stream_0 (%d bytes omitted)content-dispositionif-unmodified-sinceproxy-authorizationerr must be non-nilTLS version too lowflow_on_data_lengthheaders_half_closedmultipart/form-dataContent-Length: 0 invalid header namenetwork unreachableSwitching ProtocolsPrecondition FailedMisdirected RequestService UnavailableConnection: close invalid Trailer key already registeredunknown status codeINITIAL_WINDOW_SIZEINADEQUATE_SECURITYapi.letsencrypt.orgcached_managed_certtrying issuer %d/%dtls_get_certificateobtain_if_necessaryorder took too long (%s_identifier=%s)invalid status codeunknown hash value binary.LittleEndiansync.Cond is copiednegative coordinateunknown Go type: %v20060102150405Z0700skip this directory2006-01-02 15:04:05reflect.Value.Bytesreflect.Value.Fieldreflect.Value.Indexreflect.Value.Slicereflect.Value.Clear are not comparableGC mark terminationSIGTRAP: trace trapcgocall unavailablepanicwrap: no ( in panicwrap: no ) in called using nil *unknown wait reasonnotesleep not on g0GC work not flushedunaligned sysUnused/gc/scan/heap:bytes/gc/heap/goal:bytes/gc/heap/live:bytesbad kind in runfinqmarkroot: bad indexnwait > work.nprocs, gp->atomicstatus=marking free object KiB work (eager), [controller reset]mspan.sweep: state=sysMemStat overflowbad sequence numbermissing deferreturnpanic during mallocpanic holding lockspanic during panic unexpected g status_cgo_setenv missing, g->atomicstatus=bad runtime·mstartm not found in allmstopm holding lockssemaRoot rotateLeftbad notifyList sizeruntime: preempt g0runtime: pcdata is dodeltimer: wrong Padjusttimers: bad punsupported versionCanadian_AboriginalKhitan_Small_Script too large for IPv4 too large for IPv6bad file descriptortoo many open filesdirectory not emptydevice not a streamdisk quota exceededillegal instructionstopped (tty input)/proc/self/uid_map/proc/self/gid_mapzero length segmentRCodeNotImplementedbad flag syntax: %s2006-01-02T15:04:0502 Jan 06 15:04 MSTJan _2 15:04:05.000empty domain suffixconnection closed: quic: server closedClosing connection.QUIC_GO_DISABLE_GSOQUIC_GO_DISABLE_ECNH3_FRAME_UNEXPECTEDH3_MISSING_SETTINGSH3_REQUEST_REJECTEDH3_VERSION_FALLBACKmultipartmaxheadersContent-Dispositionmime: no media typeevictCount overflowno private key seenAPL prefix too longAPL length too longextra closing brace%02d %02d %0.3f %s No Zone Key Bit Setunexpected InstFailexec: canceling Cmdmodulus must be oddfile already existsfile does not existfile already closedunclosed left parenunknown branch typetemplate: %s:%d: %sunexpected %s in %s%s: unknown type %Tunsupported type %swhile parsing a tagdescriptor mismatchjava_multiple_filescc_generic_servicespy_generic_servicesinvalid perspectiveinvalid sample sizetoken too short: %drouter solicitationextended echo replytiming-allow-originarray is incompleteinvalid nil pointerExtensionRangeArrayfield %v is invalidunknown JumpTest %villegal char escapegoogle.protobuf.AnyHTTP CONNECT requestTCP forwarding errorUDP forwarding errorTCP redirect connectdisable-update-checkdisable update checkinvalid IPv4 addressinvalid IPv6 addressempty socks5 addressempty file directorymasquerade.proxy.urlempty string contentdownloading databasechecking for updatesx509usefallbackrootsgetCert can't be nilinvalid UTF-8 stringx509: malformed spkiinvalid DNS responseunrecognized addressunexpected network: 37252902984619140625time: invalid numbercorrupt tzdata file noun_aliases=() last_command=%q DebugFlags called onBASH_COMP_DEBUG_FILEtype not a pointer: unknown PSK identitycertificate requiredjson: Unmarshal(nil)json: Unmarshal(nil json: error calling pad length too largehttp2: stream closed%s connection error: %sframe_settings_mod_6No space found in %qsettings_big_or_dupsURL must have a hostconn_close_lost_pingassigned stream ID 0read_frame_too_largeinvalid use of queuehttp: POST too largeHTTP/%d.%d %03d %s invalid header valueunknown address typeRequest URI Too LongUnprocessable EntityInsufficient StorageMAX_HEADER_LIST_SIZEcertificate is emptyrenewing certificate%s: file info is nilchoosing certificateencoding payload: %vcreating request: %wh3=":%d"; ma=2592000no address availableasn1: syntax error: number has no digitsinvalid integer typeinvalid write resultSeek: invalid whenceSeek: invalid offsetreflect: cannot use returned zero Valuereflect.Value.IsZeroreflect.Value.Methodreflect.Value.SetIntreflect.Value.Slice3floating point errorGC sweep terminationResetDebugLog (test)chan send (nil chan)SIGALRM: alarm clockSIGTERM: termination__vdso_clock_gettimemalloc during signalclose of nil channelnotetsleep not on g0bad system page size to unallocated span/gc/scan/stack:bytes/gc/scan/total:bytes/gc/heap/frees:bytes/gc/gomemlimit:bytesp mcache not flushed markroot jobs done pacer: assist ratio=workbuf is not emptybad use of bucket.mpbad use of bucket.bpruntime: double waitruntime: pipe failedpreempt off reason: forcegc: phase errorgopark: bad g statusgo of nil func valuewirep: already in goselectgo: bad wakeupsemaRoot rotateRightreflect.makeFuncStubdodeltimer0: wrong Ptrace: out of memoryEgyptian_HieroglyphsMeroitic_Hieroglyphsmissing IPv6 addressunexpected characternegative Prefix bitsinvalid request codebad font file formatconnection timed outis a named type filekey has been revokedstopped (tty output)urgent I/O conditionif/with can't use %vnil is not a commanderror calling %s: %windex of untyped nilindex of nil pointerslice of untyped nilflag: help requestederror at line %d: %slistener already setSetting DF for IPv4.Setting DF for IPv6.H3_REQUEST_CANCELLEDmissing status field%s=":%d"; ma=2592000form-data; name="%s"gzip: invalid headerheader line too longno identifiers foundno solver configuredbad OCSP signature: ;; ANSWER SECTION: overflow unpacking aoverflow packing hexoverflow packing optDNSSEC Indeterminatehttps://%s/dns-querymodulus must be >= 0integer overflow: %qmissing value for %sunclosed section: %sunknown property: %smalformed expressionexpected digit (0-9)invalid map key: %#vunknown scalar styleinvalid parser statewhile parsing a nodewhile scanning a tagjava_outer_classnamephp_generic_servicesuninterpreted_optionFRAME_ENCODING_ERRORunexpected event: %dDropping 0-RTT keys.quic-go token sourcerouter advertisement^.*\._Ctype_uint8_t$expression too largeinvalid repeat countunknown bool value: invalid field numberWARNING: %v See %v invalid map key typeqr: invalid pad sizeunknown JumpTest %#villegal octal number^[[:space:]]*%s\r*\zTCP transparent proxyUDP transparent proxyTCP forwarding closedUDP forwarding closedoutbounds.direct.modeoutbounds.socks5.addrunsupported auth typeserver up and runninginvalid NumericStringx509: invalid versionunsupported operationlocalhost.localdomainsingle-request-reopenparsenetlinkrouteattr186264514923095703125931322574615478515625_%s_root_command() { Did you mean this? reflect.Value.Complexkey is not comparabledecompression failureunsupported extensionafter top-level valuein string escape codefeature not supportedhttp: nil Request.URLUNKNOWN_FRAME_TYPE_%dframe_ping_has_streamover_max_streams_racetoo_many_early_resetsRoundTrip failure: %vUnhandled Setting: %vnet/http: nil Contexttoo many Host headersSunMonTueWedThuFriSatmalformed Host header%03d status code %d http: invalid patternunknown address type command not supportedPrecondition RequiredInternal Server Errorhttp: proxy error: %vgetting directory: %wno certificate chainscached_unmanaged_certobtaining certificateunknown PEM header %qqueueing renewal taskadvancing OCSP staplemissing directory URLapplication/jose+jsonBandwidthConfig.MaxTxBandwidthConfig.MaxRxinvalid outbound modeoutbound %s not foundsequence tag mismatchset bit is not 0 or 1unknown ABI part kind of unexported methodunexpected value stepreflect.Value.SetZeroreflect.Value.Pointerreflect.Value.SetUintnegative shift amountconcurrent map writes/gc/heap/allocs:bytesruntime: work.nwait= previous allocCount=, levelBits[level] = runtime: searchIdx = defer on system stackpanic on system stackasync stack too large_cgo_unsetenv missingstartm: m is spinningstartlockedm: m has pfindrunnable: wrong ppreempt at unknown pcreleasep: invalid argcheckdead: runnable gruntime: newstack at runtime: newstack sp=runtime: confused by pcHeader.textStart= timer data corruptionAnatolian_HieroglyphsInscriptional_PahlaviIPv4 address too longunexpected slice sizeblock device requiredread-only file systempackage not installedlink has been severedstale NFS file handlestate not recoverabletrace/breakpoint trapuser defined signal 1user defined signal 2virtual timer expired/proc/self/setgroupspflag: help requested%s flag redefined: %s02 Jan 06 15:04 -0700record on line %d: %vflag %q begins with -bufio: negative countduplicate stream datatoo many open streamsConnection %s closed.misrouted packet: %#vH3_INCOMPLETE_REQUESTduplicate setting: %d%s %s%s, on stream %dbad type in compare: unknown OCSP status: buffer size too smalloverflow packing aaaaoverflow packing nsecoverflow packing SVCBStale NXDOMAIN Answerexec: already startedinvalid scalar lengthbad number syntax: %qundefined variable %qunknown config formatunhandled kv part: %sinvalid emitter stateexpected STREAM-STARTexpected DOCUMENT-ENDcannot marshal type: write handler not setjava_generic_servicesHYSTERIA_BRUTAL_DEBUGinvalid varint lengthinvalid ECN value: %dinvalid reserved bitsunknown ECN state: %dinvalid send mode: %dDropping key phase %dextended echo requestinvalid named captureno object keys found!invalid character %#Uexpected character %cmessage_set_extensionExtensionRangeOptionsmismatching field: %vinvalid QR version %dinvalid option lengthinvalid header lengthTCP redirect listeningTCP forwarding connectUDP forwarding connectinvalid config: %s: %sempty cert or key pathempty resolver addressmasquerade.listenHTTPS/etc/ssl/ca-bundle.pemx509: malformed issuerreflectlite.Value.Type.localhost.localdomainmissing ']' in addressinvalid address familyoperation was canceled4656612873077392578125Help about any commandunrecognized level: %qmust be at least 163840123456789aAbBcCdDeEfFexpected quoted stringunknown field type: %vTLS_AES_128_GCM_SHA256TLS_AES_256_GCM_SHA384ECDSAWithP256AndSHA256ECDSAWithP384AndSHA384ECDSAWithP521AndSHA512error decoding messageinappropriate fallback into Go struct field json: unknown field %qhttp2: frame too largewrite on closed bufferbody closed by handlerapplication/postscriptframe_data_pad_too_bigaccess-control-max-ageinvalid Trailer key %qunexpected empty hpackadjustPriority on rootmalformed HTTP requestmalformed HTTP versionX-Content-Type-OptionsUnsupported Media TypeDEBUG_HTTP2_GOROUTINESMAX_CONCURRENT_STREAMScreating lock file: %vaddress already in useencoding inner JWS: %vperforming request: %w<(.+?)>;\s*rel="(.+?)"must be at least 65536overflowing coordinatezero length BIT STRINGInt.Scan: invalid verbinvalid number base %dinternal inconsistencyunexpected method stepreflect.Value.MapIndexreflect.MapIter.SetKeyreflect.Value.SetFloat to array with length integer divide by zeroCountPagesInUse (test)ReadMetricsSlow (test)trace reader (blocked)SIGSTKFLT: stack faultSIGTSTP: keyboard stopsend on closed channelgetenv before env initinterface conversion: freeIndex is not validoldoverflow is not nils.freeindex > s.nelemsbad sweepgen in refillspan has no free spaceruntime: out of memory/gc/scan/globals:bytes/gc/heap/frees:objectsruntime: work.nwait = runtime:scanstack: gp=scanstack - bad statusheadTailIndex overflowduplicated defer entryruntime.main not on m0set_crosscall2 missingbad g->status in readywirep: invalid p stateassembly checks failed received during fork stack not a power of 2minpc or maxpc invalidtrace: alloc too largenon-Go function at pc=Inscriptional_ParthianNyiakeng_Puachue_Hmongreflectlite.Value.ElemIPv4 address too shortmultiple :: in addressargument list too longcannot allocate memoryremote address changedprotocol not availableprotocol not supportednetwork is unreachableskipping Question Nameskipping Question Typeflag %q does not existfailed to parse IP: %qundefined variable: %sindex out of range: %dJan _2 15:04:05.000000wrong number of fieldsinvalid address lengthinvalid padding lengthinvalid message lengthinvalid conn id lengthhttp3: nil Request.URL/usr/share/mime/globs2/etc/apache/mime.typesgzip: invalid checksumhpack: string too longheader field %q = %q%sidna: invalid label %qcreating new order: %wUnknown hash algorithmbad OCSP response typeinvalid responder nameconn has no connectionunrecognized address: overflow packing uint8 ;; QUESTION SECTION: overflow unpacking txtoverflow unpacking hexoverflow unpacking optnsec bits out of orderextra APL address bitsNo Reachable Authorityunexpected right parenexpected end; found %sparenthesized pipelineapplication/javascriptunknown slice type: %T0123456789abcdefABCDEFexpected a : separatortoml: cannot write: %wjava_string_check_utf8php_metadata_namespaceSetMaxDatagramSize: %dCRYPTO_BUFFER_EXCEEDEDpto (Application Data)Dropping Initial keys.x-content-type-optionsunexpected length codeerror parsing regexp: oneof type already setXXX_InternalExtensionsnon-numeric string %#qillegal UTF-8 encodingcomment not terminatedheredoc not terminatedliteral not terminatedinvalid UTF-8 detectedserver address is emptylisten address is emptySOCKS5 server listeningremote address is empty/etc/pki/tls/cacert.peminvalid PrintableStringx509: malformed UTCTimex509: invalid key usagex509: malformed versionreflectlite.Value.IsNilunexpected address typemissing port in address23283064365386962890625time: invalid duration noun_aliases+=(%q) command_aliases=() ShellCompDirectiveErrorUnknown help topic %#q trimTrailingWhitespaceschecking if file existsmissing protocol schemeinvalid URI for request0123456789aAbBcCdDeEfF_CLIENT_TRAFFIC_SECRET_0SERVER_TRAFFIC_SECRET_0tls: invalid PSK binderQUICEncryptionLevel(%v)unsupported certificateno application protocoljson: cannot unmarshal into Go value of type unexpected map key typehttp2: handler panickedhttp: request too largenet/http: abort Handlertext/xml; charset=utf-8Error reading directoryunknown error code 0x%xframe_goaway_has_streamframe_headers_pad_shortframe_rststream_bad_lennet/http context value malformed HTTP responsenon-zero reserved fieldnetwork not implementedcommand not implementedVariant Also Negotiatesaccessing lock file: %vmaking OCSP request: %vsigning EAB content: %wprovisioning client: %wHTTP request failed: %dbytes.Buffer: too largeasn1: structure error: truncated tag or lengthreflect.Value.Interfacereflect.Value.NumMethodindex out of range [%x]ReadMemStatsSlow (test)chan receive (nil chan)garbage collection scanSIGIO: i/o now possibleSIGSYS: bad system callmakechan: bad alignmentclose of closed channelunlock of unlocked lock) must be a power of 2 system huge page size (runtime: s.allocCount= s.allocCount > s.nelems/gc/heap/allocs:objectsmissing type in runfinqruntime: internal errorwork.nwait > work.nprocleft over markroot jobsgcDrain phase incorrectMB during sweep; swept runtime: netpoll failedpanic during preemptoffnanotime returning zerofatal: morestack on g0 the current g is not g0schedule: holding locksinvalid m->lockedInt = runtime/internal/atomicprocresize: invalid argmisuse of profBuf.writeunexpected signal valuespan has no free stacksstack growth after forkshrinkstack at bad timereflect.methodValueCalloperation not permittedinterrupted system calldevice or resource busyno space left on deviceoperation not supportedCPU time limit exceededprofiling timer expiredtoo many pointers (>10)segment length too longunpacking Question.Nameunpacking Question.Typeskipping Question Classtemplate %q not definedcannot assign nil to %sexpected bool; found %snon-function of type %serror decoding '%s': %sget file descriptor: %sunsupported domain typeunknown packet type: %stoo short connection IDpeer sent too much dataunknown error code: %#xinvalid status code: %w", missing CPU support multipart: NextPart: %winvalid response code: /etc/apache2/mime.typestext/css; charset=utf-8varint integer overflowfinalizing order %s: %wdone waiting for solverauthorization finalizedoverflow packing uint16overflow packing uint32 ; LONG LIVED QUERIES: ; DS HASH UNDERSTOOD: dns: bad address family ;; AUTHORITY SECTION: overflow unpacking aaaaoverflowing header sizeoverflow packing uint64overflow packing base32overflow packing base64overflow unpacking SVCBSignature Not Yet Validexec: Stdin already setapplication/dns-messageP224 point not on curveP256 point not on curveP384 point not on curveP521 point not on curveinvalid scalar encodingpattern bits too long: 0123456789abcdefABCDEF_function %q not definedmissing required key %sinvalid unicode literalunsupported encoding %vproperties: Line %d: %scircular reference in: unknown character widthwhile scanning an aliasmessage_set_wire_format[BrutalSender] [%s] %s unknown packet type: %dinvalid first ACK rangetoken must not be emptyunknown cipher suite %dPeer updated keys to %ddestination unreachablecontent-security-policyflate: internal error: invalid escape sequenceunknown empty width argexpected value, not eofbad %s slice length: %dmultiple files named %qmismatching cardinalityinvalid Message.Get on invalid Message.Set on unknown connection typeinvalid scratch slot %dunknown accessor: %v.%s%v has unknown kind: %vobfs.salamander.passwordTCP forwarding listeningUDP forwarding listeningHTTP reverse proxy errorx509: malformed validityno CNAME record receivedruntime: C malloc failed116415321826934814453125582076609134674072265625While parsing config: %smust start with a letterTLS_RSA_WITH_RC4_128_SHAerror decrypting messagecertificate unobtainablejson: unsupported type: Mon Jan _2 15:04:05 2006text/html; charset=utf-8unexpected buffer len=%vinvalid pseudo-header %qframe_headers_prio_shortinvalid request :path %qread_frame_conn_error_%sstream %d already openedapplication/octet-streamConnContext returned nilRequest Entity Too Largehttp: nil Request.Headercreating ACME client: %vdecoding private key: %vgetting ACME account: %vfinal attempt; giving upcertificate has no namesdeleting private key: %vunsupported key type: %Tunknown private key typeapplication/ocsp-requestauthorization failed: %wapplication/problem+jsonpolling order status: %wreflect.StructOf: field reflect.MapIter.SetValuereflect.Value.SetComplexreflect.Value.UnsafeAddrhash of unhashable type span has no free objectsruntime: found obj at *(/cgo/go-to-c-calls:calls/gc/heap/objects:objects/sched/latencies:secondsqueuefinalizer during GCupdate during transitionruntime: markroot index can't scan our own stackgcDrainN phase incorrectpageAlloc: out of memoryruntime: p.searchAddr = range partially overlapsruntime: epollctl failedbad defer entry in panicbypassed recovery failedstack trace unavailable runqsteal: runq overflowdouble traceGCSweepStartaddress string too shortfunction not implementedlevel 2 not synchronizedlink number out of rangeout of streams resourcesconnection reset by peerstructure needs cleaningfloating point exceptionfile size limit exceededRawSockaddrAny too smallresource length too longunpacking Question.Classdnsmessage.MustNewName("dnsmessage.Option{Code: expected float; found %s2006-01-02T15:04:05-07002006-01-02 15:04:05Z0700unable to parse date: %sresult must be a pointer%s: unsupported type: %sempty GeoIP country codeinvalid CIDR address: %squic: tls.Config not setinvalid QUIC version: %serror parsing packet: %sDATAGRAM frame too largeAdding connection ID %s.unknown encryption levelError parsing packet: %sH3_STREAM_CREATION_ERRORhttp3: invalid method %qinvalid argument to Intnidna: disallowed rune %Uvalidating authorizationinvalid responder id tag ;; ADDITIONAL SECTION: overflow unpacking uint8exec: Stdout already setexec: Stderr already setinvalid pattern syntax: streamSafe was not reset(\$)(\{?([A-Z0-9_]+)\}?)text/plain;charset=utf-8ErrorHandler should exitduplicate %TAG directiveread handler must be setexceeded max depth of %dwhile scanning an anchornot a long header packetnegative bytes_in_flightunknown cypher suite: %dDropping Handshake keys.keys updated too quicklypublic, max-age=31536000expected Base to be zerochacha20: wrong key sizeflate: maxBits too largeexpected: STRING got: %stabwriter: panic during need a character after \encodeArray: nil elementinvalid field number: %dmismatching enum lengthsunknown instruction: %#vexpected '/' for commentoutbounds.direct.bindIPv4outbounds.direct.bindIPv6unsupported outbound typeunsupported resolver typemasquerade.string.contentx509: invalid RDNSequencex509: invalid RSA modulusx509: malformed extensionx509: malformed signature2006-01-02T15:04:05Z07:00no answer from DNS serverinvalid network interfaceno such network interfaceno suitable address foundunexpected '[' in addressunexpected ']' in address2910383045673370361328125unknown command %q for %q aliashash[%q]=%q ' does not support flag 'ShellCompDirectiveNoSpaceShellCompDirectiveDefaultno encoder name specifiednet/url: invalid userinfoQUICConfig.MaxIdleTimeoutno hex data for %x stringcontext deadline exceededtls: protocol is shutdownjson: Unexpected key typereflect.Value.OverflowIntjson: unsupported value: not at beginning of valuehttp2: Request.URI is niltext/plain; charset=utf-8http: invalid Cookie.Name500 Internal Server Errorhttp2: Framer %p: read %vframe_data_pad_byte_shortframe_settings_has_streamframe_headers_zero_streamframe_headers_pad_too_bigframe_priority_bad_lengthhttp2: invalid header: %vstrict-transport-securityhttp2: unsupported schemeread_frame_unexpected_eofhttp: invalid Host headerHTTP/1.1 100 Continue port number out of range invalid username/passwordreading email address: %v()[]{}<> "\!@#$%^&|;'+=no certificates availableobtaining new certificateserved key authenticationcreating OCSP request: %vreading OCSP response: %vparsing OCSP response: %vrolling key on server: %wreading response body: %wno IPv4 address availableno IPv6 address availableSOCKS5 request failed: %dinvalid protocol/port: %secdsa: invalid public keyunknown Go type for sliceexplicit tag has no childinvalid object identifierreflect: Bits of nil Typereflect.StructOf: field "reflect.Value.SetMapIndexgoroutine profile cleanupchansend: spurious wakeupruntime·lock: lock countbad system huge page sizearena already initialized to unused region of spanunaligned sysNoHugePageOS/sched/gomaxprocs:threadsremaining pointer buffersruntime: epollwait on fd slice bounds out of rangebad defer entry in Goexit_cgo_thread_start missingallgadd: bad status Gidleruntime: program exceeds startm: p has runnable gsstoplockedm: not runnablereleasep: invalid p statecheckdead: no p for timercheckdead: no m for timer when attempting to open unexpected fault address missing stack in newstackbad status in shrinkstackmissing traceGCSweepStartIPv4 field has value >255): bad bits after slash: no such file or directoryno such device or addressinvalid cross-device linkresource deadlock avoidedsocket type not supportedno buffer space availableoperation now in progressinconsistent poll.fdMutexcan't evaluate command %qexpected string; found %scan't print %s of type %s2006-01-02 15:04:05Z07:002006-01-02 15:04:05 -0700Jan _2 15:04:05.000000000%d error(s) decoding: %s'%s' has invalid keys: %s'%s' has unset fields: %sGeoSite name %s not foundDestroying connection: %sunexpected frame type: %sBUG: invalid send mode %ddatagram support disabledconnection already existswrite on closed stream %derror handling stream: %sError writing request: %sH3_GENERAL_PROTOCOL_ERRORH3_CLOSED_CRITICAL_STREAMunknown pseudo header: %shttp3: nil Request.Headerblake2b: invalid key sizeGODEBUG: can not enable "Content-Transfer-Encodingtrying to solve challengeocsp: error from server: overflow unpacking uint16overflow unpacking uint32overflow unpacking uint64overflow unpacking base32overflow unpacking base64overflow packing anythingillegal number syntax: %q_html_template_urlescaper(?i)<(script|/script|!--)section %q does not existhour cannot be greater 23unable to parse float: %w2006-1-2 15:4:5.999999999while parsing a flow nodedid not find expected keyinvalid Unicode characterdid not find expected '!'required field %v not setleading_detached_commentsTRANSPORT_PARAMETER_ERRORCONNECTION_ID_LIMIT_ERRORnot a short header packetECN capability confirmed.Skipping packet number %d updated RTT: %s (σ: %s)upgrade-insecure-requestsunexpected type byte: %#x^.*\._Ctype_unsignedchar$windows new line expectedcheckId: %d should be %d bootstrap type wrong id: cb27e3aa (May 26th, 2020)google/protobuf/api.protoinvalid Message.Clear on got %v, want *struct kindinvalid oneof descriptor gf256: invalid generator unsupported transport typeunsupported log level: %s x509: malformed parametersx509: malformed extensionscannot marshal DNS messagetoo many colons in addressSRV header name is invalidunclosed criterion bracketcriterion lacks equal sign1455191522836685180664062572759576141834259033203125: day-of-year out of range flags_completion+=(:) must_have_one_flag=() must_have_one_noun=() Unsupported Config Type %qmust specify logging levelmalformed request body: %vinvalid port %q after hostunexpected status code: %dQUICConfig.KeepAlivePeriodmust be between 2s and 60sreflect.Value.CanInterfaceinteger overflow on token ECDSA verification failurebad certificate hash valuereflect.Value.OverflowUintencountered a cycle via %sread from empty dataBuffernet/http: request canceledstopped after 10 redirectsduplicate pseudo-header %qhttp2: Framer %p: wrote %vframe_windowupdate_bad_lenframe_priority_zero_streaminternal error: bad Writerhttp2: invalid Host headermalformed HTTP status codeaddress type not supportedHTTP Version Not SupportedreadLoopPeekFailLocked: %wgenerating private key: %vcertificate already cachedadded certificate to cachedeleting metadata file: %vfinal order is invalid: %wbinary.Read: invalid type ecdsa: invalid private keyed25519: bad seed length: base 128 integer too largetruncated base 128 integerasn1: invalid UTF-8 stringnon sequence tagged as setcryptobyte: internal errorempty buffer in CopyBuffer using unaddressable valueunknown ABI parameter kind using zero Value argumentreflect.Value.MethodByNameall goroutines stack traceSIGSTOP: stop, unblockablenotewakeup - double wakeuppersistentalloc: size == 0/gc/cycles/total:gc-cyclesnegative idle mark workersuse of invalid sweepLockerruntime: bad span s.state=runtime: pipe failed with freedefer with d.fn != nilforEachP: P did not run fnwakep: negative nmspinningstartlockedm: locked to meentersyscall inconsistent inittask with no functionscorrupted semaphore ticketout of memory (stackalloc)shrinking stack in libcallruntime: pcHeader: magic= invalid use of gostartcallAs4 called on IPv6 addressno message of desired typeno CSI structure availableinvalid request descriptorname not unique on networkrequired key not availablesegment prefix is reserveddnsmessage.NSResource{NS: flag needs an argument: %sinvalid value; expected %sexpected integer; found %sexpected complex; found %stoo many slice indexes: %dnon-comparable type %s: %v2006-01-02 15:04:05 -07:00bare " in non-quoted-fieldRemoving connection ID %s.invalid content length: %whttp3: invalid Host headerhttp: panic serving: %v %sinvalid argument to Int63ninvalid argument to Int31nblake2b: invalid hash size/etc/httpd/conf/mime.typesid (%v) <= evictCount (%v)malformed chunked encodingdeactivating authorizationinvalid responder key hash ; NSEC3 HASH UNDERSTOOD: overflow unpacking NSEC(3) ;; TSIG PSEUDOSECTION: ; Unsupported DS Digest Typeunterminated quoted stringunexpected . after term %q_html_template_htmlescaper_html_template_attrescapertemplate escaped correctlyinvalid date-time timezoneunknown line break settingfound undefined tag handlewhile parsing a block nodeinvalid character sequencewhile scanning a directiveApplication error %#x (%s), StatelessResetToken: %#x, MaxDatagramFrameSize: %d^([^\[]*)\[([^\]]+)\](.*)$chacha20: wrong nonce sizechacha20: counter overflowinline table is incompletegoogle.golang.org/genprotogoogle/protobuf/type.protoinvalid source register %vinvalid target register %villegal hexadecimal numberzero-length heredoc anchorfailed to initialize clientHTTP proxy server listeningTCP transparent proxy errorUDP transparent proxy errorunsupported log format: %s must set either tls or acmeunsupported masquerade typefailed to initialize serverfailed to download databasefailed to check for updatesunsupported string type: %vx509: malformed certificatecurrent time %s is after %scryptobyte: length overflowx509: no SerialNumber givenos: process not initializedos: unsupported signal type363797880709171295166015625unknown command %q for %q%s flags_completion+=(%q) Run '%v --help' for usage. ShellCompDirectiveKeepOrderadding path to search pathsno sink found for scheme %qcan't parse %q as a URL: %vmust be between 4s and 120sCurveP256CurveP384CurveP521tls: short read from Rand: insufficient security levelreflect.Value.OverflowFloatafter object key:value pairnet/http: use last responseinvalid dependent stream IDhttp2: response body closedhttp: invalid Cookie.DomainDATA frame with stream ID 0frame_rststream_zero_streamframe_pushpromise_pad_shortaccess-control-allow-originhttp2: server read frame %vignoring invalid trailer %qinvalid WriteHeader code %vinvalid HTTP header name %qadd DATA on non-open streamnet/http: invalid method %qunsupported protocol schemeuser must agree to CA terms%s: caching certificate: %vloading managed certificateloading renewed certificate/.well-known/acme-challengeno OCSP stapling for %v: %vbase64-decoding MAC key: %wauthorization took too longmust be between 2s and 600sdevice name cannot be emptyboringcrypto: not availableinvalid ASN.1 from SignASN1crypto/rsa: invalid moduluscipher: incorrect length IVreflect.Value.UnsafePointer is not assignable to type PageCachePagesLeaked (test)SIGILL: illegal instructionSIGXCPU: cpu limit exceededcgoUse should not be calledmakechan: size out of rangeG waiting list is corruptedruntime·unlock: lock countprogToPointerMask: overflow/gc/cycles/forced:gc-cycles/memory/classes/other:bytes/memory/classes/total:bytesfailed to set sweep barrierwork.nwait was > work.nproc not in stack roots range [allocated pages below zero?address not a stack addressmspan.sweep: bad span stateinvalid profile bucket typeruntime: corrupted polldescruntime: netpollinit failedruntime: asyncPreemptStack=runtime: thread ID overflowstopTheWorld: holding locksgcstopm: not waiting for gcinternal lockOSThread errorruntime: checkdead: nmidle=runtime: checkdead: find g runlock of unlocked rwmutexsignal received during forksigsend: inconsistent statemakeslice: len out of rangemakeslice: cap out of rangegrowslice: len out of rangestack size not a power of 2timer when must be positive: unexpected return pc for reflectlite.Value.Interfacereflectlite.Value.NumMethodIPv6 field has value >=2^16As4 called on IP zero valuechannel number out of rangecommunication error on sendnot a XENIX named type filekey was rejected by servicednsmessage.SOAResource{NS: failed to parse IP mask: %qinvalid type for comparisonrange can't iterate over %vmap has no entry for key %qcan't index item of type %scan't slice item of type %sinvalid boolean flag %s: %vflag needs an argument: -%sunexpected encryption level<- Received Initial packet.Malformed Content-Length %saccepting stream failed: %wHandling request failed: %sinvalid argument to Shufflehkdf: entropy limit reachedhttp chunk length too largeauthorization already validoverflow unpacking anythingunrecognized address familyoverflow packing APL prefixdns: empty question sectioninvalid P224 point encodinginvalid P256 point encodinginvalid P384 point encodinginvalid P521 point encodinginput overflows the modulusNAF digits must fit in int8abi.NewName: tag too long: in action started at %s:%d{{break}} outside {{range}}too many declarations in %snot a pointer to struct: %sfloat cannot end with a dottag value must not be emptyinvalid leading UTF-8 octetincomplete UTF-16 characterexpected low surrogate areawhile scanning a simple keycould not find expected ':'while increasing flow level{Largest: %d, Smallest: %d}invalid packet number spaceInvalid cipher suite id: %dinvalid argument to Uint64nexpression nests too deeplyexpected key but found noneunterminated literal string%v %v is already registeredmismatching message lengthsinvalid Message.Mutable on %v: assigning invalid valuenon-alphanumeric string %#qinvalid load byte length %dnumbers cannot start with 0gf256: invalid polynomial: unsupported obfuscation typefailed to read client configfailed to load client configTCP transparent proxy closedUDP transparent proxy closedcannot set both tls and acmemasquerade.string.statusCodefailed to read server configfailed to load server config/system/etc/security/cacertsx509: invalid RSA public keyx509: invalid DSA public keyx509: invalid DSA parametersx509: unknown elliptic curvecurrent time %s is before %serrors: target cannot be nilcannot unmarshal DNS messagecould not parse CNAME record/proc/sys/net/core/somaxconnos: process already finishedos: process already released18189894035458564758300781259094947017729282379150390625 flag_parsing_disabled=1 ShellCompDirectiveNoFileCompShellCompDirectiveFilterDirssearching for config in path%q is not a valid scheme: %vIgnored key without a value.https://api.hy2.io/v1/updateoverflow on character value can't unmarshal a nil *Level2006-01-02T15:04:05.000Z0700Ed25519 verification failureTLS_RSA_WITH_AES_128_CBC_SHATLS_RSA_WITH_AES_256_CBC_SHATLS_CHACHA20_POLY1305_SHA256json: Unmarshal(non-pointer !#$%&()*+-./:;<=>?@[]^_{|}~ unexpected end of JSON inputhttp2: client conn is closedtext/plain; charset=utf-16betext/plain; charset=utf-16leapplication/x-rar-compressedhttp: invalid Cookie.Expiresinvalid header field name %qaccess-control-allow-headersaccess-control-allow-methodsforgetting unknown stream idhttp2: Transport received %shttp: request body too largeunsupported protocol versionmissing required Host headerunexpected protocol version general SOCKS server failureTransfer-Encoding: chunked http: no Host in request URL%s: renewing certificate: %wprivate key not found for %sconverting '%s' to ASCII: %vmatched certificate in cache/.well-known/acme-challenge/panic: active locking: %v %sencoding old private key: %vSOCKS5 authentication failedmust provide a positive sizebytes: negative Repeat countcrypto/rsa: decryption errorasn1: string not valid UTF-8big: misuse of expNNWindowednegative n for ProbablyPrimepending ASN.1 child too longreflect.MakeSlice: len > capSIGHUP: terminal line hangupSIGWINCH: window size changecomparing uncomparable type notewakeup - double wakeup (region exceeds uintptr rangeneed padding in bucket (key)/gc/heap/frees-by-size:bytes/gc/heap/tiny/allocs:objects/sched/goroutines:goroutinesgcBgMarkWorker: mode not setmspan.sweep: m is not lockedfound pointer to free objectmheap.freeSpanLocked - span fatal: morestack on gsignal runtime: casgstatus: oldval=gcstopm: negative nmspinningfindrunnable: netpoll with psave on system g not allowednewproc1: newg missing stacknewproc1: new g is not GdeadFixedStack is not power-of-2missing stack in shrinkstack args stack map entries for invalid runtime symbol tableruntime: no module data for [originating from goroutine reflect: In of non-func typereflect: Key of non-map typeprotocol driver not attachedfile descriptor in bad statedestination address requireddnsmessage.Resource{Header: dnsmessage.MXResource{Pref: dnsmessage.PTRResource{PTR: %q is not a defined functionnil pointer evaluating %s.%sinvalid slice index: %d > %dMon Jan _2 15:04:05 MST 2006cannot parse '%s' as int: %s%#x doesn't fit into 62 bitsRemoving 0-RTT queue for %s.quic-go/http3 context value multipart: message too largemultipart: boundary is emptymalformed MIME header line: /usr/local/share/mime/globs2invalid byte in chunk lengthinvalid proxy address %q: %vpresenting for challenge: %wdns: svcbalpn: empty alpn-idUnsupported DNSKEY Algorithmabi.NewName: name too long: _html_template_urlnormalizer_html_template_rcdataescaperminutes cannot be greater 59seconds cannot be greater 60expected %s event but got %sincompatible %YAML directivetag handle must not be emptytag handle must end with '!'tag prefix must not be emptywhile parsing a flow mappinginvalid trailing UTF-8 octetfound unknown directive nameyaml: unmarshal errors: %sexceeded max recursion depthcannot encode %d in %d bytesinvalid Connection ID length, ECT0: %d, ECT1: %d, CE: %dinvalid P224Element encodinginvalid P256Element encodinginvalid P384Element encodinginvalid P521Element encodingexpected newline but got %#Uinvalid character in commentcan't happen: encode type %sgob: cannot encode nil valuemismatching end group markermissing Go struct field for invalid Message.NewField on failed to parse client configTCP transparent proxy connectUDP transparent proxy connectHYSTERIA_DISABLE_UPDATE_CHECKfailed to parse server configfailed to serve traffic statsx509: unsupported time formatx509: cannot parse URI %q: %sx509: malformed serial numberx509: cannot parse dnsName %qmismatched local address typeunknown IP protocol specified45474735088646411895751953125Time.UnmarshalBinary: no data two_word_flags+=("--%s") must_have_one_noun+=(%q) Eq called on unsupported typeCommand %q is deprecated, %s required flag(s) "%s" not setsearching for config in pathsinvalid type %T for bandwidthPSK must be at least %d bytessyntax error scanning booleanTLS_RSA_WITH_3DES_EDE_CBC_SHAtls: too many ignored recordstls: invalid NextProtos valuetls: invalid server key sharetls: invalid client key sharetls: invalid session encodingunknown certificate authorityhttp2: client conn not usableMon, 02 Jan 2006 15:04:05 GMTapplication/vnd.ms-fontobjecthttp: idle connection timeoutMon, 02 Jan 2006 15:04:05 MSTMon, 02-Jan-2006 15:04:05 MSTinternal error: took too muchframe_pushpromise_zero_streamframe_pushpromise_pad_too_bigaccess-control-expose-headersaccess-control-request-methodmethod %q must be GET or HEADhttp2: client connection lostHTTP/1.1 %d %s: %s%s%d %s: %shttp: panic serving %v: %v %sNon-Authoritative InformationProxy Authentication RequiredUnavailable For Legal Reasonsdup idle pconn %p in freelistcould not save account %v: %vreplaced certificate in cachereloading managed certificate%s: obtaining certificate: %w[%s] Renew: saving assets: %vdeleting certificate file: %vrenewing managed certificatesno URL to issuing certificateHTTP request failed; retryingunrecognized order status: %sQUICConfig.MaxIncomingStreamscrypto/rsa: invalid exponentsinteger not minimally-encodedzero length OBJECT IDENTIFIER20060102150405.999999999Z0700pkcs12: odd-length BMP stringcrypto/aes: invalid key size crypto/des: invalid key size io: read/write on closed pipereflect: Key of non-map type reflect: In of non-func type reflect.Value.OverflowComplex cannot be converted to type SIGPIPE: write to broken pipeSIGPWR: power failure restartneed padding in bucket (elem)runtime: mmap: access denied /cpu/classes/idle:cpu-seconds/cpu/classes/user:cpu-seconds/gc/heap/allocs-by-size:bytes/gc/stack/starting-size:bytesgc done but gcphase != _GCoffruntime: p.gcMarkWorkerMode= scanobject of a noscan objectruntime: marking free object addspecial on invalid pointerruntime: summary max pages = runtime: levelShift[level] = doRecordGoroutineProfile gp1=runtime: sudog with non-nil cgfput: bad status (not Gdead)semacquire not on the G stackruntime: split stack overflowstring concatenation too longinvalid function symbol tableinvalid length of trace eventruntime: traceback stuck. pc=runtime: impossible type kindreflect: Out of non-func type): prefix length out of rangetoo many open files in systemnumerical result out of rangemachine is not on the networkprotocol family not supportedoperation already in progressno XENIX semaphores availablenil data; no entry for key %qcannot 3-index slice a stringunable to cast negative valueinvalid decode hook signaturecannot parse '%s' as uint: %scannot parse '%s' as bool: %s'%s' expected a map, got '%s'bufio.Scanner: token too longpadding contained in alphabetinvalid syntax at line %d: %sSwitching to QUIC version %s.GSO failed when sending to %snumOutStandingFrames negativeChanging connection ID to %s.Setting DF for IPv4 and IPv6.missing QUIC Datagram supportinvalid header field name: %qcould not flush to stream: %shttp3: no Host in request URLcrypto/rc4: invalid key size mime: invalid boundary lengthmime: invalid media parametertoo many compression pointersoverflow unpacking APL prefixexec: Wait was already called%s: map must have string keysmissing closing key quote: %sinvalid timezone offset hoursfloat cannot start with a dotcannot assign boolean to a %talias value must not be emptywhile parsing a block mappingwhile parsing a flow sequenceunexpected low surrogate areacannot decode %s `%s` as a %swhile increasing indent leveldid not find the expected '>'did not find expected tag URIwhile scanning a block scalarwhile parsing a quoted scalarwhile scanning a plain scalardescriptor mismatch: %v != %vBUG: internal error (unknown)java_generate_equals_and_hashtext too long to encode as QRRetrySourceConnectionID: %s, newly acked packets (%d): %ddidn't drop initial correctlyrest when unpacking token: %dpoly1305: unexpected overflowinvalid character class rangearray cannot start with commainvalid escaped character %#Utoml: table %s already existsgob: encoder: message too bigfile %q is already registerednon-contiguous repeated fieldmismatching extension lengthsinvalid type: got %v, want %v%T does not implement Marshalfield %v has invalid type: %vunexpect encryption level: %ssyntax error (line %d:%d): %vfailed to parse CA certificatecannot bind both IP and devicex509: invalid ECDSA parametersx509: SAN dNSName is malformedx509: malformed issuerUniqueIDinvalid network interface name227373675443232059478759765625strings: negative Repeat countyear outside of range [0,9999] must_have_one_flag+=("--%s has_completion_function=1 command_aliases+=(%q) Config File %q Not Found in %qMultiple errors without a key.TLS_ECDHE_RSA_WITH_RC4_128_SHAprotocol version not supportedlooking for beginning of valuein exponent of numeric literalMonday, 02-Jan-06 15:04:05 MSThttp: named cookie not presentnegative content size computedstream error: stream ID %d; %vframe_settings_ack_with_lengthillegal window increment valueHEADERS frame with stream ID 0frame_continuation_zero_streamhttp2: decoded hpack field %+vrunning on the wrong goroutineaccess-control-request-headershttp2: panic serving %v: %v %spersistConn was already in LRUremoved certificate from cache[%s] Obtain: saving assets: %vdeleting test key from storagedeleting site asset folder: %vno certificate resources founddecoding lockfile contents: %wOCSP response needs refreshingattempting certificate renewalgetting issuer certificate: %vreading issuer certificate: %vparsing issuer certificate: %vsync: inconsistent mutex statesync: unlock of unlocked mutexcrypto/rsa: verification errorasn1: cannot marshal nil valuesquare root of negative number/godebug/non-default-behavior/reflect: Elem of invalid type reflect: Out of non-func type reflect: unexpected GC programMapIter.Key called before NextSIGUSR1: user-defined signal 1SIGUSR2: user-defined signal 2SIGVTALRM: virtual alarm clockSIGPROF: profiling alarm clockruntime: bad g in cgocallback (types from different scopes)failed to get system page sizeassignment to entry in nil mapruntime: found in object at *( in prepareForSweep; sweepgen /cpu/classes/total:cpu-seconds/gc/cycles/automatic:gc-cycles/sync/mutex/wait/total:secondsruntime: epollctl failed with freedefer with d._panic != nilpanic called with nil argumentcheckdead: inconsistent countsrunqputslow: queue is not fullruntime: bad pointer in frame invalid pointer found on stack locals stack map entries for abi mismatch detected between runtime: impossible type kind unsafe.Slice: len out of rangereflect: Len of non-array typetrailing garbage after addressinappropriate ioctl for devicesocket operation on non-socketprotocol wrong type for socketMon Jan 02 15:04:05 -0700 2006cannot parse '%s' as float: %sGot NegotiationReply: %#v %#v build local socket address: %snegative packetBuffer refCountpacketBuffer refCount not zerounexpected PATH_RESPONSE frametoo many gaps in received dataError sending Retry packet: %sGODEBUG: unknown cpu feature "subtle.XORBytes: dst too shortmultipart/form-data; boundary=missing validateFirstLine funcmime: duplicate parameter nametext/javascript; charset=utf-8urn:ietf:params:acme:error:dnsurn:ietf:params:acme:error:tlstrailing data in OCSP responseunsupported critical extensiondomain must be fully qualifiedoverflow unpacking APL addressunterminated raw quoted string{{continue}} outside {{range}}transform: short source bufferline `%s` doesn't match format(\\)?(\$)(\{?([A-Z0-9_]+)?\}?)%s: unknown type for string %Tfloat cannot be assigned to %sunknown anchor '%s' referencedtag handle must start with '!'anchor value must not be emptyfound duplicate %TAG directivewhile parsing a %TAG directivedid not find URI escaped octetwhile scanning a quoted scalarfound unexpected end of streamfound unknown escape characterApplication error %#x (%s): %snot implemented on android/armKey() is not supported on a %smissing keyKind string mappingunaddressable value of type %stype %s has no exported fieldsattempt to register empty nameoverlapping ranges: %v with %vtype mismatch: got %T, want %vinvalid character %q in stringTCP transparent proxy listeningUDP transparent proxy listeninga certificate cache is requiredx509: malformed GeneralizedTimex509: invalid basic constraintsx509: malformed tbs certificatex509: malformed subjectUniqueIDinvalid elliptic key public keyx509: certificate is valid for encoding/hex: invalid byte: %#Uinvalid network interface indexsotypeToNet unknown socket typepattern contains path separator11368683772161602973937988281255684341886080801486968994140625time: missing unit in duration # ex: ts=4 sw=4 et filetype=sh ShellCompDirectiveFilterFileExtdisable completion descriptionstrying to resolve absolute pathOnly GET and PUT are supported.address family not IPv4 or IPv6fmt: unknown base; can't happentls: no certificates configuredtls: unsupported public key: %TTLS_RSA_WITH_AES_128_GCM_SHA256TLS_RSA_WITH_AES_256_GCM_SHA384TLS_RSA_WITH_AES_128_CBC_SHA256failed to parse certificate: %wTLS: sequence number wraparoundCLIENT_HANDSHAKE_TRAFFIC_SECRETSERVER_HANDSHAKE_TRAFFIC_SECRETtls: failed to sign handshake: bad certificate status responsejson: invalid number literal %qin literal true (expecting 'r')in literal true (expecting 'u')in literal true (expecting 'e')in literal null (expecting 'u')in literal null (expecting 'l')expected colon after object keymultipart/byteranges; boundary=http2: connection error: %v: %vframe_headers_prio_weight_shortPRIORITY frame with stream ID 0too many authentication methodsRequested Range Not SatisfiableRequest Header Fields Too LargeNetwork Authentication Requiredtoo many transfer encodings: %qnet/http: TLS handshake timeoutunable to acquire lock '%s': %vissuer %d (%s) is not a Revokerno certificates found in bundleloaded certificate from storageforcefully renewing certificateunexpected status code: HTTP %dJSON-decoding response body: %w{"e":"%s","kty":"RSA","n":"%s"}UDP not supported by HTTP proxybindIP4 must be an IPv4 addressbindIP6 must be an IPv6 addressapplication/json; charset=utf-8crypto/ecdh: invalid public keycrypto/rsa: invalid prime valuereflect: Len of non-array type reflect.MakeSlice: negative lenreflect.MakeSlice: negative capslice bounds out of range [:%x]slice bounds out of range [%x:]SIGSEGV: segmentation violationinternal error - misuse of itab) not in usable address space: runtime: cannot allocate memorycheckmark found unmarked object/memory/classes/heap/free:bytes/memory/classes/os-stacks:bytespacer: sweep done at heap size non in-use span in unswept listcasgstatus: bad incoming valuesresetspinning: not a spinning mentersyscallblock inconsistent fatal: bad g in signal handler runtime: split stack overflow: ...additional frames elided... unsafe.String: len out of rangereflect: NumIn of non-func typezone must be a non-empty string.lib section in a.out corruptedcannot assign requested addressmissing argument for comparisonrange over send-only channel %vvalue has type %s; should be %sMon, 02 Jan 2006 15:04:05 -0700Sent NegotiationReply: %#v %#v GeoIP country code %s not foundreceived a HANDSHAKE_DONE frameunexpected encryption level: %scannot use GSO with a basicConncannot use ECN with a basicConnaccount status is not valid: %sgetting authorization at %s: %wdns: reading random id failed: overflow unpacking domain namesunrecognized APL address familydns: svcbalpn: alpn-id too longmergeRuneSets odd length []runeunterminated character constantline `%s` has an unset variableinvalid timezone offset minutescouldn't parse octal number: %wcannot store a table in a slice2006-1-2T15:4:5.999999999Z07:002006-1-2t15:4:5.999999999Z07:00found duplicate %YAML directiveincomplete UTF-8 octet sequencewhile scanning a %TAG directivefield %v contains invalid UTF-8cannot reset invalid %v messageno_standard_descriptor_accessorclient sent a preferred_address Ignoring all packets below %d.didn't drop handshake correctlysession ticket keys unavailablettl=%d src=%v dst=%v ifindex=%dreflect.Value has no flag fieldheredoc doesn't contain newlinewindows new line should be \r\ncannot call BytesRange with niltoml: key %s is already definedencodeReflectValue: nil elementcannot parse reserved wire typeinvalid Go type %v for field %v%T does not implement Unmarshalfailed to initialize logger: %s https://acme.zerossl.com/v2/DV90/etc/pki/tls/certs/ca-bundle.crtx509: unsupported elliptic curvex509: invalid constraint value: x509: malformed subjectPublicKeyx509: invalid private key lengthx509: cannot parse rfc822Name %qx509: ECDSA verification failurex509: unknown extended key usagex509: unknown SignatureAlgorithmgo package net: addrLookupOrder(go package net: hostLookupOrder(28421709430404007434844970703125: day-of-year does not match day flags_with_completion+=(%q) __%s_handle_subdirs_in_dir_flag must_have_one_flag+=("-%s") TLS_ECDHE_ECDSA_WITH_RC4_128_SHAchacha20poly1305: bad key lengthtls: unknown Renegotiation valuetls: NextProtos values too largetls: Start called more than oncetls: failed to parse private keyin literal false (expecting 'a')in literal false (expecting 'l')in literal false (expecting 's')in literal false (expecting 'e')invalid range: failed to overlapframe_windowupdate_zero_inc_connaccess-control-allow-credentialsuse of closed network connectionhttp2: server ignoring frame: %vread limit of %d bytes exhaustedwaiting on internal rate limitercertificate renewed successfullyfell back to default certificate[ERROR] key auth HTTP server: %vone usage of each socket addresspanic: http solver server: %v %spanic: certificate worker: %v %ssync: Unlock of unlocked RWMutexsync: negative WaitGroup countercrypto/ecdh: invalid private keyecdsa: internal error: r is zeroecdsa: internal error: s is zeroed25519: bad public key length: integer is not minimally encodedcannot represent time as UTCTimecrypto/aes: input not full blockcrypto/des: input not full blockreflect: NumIn of non-func type reflect.MapOf: invalid key type MapIter.Value called before Nextreflect.Value.Grow: negative lenslice bounds out of range [::%x]slice bounds out of range [:%x:]slice bounds out of range [%x::]SIGFPE: floating-point exceptionSIGTTOU: background write to tty (types from different packages)runtime: fixalloc size too largeinvalid limiter event type foundscanstack: goroutine not stoppedscavenger state is already wiredsweep increased allocation countremovespecial on invalid pointerruntime: root level max pages = _cgo_pthread_key_created missingruntime: sudog with non-nil elemruntime: sudog with non-nil nextruntime: sudog with non-nil prevruntime: mcall function returnednon-Go code disabled sigaltstackruntime: newstack called from g=runtime: stack split at bad timepanic while printing panic valuereflect: NumOut of non-func typeunexpected character, want colonresource temporarily unavailablenumerical argument out of domainsoftware caused connection abortdnsmessage.ResourceHeader{Name: dnsmessage.CNAMEResource{CNAME: dnsmessage.AResource{A: [4]byte{unable to parse %s as net.IPMaskbufio: invalid use of UnreadBytebufio: invalid use of UnreadRunebufio: tried to fill full buffervalue doesn't fit into 62 bits: can't determine encryption levelRetiring connection ID %s in %s.peer attempted to open stream %dSetting up connection failed: %s" not supported for cpu option "mime: invalid boundary characterunexpected multi-line response: mime: expected token after slash ; DNSSEC ALGORITHM UNDERSTOOD: string exceeded 255 bytes in txtinput overflows the modulus sizemalformed character constant: %sreadPythonMultilines: parsing %qValue %d for key %s out of rangedate time should have a timezonecouldn't parse binary number: %wwhile parsing a block collectiondid not find expected ',' or ']'did not find expected ',' or '}'found incompatible YAML documentincomplete UTF-16 surrogate pairwhile scanning a %YAML directivedid not find expected whitespacemultiple ,inline maps in struct invalid packet number length: %dinvalid connection ID length: %dnon-sequential packet number use lost packet %d (time threshold)unexpected read encryption levelchacha20: invalid buffer overlapABCDEFGHIJKLMNOPQRSTUVWXYZ2345670123456789ABCDEFGHIJKLMNOPQRSTUVexpected: IDENT | STRING got: %sunimplemented Value for type: %sbasic string not terminated by "bootstrap type already present: variable length integer overflowgoogle/protobuf/field_mask.protogoogle/protobuf/descriptor.protoweak message %v is not linked in%v already implements proto.Enumfield %v has invalid nil pointerexceeded maximum recursion depthunexpected null character (0x00)could not parse value for %v: %qgf256: invalid check byte lengthinvalid escape code %q in stringuse this URI to share your serverapplication/x-www-form-urlencodedx509: invalid RSA public exponentx509: SAN rfc822Name is malformedx509: invalid extended key usagesgo package net: confVal.netCgo = 142108547152020037174224853515625710542735760100185871124267578125Called Execute() on a nil Commandattempting to read in config fileno encoder registered for name %qQUICConfig.MaxStreamReceiveWindowbytes.Buffer.Grow: negative counttls: failed to write to key log: tls: invalid server finished hashtls: invalid client finished hashtls: unexpected ServerKeyExchangetls: unknown public key algorithmpseudo header field after regularhttp2: recursive push not allowedhttp: invalid Read on closed Bodynet/http: skip alternate protocolhttp: CloseIdleConnections calledhttp: invalid or unsafe file pathhttp: error reading directory: %vinvalid header field value for %qpad size larger than data payloadframe_pushpromise_promiseid_shorthttp2: invalid pseudo headers: %vinvalid concurrent Body.Read callhttp: multiple registrations for connection not allowed by rulesetinvalid username/password versionunsupported transfer encoding: %qcertificate obtained successfullyencoding certificate metadata: %vdecoding certificate metadata: %vno certificate available for '%s'cleaning up embedded provider: %vchecking authorization status: %wapplication/pem-certificate-chainno IPv4 or IPv6 address availablecrypto: requested hash function #bytes.Reader.Seek: invalid whencesync: RUnlock of unlocked RWMutexSigEd25519 no Ed25519 collisionsSigEd25519 no Ed25519 collisionsed25519: bad private key length: indefinite length found (not DER)struct contains unexported fieldscrypto/aes: output not full blockcrypto/des: output not full blockskip everything and stop the walkreflect: slice index out of rangereflect: NumOut of non-func type of method on nil interface valuereflect: Field index out of rangereflect: array index out of rangereflect.Value.Equal: invalid Kind to pointer to array with length slice bounds out of range [%x:%y]SIGCHLD: child status has changedSIGTTIN: background read from ttySIGXFSZ: file size limit exceededruntime: memory allocated by OS [misrounded allocation in sysAllocconcurrent map read and map write/cpu/classes/gc/pause:cpu-seconds/cpu/classes/gc/total:cpu-seconds/gc/limiter/last-enabled:gc-cycle/memory/classes/heap/stacks:bytes/memory/classes/heap/unused:bytesmin must be a non-zero power of 2runtime: failed mSpanList.insert runtime: epollcreate failed with runtime: castogscanstatus oldval=stoplockedm: inconsistent lockingfindrunnable: negative nmspinningfreeing stack not in a stack spanstackalloc not on scheduler stackruntime: goroutine stack exceeds runtime: text offset out of rangetimer period must be non-negativeruntime: name offset out of rangeruntime: type offset out of rangetoo many levels of symbolic linkstoo many Answers to pack (>65535)dnsmessage.SRVResource{Priority: dnsmessage.UnknownResource{Type: waiting for unsupported file typeflag accessed but not defined: %sunknown shorthand flag: %q in -%sflag needs an argument: %q in -%s%s must be formatted as key=valueincompatible types for comparisoncannot index slice/array with nil'%s' expected type '%s', got '%s'decoder not found for this formatinvalid value %q for flag -%s: %vClosing connection with error: %sNo compatible QUIC version found.sendQueue.Send would have blockedinvalid value for H3_DATAGRAM: %dinvalid request pseudo header: %speer sent an unexpected frame: %TGODEBUG: no value specified for "solving challenges: %w (order=%s)unsupported issuer hash algorithmdns: bad MatchingType or Selectoroverflow packing uint64 as uint48overflow unpacking signed messagescalar has high bit set illegallyunaligned 64-bit atomic operationkey-value delimiter not found: %sinvalid timezone offset charactercouldn't parse decimal number: %wnumber cannot end with underscoreanchor '%s' value contains itselfexpected nothing after STREAM-ENDwhile scanning for the next tokenreceived ACK for an unsent packetunexpected write encryption levelerror creating new AES cipher: %sleafCounts[maxBits][maxBits] != nregexp: unhandled case in compileslice offset larger than int (%d)no support for proto1 weak fieldsinvalid SetUnknown on nil Messagecould not format value for %v: %vno support for proto1 MessageSetsfailed to serve masquerade HTTP(S)/etc/ssl/certs/ca-certificates.crtadding nil Certificate to CertPoolx509: unknown public key algorithmx509: invalid certificate policies%s %q is excluded by constraint %qx509: Ed25519 verification failurex509: unhandled critical extension3552713678800500929355621337890625: day-of-year does not match monthcobra_annotation_flag_set_by_cobraCommand can't be a child of itselfexpected an RSA public key, got %TTLS_ECDHE_RSA_WITH_AES_128_CBC_SHATLS_ECDHE_RSA_WITH_AES_256_CBC_SHAconnection doesn't support Ed25519tls: malformed key_share extensionTLS 1.3, server CertificateVerifyTLS 1.3, client CertificateVerifyfailed to construct HKDF label: %sin \u hexadecimal character escapeexpected comma after array elementtimeout waiting for client prefacehttp2: aborting request body writehttp: connection has been hijackedhttp: persistConn.readLoop exitinghttp: read on closed response bodystream error: stream ID %d; %v; %vframe_settings_window_size_too_bigframe_windowupdate_zero_inc_streamnewWriterAndRequestNoBody(%+v): %vhttp: MultipartReader called twicehttp: invalid Content-Length of %qBaseContext returned a nil contextunsupported authentication method looking up account with server: %vDo you agree to the terms? (y/n): certificate should not be obtainedrenewing and reloading certificatelooking up info for HTTP challengemaxEvents cannot be less than zerofetching new nonce from server: %wcrypto/rsa: missing public modulusinvalid padding bits in BIT STRINGcrypto/aes: invalid buffer overlapcrypto/des: invalid buffer overlapreflect: Method index out of rangereflect: ChanDir of non-chan type reflect: Field of non-struct type reflect: Field index out of boundsreflect.FuncOf: too many argumentsreflect.StructOf: duplicate field " is anonymous but has PkgPath setreflect: string index out of rangereflect: recv on send-only channelreflect: send on recv-only channelreflect.Value.Grow: slice overflowslice bounds out of range [:%x:%y]slice bounds out of range [%x:%y:]SIGURG: urgent condition on socketout of memory allocating allArenas/memory/classes/heap/objects:bytesruntime.SetFinalizer: cannot pass too many pages allocated in chunk?mspan.ensureSwept: m is not lockedruntime: netpollBreak write failedforEachP: sched.safePointWait != 0schedule: spinning with local workruntime: standard file descriptor runtime: g is running but p is notdoaddtimer: P already set in timertoo many references: cannot spliceFlag --%s has been deprecated, %s can't evaluate field %s in type %scan't handle %s for arg of type %svalue is nil; should be of type %scannot squash non-struct type '%s'flag provided but not defined: -%sillegal base64 data at input byte set socket option: SO_NONBLOCK: %sparsing socket control message: %sError sending CONNECTION_CLOSE: %sRestoring Transport Parameters: %sProcessed Transport Parameters: %smissing retry_source_connection_idListening for %s connections on %sheader field is not lower-case: %sinvalid response pseudo header: %scrypto/rc4: invalid buffer overlapempty NSEC(3) block in type bitmaprepeated SVCB keys are not allowedsigner name doesn't match key nameexecutable file not found in $PATH%s: unsupported type to struct: %s%s: %s asked for 'key', impossiblehandleValue not implemented for %sdid not find expected node contentinvalid length of a UTF-8 sequencecontrol characters are not allowedchacha20: wrong HChaCha20 key sizeillegal base32 data at input byte invalid nested repetition operatorinvalid or unsupported Perl syntaxbad tag in lazy extension decodingmismatching field: got %v, want %vtraffic stats server up and runningx509: malformed extension OID fieldx509: wrong Ed25519 public key sizex509: invalid authority info accessx509: failed to marshal curve OID: encoding/hex: odd length hex string1776356839400250464677810668945312588817841970012523233890533447265625ryuFtoaFixed32 called with prec > 9strings.Reader.Seek: invalid whence2006-01-02T15:04:05.999999999Z07:00non-positive interval for NewTicker__%[1]s_handle_go_custom_completioncobra_annotation_mutually_exclusivemissing EncodeTime in EncoderConfigunsigned integer overflow on token unsupported signature algorithm: %vTLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHAtls: too many non-advancing recordstls: server selected an invalid PSKtls: invalid or missing PSK bindershttp: server closed idle connectionCONTINUATION frame with stream ID 0Prohibited TLS 1.2 Cipher Suite: %xhttp2: server: client %v said hellohttp2: server processing setting %vWrite called after Handler finishedcertificate for '%s' is not managedpresenting with embedded solver: %vdirectory missing newNonce endpointurn:ietf:params:acme:error:badNonceserver rejected our nonce; retryingtraffic logger requested disconnectbigmod: modulus is smaller than natsuperfluous leading zeros in length'_' must separate successive digitscrypto/md5: invalid hash state sizeisReflexive called on non-key type " is unexported but missing PkgPathreflect.MakeSlice of non-slice typepersistentalloc: align is too large/memory/classes/heap/released:bytesgreyobject: obj not pointer-alignedmismatched begin/end of activeSweepmheap.freeSpanLocked - invalid freeattempt to clear non-empty span setruntime: close polldesc w/o unblockruntime: inconsistent read deadlinefindrunnable: netpoll with spinningpidleput: P has non-empty run queuetraceback did not unwind completelyruntime: cannot open /dev/log/mainnetwork dropped connection on resettransport endpoint is not connectedtoo many Questions to pack (>65535)file type does not support deadlineinvalid argument %q for %q flag: %vexpected unsigned integer; found %snon-comparable types %s: %v, %s: %v%s: unsupported type for squash: %sGot Reply: %#v %#v %#v %#v %#v %#v set socket option: SO_REUSEADDR: %sclose called for canceled stream %dcrypto/blake2b: cannot marshal MACsform-data; name="%s"; filename="%s"mime: bogus characters after %%: %qhpack: invalid Huffman-encoded datadynamic table size update too largeoverflow unpacking uint64 as uint48dns: TSIG not last RR in additionalonly standard queries are supportedtruncated messages aren't supportedP224 point is the point at infinityP256 point is the point at infinityP384 point is the point at infinityP521 point is the point at infinityrange can only initialize variablestransform: short destination buffer%s: unknown kind to decode into: %s%s: not an object type for map (%T)nanoseconds need at least one digitnumber cannot start with underscoretoml: cannot encode a nil interfaceshould not be called with empty keynumber %f does not fit in a float32must set the input source only oncedid not find expected '-' indicatorfound extremely long version numberfound unexpected document indicatortimeout: no recent network activity %s &wire.NewTokenFrame{Token: %#x}%d exceeds the maximum stream countclient sent a stateless_reset_tokendidn't expect ECN to be unsupported0-RTT not allowed. Rejecting 0-RTT.unknown session ticket revision: %dmax-age=31536000; includesubdomainschacha20: output smaller than inputflate: corrupt input before offset basic strings cannot have new linesfile %q has a name conflict over %vfound wrong type: got %v, want enumstring field contains invalid UTF-8%v already implements proto.Messageunimplemented HCLToken for type: %sdelimiters may only be "{}" or "<>"x509: zero or negative DSA parameterx509: invalid CRL distribution pointx509: invalid subject key identifierx509: malformed algorithm identifierx509: invalid X25519 private key: %vx509: serial number must be positive444089209850062616169452667236328125ryuFtoaFixed64 called with prec > 180123456789abcdefghijklmnopqrstuvwxyzstrings.Builder.Grow: negative countstrings: Join output length overflowTime.UnmarshalBinary: invalid length__%s_handle_filename_extension_flag Completion ended with directive: %s could not discover absolute path: %winvalid semicolon separator in querysyntax error scanning complex numberexpected an ECDSA public key, got %TTLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHATLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHAtls: keys must have at least one keyunsupported SSLv2 handshake receivedtls: server did not send a key sharejson: encoding error for type %q: %qhttp: no Location header in responsehttp: unexpected EOF reading trailerhttp: invalid byte %q in Cookie.Path LastStreamID=%v ErrCode=%v Debug=%qhttp2: server rejecting conn: %v, %sHeader called after Handler finishedRoundTrip retrying after failure: %vJanFebMarAprMayJunJulAugSepOctNovDecno acceptable authentication methodsHijack failed on protocol switch: %v%s: insecure CA URL (HTTPS required)%s: could not make path relative: %vcustom certificate selection resultsmaintaining newly-loaded certificateusing externally-managed certificatepanic: tls-alpn solver server: %v %scomputing account JWK thumbprint: %vbytes: Repeat output length overflowbytes.Reader.ReadAt: negative offsetbytes.Reader.Seek: negative positionno assembly implementation availableIA5String contains invalid charactercrypto/cipher: input not full blocksmethod ABI and value ABI don't alignreflect.Value.Equal: values of type lfstack node allocated from the heap) is larger than maximum page size (key size not a multiple of key alignruntime: invalid typeBitsBulkBarrieruncaching span but s.allocCount == 0/memory/classes/metadata/other:bytesuser arena span is on the wrong listruntime: marked free object in span runtime: unblock on closing polldescruntime: inconsistent write deadlineruntime: sudog with non-nil waitlinkruntime: mcall called on m->g0 stackstartm: P required for spinning=true) is not Grunnable or Gscanrunnable runtime: bad notifyList size - sync=signal arrived during cgo execution accessed data from freed user arena runtime: wrong goroutine in newstackruntime: invalid pc-encoded table f=crypto/sha1: invalid hash state sizecrypto/sha512: invalid hash functionreflect: NumField of non-struct typeaccessing a corrupted shared librarycompressed name in SRV resource dataexceeded maximum template depth (%v)%s is not a method but has argumentswrong number of args: got %d want %dinternal error: associate not commonunable to cast %#v of type %T to intcannot parse '%s', %d overflows uintcannot parse '%s', %f overflows uintinvalid boolean value %q for -%s: %vGot NegotiationRequest: %#v %#v %#v Sent Reply: %#v %#v %#v %#v %#v %#v build destination socket address: %sDestroying connection with error: %sDropping Version Negotiation packet.Increased send buffer size to %d kiBcrypto/rand: argument to Int is <= 0mime: SetBoundary called after writemalformed MIME header initial line: waiting for solver before continuinginitiating challenge with server: %wPrivate-key-format: v1.3 Algorithm: address and mask lengths don't matchoverflowing unpacking signed messageedwards25519: invalid point encodinginvalid pattern syntax (+ after -): %s: cannot decode into interface: %Ttoml: cannot encode value of type %smust set the output target only onceunknown problem parsing YAML contentdocument contains excessive aliasingdid not find expected did not find expected version numbercannot merge into invalid %v messagestream data overflows maximum offsetmissing initial_source_connection_idInstalled 0-RTT Read keys (using %s)Installed 1-RTT Read keys (using %s)chacha20: wrong HChaCha20 nonce sizerange length is larger than capacitygoogle/protobuf/source_context.proto%v: MessageSet with no unknown fieldinvalid characters in heredoc anchorinvalid hex escape code %q in stringmust specify one and only one addressmasquerade HTTP server up and runningx509: malformed extension value fieldx509: RSA key missing NULL parametersx509: invalid CRL distribution pointsx509: unsupported private key versionx509: invalid Ed25519 private key: %vx509: unsupported public key type: %T2220446049250313080847263336181640625timezone hour outside of range [0,23]QUICConfig.InitialStreamReceiveWindowQUICConfig.MaxConnectionReceiveWindowcannot create context from nil parenttls: unsupported certificate key (%T)TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256tls: failed to verify certificate: %scrypto: Size of unknown hash functionbytes.Buffer: truncation out of rangehttp: invalid byte %q in Cookie.Valueunexpected CONTINUATION for stream %dhttp2: Transport sending health checkhttp2: Transport health check successRoundTrip on uninitialized ClientConnhttp2: server encoding header %q = %qhttp: TLS handshake error from %s: %vcould not save account to storage: %vaccount pre-registration callback: %vdone waiting on internal rate limiterunable to parse PEM certificate chaincertificate already exists in storagecould not get certificate from issuerserved key authentication certificatedefault certificate selection resultsrenewing certificate on-demand failedpanic: tls-alpn solver handler: %v %scrypto/ecdh: invalid private key sizecrypto/rsa: public exponent too smallcrypto/rsa: public exponent too largesubtle: slices have different lengthscrypto/rsa: unsupported hash functionbigmod: internal error: shrinking natexplicitly tagged member didn't matchout does not point to an integer typecipher: message authentication failedcrypto/cipher: invalid buffer overlapcrypto/cipher: incorrect GCM tag sizegodebug: unexpected IncNonDefault of reflect: Bits of non-arithmetic Type reflect: NumField of non-struct type reflect: IsVariadic of non-func type needKeyUpdate called on non-key type reflect: funcLayout of non-func type reflect.Value.Bytes of non-byte slicereflect.Value.Bytes of non-byte arrayreflect.Value.Bytes of non-rune slicemethod ABI and value ABI do not alignreflect.Value.Convert: value of type runtime: allocation size out of range) is smaller than minimum page size (/cpu/classes/gc/mark/idle:cpu-secondssetprofilebucket: profile already setfailed to reserve page summary memoryruntime: netpoll: break fd ready for _cgo_notify_runtime_init_done missingstartTheWorld: inconsistent mp->nextpruntime: unexpected SPWRITE function all goroutines are asleep - deadlock!value too large for defined data typecannot exec a shared library directlyoperation not possible due to RF-killtoo many Authorities to pack (>65535)too many Additionals to pack (>65535)dnsmessage.TXTResource{TXT: []string{%q is an incomplete or empty templatedereference of nil pointer of type %scannot index slice/array with type %sunable to cast %#v of type %T to Timeunable to cast %#v of type %T to boolunable to cast %#v of type %T to uintparse error on line %d, column %d: %vvariable value type must be a pointerSent NegotiationRequest: %#v %#v %#v Got Request: %#v %#v %#v %#v %#v %#v set socket option: IP_TRANSPARENT: %sPeer closed connection with error: %smessage too large (maximum: %d bytes)Error sending INVALID_TOKEN error: %sError sending Version Negotiation: %speer attempted to open send stream %dTemporary error reading from conn: %wuse of http3.Server without TLSConfiginvalid header field value for %s: %qopening the control stream failed: %wchacha20poly1305: plaintext too largewaiting for solver %T to be ready: %wurn:ietf:params:acme:error:connectionNSEC(3) block too long in type bitmapdns: svcbalpn: alpn array overflowingexec: StdinPipe after process startedbisect.Hash: unexpected argument typecomment ends before closing delimiterunrecognized character in action: %#Ucouldn't parse hexadecimal number: %wcannot have underscore after exponentcannot store TOML string into a Go %sexpected DOCUMENT-START or STREAM-ENDcannot parse invalid wire-format data%s not allowed at encryption level %sInstalled 0-RTT Write keys (using %s)Installed 1-RTT Write keys (using %s)unexpected write encryption level: %sPeer confirmed key update to phase %dInitiating key update to key phase %dinvalid character at start of key: %cliteral strings cannot have new linestype not registered for interface: %sgob NewTypeObject can't handle type: GOLANG_PROTOBUF_REGISTRATION_CONFLICTshow QR code for server config sharingno certificate matches the pinned hashfailed to send ZeroSSL EAB request: %wmasquerade HTTPS server up and runningcrypto/sha256: invalid hash state sizex509: invalid subject alternative namex509: empty name constraints extensionx509: invalid authority key identifierx509: failed to parse EC private key: x509: cannot validate certificate for syscall: readInt with unsupported size1110223024625156540423631668090820312555511151231257827021181583404541015625strings.Reader.ReadAt: negative offsetstrings.Reader.Seek: negative positionstrings: Repeat output length overflownon-positive interval for Ticker.Resettime: missing Location in call to Date%s is not a valid port number or rangetls: invalid ClientKeyExchange messagetls: invalid ServerKeyExchange messageexpected an Ed25519 public key, got %Tinternal error: unknown signature typetls: server selected unsupported grouptls: unsupported signing key type (%T)tls: early_data without pre_shared_keytls: client sent unexpected early datatls: failed to sign ECDHE parameters: tls: server selected unsupported curvetls: missing ServerKeyExchange messagetls: internal error: unsupported curveafter decimal point in numeric literalfailed to parse Location header %q: %vhttp2: server connection from %v on %phttp: Accept error: %v; retrying in %vnet/http: invalid header field name %qregistering account %v with server: %wTLS handshake aborted by event handlerhandshake aborted by event handler: %wsuccessfully stapled new OCSP responsepanic: ring buffer rate limiter: %v %sinternal error: unknown string type %dasn1: Unmarshal recipient value is nilreflect: bad size computation in MapOfreflect.typeptrdata: unexpected type, reflect: Method on nil interface valueindex out of range [%x] with length %ym changed unexpectedly in cgocallbackgmakechan: invalid channel element typeinternal error: exit hook invoked exitunreachable method called. linker bug?concurrent map iteration and map writeelem size not a multiple of elem aligngcBgMarkWorker: blackening not enabledcannot read stack of running goroutineruntime: blocked read on free polldescunfinished open-coded defers in Goexitruntime: sudog with non-false isSelectarg size to reflect.call more than 1GBaddtimer called with initialized timercrypto/sha512: invalid hash state sizeIPv4 field has octet with leading zerocan not access a needed shared libraryinsufficient data for base length typetemplate: %s: executing %q at <%s>: %scan't give argument to non-function %sindirection through explicit nil in %sevalEmptyInterface: nil (can't happen)unable to cast %#v of type %T to int64unable to cast %#v of type %T to []intresult must be addressable (a pointer)error decoding json.Number into %s: %sflag %s set at %s before being definedSent Request: %#v %#v %#v %#v %#v %#v Could not determine native endianness.unexpected size for SETTINGS frame: %dhttp3: unsupported protocol scheme: %schacha20poly1305: ciphertext too largemime: expected slash after first tokenexec: StdoutPipe after process startedexec: StderrPipe after process startedinvalid P224 compressed point encodinginvalid P256 compressed point encodinginvalid P384 compressed point encodinginvalid P521 compressed point encoding%s: not an object type for struct (%T)readPythonMultilines: matched %d partserror creating new key: empty key nameextra bytes at the end of the timezonecannot have underscore before exponenttoml: number %d does not fit in an intline %d: cannot unmarshal %s%s into %sline %d: field %s not found in type %sdid not find expected could not find expected directive namefound an incorrect leading UTF-8 octetno support for message_set_wire_format%v: unable to resolve extension %v: %vtype mismatch: cannot convert %v to %sinvalid connection ID length: %d bytes lost packet %d (reordering threshold)negative number of outstanding packetsCryptoSetup: keys were already droppedReceived 0-RTT read key for the clientfailed to read session ticket revisionnested object expected: LBRACE got: %sobject expected closing RBRACE got: %sKind.String() not implemented for '%d'found wrong type: got %v, want messagename reference must be fully qualifiedinvalid field: no encoder for %v %v %vcannot encode %d bits into %d-bit codeinvalid octal escape code %q in stringfailed getting EAB credentials: HTTP %dcannot set both acl.file and acl.inlinex509: invalid subject alternative namesx509: invalid NameConstraints extensionx509: failed to parse URI constraint %qx509: failed to marshal private key: %vx509: unknown EC private key version %d because it doesn't contain any IP SANsx509: invalid elliptic curve public keyx509: signing with MD5 is not supportedx509: trailing data after X.509 Subjectgo package net: using cgo DNS resolver 2775557561562891351059079170227050781252006-01-02 15:04:05.999999999 -0700 MSTcobra_annotation_bash_completion_custom local_nonpersistent_flags+=("-%s") cobra_annotation_required_if_others_sethop interval must be at least 5 secondstls: unsupported certificate curve (%s)TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256tls: internal error: wrong nonce lengthno mutually supported protocol versionschain is not signed by an acceptable CAhttp: putIdleConn: keep alives disabledinvalid HTTP header value for header %qusername/password authentication failedcache full; evicting random certificateconverting identifier '%s' to ASCII: %vno certificate matching TLS ClientHellono OCSP server specified in certificateecdsa: unsupported curve by crypto/ecdhecdsa: public key point is the infinityed25519: bad Ed25519ph context length: crypto/rsa: invalid options for Decrypttags don't match (%d vs %+v) %+v %s @%dasn1: Unmarshal recipient value is nil math/big: buffer too small to fit valuecipher: incorrect tag size given to GCMreflect.MakeMapWithSize of non-map typeinternal error: exit hook invoked panicmismatched count during itab table copyout of memory allocating heap arena map/cpu/classes/gc/mark/assist:cpu-seconds/cpu/classes/scavenge/total:cpu-seconds/memory/classes/profiling/buckets:bytesmspan.sweep: bad span state after sweepruntime: blocked write on free polldescsuspendG from non-preemptible goroutineruntime: casfrom_Gscanstatus failed gp=stack growth not allowed in system calltraceback: unexpected SPWRITE function IPv4 field must have at least one digittransport endpoint is already connectedSetctty set but Ctty not valid in childsyscall.releaseForkLock: negative countdnsmessage.AAAAResource{AAAA: [16]byte{unable to cast %#v of type %T to uint64unable to cast %#v of type %T to uint32unable to cast %#v of type %T to stringextraneous or missing " in quoted-fieldcsv: invalid field or comment delimiterGot UserPassNegotiationReply: %#v %#v set socket option: IPV6_TRANSPARENT: %sdropped unexpected encryption level: %sIncreased receive buffer size to %d kiBError sending Stateless Reset to %s: %sinternal error: call to fastSource.Seedcrypto/blake2b: invalid hash state sizemultipart: can't write to finished partinvalid indexed representation index %dvalidations succeeded; finalizing orderno certificate chains offered by serverurn:ietf:params:acme:error:unauthorizedbad signature on embedded certificate: ;; OPT PSEUDOSECTION: ; EDNS: version comment length insufficient for parsingexec: environment variable contains NULcannot add shadow to another shadow keymissing closing key quote from %q to %qcannot store inline table in Go type %stoml: number %d does not fit in an int8cannot decode node with unknown kind %dunknown problem generating YAML contentcannot marshal invalid UTF-8 data as %scannot encode node with unknown kind %dfound an incorrect trailing UTF-8 octetdid not find expected hexdecimal number %s &wire.MaxDataFrame{MaximumData: %d} Setting ACK timer to max ack delay: %sUnmarshalling session ticket failed: %sReceived 0-RTT write key for the servermissing argument to repetition operatortrailing backslash at end of expressionunexpected token while parsing list: %sExpected object, got unknown token: %+vgob: cannot encode nil pointer of type can't represent recursive pointer type google.golang.org/genproto/protobuf/apigoogle.golang.org/protobuf/types/known/%v: MessageSet with no extensions fieldinvalid value: merging into nil messagefailed to creare ZeroSSL EAB request: %wx509: malformed extension critical fieldx509: cannot parse IP address of length %s %q is not permitted by any constrainterrors: target must be a non-nil pointertime: Stop called on uninitialized Timer13877787807814456755295395851135253906256938893903907228377647697925567626953125ryuFtoaFixed32 called with negative precports not allowed with file URLs: got %vclient doesn't support certificate curveoversized record received with length %dtls: received empty certificates messagetls: client didn't provide a certificatehttp2: timeout awaiting response headersFrame accessor called on non-owned Frameinternal error: expecting non-nil streamrequest header %q is not valid in HTTP/2http2: Transport encoding header %q = %qprotocol error: headers after END_STREAMwriteData(stream=%d, p=%d, endStream=%v)unrecognized or unsupported key type: %surn:ietf:params:acme:error:orderNotReadyed25519: bad Ed25519ctx context length: crypto/rsa: input must be hashed messagersa: internal error: inconsistent lengthNumericString contains invalid charactercannot represent time as GeneralizedTimecrypto/cipher: output smaller than inputcrypto/cipher: message too large for GCMreflect: FieldByName of non-struct type reflect: bad layout computation in MapOfreflect.Value.Call: call of nil functionreflect.Value.Call: wrong argument countattempted to copy pointer to FP registerMapIter.Key called on exhausted iteratorreflect.Value.SetBytes of non-byte slicereflect.Value.setRunes of non-rune sliceinvalid span in heapArena for user arenabulkBarrierPreWrite: unaligned argumentsruntime: typeBitsBulkBarrier with type refill of span with free space remaining/cpu/classes/scavenge/assist:cpu-secondsruntime.SetFinalizer: first argument is failed to acquire lock to reset capacitymarkWorkerStop: unknown mark worker modecannot free workbufs when work.full != 0runtime: out of memory: cannot allocate runtime: netpollBreak write failed with deferproc: d.panic != nil after newdefermust be able to track idle limiter eventaddress family not supported by protocolunable to cast %#v of type %T to float64Sent UserPassNegotiationReply: %#v %#v reading original destination address: %sauthentication error, HTTP status code: Dropping (potentially) duplicate packet.received NEW_TOKEN frame from the clientpeer attempted to open receive stream %dfailed to determine send buffer size: %wActivating reading of ECN bits for IPv4.Activating reading of ECN bits for IPv6.http3: invalid http header field name %qchacha20poly1305: invalid buffer overlapmultipart: unexpected line in Next(): %qmalformed MIME header: missing colon: %qevictOldest(%v) on table with %v entriesoverflowing NSEC(3) block in type bitmapedwards25519: use of uninitialized Pointfloat can have at most one decimal pointtoml: number %d does not fit in an int32toml: number %d does not fit in an int16line %d: field %s already set in type %sunsupported flag %q in tag %q of type %sreceived a stateless reset with token %xclient sent a retry_source_connection_idCannot drop keys for encryption level %sflow controller reset after reading datamismatching version. Got %d, expected %d0-RTT was rejected. Dropping 0-RTT keys.Installed Handshake Read keys (using %s)quotedprintable: invalid hex byte 0x%02xunicode point needs %d character, not %dtoml: key %s should be a table, not a %sfound wrong type: got %v, want extensionmessage %T is neither a v1 or v2 Messageinvalid type: no encoder for %v %v %v/%vinvalid Unicode escape code %q in stringx509: cannot parse URI %q: invalid domainunexpected call to os.Exit(0) during test34694469519536141888238489627838134765625strconv: illegal AppendInt/FormatInt basetime: Reset called on uninitialized Timertime: missing Location in call to Time.InTime.UnmarshalBinary: unsupported version help [path to command] for full details.Generate the autocompletion script for %snet/url: invalid control character in URLQUICConfig.InitialConnectionReceiveWindowtls: internal error: unsupported key (%T)tls: handshake has not yet been performedinvalid value length: expected %d, got %dtls: unsupported decryption key type (%T)tls: failed to parse client certificate: tls: internal error: failed to clone hashtls: internal error: unknown cipher suitetls: no supported elliptic curves offeredtls: internal error: empty verified chainwriteEndsStream called on nil writeFramerinvariant; can't close stream in state %vhttp2: server ignoring unknown setting %vCloseNotify called after Handler finishedWriteHeader called after Handler finishedhttp2: no cached connection was availablehttp2: Transport health check failure: %vhttp2: invalid Upgrade request header: %qtransport got GOAWAY with error code = %vmaking TLS-ALPN challenge certificate: %vserver does not support newAuthz endpointunrecognized Content-Type from server: %s{"crv":"%s","kty":"EC","x":"%s","y":"%s"}bytes.Buffer.WriteTo: invalid Write countbytes.Reader.WriteTo: invalid Write countasn1: internal error in parseTagAndLengthcrypto/md5: invalid hash state identifiercan't call pointer on a non-pointer Valuereflect: FieldByIndex of non-struct type reflect.Value.Addr of unaddressable valueMapIter.Next called on exhausted iteratorruntime: typeBitsBulkBarrier without type/memory/classes/metadata/mspan/free:bytesruntime.SetFinalizer: second argument is gcSweep being done but phase is not GCoffobjects added out of order or overlappingmheap.freeSpanLocked - invalid stack freemheap.freeSpanLocked - invalid span stateattempted to add zero-sized address rangeruntime: blocked read on closing polldescstopTheWorld: not stopped (stopwait != 0) closed, unable to open /dev/null, errno= received on thread with no signal stack colon must be followed by more characterssync/atomic: swap of nil value into Valuetrying to get %s value of flag of type %swrong type for value; expected %s; got %sunable to cast %#v of type %T to Durationunable to cast %#v of type %T to []stringInvalid Version of Username Password Authconvert file descriptor to connection: %sset socket option: IP_RECVORIGDSTADDR: %sunable to obtain original destination: %sDropping a packet with an unknown versionSetting DF failed for both IPv4 and IPv6.http3: no cached connection was availableaccepting bidirectional stream failed: %scontradicting content lengths (%s and %s)idna: internal error in punycode encodingurn:ietf:params:acme:error:serverInternaldns: length mismatch, want 0/2 but got %dout of order NSEC(3) block in type bitmapHTTPS server returned with non-OK code %dexpecting colon between hours and minutesfound an indentation indicator equal to 0crypto/tls bug: why more than one ticket?Installed Handshake Write keys (using %s)unexpected Retry integrity tag length: %dexpected Required Insert Count to be zeroreflect.Value flag field has changed kind""" not allowed in multiline basic stringtoml: expected %s to be a table, not a %sgoogle.golang.org/genproto/protobuf/ptypemismatching message name: got %v, want %vinvalid Message.WhichOneof descriptor on x509: %q cannot be encoded as an IA5Stringx509: RSA modulus is not a positive number173472347597680709441192448139190673828125867361737988403547205962240695953369140625time: Reset called on uninitialized TickerTime.MarshalBinary: unexpected zone offsetUnable to find a command for arguments: %vError while parsing flags from args %v: %s%s?cver=%s&plat=%s&arch=%s&chan=%s&side=%stls: private key does not match public keylooking for beginning of object key stringmix of request and response pseudo headersPRIORITY frame payload size was %d; want 5Failed to parse goroutine ID out of %q: %vhttp2: server connection error from %v: %vpromised request headers cannot include %qhttp: multipart handled by MultipartReaderhttp: ContentLength=%d with Body length %dcould not decode account's private key: %vstarted background certificate maintenancestopped background certificate maintenancePrintableString contains invalid characterreflect: negative length passed to ArrayOfreflect: Call with too few input argumentsmismatch between ABI description and typesMapIter.Value called on exhausted iteratorreflect: cannot convert slice with length persistentalloc: align is not a power of 2out of memory allocating checkmarks bitmap/cpu/classes/gc/mark/dedicated:cpu-seconds/memory/classes/metadata/mcache/free:bytes/memory/classes/metadata/mspan/inuse:bytesnon-empty mark queue after concurrent marksweep: tried to preserve a user arena spanruntime: blocked write on closing polldescacquireSudog: found s.elem != nil in cachefatal error: cgo callback before cgo call on a locked thread with no template threadunexpected signal during runtime execution received but handler not on signal stack crypto/sha1: invalid hash state identifierinsufficient data for resource body lengthsync/atomic: store of nil value into Valuedeprecated message for flag %q must be setinternal error: no fields in evalChainNodefunction name %q is not a valid identifierdecoder already registered for this formatencoder already registered for this formatclosing connection in order to recreate itSwitching destination connection ID to: %sError occurred handling initial packet: %sError sending CONNECTION_REFUSED error: %stried to delete unknown outgoing stream %dtried to delete unknown incoming stream %daccepting unidirectional stream failed: %sexpected first frame to be a HEADERS frameinvalid HTTP header value %q for header %qpoly1305: write to MAC after Sum or VerifySVCB keys not in strictly increasing orderdns: svcbipv6hint: expected ipv6, got ipv4domain name exceeded %d wire-format octetserror parsing data source: unknown type %qleading zero not allowed on decimal numbercannot have underscore after decimal pointinvalid array: want %d elements but got %dmissing original_destination_connection_idreceived duplicate transport parameter %#xSending ACK because the ACK timer expired.packet %d not found in sent packet historycrypto/tls bug: where's my session ticket?quotedprintable: invalid bytes after =: %qKeyValue should have at least two childrenarray elements must be separated by commasgob: encoded unsigned integer out of rangeheredoc expected second '<', didn't see itx509: failed to parse dnsName constraint %qx509: invalid X25519 private key parametersmult64bitPow10: power of 10 is out of range local_nonpersistent_flags+=("--%[1]s") TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256tls: received unexpected key update messagetls: server did not select an ALPN protocoltls: server sent unrequested session tickettls: received malformed key_share extensiontls: invalid early data for QUIC connectiontls: client's Finished message is incorrecttls: handshake data received at wrong leveltls: SendSessionTicket called on the clientno multipart boundary param in Content-Typenet/http: timeout awaiting response headerstimeout waiting for SETTINGS frames from %vhttp2: server closing client connection: %vhttp2: unexpected ALPN protocol %q; want %qTransport: unhandled response frame type %Thttp2: too many 1xx informational responsesError enabling Transport HTTP/2 support: %vnet/http: invalid header field value for %qunable to write OCSP staple file for %v: %vresponse had invalid Retry-After header: %sorder pending, authorizations remaining: %vexplicit time type given to non-time membermultiple Read calls return no data or errorreflect: nil type passed to Type.Implementsreflect: CallSlice of non-variadic functionreflect: Call with too many input arguments/memory/classes/metadata/mcache/inuse:bytesruntime.SetFinalizer: first argument is nilruntime.SetFinalizer: finalizer already setgcBgMarkWorker: unexpected gcMarkWorkerModenon in-use span found with specials bit setgrew heap, but no adequate free space foundroot level max pages doesn't fit in summaryunfinished open-coded defers in deferreturnruntime: releaseSudog with non-nil gp.paramunknown runnable goroutine during bootstrapruntime: casfrom_Gscanstatus bad oldval gp=runtime:stoplockedm: lockedg (atomicstatus=runtime: opened unexpected file descriptor methodValueCallFrameObjs is not in a module): IPv6 zones cannot be present in a prefixinterrupted system call should be restartedFlag shorthand -%s has been deprecated, %s invalid string being converted to IPNet: %s%s is an unexported field of struct type %swrong number of args for %s: want %d got %dbufio: tried to rewind past start of bufferset socket option: IPV6_RECVORIGDSTADDR: %sdatagramQueue BUG: Pop called for nil framestream %d canceled by %s with error code %dfailed to determine receive buffer size: %wreading stream type on stream %d failed: %sHEADERS frame too large: %d bytes (max: %d)exec: WaitDelay expired before I/O completeedwards25519: invalid point encoding lengthnon executable command in pipeline stage %dreadPythonMultilines: end of value, got: %qexpecting colon between minutes and secondscannot have underscore before decimal pointtoml: type %s is not supported as a map keytoml: decoding pointer target cannot be nilextra characters at the end of a local time!!binary value contains invalid base64 datafound character that cannot start any tokendid not find expected comment or line breakfound unexpected non-alphabetical characterfound invalid Unicode character escape codetimeout: handshake did not complete in time %s &wire.DataBlockedFrame{MaximumData: %d}sent packet with unexpected ECN marking: %s''' not allowed in multiline literal stringfile %q has a package name conflict over %vfailed decoding ZeroSSL EAB API response: %wcrypto/sha256: invalid hash state identifierx509: invalid RDNSequence: invalid attributex509: invalid Ed25519 private key parametersx509: invalid Ed25519 private key length: %dx509: internal error: cannot parse domain %qcrypto/x509: error fetching intermediate: %wx509: failed to unmarshal raw CSR Attributesuse of WriteTo with pre-connected connectionmult128bitPow10: power of 10 is out of range local_nonpersistent_flags+=("--%[1]s=") %v Logger.check error: failed to get caller fragments not allowed with file URLs: got %vtls: server's Finished message was incorrecttls: server sent an incorrect legacy versiontls: SendSessionTicket called multiple timeshttp: putIdleConn: too many idle connectionsconnection exceeded flow control window sizehttp2: could not negotiate protocol mutuallyhttp2: invalid Connection request header: %qhttp: Request.ContentLength=%d with nil Bodyretrieving next certificate in chain: %s: %wunsupported SOCKS5 authentication method: %ded25519: bad Ed25519ph message hash length: cipher: NewGCM requires 128-bit block cipherreflect: call of MakeFunc with non-Func typereflect: FieldByNameFunc of non-struct type reflect: funcLayout with interface receiver using value obtained using unexported fieldreflect: function created by MakeFunc using reflect: Value.SetIterKey called before Nextreflect: slice length out of range in SetLenspan on userArena.faultList has invalid sizeout of memory allocating heap arena metadataruntime: cannot remap pages in address space/cpu/classes/scavenge/background:cpu-secondsruntime: unexpected metric registration for gcmarknewobject called while doing checkmarkactive sweepers found at start of mark phaseno P available, write barriers are forbiddencannot trace user goroutine on its own stackunsafe.Slice: ptr is nil and len is not zeroruntime: cannot create a socket for loggingcrypto/sha512: invalid hash state identifierinsufficient data for calculated length typeencoding alphabet contains newline characterError parsing Version Negotiation packet: %sDiscarding DATAGRAM frame (%d bytes payload)activating ECN failed for both IPv4 and IPv6multipart: expecting a new Part; got line %qmime: unexpected content after media subtypetemplate: multiple definition of template %qneed at least one digit after fraction pointyaml internal error: please report the issueneither tag nor implicit flags are specifiedmapping keys are not allowed in this contextdid not find expected digit or '.' characterPTO timer in unexpected encryption level: %smax-age=31536000; includesubdomains; preloadmultiline basic string not terminated by """this should not be a top level node type: %s%s previously from: %q currently from: %qx509: IP constraint contained invalid mask %xx509: certificate signed by unknown authorityrequires at least %d arg(s), only received %dsink factory already registered for scheme %qIgnored key-value pairs with non-string keys.context: internal error: missing cancel errorTLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256tls: internal error: unexpected renegotiationtls: internal error: failed to update binderstls: no server certificates in client sessiontls: failed to find any PEM data in key inputjson.RawMessage: UnmarshalJSON on nil pointerhttp: putIdleConn: connection is in bad statehttp: no Client.Transport or DefaultTransportinvalid request :path %q from URL.Opaque = %qunbuffered done channel passed in for type %Thttp: multipart handled by ParseMultipartFormHTTP/1.1 %d %s%sUnsupported transfer encodingnet/http: internal error: connCount underflowclient tried to switch to invalid protocol %qcertificate has no names; removing from cachecertificate expires soon; queuing for renewaloverride disables querying OCSP responder: %v[ERROR] TLS-ALPN challenge server: accept: %vcrypto/rsa: message too long for RSA key sizezero length explicit tag was not an asn1.Flagmath/big: cannot unmarshal %q into a *big.Intreflect: nil type passed to Type.AssignableToreflect: internal error: invalid method indextransitioning GC to the same state as before?produced a trigger greater than the heap goaltried to run scavenger from another goroutineruntime: failed mSpanList.remove span.npages=exitsyscall: syscall frame is no longer validunsafe.String: ptr is nil and len is not zeroruntime: cannot connect to /dev/socket/logdwcannot send after transport endpoint shutdownparsing/packing of this section has completed%q shorthand is more than one ASCII charactercan't call method/function %q with %d resultswrong number of args: got %d want at least %dbufio.Scanner: Read returned impossible countretired connection ID %d (highest issued: %d)Dropping packet with version %x. Expected %x.connection BUG: couldn't pack %s probe packetreceived HTTP/3 frame on bidirectional streamcrypto/blake2b: invalid hash state identifierno response matching the supplied certificatew must be at least 2 by the definition of NAFfloat integer part cannot have leading zeroesDisabling ECN. All testing packets were lost.Expected object value, got unknown token: %+vescape sequence is invalid Unicode code pointdetected mutation on the default bytes for %vdecode failure in lazy extension decoding: %v0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ $%*+-./:https://acme-v02.api.letsencrypt.org/directoryx509: failed to unmarshal elliptic curve pointx509: failed to parse rfc822Name constraint %qx509: malformed signature algorithm identifierx509: unknown curve while marshaling to PKCS#8x509: invalid elliptic curve private key valuex509: cannot sign with hash function requestedTime.UnmarshalJSON: input is not a JSON stringERROR: unexpected ShellCompDirective value: %dcan't register a sink factory for empty stringfirst path segment in URL cannot contain colon%v Unsafe CheckedEntry re-use near Entry %+v. PSSWithSHA256PSSWithSHA384PSSWithSHA512Ed25519tls: server chose an unconfigured cipher suitetls: failed to parse certificate from server: tls: server did not echo the legacy session IDtls: server accepted 0-RTT with the wrong ALPNtls: received new session ticket from a clientrequest Content-Type isn't multipart/form-dataGOAWAY close timer fired; closing conn from %vinternal error: cannot create stream with id 0http2: Transport creating client conn %p to %vprotocol error: received DATA after END_STREAMnet/http: internal error: misuse of tryDelivernet/http: too many 1xx informational responsesbackend tried to switch to invalid protocol %q%s: caching certificate after obtaining it: %vtimed out waiting to obtain certificate for %sunexpected state: %s - order already finalizedbytes.Reader.UnreadByte: at beginning of slicebytes.Reader.UnreadRune: at beginning of sliceed25519: internal error: setting scalar failedmath/big: mismatched montgomery number lengthscipher.NewCTR: IV length must equal block sizereflect: nil type passed to Type.ConvertibleToreflect.Struct: fields with different PkgPath reflect.StructOf: illegal embedded field type returned value obtained from unexported fieldreflect: Value.SetIterValue called before Nextreflect: slice capacity out of range in SetCapreflect.Value.Slice: slice index out of boundsslice bounds out of range [:%x] with length %ypanicwrap: unexpected string after type name: memory reservation exceeds address space limittried to park scavenger from another goroutinereleased less than one physical page of memory (bad use of unsafe.Pointer? try -d=checkptr) sysGrow bounds not aligned to pallocChunkBytesruntime: failed to create new OS thread (have runtime: panic before malloc heap initialized stopTheWorld: not stopped (status != _Pgcstop)runtime: name offset base pointer out of rangeruntime: type offset base pointer out of rangeruntime: text offset base pointer out of rangeboth Setctty and Foreground set in SysProcAttrinvalid string being converted to Bytes: %s %sfunction called with %d args; should be 1 or 2crypto/rand: prime size must be at least 2-bitOCSP response contains bad number of responsesdns: svcbipv4hint: expected ipv4, hint is ipv6dns: svcbipv6hint: expected ipv6, hint is ipv4edwards25519: invalid field element input sizemapping values are not allowed in this contextdid not find expected whitespace or line breakerror while reading transport parameter %d: %sTransport parameters changed. Rejecting 0-RTT.multiline literal string not terminated by '''google.golang.org/genproto/protobuf/field_maskx509: malformed public key algorithm identifierx509: certificate contains duplicate extensionsx509: internal error: IP SAN %x failed to parse (temporarily override with GODEBUG=x509sha1=1)unexpected error wrapping poll.ErrFileClosing: cobra_annotation_bash_completion_subdirs_in_dirfirst record does not look like a TLS handshaketls: handshake did not verify certificate chaintls: incorrect renegotiation extension contentstls: server selected unadvertised ALPN protocoltls: server selected TLS 1.3 in a renegotiationtls: server sent two HelloRetryRequest messagestls: internal error: pskBinders length mismatchhttp: server gave HTTP response to HTTPS clientflow control update exceeds maximum window sizewr.done != nil for write100ContinueHeadersFrame1xx informational response with END_STREAM flagprotocol error: received DATA on a HEAD request[FrameWriteRequest stream=%d, ch=%v, writer=%v]missing config pointer (must use NewACMEIssuer)opening distributed challenge token file %s: %vunable to delete stale lockfile; deadlocked: %wtimed out waiting for certificate renewal of %sasn1: Unmarshal recipient value is non-pointer explicit string type given to non-string memberreflect.Value.Bytes of unaddressable byte arrayreflect: CallSlice with too few input argumentsregister-based return value has stack componentreflect.Value.Slice3: slice index out of boundsreflect.Value.UnsafeAddr of unaddressable valueslice bounds out of range [::%x] with length %yP has cached GC work at end of mark terminationfailed to acquire lock to start a GC transitionfinishGCTransition called without starting one?tried to sleep scavenger from another goroutineracy sudog adjustment due to parking on channelfunction symbol table not sorted by PC offset: attempting to link in too many shared librariesbufio: reader returned negative count from Read^(\w+)\s*\(([^,]+)(?:,([^,]+))?(?:,([^,]+))?\)$Queueing packet (%d bytes) for later decryption:path, :authority and :method must not be emptychacha20poly1305: message authentication failedthe message the server sent us isn't a responsefloat decimal point must be preceded by a digitfloat decimal point must be followed by a digittoml: encoding a nil interface is not supportedfound a tab character that violates indentationAckFrame: ACK frame contains invalid ACK rangesCanceling loss detection timer. No PTO needed..Not doing 0-RTT. Has sealer: %t, has params: %tthe session ticket has more bytes than expectedinvalid string length %d: exceeds input size %dmap field %v cannot be set with read-only valuex509: X25519 key encoded with illegal parametersx509: SAN uniformResourceIdentifier is malformedx509: IP constraint contained value of length %dx509: internal error: cannot parse constraint %qx509: internal error: URI SAN %q failed to parsex509: only RSA, ECDSA and Ed25519 keys supportedx509: only CAs are allowed to specify MaxPathLenx509: failed to serialise extensions attribute: strconv: illegal AppendFloat/FormatFloat bitSizenot enough significant bits after mult64bitPow10group id '%s' is not defined for subcommand '%s'tls: CloseWrite called before handshake completeunable to generate random session ticket key: %vfailed to parse certificate #%d in the chain: %wtls: CurvePreferences includes unsupported curvetls: Config MinVersion must be at least TLS 1.13internal error: should have a body in this statenet/http: Hijack called after ServeHTTP finishedcertificate appears to have been renewed already[ERROR] TLS-ALPN challenge server: handshake: %vserver set unrecognized authorization status: %sretrieving alternate certificate chain at %s: %wcrypto/rsa: input must be hashed with given hashInt.GobDecode: encoding version %d not supportedout points to big.Int, but defaultValue does notreflect: CallSlice with too many input argumentsslice bounds out of range [:%x] with capacity %yruntime: cannot map pages in arena address spaceparsing/packing of this type isn't available yetinvalid string being converted to IP address: %scan't install method/function %q with %d results'%s' needs a map with string keys, has '%s' keysbufio: writer returned negative count from Writeconnection BUG: unspecified error type (msg: %s)cannote remove connection, connection is unknownTracking %d connection IDs and %d reset tokens. Activating reading of packet info bits for IPv4.Activating reading of packet info bits for IPv6.peer tried to open stream %d (current limit: %d)dates are expected to have the format YYYY-MM-DDextra characters at the end of a local date timetoml: negative number %d does not fit in an uintreceived %d bytes on stream %d, allowed %d byteserror while trying to parse list within list: %sinvalid Mutable on field with non-composite typefield %v has invalid type: got %v, want map kindlist field %v cannot be set with read-only valueinvalid status code (must be 200-599, except 233)/etc/pki/ca-trust/extracted/pem/tls-ca-bundle.pemx509: invalid RDNSequence: invalid attribute typex509: Ed25519 key encoded with illegal parametersx509: private key contains zero or negative valuex509: private key contains zero or negative primenot enough significant bits after mult128bitPow10strings.Reader.UnreadByte: at beginning of stringstrings.Reader.UnreadRune: at beginning of stringstrings.Reader.WriteTo: invalid WriteString count# bash completion for %-36s -*- shell-script -*- # fish completion for %-36s -*- shell-script -*- crypto/tls: ExportKeyingMaterial context too longtls: server advertised unrequested ALPN extensiontls: server sent a cookie in a normal ServerHellotls: client offered only unsupported versions: %xtls: client using inappropriate protocol fallbacktls: client illegally modified second ClientHellohttp2: request body closed due to handler exitinghttp: wrote more than the declared Content-Length (Client.Timeout exceeded while awaiting headers)unexpected Peek failure reading buffered byte: %vnet/http: Transport.Dial hook returned (nil, nil)%s: reloading renewed certificate into memory: %vrenewing certificate aborted by event handler: %wdecoding challenge token file %s (corrupted?): %vfailed to decode PEM block containing private keynot configured for on-demand certificate issuancesubject name does not qualify for certificate: %scould not remove compromised private key from useecdsa: internal error: truncated hash is too longcrypto/elliptic: internal error: invalid encodingreflect.Value.Slice: slice of unaddressable arrayslice bounds out of range [::%x] with capacity %yinvalid memory address or nil pointer dereferencepanicwrap: unexpected string after package name: s.allocCount != s.nelems && freeIndex == s.nelemsdelayed zeroing on data that may contain pointersruntime.reflect_makemap: unsupported map key typesweeper left outstanding across sweep generationsfully empty unfreed span set block found in resetcasgstatus: waiting for Gwaiting but is Grunnablethe :: must expand to at least one field of zerosinvalid or incomplete multibyte or wide characterputPacketBuffer called with packet of wrong size!Dropping long header packet of type %s (%d bytes)Activating reading of ECN bits for IPv4 and IPv6.error parsing connection ID on packet from %s: %stried to delete incoming stream %d multiple timeschacha20poly1305: bad nonce length passed to Sealchacha20poly1305: bad nonce length passed to Opendatetime separator is expected to be T or a spacetoml: negative number %d does not fit in an uint8client sent an original_destination_connection_idVersion Negotiation packet has empty version listDisabling ECN. ECN counts decreased unexpectedly.received packet with unknown encryption level: %sPeer doesn't await address validation any longer.Congestion limited: bytes in flight %d, window %dexpected character %c but the document ended heresubslice address (%d) is before data address (%d)gob: registering duplicate types for %q: %s != %sgob: registering duplicate names for %s: %q != %qhttps://api.zerossl.com/acme/eab-credentials-emailx509: missing ASN.1 contents; use ParseCertificatex509: invalid RDNSequence: invalid attribute valuex509: RSA public exponent is not a positive numberx509: unknown key type while marshaling PKCS#8: %Tcryptobyte: attempted write while child is pendinggo package net: dynamic selection of DNS resolver cobra_annotation_bash_completion_one_required_flagtls: received unexpected CertificateStatus messagetls: invalid signature by the server certificate: tls: invalid signature by the client certificate: net/http: cannot rewind body after connection losshttp: putIdleConn: CloseIdleConnections was calledgot CONTINUATION for stream %d; expected stream %dhttp: suspiciously long trailer after chunked bodynet/http: Transport failed to read from server: %vnet/http: HTTP/1.x transport connection broken: %wobtaining certificate aborted by event handler: %wunknown key type; only RSA and ECDSA are supportedinvalid hijack address (must be an IP address): %scrypto/elliptic: nistec rejected normalized scalarcrypto/cipher: incorrect nonce length given to GCMreflect.Value.Slice3: slice of unaddressable arraycgo argument has Go pointer to unpinned Go pointermallocgc called with gcphase == _GCmarkterminationrecursive call during initialization - linker skewattempt to execute system stack code on user stack%s has arguments but cannot be invoked as functionNot adding connection ID %s, as it already exists.chacha20: SetCounter attempted to rollback counterdns: svcbport: port length is not exactly 2 octetsedwards25519: invalid SetUniformBytes input lengthcannot add shadow to auto-increment or boolean keytoml: negative number %d does not fit in an uint64toml: negative number %d does not fit in an uint32toml: negative number %d does not fit in an uint16^[-+]?[0-9][0-9_]*(?::[0-5]?[0-9])+(?:\.[0-9_]*)?$ACK rate: %.2f (total=%d, ack=%d, loss=%d, rtt=%d)initial_max_streams_uni too large: %d (maximum %d)unknown transport parameter marshaling version: %dreceived an ACK for skipped packet number: %d (%s)reflect.Value read-only flag has changed semanticsexpected: IDENT | STRING | ASSIGN | LBRACE got: %serror while trying to parse object within list: %sslice offset (%d) is farther than data length (%d)invalid uint data length %d: exceeds input size %dgoogle.golang.org/genproto/protobuf/source_contextinvalid Mutable on map with non-message value typefield %v has invalid type: got %v, want slice kindcache must have GetConfigForCert set in its optionsx509: certificate has expired or is not yet valid: query parameters not allowed with file URLs: got %vScanState's Read should not be called. Use ReadRunetls: VerifyHostname called on TLS server connectioncrypto/tls: reserved ExportKeyingMaterial label: %stls: server's identity changed during renegotiationtls: server selected unsupported compression formattls: server sent an unexpected early_data extensiontls: client did not request an application protocolJSON decoder out of sync - data changing underfoot?http2: invalid Transfer-Encoding request header: %qprotocol error: received %T before a SETTINGS frameloading managed certificate for %v from storage: %vgot nil TLS-ALPN challenge certificate but no errorunable to forcefully get new certificate for %v: %wcrypto/ecdh: internal error: isLess input too largecrypto/elliptic: Add was called on an invalid pointgodebug: Value of name not listed in godebugs.All: limiterEvent.stop: invalid limiter event type foundpotentially overlapping in-use allocations detectedfatal: systemstack called from unexpected goroutine'%s': source data must be an array or slice, got %sdefault type does not match variable type: %v != %vIgnoring Retry, since we already received a packet.Ignoring Retry, since a Retry was already received.authz %s has unexpected status; order will fail: %sreadPythonMultilines: failed to peek with error: %vline %d: mapping key %#v already defined at line %dinitial_max_streams_bidi too large: %d (maximum %d) Queueing ACK because packet %d was missing before.expected = after a key, but the document ends thereslice ends (%d+%d) is farther than data length (%d)invalid AppendMutable on list with non-message typeextension %v extends %v outside the extension rangefield %v has invalid type: got %v, want struct kindfield %v has invalid type: %v does not implement %vunicode code point U+E123 reserved for internal usex509: cannot verify signature: insecure algorithm %verrors: *target must be interface or implement errorcobra_annotation_bash_completion_filename_extensionsRegisterFlagCompletionFunc: flag '%s' does not existuser and password not allowed with file URLs: got %vtls: server selected unsupported protocol version %xtls: received a session ticket with invalid lifetimetls: internal error: session ticket keys unavailabletls: private key type does not match public key typerequest header "TE" may only be "trailers" in HTTP/2http2: Transport readFrame error on conn %p: (%T) %vprotocol error: received DATA before a HEADERS framedid not find chain matching preferences; using firstecdsa: internal error: unexpectedly masking off bitscrypto/rsa: PSSOptions.SaltLength cannot be negativemallocgc called without a P or outside bootstrappingruntime: cannot disable permissions in address spaceruntime.SetFinalizer: pointer not in allocated blockruntime: use of FixAlloc_Alloc before FixAlloc_Init span set block with unpopped elements found in resetcasfrom_Gscanstatus: gp->status is not in scan statednsmessage.OPTResource{Options: []dnsmessage.Option{wrong number of args for %s: want at least %d got %dGot UserPassNegotiationRequest: %#v %#v %#v %#v %#v Ignoring spoofed Retry. Integrity Tag doesn't match.Removing connection ID %s after it has been retired.Activating reading of packet info for IPv4 and IPv6.activating packet info failed for both IPv4 and IPv6:path must be empty and :authority must not be emptyhttp3: invalid http header field value %q for key %vdownloading certificate chain from %s: %w (order=%s)successfully downloaded available certificate chainsinternal error: missing handler for resolver table: invalid value for max_packet_size: %d (minimum 1200)invalid value for max_ack_delay: %dms (maximum %dms) setting loss timer for packet %d (%s) to %s (in %s)Starting key drop timer to drop key phase %d (in %s)unexpected character 'i' while scanning for a numberunexpected character 'n' while scanning for a numberprototext: error parsing unknown field wire type: %vx509: certificate specifies an incompatible key usagetls: unable to generate random session ticket key: %vtls: received unexpected handshake message of type %Ttls: client does not support uncompressed connectionstls: HKDF-Expand-Label invocation failed unexpectedlytls: failed to find any PEM data in certificate inputhttp: putIdleConn: too many idle connections for hosthttp2: Framer %p: failed to decode just-written frameillegal use of AllowIllegalReads with ReadMetaHeadershttp2: Transport failed to get client conn for %s: %vnet/http: CloseNotify called after ServeHTTP finishedsubject does not qualify for a public certificate: %sfound preferred certificate chain by root common namefound unknown private key type in PKCS#8 wrapping: %Tgetting certificate from external certificate managerforcefully renewing certificate due to REVOKED statusHTTP %d: JSON-decoding problem details: %w (raw='%s')pem: cannot encode a header key that contains a coloncrypto/ecdh: internal error: mismatched isLess inputscrypto/elliptic: attempted operation on invalid pointmath/big: internal error: cannot find (D/n) = -1 for reflect: non-interface type passed to Type.Implementsreflect.Value.Slice: string slice index out of boundssync/atomic: compare and swap of nil value into Valuebufio.Scan: too many empty tokens without progressingSent UserNameNegotiationRequest: %#v %#v %#v %#v %#v <- Reading packet %d (%d bytes) for connection %s, %sserver sent reduced limits after accepting 0-RTT data-> Sending packet %d (%d bytes) for connection %s, %sreceived crypto data after change of encryption levelAdding connection IDs %s and %s for a new connection.wire.PutStreamFrame called with packet of wrong size!received a packet with an unexpected connection ID %sdid not find expected alphabetic or numeric character^[-+]?(\.[0-9]+|[0-9]+(\.[0-9]*)?)([eE][-+]?[0-9]+)?$invalid value for ack_delay_exponent: %d (maximum %d)Canceling loss detection timer. No packets in flight.script-src 'none'; object-src 'none'; base-uri 'none'chacha20: internal error: wrong dst and/or src lengthinvalid GOLANG_PROTOBUF_REGISTRATION_CONFLICT value: having only HTTP server without HTTPS is not supportedx509: cannot verify signature: algorithm unimplementedx509: invalid RDNSequence: invalid attribute value: %sURI with IP (%q) cannot be matched against constraintscryptobyte: Builder is exceeding its fixed-size bufferfmt: scanning called UnreadRune with no rune availablecertificate is not valid for requested server name: %wtls: server resumed a session with a different versiontls: server accepted 0-RTT with the wrong cipher suitetls: certificate used with invalid signature algorithmtls: client indicated early data in second ClientHellotls: failed to create cipher while encrypting ticket: tls: found unknown private key type in PKCS#8 wrappinghttp: Request.Write on Request with no Host or URL setread loop ending; caller owns writable underlying conninternal error: expected to be already writing a framehttp2: received GOAWAY %+v, starting graceful shutdownhttp2: handler wrote more than declared Content-Lengthtarget must be an absolute URL or an absolute path: %qnet/http: can't write control character in Request.URLhttputil: ReverseProxy read error during body copy: %vhttps://acme-staging-v02.api.letsencrypt.org/directoryno matching certificates and no custom selection logicremoved certificate's compromised private key from usebytes.Buffer: reader returned negative count from Readcrypto/elliptic: Double was called on an invalid pointreflect: Value.SetIterKey called on exhausted iteratorgcControllerState.findRunnable: blackening not enabledno goroutines (main called runtime.Goexit) - deadlock! goroutine running on other thread; stack unavailable , square brackets can only be used with IPv6 addresses, IPv6 addresses must be surrounded by square bracketsname is not in canonical format (it must end with a .)panic calling String method on zero %v for flag %s: %vexpected first connection ID to have sequence number 0error parsing packet, couldn't parse connection ID: %sexpected retry_source_connection_id to equal %s, is %sClient offered version %s, sending Version Negotiationreceived pseudo header %s after a regular header fieldtoml: cannot decode TOML %s into a Go value of type %stag handle must contain alphanumerical characters onlyexplicitly tagged !!binary data must be base64-encodedblock sequence entries are not allowed in this contextoption ,inline needs a map with string keys in struct Not enough samples (total=%d, ack=%d, loss=%d, rtt=%d) %s &wire.MaxStreamsFrame{Type: uni, MaxStreamNum: %d}Canceling loss detection timer. Amplification limited.received %d bytes for the connection, allowed %d bytesAccepting 0-RTT. Restoring RTT from session ticket: %squic: HKDF-Expand-Label invocation failed unexpectedlyquotedprintable: invalid unescaped byte 0x%02x in bodyfield %v has invalid type: got %v, want interface kindx509: too many intermediates for path length constraintx509: failed to load system roots and no roots providedos: invalid use of WriteAt on file opened with O_APPEND is longer than the maximum zone name length (40 bytes)tls: internal error: handshake should have had a resulttls: no ECDHE curve supported by both client and servernet/http: request canceled while waiting for connectionnet/http: invalid byte %q in %s; dropping invalid byteshttp2: server: error reading preface from client %v: %vinternal error: can only be writing one frame at a timefound preferred certificate chain by issuer common name[WARNING] Unable to delete invalid OCSP staple file: %vcould not start listener for challenge server at %s: %vmust set at least one of Certificates or GetCertificatecrypto/rsa: GenerateMultiPrimeKey: nprimes must be >= 2cipher.NewCBCEncrypter: IV length must equal block sizecipher.NewCBCDecrypter: IV length must equal block sizereflect: internal error: invalid use of makeMethodValuereflect.FuncOf: last arg of variadic func must be slicemheap.freeSpanLocked - invalid free of user arena chunkcasfrom_Gscanstatus:top gp->status is not in scan stateeach colon-separated field must have at least one digitunable to cast %#v of type %T to map[string]interface{}cannot assign type '%s' to map value field of type '%s'bufio.Scanner: SplitFunc returns negative advance countSending a keep-alive PING to keep the connection alive.dns: svcbmandatory: value length is not a multiple of 2edwards25519: invalid SetBytesWithClamping input lengtherror when getting key of section %q: key %q not existstimes are expected to have the format HH:MM:SS[.NNNNNN]number must have at least one digit between underscoresmap merge requires map or sequence of maps as the valuealias value must contain alphanumerical characters only %s &wire.MaxStreamsFrame{Type: bidi, MaxStreamNum: %d}expected preferred_address to be %d long, read %d byteserror parsing list, expected comma or list end, got: %sextension number %d is already registered on message %vindent may only be composed of space and tab charactersx509: internal error: empty chain when appending CA certstrings: illegal use of non-zero Builder copied by valueRegisterFlagCompletionFunc: flag '%s' already registeredfile URLs must leave host empty or use localhost: got %vtls: no cipher suite supported by both client and servertls: TLS 1.3 client supports illegal compression methodstls: client sent invalid key share in second ClientHellotls: SendSessionTicket called before handshake completedptrEncoder.encode should have emptied ptrSeen via defershttp2: request body larger than specified content lengthhttp2: response header list larger than advertised limithttp: Request.RequestURI can't be set in client requestspromised request headers cannot include pseudo header %qviolation of WriteScheduler interface: unknown stream %dnet/http: Transport.DialContext hook returned (nil, nil)b4050a850c04b3abf54132565044b0b7d7bfd8ba270b39432355ffb4b70e0cbd6bb4bf7f321390b94a03c1d356c21122343280d6115c1d21bd376388b5f723fb4c22dfe6cd4375a05a07476444d5819985007e34non-empty pointer map passed for non-pointer-size valuesreflect: Value.SetIterValue called on exhausted iteratorprofilealloc called without a P or outside bootstrappingin gcMark expecting to see gcphase as _GCmarkterminationrecord on line %d; parse error on line %d, column %d: %v<- Reading packet %d (%d bytes) for connection %s, 1-RTTexpected initial_source_connection_id to equal %s, is %sSTREAM frames are handled with their respective streams.Conn has send buffer of %d kiB (wanted: at least %d kiB)cannot add nested value to auto-increment or boolean keytoml: not encoding uint (%d) greater than max int64 (%d)attempted to go past the end of stream; corrupted value?anchor value must contain alphanumerical characters onlyoption ,inline may only be used on a struct or map field %s &wire.StreamsBlockedFrame{Type: uni, MaxStreams: %d}StreamFrame: attempting to write empty frame without FINremaining length (%d) smaller than parameter length (%d)wrong length for stateless_reset_token: %d (expected 16)TransportParameter BUG: transport parameter %d not founda powerful, lightning fast and censorship resistant proxyAperture Internet Laboratory x509: failed to parse EC private key embedded in PKCS#8: tls: Ed25519 public keys are not supported before TLS 1.2received record with version %x when expecting version %xtls: server sent an unnecessary HelloRetryRequest messagetls: server selected an invalid PSK and cipher suite pairbackend tried to switch protocol %q when %q was requestedloading existing private key for reuse with issuer %s: %vsync: WaitGroup misuse: Add called concurrently with Waitruntime: checkmarks found unexpected unmarked object obj=runtime: netpoll: break fd ready for something unexpectedruntime: failed to disable profiling timer; timer_delete(non-Go code set up signal handler without SA_ONSTACK flagcan't handle assignment of %s to empty interface argumentcannot run executable found relative to current directory (set GODEBUG=execwait=2 to capture stacks for debugging)congestion BUG: decreased max datagram size from %d to %d %s &wire.StreamsBlockedFrame{Type: bidi, MaxStreams: %d}Max outstanding limited: tracking %d packets, maximum: %dx509: failed to parse RSA private key embedded in PKCS#8: x509: provided PrivateKey doesn't match parent's PublicKeyDNS response contained records which contain invalid names"help" flag declared as non-bool. Please correct your codeGenerate the autocompletion script for the specified shelltls: server changed cipher suite after a HelloRetryRequestjson: cannot set embedded pointer to unexported struct: %vcannot push URL with scheme %q from request with scheme %qhttp2: client connection force closed via ClientConn.Closecache must be initialized with a GetConfigForCert callbackno information found to solve challenge for identifier: %sno matching certificate; will choose from all certificatescrypto/ecdh: internal error: converting the wrong key typecrypto/ecdh: bad X25519 remote ECDH input: low order pointcrypto/elliptic: ScalarMult was called on an invalid pointsync/atomic: swap of inconsistently typed value into Valuereceived conflicting connection IDs for sequence number %dreceived CRYPTO frame with unexpected encryption level: %stried to send a ECN-marked packet although ECN is disableddns: svcbnodefaultalpn: no-default-alpn must have no valueGODEBUG=execwait=2 detected a leaked exec.Cmd created by: inline table cannot contain nested tables, only key-valuesreceived ACK for key phase %d, but peer didn't update keysgob: cannot encode nil pointer of type %s inside interfacetls: server resumed a session with a different cipher suitetls: server selected TLS 1.3 using the legacy version fieldtls: server sent an unnecessary HelloRetryRequest key_sharehttp2: Transport received Server's graceful shutdown GOAWAYRoundTripper returned a response & error; ignoring responsehttp: superfluous response.WriteHeader call from %s (%s:%d)http: response.Write on hijacked connection from %s (%s:%d)unsupported scheme for HTTP proxy (use http:// or https://)sync: WaitGroup is reused before previous Wait has returnedcrypto/ecdh: private key and public key curves do not matchreflect: reflect.Value.Elem on an invalid notinheap pointerreflect: indirection through nil pointer to embedded structruntime: mmap: too much locked memory (check 'ulimit -l'). sync/atomic: store of inconsistently typed value into Valuebufio.Scanner: SplitFunc returns advance count beyond inputRejecting new connection due to GetConfigForClient callbackConn has receive buffer of %d kiB (wanted: at least %d kiB)toml: decoding can only be performed into a pointer, not %stoml: cannot convert map key of type %s to expected type %sRetire Prior To value (%d) larger than Sequence Number (%d)key '%s' expected start of object ('{') or assignment ('=')tls: no supported versions satisfy MinVersion and MaxVersiontls: initial handshake had non-empty renegotiation extensiontls: server resumed a session with a different EMS extensiontls: client requested unsupported application protocols (%s) (Client.Timeout or context cancellation while reading body)internal error: attempt to send frame on a closed stream: %vmalformed response from server: missing status pseudo headerviolation of WriteScheduler interface: cannot close stream 0net/http: server response headers exceeded %d bytes; abortedfailed storage check: %v - storage is probably misconfiguredexternal certificate manager: %s: filling cert from leaf: %vbytes.Reader.UnreadRune: previous operation was not ReadRunecrypto/elliptic: CombinedMult was called on an invalid pointreflect: call of reflect.Value.Cap on ptr to non-array Valuereflect: call of reflect.Value.Len on ptr to non-array Valuemanual span allocation called with non-manually-managed typeaddr range base and limit are not in the same memory segmentruntime: failed to configure profiling timer; timer_settime(sync/atomic: compare and swap of inconsistently typed valuesBUG: readPosInFrame (%d) > frame.DataLen (%d) in stream.Readfound a tab character where an indentation space is expectedinvalid value for active_connection_id_limit: %d (minimum 2) Queuing ACK because there's a new missing packet to report.Loss detection alarm fired in loss timer mode. Loss time: %sLoss detection alarm for %s fired in PTO mode. PTO count: %dCryptoSetup: keys at this encryption level not yet availablestart pointer address (%d) is after end pointer address (%d)failed getting ZeroSSL EAB credentials: HTTP %d: %s (code %d)x509: failed to parse URI constraint %q: cannot be IP addressgo package net: GODEBUG setting forcing use of Go's resolver "version" flag declared as non-bool. Please correct your codeto request completion choices for the specified command-line.tls: unsupported certificate: private key is %T, expected *%Ttls: server sent a ServerHello extension forbidden in TLS 1.3tls: client certificate used with invalid signature algorithmnet/http: invalid Cookie.Domain %q; dropping domain attributeReverseProxy must have exactly one of Director or Rewrite setreflect: wrong return count from function created by MakeFuncruntime: may need to increase max user processes (ulimit -u) abiRegArgsType needs GC Prog, update methodValueCallFrameObjsReceived a Version Negotiation packet. Supported Versions: %sSending stateless reset to %s (connection ID: %s). Token: %#xexec: Cmd started a Process but leaked without a call to Waitinvalid base '%c', should have been checked by scanIntOrFloatinternal error: unexpected tail comment event (please report)Increasing receive flow control window for stream %d to %d kBx509: failed to marshal EC private key while building PKCS#8: x509: certificate is not authorized to sign other certificatesURI with empty host (%q) cannot be matched against constraintsx509: certificate private key does not implement crypto.Signerstrings.Reader.UnreadRune: previous operation was not ReadRunetls: server did not send a quic_transport_parameters extensiontls: client used the legacy version field to negotiate TLS 1.3tls: client did not send a quic_transport_parameters extensiontls: certificate cannot be used with the selected cipher suitehttp2: request header list larger than peer's advertised limitno configuration associated with certificate; unable to manage0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZreflect.ArrayOf: array size would exceed virtual address spacereflect: reflect.Value.Pointer on an invalid notinheap pointerfound bad pointer in Go heap (incorrect use of unsafe or cgo?)limiterEvent.stop: found wrong event in p's limiter event slotslice length too short to convert to array or pointer to arrayruntime: internal error: misuse of lockOSThread/unlockOSThreadabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789expected original_destination_connection_id to equal %s, is %sDropping packet from %s (%d bytes). Server receive queue full.Received a stateless reset with token %#x. Closing connection.the message the server sent is empty, incomplete, or corruptedtoml: cannot decode TOML %s into struct field %s.%s of type %scannot have key %q in inlined map: conflicts with struct fieldwrong length for disable_active_migration: %d (expected empty) Queueing ACK because the first packet should be acknowledged.Request shell completion choices for the specified command-linehttp2: push would exceed peer's SETTINGS_MAX_CONCURRENT_STREAMSrequest declared a Content-Length of %d but only wrote %d bytes

HTTP Error 431

Request Header Field(s) Too Large

violation of WriteScheduler interface: stream %d already closedinternal error: exactly one of res or err should be set; nil=%vcryptobyte: BuilderContinuation reallocated a fixed-size buffermalformed GOMEMLIMIT; see `go doc runtime/debug.SetMemoryLimit`received invalid offset %d on crypto stream, maximum allowed %dPacketPacker BUG: packet too large (%d bytes, allowed %d bytes)dns: internal error: unpack should never be called on RR_Headerparser should not permit expression of kind %s at document roottls: certificate private key does not implement crypto.Decrypterjson: invalid number literal, trying to unmarshal %q into Numberhttp: request method or response status code does not allow bodyhttp2: too many control frames in send queue, closing connection Content-Type: text/plain; charset=utf-8 Connection: close suppressing panic for copyResponse error in test; copy error: %vcan't switch protocols using non-Hijacker ResponseWriter type %Terror while checking if stored certificate is also expiring soon5ac635d8aa3a93e7b3ebbd55769886bc651d06b0cc53b0f63bce3c3e27d2604b6b17d1f2e12c4247f8bce6e563a440f277037d812deb33a0f4a13945d898c2964fe342e2fe1a7f9b8ee7eb4a7c0f9e162bce33576b315ececbb6406837bf51f5reflect.StructOf: struct size would exceed virtual address spaceruntime.SetFinalizer: first argument was allocated into an arenaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_shouldn't queue undecryptable packets after handshake completionClient sent an invalid retry token. Sending INVALID_TOKEN to %s.failed to increase send buffer size (wanted: %d kiB, got %d kiB)class must be IN (Internet) (or ANYCLASS (*), which includes IN). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . readPythonMultilines: failed to skip to the end, returning errorRestoring of transport parameters from session ticket failed: %sunmarshaling transport parameters from session ticket failed: %sDropping key phase %d ahead of scheduled time. Drop time was: %sextension %v has mismatching containing message: got %v, want %vx509: inner and outer signature algorithm identifiers don't matchx509: issuer name does not match subject from issuing certificatex509: certificate request contains duplicate requested extensionstls: internal error: attempted to read record with QUIC transporttls: server selected an invalid version after a HelloRetryRequesttls: session supported extended_master_secret but client does nothttp: response.WriteHeader on hijacked connection from %s (%s:%d)net/http: Transport.DialTLS or DialTLSContext returned (nil, nil)crypto/rsa: too few primes of given length to generate an RSA keycryptobyte: pending child length %d exceeds %d-byte length prefixuser arena chunk size is not a multiple of the physical page sizeruntime.SetFinalizer: pointer not at beginning of allocated block'%s' expected type '%s', got unconvertible type '%s', value: '%v'Received first packet. Switching destination connection ID to: %sencryption level changed, but crypto stream has more data to readextended CONNECT: :scheme, :path and :authority must not be emptynistec: internal error: p224Table called with out-of-bounds valuenistec: internal error: p256Table called with out-of-bounds valuenistec: internal error: p384Table called with out-of-bounds valuenistec: internal error: p521Table called with out-of-bounds value %s &wire.MaxStreamDataFrame{StreamID: %d, MaximumStreamData: %d}x509: certificate is not valid for any names, but wanted to match x509: requested SignatureAlgorithm does not match private key typex509: signature over certificate returned by signer is invalid: %wtls: certificate private key (%T) does not implement crypto.Signerclient doesn't support ECDHE, can only use legacy RSA key exchangetls: server sent an unexpected quic_transport_parameters extensiontls: client sent an unexpected quic_transport_parameters extensionsender tried to send more than declared Content-Length of %d bytesunable to get configuration to manage certificate; unable to renewcryptobyte: high-tag number identifier octects not supported: 0x%xreflect: indirection through nil pointer to embedded struct field runtime: unexpected error while checking standard file descriptor Got Datagram. data: %#v %#v %#v %#v %#v %#v datagram address: %#v received conflicting stateless reset tokens for sequence number %dParsed a coalesced packet. Part %d: %d bytes. Remaining: %d bytes.Dropping %s packet (%d bytes) because we already dropped the keys.-> Sending packet %d (%d bytes) for connection %s, 1-RTT (ECN: %s)-> Sending coalesced packet (%d parts, %d bytes) for connection %sfailed to parse version for sending version negotiation packet: %scan only use a single QUIC version for dialing a HTTP/3 connectionskipping challenge initiation because authorization is not pendinginternal error: attempted to parse unknown event (please report): Increasing receive flow control window for the connection to %d kBtoml: key %s already exists as a %s, but should be an array tableDescriptor.Options called without importing the descriptor packagex509: internal error: supported public key does not implement EqualHelp provides help for any command in the application. Simply type tls: server sent certificate containing RSA key larger than %d bitstls: client sent certificate containing RSA key larger than %d bitscannot make valid ACMEIssuer without an associated CertMagic configcannot make a valid config without a pointer to a certificate cacheReceived %d packets after sending CONNECTION_CLOSE. Retransmitting.Dropping %s packet (%d bytes) that could not be unpacked. Error: %sfailed to increase receive buffer size (wanted: %d kiB, got %d kiB)no compatible QUIC version found (we support %s, server offered %s)inconsistent transport parameter length for transport parameter %#xfield %v with invalid Mutable call on field with non-composite typeif non-empty, httptest.NewServer serves on this address and blocks.Failed to find flag %q and mark it as being required in a flag grouptls: internal error: sending non-handshake message to QUIC transportpadding bytes must all be zeros unless AllowIllegalWrites is enabledhttp2: Transport conn %p received error from processing frame %v: %vhttp2: Transport received unsolicited DATA frame; closing connectionhttp: message cannot contain multiple Content-Length headers; got %qcertificate does not need to be renewed, but renewal is being forced[ERROR] TLS-ALPN challenge server: expected tls.Conn but got %T: %#v2695994666715063979466701508701963067355791626002630814351006629888126959946667150639794667015087019625940457807714424391721682722368061big: invalid 2nd argument to Int.Jacobi: need odd integer but got %sreflect: reflect.Value.UnsafePointer on an invalid notinheap pointerAllThreadsSyscall6 results differ between threads; runtime corruptedembedded IPv4 address must replace the final 2 fields of the addresscan not look up shorthand which is more than one ASCII character: %qreceived retry_source_connection_id, although no Retry was performedReplacing connection for connection IDs %s with a closed connection.Dropping a packet that is too small to be a valid Initial (%d bytes)crypto/hmac: hash generation function does not produce unique valuesstrict mode: fields in the document are missing in the target structexpected SCALAR, SEQUENCE-START, MAPPING-START, or ALIAS, but got %vVersion Negotiation packet has a version list with an invalid lengthextension %v does not implement protoreflect.ExtensionTypeDescriptortls: peer doesn't support the certificate custom signature algorithmstls: handshake message of length %d bytes exceeds maximum of %d bytestls: client certificate contains an unsupported public key of type %Thttp2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)in case of issues. You can leave it blank, but we don't recommend it.invalid: OCSP response for %v valid after certificate expiration (%s)response Content-Type is %s but target container is not io.Writer: %Treflect: embedded interface with unexported method(s) not implementedtoo many hex fields to fit an embedded IPv4 at the end of the address'%s': expected source data to have length less or equal to %d, got %dOnLost callback called although there's no MTU probe packet in flightpacket too small, expected at least 20 bytes after the header, got %dPacket too small. Expected at least 20 bytes after the header, got %dedwards25519: internal error: setShortBytes called with a long string %s &wire.StreamDataBlockedFrame{StreamID: %d, MaximumStreamData: %d}x509: PKCS#8 wrapping contained private key with unknown algorithm: %vx509: certificate relies on legacy Common Name field, use SANs insteadgot %s for stream %d; expected CONTINUATION following %s for stream %dbytes.Buffer: UnreadByte: previous operation was not a successful readsync/atomic: compare and swap of inconsistently typed value into ValueOnAcked callback called although there's no MTU probe packet in flightdns: svcbipv6hint: ipv6 address byte array length not a multiple of 16 %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, DelayTime: %s%s}x509: issuer has name constraints but leaf doesn't have a SAN extensionif any flags in the group [%v] are set they must all be set; missing %vtls: peer doesn't support any of the certificate's signature algorithmsjson: invalid use of ,string struct tag, trying to unmarshal %q into %vinternal error: attempt to send frame on a half-closed-local stream: %vinternal error: 101 switching protocols response with non-writable bodyPlease enter your email address to signify agreement and to be notifiedthere is only one chain offered; selecting it regardless of preferencesall external certificate managers yielded no certificates and no errorstoo many concurrent operations on a single file or socket (max 1048575)Not adding connection ID %s for a new connection, as it already exists.PacketPacker BUG: payload size inconsistent (expected %d, got %d bytes)dynamic table size update MUST occur at the beginning of a header blockexec: command with a non-nil Cancel was not created with CommandContextpacket length (%d bytes) is smaller than the expected length (%d bytes) %s &wire.ResetStreamFrame{StreamID: %d, ErrorCode: %#x, FinalSize: %d}toml: cannot redefine table %s that has already been explicitly defined{{with .Name}}{{printf "%s " .}}{{end}}{{printf "version %s" .Version}} client doesn't support any cipher suites compatible with the certificatetls: server's certificate contains an unsupported type of public key: %Ttls: certificate private key of type %T does not implement crypto.Signercrypto/ecdh: internal error: nistec ScalarBaseMult returned the identityreflect: embedded type with methods not implemented for non-pointer typeIgnoring Retry, since the server didn't change the Source Connection ID.dns: svcbipv4hint: ipv4 address byte array length is not a multiple of 4tls: received unexpected handshake message of type %T when waiting for %Ttls: internal error: handshake returned an error but is marked successfultls: found a certificate rather than a key in the PEM for the private keycoalesced packet has different destination connection ID: %s, expected %sconnection doesn't allow setting of send buffer size. Not a *net.UDPConn?Limited by the number of tracked packets: tracking %d packets, maximum %dreceived inconsistent final offset for stream %d (old: %d, new: %d bytes) if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; thenhttps://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geoip.dattls: certificate RSA key size too small for supported signature algorithmsbytes.Buffer: UnreadRune: previous operation was not a successful ReadRunemalformed response from server: malformed non-numeric status pseudo headernet/http: server replied with more than declared Content-Length; truncatedDropping undecryptable packet (%d bytes). Undecryptable packet queue full.Amplification window limited. Received %d bytes, already sent out %d bytes%[2]s is a special command that is used by the shell completion logic %[1]stls: internal error: attempted to read record with pending application dataUnsolicited response received on idle HTTP channel starting with %q; err=%vcertificate revoked, but unable to fully clean up assets from issuer %s: %vno configuration associated with certificate; unable to manage OCSP staplesACK rate too low: %.2f, clamped to %.2f (total=%d, ack=%d, loss=%d, rtt=%d)Disabling ECN. Received less ECT(0) + ECN-CE than packets sent with ECT(0).Disabling ECN. Received less ECT(1) + ECN-CE than packets sent with ECT(1).https://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geosite.dattls: failed to send closeNotify alert (but connection was closed anyway): %wtls: server certificate contains incorrect key type for selected ciphersuiteHTTP/1.0 400 Bad Request Client sent an HTTP request to an HTTPS server. on-demand certificate's OCSP status is REVOKED; will try to forcefully renewunable to redefine %q shorthand in %q flagset: it's already used for %q flagconnection doesn't allow setting of receive buffer size. Not a *net.UDPConn? %s &wire.CryptoFrame{Offset: %d, Data length: %d, Offset + Data length: %d}crypto/tls: ExportKeyingMaterial is unavailable when renegotiation is enabledinvalid Body.Read call. After hijacked, the original Request must not be usedMapIter.Next called on an iterator that does not have an associated map Valuegithub.com/quic-go/quic-go/internal/utils/ringbuffer: pop from an empty queuegithub.com/apernet/quic-go/internal/utils/ringbuffer: pop from an empty queueRemoving connection IDs %s for a closed connection after it has been retired.recevedPacketTracker BUG: ReceivedPacket called for old / duplicate packet %dreceived offset %d for stream %d, but final offset was already received at %dreceived final offset %d for stream %d, but already received offset %d beforex509: signature check attempts limit reached while verifying certificate chainThis is a command line tool. You need to open cmd.exe and run it from there. Failed to find flag %q and mark it as being in a mutually exclusive flag groupinvalid configuration: maxEvents = 0 and window != 0 does not allow any events115792089210356248762697446949407573530086143415290314195533631308867097853951115792089210356248762697446949407573529996955224135760342422259061068512044369reflect: embedded type with methods not implemented if type is not first fieldgithub.com/quic-go/quic-go/internal/utils/ringbuffer: back from an empty queueinvalid quic-go log level, see https://github.com/apernet/quic-go/wiki/LoggingDisabling ECN. ECN-marked packet acknowledged, but no ECN counts on ACK frame.tls: client certificate private key of type %T does not implement crypto.Signerhttp2: server closing client connection; error reading frame from client %s: %vinvalid configuration: maxEvents = 0 and window != 0 would not allow any eventscannot convert slice with length %y to array or pointer to array with length %xgithub.com/quic-go/quic-go/internal/utils/ringbuffer: offset from invalid indexgithub.com/quic-go/quic-go/internal/utils/ringbuffer: front from an empty queuelocal datetimes are expected to have the format YYYY-MM-DDTHH:MM:SS[.NNNNNNNNN]toml: type %s implementing the TextMarshaler interface cannot be a root elementx509: invalid signature: parent certificate cannot sign this kind of certificatetls: either ServerName or InsecureSkipVerify must be specified in the tls.Confighttp: RoundTripper implementation (%T) returned a nil *Response with a nil errorcrypto/ecdh: internal error: nistec ScalarBaseMult failed for a fixed-size inputDropping %s packet (%d bytes) for which we couldn't unpack the header. Error: %sdidn't expect MAX_DATA / MAX_STREAM_DATA / MAX_STREAMS frame to be sent in 0-RTTno port can be announced, specify it explicitly using Server.Port or Server.Addrhttp3 client BUG: RoundTripOpt called for the wrong client (expected %s, got %s)crypto/rand: blocked for 60 seconds waiting to read random data from the kernel Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sVersion: %s}Disabling ECN. Received more ECT(0) / ECT(1) acknowledgements than packets sent.received packet number %d on a 0-RTT packet after receiving %d on a 1-RTT packetif any flags in the group [%v] are set none of the others can be; %v were all set[ERROR] Keeping lock file fresh: %v - terminating lock maintenance (lockfile: %s)Rejecting new connection. Server currently busy. Accept queue length: %d (max %d)BUG: ackhandler would have acked wrong packet %d, while evaluating range %d -> %dx509: a root or intermediate certificate is not authorized to sign for this name: certificate expires soon but is already being renewed; serving current certificaterefusing to use HTTP_PROXY value in CGI environment; see golang.org/s/cgihttpproxyx509: issuer has name constraints but leaf contains unknown or unconstrained name: (possibly because of %q while trying to verify candidate authority certificate %q)json: invalid use of ,string struct tag, trying to unmarshal unquoted value into %vno issuers configured; impossible to renew or check existing certificate in storagereflect: embedded type with methods not implemented if there is more than one fieldVersion: %s BuildDate: %s BuildType: %s CommitHash: %s Platform: %s Architecture: %sx509: signature algorithm specifies an %s public key, but have public key of type %Ttls: downgrade attempt detected, possibly due to a MitM attack or a broken middleboxpacketPacker BUG: Peeked and Popped packet numbers do not match: expected %d, got %dDropping a packet with an unsupported version number %d that is too small (%d bytes)x509: failed to parse private key (use ParseECPrivateKey instead for this key format)http: WriteHeader called with both Transfer-Encoding of %q and a Content-Length of %dunable to obtain new to certificate after OCSP status of REVOKED; removing from cachereflect.Value.Interface: cannot return value obtained from unexported field or methodDropping a packet with an unknown version for which we failed to parse connection IDsPacketConn is not a net.UDPConn. Disabling optimizations possible on UDP connections.x509: a root or intermediate certificate is not authorized for an extended key usage: certificate has expired, but is already being renewed; waiting for renewal to completereflect: New of type that may not be allocated in heap (possibly undefined cgo C type) %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, AckRanges: {%s}, DelayTime: %s%s}Sent %d packets with current key phase. Initiating key update to the next key phase: %dhttps://developers.google.com/protocol-buffers/docs/reference/go/faq#namespace-conflictx509: failed to parse private key (use ParsePKCS8PrivateKey instead for this key format)x509: failed to parse private key (use ParsePKCS1PrivateKey instead for this key format)no issuers configured; impossible to obtain or check for existing certificate in storage Short Header{DestConnectionID: %s, PacketNumber: %d, PacketNumberLen: %d, KeyPhase: %s}Unable to extract port from listener %+v, will not be announced using SetQuicHeaders: %scertificate expires soon, but is already renewed in storage; reloading stored certificateDropping Initial packet (%d bytes) with unexpected source connection ID: %s (expected %s)%s: no solvers available for remaining challenges (configured=%v offered=%v remaining=%v)http2: server sent GOAWAY and closed the connection; LastStreamID=%v, ErrCode=%v, debug=%qOCSP status for managed certificate is REVOKED; attempting to replace with new certificatefailed to sufficiently increase send buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)Received %d packets with current key phase. Initiating key update to the next key phase: %dtls: handshake hash for a client certificate requested after discarding the handshake buffer[INFO][%s] Lock for '%s' is stale (created: %s, last update: %s); removing then retrying: %stls: unsupported certificate: private key is *ed25519.PrivateKey, expected ed25519.PrivateKeyretired connection ID %d (%s), which was used as the Destination Connection ID on this packetfailed to sufficiently increase receive buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)---------------------------------------------------------------------------------------------- %s &wire.NewConnectionIDFrame{SequenceNumber: %d, ConnectionID: %s, StatelessResetToken: %#x}&wire.TransportParameters{OriginalDestinationConnectionID: %s, InitialSourceConnectionID: %s, b3312fa7e23ee7e4988e056be3f82d19181d9c6efe8141120314088f5013875ac656398d8a2ed19d2a85c8edd3ec2aefaa87ca22be8b05378eb1c71ef320ad746e1d3b628ba79b9859f741e082542a385502f25dbf55296c3a545e3872760ab73617de4a96262c6f5d9e98bf9292dc29f8f41dbd289a147ce9da3113b5f0b8c00a60b1ce1d7e819d7a431d7c90ea0e5fhttp: RoundTripper implementation (%T) returned a *Response with content length %d but a nil BodyNoClientCertRequestClientCertRequireAnyClientCertVerifyClientCertIfGivenRequireAndVerifyClientCertunable to get automation config for certificate; maintenance for this certificate will likely failload yielded different value than was stored; expected %d bytes, got %d bytes of differing elements %s &wire.StreamFrame{StreamID: %d, Fin: %t, Offset: %d, Data length: %d, Offset + Data length: %d}cipher: the nonce can't have zero length, or the security of the key will be immediately compromisedsentPacketHandler BUG: PTO fired, but bytes_in_flight is 0 and Initial and Handshake already droppedcgocheck > 1 mode is no longer supported at runtime. Use GOEXPERIMENT=cgocheck2 at build time instead.\A\s*(?:export\s+)?([\w\.]+)(?:\s*=\s*|:\s+?)('(?:\'|[^'])*'|"(?:\"|[^"])*"|[^#\n]+)?\s*(?:\s*\#.*)?\z Queueing ACK because packet %d packets were received after the last ACK (using initial threshold: %d).ed25519: expected opts.HashFunc() zero (unhashed message, for standard Ed25519) or SHA-512 (for Ed25519ph)asn1: time did not serialize back to the original value and may be invalid: given %q, but serialized as %qconfig returned for certificate %v is not nil and points to different cache; got %p, expected %p (this one)Starting new connection to %s (%s -> %s), source connection ID %s, destination connection ID %s, version %sinvalid nil message info; this suggests memory corruption due to a race or shallow copy on the message struct[INFO][%s] %s: Empty lockfile (%v) - likely previous process crashed or storage medium failure; treating as stalehttp2: Transport: cannot retry err [%v] after Request.Body was written; define Request.GetBody to avoid this error3940200619639447921227904010014361380507973927046544666794829340424572177149687032904726608825893800186160697311231939402006196394479212279040100143613805079739270465446667946905279627659399113263569398956308152294913554433653942643Perform a TCP ping to a specified remote address through the proxy server. Can be used as a simple connectivity test.tls: failed to find "CERTIFICATE" PEM block in certificate input after skipping PEM blocks of the following types: %vIncreasing receive flow control window for the connection to %d kB, in response to stream flow control window increase flags=() two_word_flags=() local_nonpersistent_flags=() flags_with_completion=() flags_completion=() {{with (or .Long .Short)}}{{. | trimTrailingWhitespaces}} {{end}}{{if or .Runnable .HasSubCommands}}{{.UsageString}}{{end}}tls: failed to find certificate PEM data in certificate input, but did find a private key; PEM inputs may have been switchedYour sites will be served over HTTPS automatically using an automated CA. By continuing, you agree to the CA's terms of service\000\001\002\003\004\005\006\007\008\009\010\011\012\013\014\015\016\017\018\019\020\021\022\023\024\025\026\027\028\029\030\031tls: failed to find PEM block with type ending in "PRIVATE KEY" in key input after skipping PEM blocks of the following types: %v Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sPacketNumber: %d, PacketNumberLen: %d, Length: %d, Version: %s}0051953eb9618e1c9a1f929a21a0b68540eea2da725b99b315f3b8b489918ef109e156193951ec7e937b1652c0bd3bb1bf073573df883d2c34f1ef451fd46b503f0000c6858e06b70404e9cd9e3ecb662395b4429c648139053fb521f828af606b4d3dbaa14b5e77efe75928fe1dc127a2ffa8de3348b3c1856a429bf97e7e31c2e5bd66011839296a789a3bc0045c8a5fb42c7d1bd998f54449579b446817afbd17273e662c97ee72995ef42640c550b9013fad0761353c7086a272c24088be94769fd16650HTTP/1.1 431 Request Header Fields Too Large Content-Type: text/plain; charset=utf-8 Connection: close 431 Request Header Fields Too LargeGenerate the autocompletion script for %[1]s for the specified shell. See each sub-command's help for details on how to use the generated script. if [[ $(type -t compopt) = "builtin" ]]; then complete -o default -F __start_%s %s else complete -o default -o nospace -F __start_%s %s fi Received invalid IPv6 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.Received invalid IPv4 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.68647976601306097149819007990813932172694353001433054093944634591855431833976560521225596406614545549772963113914808580371219879997166438125740282911150571516864797660130609714981900799081393217269435300143305409394463459185543183397655394245057746333217197532963996371363321113864768612440380340372808892707005449[WARNING] OS reports a contradiction: %v - but we cannot connect to it, with this error: %v; continuing anyway 🤠(I don't know what causes this... if you do, please help?)http2: TLSConfig.CipherSuites is missing an HTTP/2-required AES_128_GCM_SHA256 cipher (need at least one of TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 or TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256)00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899duplicate registration of %q The generated definition for this file has moved: from: %q to: %q A dependency on the %q module must be at version %v or higher. Upgrade the dependency by running: go get -u %v InitialMaxStreamDataBidiLocal: %d, InitialMaxStreamDataBidiRemote: %d, InitialMaxStreamDataUni: %d, InitialMaxData: %d, MaxBidiStreamNum: %d, MaxUniStreamNum: %d, MaxIdleTimeout: %s, AckDelayExponent: %d, MaxAckDelay: %s, ActiveConnectionIDLimit: %dÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿ ÿÿÿÿÿÿÿ ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿ ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿ€@À  `àPĞ0°pğˆHÈ(¨hè˜XØ8¸xø„DÄ$¤dä”TÔ4´tô ŒLÌ,¬lìœ\Ü<¼|ü‚BÂ"¢bâ’RÒ2²rò ŠJÊ*ªjêšZÚ:ºzú†FÆ&¦fæ–VÖ6¶vöNÎ.®nî^Ş>¾~şAÁ!¡aá‘QÑ1±qñ ‰IÉ)©ié™YÙ9¹yù…EÅ%¥eå•UÕ5µuõ MÍ-­mí]İ=½}ıƒCÃ#£cã“SÓ3³só ‹KË+«kë›[Û;»{û‡GÇ'§gç—W×7·w÷OÏ/¯oïŸ_ß?¿ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿGenerate the autocompletion script for powershell. To load completions in your current shell session: %[1]s completion powershell | Out-String | Invoke-Expression To load completions for every new session, add the output of the above command to your powershell profile. Generate the autocompletion script for the fish shell. To load completions in your current shell session: %[1]s completion fish | source To load completions for every new session, execute once: %[1]s completion fish > ~/.config/fish/completions/%[1]s.fish You will need to start a new shell for this setup to take effect. ░█░█░█░█░█▀▀░▀█▀░█▀▀░█▀▄░▀█▀░█▀█░░░▀▀▄ ░█▀█░░█░░▀▀█░░█░░█▀▀░█▀▄░░█░░█▀█░░░▄▀░ ░▀░▀░░▀░░▀▀▀░░▀░░▀▀▀░▀░▀░▀▀▀░▀░▀░░░▀▀▀ \127\128\129\130\131\132\133\134\135\136\137\138\139\140\141\142\143\144\145\146\147\148\149\150\151\152\153\154\155\156\157\158\159\160\161\162\163\164\165\166\167\168\169\170\171\172\173\174\175\176\177\178\179\180\181\182\183\184\185\186\187\188\189\190\191\192\193\194\195\196\197\198\199\200\201\202\203\204\205\206\207\208\209\210\211\212\213\214\215\216\217\218\219\220\221\222\223\224\225\226\227\228\229\230\231\232\233\234\235\236\237\238\239\240\241\242\243\244\245\246\247\248\249\250\251\252\253\254\255Generate the autocompletion script for the bash shell. This script depends on the 'bash-completion' package. If it is not installed already, you can install it via your OS's package manager. To load completions in your current shell session: source <(%[1]s completion bash) To load completions for every new session, execute once: #### Linux: %[1]s completion bash > /etc/bash_completion.d/%[1]s #### macOS: %[1]s completion bash > $(brew --prefix)/etc/bash_completion.d/%[1]s You will need to start a new shell for this setup to take effect. Generate the autocompletion script for the zsh shell. If shell completion is not already enabled in your environment you will need to enable it. You can execute the following once: echo "autoload -U compinit; compinit" >> ~/.zshrc To load completions in your current shell session: source <(%[1]s completion zsh) To load completions for every new session, execute once: #### Linux: %[1]s completion zsh > "${fpath[1]}/_%[1]s" #### macOS: %[1]s completion zsh > $(brew --prefix)/share/zsh/site-functions/_%[1]s You will need to start a new shell for this setup to take effect. Hysteria Traffic Stats API Server

This is a Hysteria Traffic Stats API server.

Check the documentation for usage.

{ local cur prev words cword split declare -A flaghash 2>/dev/null || : declare -A aliashash 2>/dev/null || : if declare -F _init_completion >/dev/null 2>&1; then _init_completion -s || return else __%[1]s_init_completion -n "=" || return fi local c=0 local flag_parsing_disabled= local flags=() local two_word_flags=() local local_nonpersistent_flags=() local flags_with_completion=() local flags_completion=() local commands=("%[1]s") local command_aliases=() local must_have_one_flag=() local must_have_one_noun=() local has_completion_function="" local last_command="" local nouns=() local noun_aliases=() __%[1]s_handle_word } firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHRESETHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTOPEXTTMETSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastIDUsage:{{if .Runnable}} {{.UseLine}}{{end}}{{if .HasAvailableSubCommands}} {{.CommandPath}} [command]{{end}}{{if gt (len .Aliases) 0}} Aliases: {{.NameAndAliases}}{{end}}{{if .HasExample}} Examples: {{.Example}}{{end}}{{if .HasAvailableSubCommands}}{{$cmds := .Commands}}{{if eq (len .Groups) 0}} Available Commands:{{range $cmds}}{{if (or .IsAvailableCommand (eq .Name "help"))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{else}}{{range $group := .Groups}} {{.Title}}{{range $cmds}}{{if (and (eq .GroupID $group.ID) (or .IsAvailableCommand (eq .Name "help")))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{if not .AllChildCommandsHaveGroup}} Additional Commands:{{range $cmds}}{{if (and (eq .GroupID "") (or .IsAvailableCommand (eq .Name "help")))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{end}}{{end}}{{if .HasAvailableLocalFlags}} Flags: {{.LocalFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasAvailableInheritedFlags}} Global Flags: {{.InheritedFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasHelpSubCommands}} Additional help topics:{{range .Commands}}{{if .IsAdditionalHelpTopicCommand}} {{rpad .CommandPath .CommandPathPadding}} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableSubCommands}} Use "{{.CommandPath}} [command] --help" for more information about a command.{{end}} -----BEGIN RSA TESTING KEY----- MIIEvAIBADANBgkqhkiG9w0BAQEFAASCBKYwggSiAgEAAoIBAQDoZtrm0dXV0Aqi 4Bpc7f95sNRTiu/AJSD8I1onY9PnEsPg3VVxvytsVJbYdcqr4w99V3AgpH/UNzMS gAZ/8lZBNbsSDOVesJ3euVqMRfYPvd9pYl6QPRRpSDPm+2tNdn3QFAvta9EgJ3sW URnoU85w+W6aLI2bNSq3AaE771p3VbkGolpEjo9h+i42TBHo1rhPNKPkGupR8/QX AOLMpInRdeaHyDwb2a3DE5I3dG7VAVzrVfJ6W6Q84YoFX+rpEE2SVM17SAjy6xQy VjKgLvK2mk0xbtfa+h0B6VK7bmODHZqeP18NVm6HsBcXn7iclLgAC3SfWU1jucZK x1lqzw9tAgMBAAECggEABWzxS1Y2wckblnXY57Z+sl6YdmLV+gxj2r8Qib7g4ZIk lIlWR1OJNfw7kU4eryib4fc6nOh6O4AWZyYqAK6tqNQSS/eVG0LQTLTTEldHyVJL dvBe+MsUQOj4nTndZW+QvFzbcm2D8lY5n2nBSxU5ypVoKZ1EqQzytFcLZpTN7d89 EPj0qDyrV4NZlWAwL1AygCwnlwhMQjXEalVF1ylXwU3QzyZ/6MgvF6d3SSUlh+sq XefuyigXw484cQQgbzopv6niMOmGP3of+yV4JQqUSb3IDmmT68XjGd2Dkxl4iPki 6ZwXf3CCi+c+i/zVEcufgZ3SLf8D99kUGE7v7fZ6AQKBgQD1ZX3RAla9hIhxCf+O 3D+I1j2LMrdjAh0ZKKqwMR4JnHX3mjQI6LwqIctPWTU8wYFECSh9klEclSdCa64s uI/GNpcqPXejd0cAAdqHEEeG5sHMDt0oFSurL4lyud0GtZvwlzLuwEweuDtvT9cJ Wfvl86uyO36IW8JdvUprYDctrQKBgQDycZ697qutBieZlGkHpnYWUAeImVA878sJ w44NuXHvMxBPz+lbJGAg8Cn8fcxNAPqHIraK+kx3po8cZGQywKHUWsxi23ozHoxo +bGqeQb9U661TnfdDspIXia+xilZt3mm5BPzOUuRqlh4Y9SOBpSWRmEhyw76w4ZP OPxjWYAgwQKBgA/FehSYxeJgRjSdo+MWnK66tjHgDJE8bYpUZsP0JC4R9DL5oiaA brd2fI6Y+SbyeNBallObt8LSgzdtnEAbjIH8uDJqyOmknNePRvAvR6mP4xyuR+Bv m+Lgp0DMWTw5J9CKpydZDItc49T/mJ5tPhdFVd+am0NAQnmr1MCZ6nHxAoGABS3Y LkaC9FdFUUqSU8+Chkd/YbOkuyiENdkvl6t2e52jo5DVc1T7mLiIrRQi4SI8N9bN /3oJWCT+uaSLX2ouCtNFunblzWHBrhxnZzTeqVq4SLc8aESAnbslKL4i8/+vYZlN s8xtiNcSvL+lMsOBORSXzpj/4Ot8WwTkn1qyGgECgYBKNTypzAHeLE6yVadFp3nQ Ckq9yzvP/ib05rvgbvrne00YeOxqJ9gtTrzgh7koqJyX1L4NwdkEza4ilDWpucn0 xiUZS4SoaJq6ZvcBYS62Yr1t8n09iG47YL8ibgtmH3L+svaotvpVxVK+d7BLevA/ ZboOWVe3icTy64BT3OQhmg== -----END RSA TESTING KEY----- °ì­Ø­Ù 37?/* & * ; 9 %«í«â«ã©à©á©æ£Ë£È£É#>'  1<   0 ")  7  +19$€p$: Ár.Ár,Ár:>,Ás<Ás*ÂL$ÂL; ) ƒ«ãƒ«ò 4à«ê«ó 4ï–áÍ„åà ‹ìË”ìÏšì‹ìÛ”ìßšìÒ ! #ʠʣœÊ¢ŸÊ¥ʤ‘ʧʦ“Ê©’ʨ•ÊóµÊğ´Êñ·Êö¶Ê÷‰ÊôˆÊõ‹ÊúŠÊûÊøŒÊùÊşÊÿÊü€ÊıƒÊâ‚Êã…Êà„Êá‡Êæ†Êç™Êä˜Êå›ÊêšÊëÊèœØ“‰ß”‹0 ,)4< '2869/9 :::%;/;%46 7*000.111022-33>'   #(66' &     5     <+)?45454)/)5+++ +<*&*"&8!!"+.4=    <>5<5!5#5&4447133.<.):)<) )+-+5$$''&"6" "   ?  (0 == =1 =, =  ?? < 9! 9) 97 99 6  6 6 7' 78 73 ' '&   3 /    "      > + / 6     <3 ;* 9" 9) 97 + (( &5 $ $ % #< #0 #  # !: ! ! 5  - ( .     $ "   2 =  & 1 : # <     2 1   / +     5 9 = ?1364<  % .2>13 %$8;422/,?  /><>>>:>+?>"4.<% 09'“ıõ  # ! & " / , $ ' % ; = ? 9. 7 .:9' 1&90  96#20 2 0(2,3 :8% 5*;.-, 87/ ,--/( 57.97 *%60 ;'2.2=$=' 6,;.,†ùêÿë 2 5 4 ; > 8 * / , % & # !%$+.*&8>460 ‹ıĞìƇàŠ-2ã€ïä-2êˆæëæè„æé—æî-2ù-2ö㭀㒈ãã€ã—ˆã•ˆşËşÊ„şÍ‘ïÉ-2Á-2À-2ˈ@ @àõæùàú“ÿô„îÓ (3  )1;* # 0 ! !0 ?5   7 +# # 2   #;='  1  3. /,#>8 " 8> /'" + " /1 74 ","?$5<3=*8  7+7(;?  $$;,$  >>  )    '< .' " )*)<,  . # ' 8 %2+&0 )4   * $ 0 *( 29,4'  : . . +0   "0 ;,/"1 .  7 2 . 1 :/0+- , =  ;/ :  . 4  1#4"'8>57&9+ .  ,> 4#%"  +  +  +   =   &0(75'6.=;;, > < % < %!   0' = >4>&? ?( - :3 8:   72% "< /<>+ '?   <=  "  )= /4 7 : ?3 :/   7"0(  %< +  70 >570 =%, 9# >  < +,:%" $ =+ /  ' #   22< 1  -  ?   1& / $<3 $  ?5 ##02(+   +02  + -? #: # %$ >+ 01 1 9    *) - .1 .2 < >  3  2  %,&!"9(  2    #().1 $ '8 07#7-)2 6  (!5  / , 3 ,1 /5 "1 "  ?% <, ?# > &  : + " )   - ( ) /  . , /* -9 "8 %  : ; ? 3% 6 6 7 , ,    8*/24:"+ 0& ;>$>292:1,1<17#7* '-4*7'!%7  1 .0=  :*1-"32:0$6445  7  +  +-‰Êê‰Êè 8 8 8 8% 8! 8- 8/ 8+ 87 85 9  9  9 9 Ïu ÏuÏuÏu  9 9 Ï`;Ï`>Ï`9Ï`8Ï`7Ï`*Ï`-Ï`,  & =. =% > > ? ?  ?  ?  ? > > >  >, >  ? ? ? ? ? ? ? ? ? ?  ? ? ?  =2 =6 < <:!:#8 :&8 :$:,88:*:7:5:;::<:4:':-:%:?:=:):/Ïs' = +* 99 9; 9? )  (%(')+/ " " "' "/ "3 "$$!8745' 2=;: $ ) $ , .  .# (/ % 90 4  # , 2  :3      0> -> <+ 8 3  % "&   %9 &2 &0 ! !7 5 =4 ? >  : 9  % - - ,4 ., )  6! 1 3 + 8  8= ( ( +   3)!  %#>"%*;70 ; /-715+>79+, "0 ̈a Ì„23 Ì Ì§1o1â„41â„23â„4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ÌŠ ̨ ̃ Ì‹lxÌˆÌ Î¹; ̈Ìեւاٴوٴۇٴيٴक़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼à¹à¸²à»àº²àº«àº™àº«àº¡à½‚ྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱཱྀྀྒྷྜྷྡྷྦྷྫྷà¾à¾µĞ²Ğ´Ğ¾ÑтъѣæbdeÇgikmnÈ£ptuÉɑəɛɜŋɔɯvβγδφχÏнɒcɕðfɟɡɥɨɩɪÊɭʟɱɰɲɳɴɵɸʂʃƫʉʊʋʌzÊʑʒθssάέήίόÏÏἀιá¼Î¹á¼‚ιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧιὰιαιάιᾶιι ̈͂ὴιηιήιῆι Ì“Ì€ Ì“Ì Ì“Í‚Î Ì”Ì€ Ì”Ì Ì”Í‚Î° ̈̀`ὼιωιÏιῶι′′′′′‵‵‵‵‵!!???!!?′′′′0456789+=()rsħnoqsmtmωå×בגדπ1â„71â„91â„101â„32â„31â„52â„53â„54â„51â„65â„61â„83â„85â„87â„81â„iiivviviiiixxi0â„3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==â«Ì¸É«É½È¿É€. ã‚™ ゚よりコト(á„€)(á„‚)(ᄃ)(á„…)(ᄆ)(ᄇ)(ᄉ)(á„‹)(á„Œ)(á„)(á„)(á„)(á„‘)(á„’)(ê°€)(나)(다)(ë¼)(마)(ë°”)(사)(ì•„)(ì)(ì°¨)(ì¹´)(타)(파)(하)(주)(오전)(오후)(一)(二)(三)(å››)(五)(å…­)(七)(å…«)(ä¹)(å)(月)(ç«)(æ°´)(木)(金)(土)(æ—¥)(æ ª)(有)(社)(å)(特)(財)(ç¥)(労)(代)(呼)(å­¦)(監)(ä¼)(資)(å”)(祭)(休)(自)(至)212223242526272829303132333435참고주ì˜3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパートアルファアンペアアールイニングインãƒã‚¦ã‚©ãƒ³ã‚¨ã‚¹ã‚¯ãƒ¼ãƒ‰ã‚¨ãƒ¼ã‚«ãƒ¼ã‚ªãƒ³ã‚¹ã‚ªãƒ¼ãƒ ã‚«ã‚¤ãƒªã‚«ãƒ©ãƒƒãƒˆã‚«ãƒ­ãƒªãƒ¼ã‚¬ãƒ­ãƒ³ã‚¬ãƒ³ãƒã‚®ã‚¬ã‚®ãƒ‹ãƒ¼ã‚­ãƒ¥ãƒªãƒ¼ã‚®ãƒ«ãƒ€ãƒ¼ã‚­ãƒ­ã‚­ãƒ­ã‚°ãƒ©ãƒ ã‚­ãƒ­ãƒ¡ãƒ¼ãƒˆãƒ«ã‚­ãƒ­ãƒ¯ãƒƒãƒˆã‚°ãƒ©ãƒ ã‚°ãƒ©ãƒ ãƒˆãƒ³ã‚¯ãƒ«ã‚¼ã‚¤ãƒ­ã‚¯ãƒ­ãƒ¼ãƒã‚±ãƒ¼ã‚¹ã‚³ãƒ«ãƒŠã‚³ãƒ¼ãƒã‚µã‚¤ã‚¯ãƒ«ã‚µãƒ³ãƒãƒ¼ãƒ ã‚·ãƒªãƒ³ã‚°ã‚»ãƒ³ãƒã‚»ãƒ³ãƒˆãƒ€ãƒ¼ã‚¹ãƒ‡ã‚·ãƒ‰ãƒ«ãƒˆãƒ³ãƒŠãƒãƒãƒƒãƒˆãƒã‚¤ãƒ„パーセントパーツãƒãƒ¼ãƒ¬ãƒ«ãƒ”アストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータãƒã‚¤ãƒ³ãƒˆãƒœãƒ«ãƒˆãƒ›ãƒ³ãƒãƒ³ãƒ‰ãƒ›ãƒ¼ãƒ«ãƒ›ãƒ¼ãƒ³ãƒã‚¤ã‚¯ãƒ­ãƒã‚¤ãƒ«ãƒãƒƒãƒãƒãƒ«ã‚¯ãƒãƒ³ã‚·ãƒ§ãƒ³ãƒŸã‚¯ãƒ­ãƒ³ãƒŸãƒªãƒŸãƒªãƒãƒ¼ãƒ«ãƒ¡ã‚¬ãƒ¡ã‚¬ãƒˆãƒ³ãƒ¡ãƒ¼ãƒˆãƒ«ãƒ¤ãƒ¼ãƒ‰ãƒ¤ãƒ¼ãƒ«ãƒ¦ã‚¢ãƒ³ãƒªãƒƒãƒˆãƒ«ãƒªãƒ©ãƒ«ãƒ”ールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20点21点22点23点24点daauovpcdmiuå¹³æˆæ˜­å’Œå¤§æ­£æ˜æ²»æ ªå¼ä¼šç¤¾panamakakbmbgbkcalpfnfmgkghzmldlklfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhahpinkkktlmlnlxphprsrsvwbv∕ma∕m1æ—¥2æ—¥3æ—¥4æ—¥5æ—¥6æ—¥7æ—¥8æ—¥9æ—¥10æ—¥11æ—¥12æ—¥13æ—¥14æ—¥15æ—¥16æ—¥17æ—¥18æ—¥19æ—¥20æ—¥21æ—¥22æ—¥23æ—¥24æ—¥25æ—¥26æ—¥27æ—¥28æ—¥29æ—¥30æ—¥31日ьɦɬÊʇœÊ𤋮𢡊𢡄ğ£•ğ¥‰‰ğ¥³ğ§»“fffiflstմնմեմիվնմխיִײַעהכל×רתש×שׂשּ×שּׂ×Ö·×Ö¸×ּבּגּדּהּוּזּטּיּךּכּלּ×ּנּסּףּפּצּקּרּשּתּוֹבֿכֿפֿ×לٱٻپڀٺٿٹڤڦڄڃچڇÚÚŒÚÚˆÚ˜Ú‘Ú©Ú¯Ú³Ú±ÚºÚ»Û€ÛÚ¾Û’Û“Ú­Û‡Û†ÛˆÛ‹Û…Û‰ÛىئائەئوئۇئۆئۈئÛئىیئجئحئمئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحطمظمعجعمغجغمÙجÙØ­ÙØ®ÙÙ…ÙÙ‰Ùيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمينجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ÙÙ‘ ÙÙ‘ ÙÙ‘ ÙÙ‘ ّٰئرئزئنبربزبنترتزتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـÙّـÙّـÙّطىطيعىعيغىغيسىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميحمىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمىÙخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنمينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمينحيعميكمينجحمخيلجمكممجحيحجيمجيÙميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليهوسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\$%@ـًـÙÙ€ÙÙ€ÙـّـْءآأؤإئابةتثجحخدذرزسشصضطظعغÙقكلمنهويلآلألإلا"'/^|~¢£¬¦¥ËˑʙɓʣꭦʥʤɖɗᶑɘÉʩɤɢɠʛʜɧʄʪʫêÉ®ÊøɶɷɺɾʀʨʦꭧʧʈⱱÊʡʢʘǀÇÇ‚ğ…—ğ…¥ğ…˜ğ…¥ğ…˜ğ…¥ğ…®ğ…˜ğ…¥ğ…¯ğ…˜ğ…¥ğ…°ğ…˜ğ…¥ğ…±ğ…˜ğ…¥ğ…²ğ†¹ğ…¥ğ†ºğ…¥ğ†¹ğ…¥ğ…®ğ†ºğ…¥ğ…®ğ†¹ğ…¥ğ…¯ğ†ºğ…¥ğ…¯Ä±È·Î±ÎµÎ¶Î·ÎºÎ»Î¼Î½Î¾Î¿ÏƒÏ„υψ∇∂ÏабгежзиклмпруфхцчшыÑÑꚉәіјөүÓґѕџҫꙑұٮڡٯ0,1,2,3,4,5,6,7,8,9,(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)〔s〕wzhvsdppvwcmcmdmrdjã»ã‹ã‚³ã‚³ã‚µæ‰‹å­—åŒãƒ‡äºŒå¤šè§£å¤©äº¤æ˜ ç„¡æ–™å‰å¾Œå†æ–°åˆçµ‚生販声å¹æ¼”投æ•ä¸€ä¸‰éŠå·¦ä¸­å³æŒ‡èµ°æ‰“ç¦ç©ºåˆæº€æœ‰æœˆç”³å‰²å–¶é…〔本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔å‹ã€•ã€”敗〕得å¯ä¸½ä¸¸ä¹ä½ ä¾®ä¾»å€‚åºå‚™åƒ§åƒã’å…兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北å‰å‘åšå³å½å¿ç°åŠåŸå«å±å†å’å¸å‘ˆå‘¨å’¢å“¶å”啓啣善喙喫喳嗂圖嘆圗噑噴切壮åŸåŸ´å å‹å ²å ±å¢¬å£²å£·å¤†å¤¢å¥¢å§¬å¨›å¨§å§˜å©¦ã›®å¬ˆå¬¾å¯ƒå¯˜å¯§å¯³å¯¿å°†å°¢ã屠屮峀å²åµƒåµ®åµ«åµ¼å·¡å·¢ã ¯å·½å¸¨å¸½å¹©ã¡¢ã¡¼åº°åº³åº¶å»Šå»¾èˆå¼¢ã£‡å½¢å½«ã££å¾šå¿å¿—忹æ‚㤺㤜悔惇慈慌æ…æ…ºæ†æ†²æ†¤æ†¯æ‡æ‡²æ‡¶æˆæˆ›æ‰æŠ±æ‹”æ挽拼æ¨æƒæ¤æ¢æ…æ©ã¨®æ‘©æ‘¾æ’摷㩬æ•æ•¬æ—£æ›¸æ™‰ã¬™æš‘㬈㫤冒冕最暜肭ä™æœ—望朡ææ“㭉柺æ…桒梅æ¢æ Ÿæ¤”ã®æ¥‚榣槪檨櫛㰘次歔ã±æ­²æ®Ÿæ®ºæ®»æ±æ²¿æ³æ±§æ´–派海æµæµ©æµ¸æ¶…洴港湮㴳滋滇淹潮濆瀹ç€ç€›ã¶–çŠç½ç·ç‚­ç……熜爨爵ç‰çŠ€çŠ•çºç‹ãº¬ç¥ãº¸ç‘‡ç‘œç‘±ç’…瓊㼛甤甾異ç˜ã¿¼ä€ˆç›´çœçœŸçŠä€¹ç‹ä†ä‚–ç¡ç¢Œç£Œäƒ£ç¥–ç¦ç§«ä„¯ç©€ç©Šç©äˆ‚篆築䈧糒䊠糨糣紀絣äŒç·‡ç¸‚繅䌴ä™ç½ºç¾•ç¿ºè€…è è°ä•è‚²è„ƒä‹è„¾åªµèˆ„è¾ä‘«èŠ‘芋èŠåŠ³èŠ±èŠ³èŠ½è‹¦è‹¥èŒè£è­èŒ£è½è§è‘—è“èŠèŒèœä”«è“±è“³è”–蕤ä•ä•¡ä•«è™è™œè™§è™©èš©èšˆèœè›¢è¹èœ¨è«è†èŸ¡è ä—¹è¡ è¡£è£—è£ä˜µè£ºã’»äš¾ä›‡èª è«­è®Šè±•è²«è³è´›èµ·è·‹è¶¼è·°è»”輸邔郱鄑鄛鈸鋗鋘鉼é¹é•é–‹ä¦•é–·ä§¦é›ƒå¶²éœ£ä©®ä©¶éŸ äª²é ‹é ©é£¢ä¬³é¤©é¦§é§‚駾ä¯é¬’鱀鳽ä³ä³­éµ§ä³¸éº»äµ–黹黾鼅é¼é¼–é¼»AÀAÁAÂAÃAÄA ÅC'ÇEÈEÉEÊEËIÌIÍIÎIÏNÑOÒOÓOÔOÕOÖUÙUÚUÛUÜYİaàaáaâaãaäa åc'çeèeéeêeëiìiíiîiïnñoòoóoôoõoöuùuúuûuüyıyÿAaAaA(a(CcCc C c C  c  D d EeEeEeE(e(E e GgGgG g!G'"g'#H$h%I(i)I*i+I,i-I(.i(/I0J4j5K'6k'7L9l:L';l'<L =l >NCnDN'En'FN Gn HOLoMONoOO Po QRTrUR'Vr'WR Xr YSZs[S\s]S'^s'_S `s aT'bt'cT dt eUhuiUjukUlumU nu oU pu qU(ru(sWtwuYvywYxZyzzZ{z|Z }z ~O o¡U¯u°A Ía ÎI Ïi ĞO Ño ÒU Óu ÔÜÕüÖÜ×üØÜ Ùü ÚÜÛüÜÄŞäß&à'áÆâæãG æg çK èk éO(êo(ëêìëí· î’ ïj ğGôgõNønùÅúåûÆüæıØşøÿAaAaEeEeIi I i O o OoRrRrUuUuS&s&T&t&H h A&a'E'(e')Ö*ö+Õ,õ-O.o/.0/1Y2y3¨…‘†•ˆ—‰™ŠŸŒ¥©Ê™ª¥«±¬µ­·®¹¯Ë°¹ÊÅË¿ÌÅÍÉÎÒÓÒÔ  #895P5Q3SVW:\8]C^tvuwÁ6ÂĞ0ÑÒ0ÓÖ5×ØÚÙÛÜ6İŞ7ßâ8ãä8åæ>çèêéë-ìMí#îCï#ğCñ# òC ó'ôGõ+øKù'S"'T#HT$'U%JT&ÕTÀÁTÂÒTÓ ( < ) 0 < 1 3 < 4 Ç ¾ Ë Ç × Ì G V H G > K G W L ’ × ” Æ ¾ Ê Ç ¾ Ë Æ × Ì F V H ¿ Õ À Æ Õ Ç Æ Ö È Æ Â Ê Ê Õ Ë F > J G > K F W L Ù Ê Ú Ù Ï Ü Ü Ê İ Ù ß Ş%.&55 5  5  55:5;<5=>5@?5AB5CA%a%BbB#b#B1b1Çç D d D# d# D1d1D'd'D-d-E-e-E0e0()FfG g!H"h#H#$h#%H&h'H'(h')H.*h.+I0,i0-Ï.ï/K0k1K#2k#3K14k15L#6l#76879L1:l1;L-<l-=M>m?M@mAM#Bm#CNDnEN#Fn#GN1Hn1IN-Jn-KÕLõMÕNõOLPMQLRMSPTpUPVpWRXrYR#Zr#[Z\[]R1^r1_S`saS#bs#cZd[e`fagbhciTjtkT#lt#mT1nt1oT-pt-qU$ru$sU0tu0uU-vu-whxiyjzk{V|v}V#~v#W€wW‚wƒW„w…W†w‡W#ˆw#‰XŠx‹XŒxYyZz‘Z#’z#“Z1”z1•h1–t—w ˜y ™›A# a#¡A ¢a £Â¤â¥Â¦â§Â ¨â ©Âªâ« ¬¡­®¯°± ² ³´µ ¶¡·E#¸e#¹E ºe »E¼e½Ê¾ê¿ÊÀêÁÊ Âê ÃÊÄêŸƹÇI Èi ÉI#Êi#ËO#Ìo#ÍO Îo ÏÔĞôÑÔÒôÓÔ Ôô ÕÔÖô×ÌØÍÙ Ú¡Û Ü¡İ  Ş¡ ß à¡á #â¡#ãU#äu#åU æu ç¯è°é¯ê°ë¯ ì° í¯î°ï¯#ğ°#ñYòyóY#ôy#õY öy ÷Yøyù±±BB‘‘       B Bµµ••· ·! "!# $!% B&!B'—(—)(*)+(,)-(B.)B/¹0¹1021304150B61B7™8™98:9;8<9=8B>9B?¿@¿A@BAC@DAEŸHŸIHJIKHLIMÅPÅQPRQSPTQUPBVQBW¥YY[Y]YB_É`Éa`bac`dae`BfaBg©h©ihjikhlimhBniBo±pµr·t¹v¿xÅzÉ|E€EE‚EƒE„E…E†E‡Eˆ E‰ EŠ E‹ EŒ EEE E!E‘"E’#E“$E”%E•&E–'E—(E˜)E™*Eš+E›,Eœ-E.E/EŸ`E aE¡bE¢cE£dE¤eE¥fE¦gE§hE¨iE©jEªkE«lE¬mE­nE®oE¯±°±±pE²±E³¬E´±B¶¶E·‘¸‘¹‘º‘E¼¨BÁtE·EîEÄ·BÆÆEÇ•È—Ê—E̿ͿοBϹйÑÊÒ¹BÖÊB×™Ø™Ù™ÚşİşŞşBßÅàÅáËâÁäÁåÅBæËBç¥è¥é¥ê¡ì¨í|EòÉEóÎEôÉBööE÷Ÿø©ú©Eü!8!š!’8!›!”8!®!Ğ8!Í!Ô8!Î!Ò8!Ï"8""8" " 8" "#8"$"%8"&"<8"A"C8"D"E8"G"H8"I=8"`"a8"b"M8"m<8"n>8"o"d8"p"e8"q"r8"t"s8"u"v8"x"w8"y"z8"€"{8""‚8"„"ƒ8"…"†8"ˆ"‡8"‰"¢8"¬"¨8"­"©8"®"«8"¯"|8"à"}8"á"‘8"â"’8"ã"²8"ê"³8"ë"´8"ì"µ8"í0K0™0L0M0™0N0O0™0P0Q0™0R0S0™0T0U0™0V0W0™0X0Y0™0Z0[0™0\0]0™0^0_0™0`0a0™0b0d0™0e0f0™0g0h0™0i0o0™0p0o0š0q0r0™0s0r0š0t0u0™0v0u0š0w0x0™0y0x0š0z0{0™0|0{0š0}0F0™0”00™00«0™0¬0­0™0®0¯0™0°0±0™0²0³0™0´0µ0™0¶0·0™0¸0¹0™0º0»0™0¼0½0™0¾0¿0™0À0Á0™0Â0Ä0™0Å0Æ0™0Ç0È0™0É0Ï0™0Ğ0Ï0š0Ñ0Ò0™0Ó0Ò0š0Ô0Õ0™0Ö0Õ0š0×0Ø0™0Ù0Ø0š0Ú0Û0™0Ü0Û0š0İ0¦0™0ô0ï0™0÷0ğ0™0ø0ñ0™0ù0ò0™0ú0ı0™0ş™ºš›ºœ¥º«1'.2'/G>KGWL¹º»¹°¼¹½¾¸¯º¹¯»508#compdef %[1]s compdef _%[1]s %[1]s # zsh completion for %-36[1]s -*- shell-script -*- __%[1]s_debug() { local file="$BASH_COMP_DEBUG_FILE" if [[ -n ${file} ]]; then echo "$*" >> "${file}" fi } _%[1]s() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d local lastParam lastChar flagPrefix requestComp out directive comp lastComp noSpace keepOrder local -a completions __%[1]s_debug "\n========= starting completion logic ==========" __%[1]s_debug "CURRENT: ${CURRENT}, words[*]: ${words[*]}" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CURRENT location, so we need # to truncate the command-line ($words) up to the $CURRENT location. # (We cannot use $CURSOR as its value does not work when a command is an alias.) words=("${=words[1,CURRENT]}") __%[1]s_debug "Truncated words[*]: ${words[*]}," lastParam=${words[-1]} lastChar=${lastParam[-1]} __%[1]s_debug "lastParam: ${lastParam}, lastChar: ${lastChar}" # For zsh, when completing a flag with an = (e.g., %[1]s -n=) # completions must be prefixed with the flag setopt local_options BASH_REMATCH if [[ "${lastParam}" =~ '-.*=' ]]; then # We are dealing with a flag with an = flagPrefix="-P ${BASH_REMATCH}" fi # Prepare the command to obtain completions requestComp="${words[1]} %[2]s ${words[2,-1]}" if [ "${lastChar}" = "" ]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go completion code. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} \"\"" fi __%[1]s_debug "About to call: eval ${requestComp}" # Use eval to handle any environment variables and such out=$(eval ${requestComp} 2>/dev/null) __%[1]s_debug "completion output: ${out}" # Extract the directive integer following a : from the last line local lastLine while IFS='\n' read -r line; do lastLine=${line} done < <(printf "%%s\n" "${out[@]}") __%[1]s_debug "last line: ${lastLine}" if [ "${lastLine[1]}" = : ]; then directive=${lastLine[2,-1]} # Remove the directive including the : and the newline local suffix (( suffix=${#lastLine}+2)) out=${out[1,-$suffix]} else # There is no directive specified. Leave $out as is. __%[1]s_debug "No directive found. Setting do default" directive=0 fi __%[1]s_debug "directive: ${directive}" __%[1]s_debug "completions: ${out}" __%[1]s_debug "flagPrefix: ${flagPrefix}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then __%[1]s_debug "Completion received error. Ignoring completions." return fi local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} local startIndex=$((${#activeHelpMarker}+1)) local hasActiveHelp=0 while IFS='\n' read -r comp; do # Check if this is an activeHelp statement (i.e., prefixed with $activeHelpMarker) if [ "${comp[1,$endIndex]}" = "$activeHelpMarker" ];then __%[1]s_debug "ActiveHelp found: $comp" comp="${comp[$startIndex,-1]}" if [ -n "$comp" ]; then compadd -x "${comp}" __%[1]s_debug "ActiveHelp will need delimiter" hasActiveHelp=1 fi continue fi if [ -n "$comp" ]; then # If requested, completions are returned with a description. # The description is preceded by a TAB character. # For zsh's _describe, we need to use a : instead of a TAB. # We first need to escape any : as part of the completion itself. comp=${comp//:/\\:} local tab="$(printf '\t')" comp=${comp//$tab/:} __%[1]s_debug "Adding completion: ${comp}" completions+=${comp} lastComp=$comp fi done < <(printf "%%s\n" "${out[@]}") # Add a delimiter after the activeHelp statements, but only if: # - there are completions following the activeHelp statements, or # - file completion will be performed (so there will be choices after the activeHelp) if [ $hasActiveHelp -eq 1 ]; then if [ ${#completions} -ne 0 ] || [ $((directive & shellCompDirectiveNoFileComp)) -eq 0 ]; then __%[1]s_debug "Adding activeHelp delimiter" compadd -x "--" hasActiveHelp=0 fi fi if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then __%[1]s_debug "Activating nospace." noSpace="-S ''" fi if [ $((directive & shellCompDirectiveKeepOrder)) -ne 0 ]; then __%[1]s_debug "Activating keep order." keepOrder="-V" fi if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local filteringCmd filteringCmd='_files' for filter in ${completions[@]}; do if [ ${filter[1]} != '*' ]; then # zsh requires a glob pattern to do file filtering filter="\*.$filter" fi filteringCmd+=" -g $filter" done filteringCmd+=" ${flagPrefix}" __%[1]s_debug "File filtering command: $filteringCmd" _arguments '*:filename:'"$filteringCmd" elif [ $((directive & shellCompDirectiveFilterDirs)) -ne 0 ]; then # File completion for directories only local subdir subdir="${completions[1]}" if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" pushd "${subdir}" >/dev/null 2>&1 else __%[1]s_debug "Listing directories in ." fi local result _arguments '*:dirname:_files -/'" ${flagPrefix}" result=$? if [ -n "$subdir" ]; then popd >/dev/null 2>&1 fi return $result else __%[1]s_debug "Calling _describe" if eval _describe $keepOrder "completions" completions $flagPrefix $noSpace; then __%[1]s_debug "_describe found some completions" # Return the success of having called _describe return 0 else __%[1]s_debug "_describe did not find completions." __%[1]s_debug "Checking if we should do file completion." if [ $((directive & shellCompDirectiveNoFileComp)) -ne 0 ]; then __%[1]s_debug "deactivating file completion" # We must return an error code here to let zsh know that there were no # completions found by _describe; this is what will trigger other # matching algorithms to attempt to find completions. # For example zsh can match letters in the middle of words. return 1 else # Perform file completion __%[1]s_debug "Activating file completion" # We must return the result of this command, so it must be the # last command, or else we must store its result to return it. _arguments '*:filename:_files'" ${flagPrefix}" fi fi fi } # don't run the completion function when being source-ed or eval-ed if [ "$funcstack[1]" = "_%[1]s" ]; then _%[1]s fi function __%[1]s_debug set -l file "$BASH_COMP_DEBUG_FILE" if test -n "$file" echo "$argv" >> $file end end function __%[1]s_perform_completion __%[1]s_debug "Starting __%[1]s_perform_completion" # Extract all args except the last one set -l args (commandline -opc) # Extract the last arg and escape it in case it is a space set -l lastArg (string escape -- (commandline -ct)) __%[1]s_debug "args: $args" __%[1]s_debug "last arg: $lastArg" # Disable ActiveHelp which is not supported for fish shell set -l requestComp "%[10]s=0 $args[1] %[3]s $args[2..-1] $lastArg" __%[1]s_debug "Calling $requestComp" set -l results (eval $requestComp 2> /dev/null) # Some programs may output extra empty lines after the directive. # Let's ignore them or else it will break completion. # Ref: https://github.com/spf13/cobra/issues/1279 for line in $results[-1..1] if test (string trim -- $line) = "" # Found an empty line, remove it set results $results[1..-2] else # Found non-empty line, we have our proper output break end end set -l comps $results[1..-2] set -l directiveLine $results[-1] # For Fish, when completing a flag with an = (e.g., -n=) # completions must be prefixed with the flag set -l flagPrefix (string match -r -- '-.*=' "$lastArg") __%[1]s_debug "Comps: $comps" __%[1]s_debug "DirectiveLine: $directiveLine" __%[1]s_debug "flagPrefix: $flagPrefix" for comp in $comps printf "%%s%%s\n" "$flagPrefix" "$comp" end printf "%%s\n" "$directiveLine" end # this function limits calls to __%[1]s_perform_completion, by caching the result behind $__%[1]s_perform_completion_once_result function __%[1]s_perform_completion_once __%[1]s_debug "Starting __%[1]s_perform_completion_once" if test -n "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Seems like a valid result already exists, skipping __%[1]s_perform_completion" return 0 end set --global __%[1]s_perform_completion_once_result (__%[1]s_perform_completion) if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completions, probably due to a failure" return 1 end __%[1]s_debug "Performed completions and set __%[1]s_perform_completion_once_result" return 0 end # this function is used to clear the $__%[1]s_perform_completion_once_result variable after completions are run function __%[1]s_clear_perform_completion_once_result __%[1]s_debug "" __%[1]s_debug "========= clearing previously set __%[1]s_perform_completion_once_result variable ==========" set --erase __%[1]s_perform_completion_once_result __%[1]s_debug "Succesfully erased the variable __%[1]s_perform_completion_once_result" end function __%[1]s_requires_order_preservation __%[1]s_debug "" __%[1]s_debug "========= checking if order preservation is required ==========" __%[1]s_perform_completion_once if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Error determining if order preservation is required" return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveKeepOrder %[9]d set -l keeporder (math (math --scale 0 $directive / $shellCompDirectiveKeepOrder) %% 2) __%[1]s_debug "Keeporder is: $keeporder" if test $keeporder -ne 0 __%[1]s_debug "This does require order preservation" return 0 end __%[1]s_debug "This doesn't require order preservation" return 1 end # This function does two things: # - Obtain the completions and store them in the global __%[1]s_comp_results # - Return false if file completion should be performed function __%[1]s_prepare_completions __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" # Start fresh set --erase __%[1]s_comp_results __%[1]s_perform_completion_once __%[1]s_debug "Completion results: $__%[1]s_perform_completion_once_result" if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completion, probably due to a failure" # Might as well do file completion, in case it helps return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) set --global __%[1]s_comp_results $__%[1]s_perform_completion_once_result[1..-2] __%[1]s_debug "Completions are: $__%[1]s_comp_results" __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveError %[4]d set -l shellCompDirectiveNoSpace %[5]d set -l shellCompDirectiveNoFileComp %[6]d set -l shellCompDirectiveFilterFileExt %[7]d set -l shellCompDirectiveFilterDirs %[8]d if test -z "$directive" set directive 0 end set -l compErr (math (math --scale 0 $directive / $shellCompDirectiveError) %% 2) if test $compErr -eq 1 __%[1]s_debug "Received error directive: aborting." # Might as well do file completion, in case it helps return 1 end set -l filefilter (math (math --scale 0 $directive / $shellCompDirectiveFilterFileExt) %% 2) set -l dirfilter (math (math --scale 0 $directive / $shellCompDirectiveFilterDirs) %% 2) if test $filefilter -eq 1; or test $dirfilter -eq 1 __%[1]s_debug "File extension filtering or directory filtering not supported" # Do full file completion instead return 1 end set -l nospace (math (math --scale 0 $directive / $shellCompDirectiveNoSpace) %% 2) set -l nofiles (math (math --scale 0 $directive / $shellCompDirectiveNoFileComp) %% 2) __%[1]s_debug "nospace: $nospace, nofiles: $nofiles" # If we want to prevent a space, or if file completion is NOT disabled, # we need to count the number of valid completions. # To do so, we will filter on prefix as the completions we have received # may not already be filtered so as to allow fish to match on different # criteria than the prefix. if test $nospace -ne 0; or test $nofiles -eq 0 set -l prefix (commandline -t | string escape --style=regex) __%[1]s_debug "prefix: $prefix" set -l completions (string match -r -- "^$prefix.*" $__%[1]s_comp_results) set --global __%[1]s_comp_results $completions __%[1]s_debug "Filtered completions are: $__%[1]s_comp_results" # Important not to quote the variable for count to work set -l numComps (count $__%[1]s_comp_results) __%[1]s_debug "numComps: $numComps" if test $numComps -eq 1; and test $nospace -ne 0 # We must first split on \t to get rid of the descriptions to be # able to check what the actual completion will be. # We don't need descriptions anyway since there is only a single # real completion which the shell will expand immediately. set -l split (string split --max 1 \t $__%[1]s_comp_results[1]) # Fish won't add a space if the completion ends with any # of the following characters: @=/:., set -l lastChar (string sub -s -1 -- $split) if not string match -r -q "[@=/:.,]" -- "$lastChar" # In other cases, to support the "nospace" directive we trick the shell # by outputting an extra, longer completion. __%[1]s_debug "Adding second completion to perform nospace directive" set --global __%[1]s_comp_results $split[1] $split[1]. __%[1]s_debug "Completions are now: $__%[1]s_comp_results" end end if test $numComps -eq 0; and test $nofiles -eq 0 # To be consistent with bash and zsh, we only trigger file # completion when there are no other completions __%[1]s_debug "Requesting file completion" return 1 end end return 0 end # Since Fish completions are only loaded once the user triggers them, we trigger them ourselves # so we can properly delete any completions provided by another script. # Only do this if the program can be found, or else fish may print some errors; besides, # the existing completions will only be loaded if the program can be found. if type -q "%[2]s" # The space after the program name is essential to trigger completion for the program # and not completion of the program name itself. # Also, we use '> /dev/null 2>&1' since '&>' is not supported in older versions of fish. complete --do-complete "%[2]s " > /dev/null 2>&1 end # Remove any pre-existing completions for the program since we will be handling all of them. complete -c %[2]s -e # this will get called after the two calls below and clear the $__%[1]s_perform_completion_once_result global complete -c %[2]s -n '__%[1]s_clear_perform_completion_once_result' # The call to __%[1]s_prepare_completions will setup __%[1]s_comp_results # which provides the program's completion choices. # If this doesn't require order preservation, we don't use the -k flag complete -c %[2]s -n 'not __%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # otherwise we use the -k flag complete -k -c %[2]s -n '__%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # powershell completion for %-36[1]s -*- shell-script -*- function __%[1]s_debug { if ($env:BASH_COMP_DEBUG_FILE) { "$args" | Out-File -Append -FilePath "$env:BASH_COMP_DEBUG_FILE" } } filter __%[1]s_escapeStringWithSpecialChars { $_ -replace '\s|#|@|\$|;|,|''|\{|\}|\(|\)|"|`|\||<|>|&','`$&' } [scriptblock]$__%[2]sCompleterBlock = { param( $WordToComplete, $CommandAst, $CursorPosition ) # Get the current command line and convert into a string $Command = $CommandAst.CommandElements $Command = "$Command" __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "WordToComplete: $WordToComplete Command: $Command CursorPosition: $CursorPosition" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CursorPosition location, so we need # to truncate the command-line ($Command) up to the $CursorPosition location. # Make sure the $Command is longer then the $CursorPosition before we truncate. # This happens because the $Command does not include the last space. if ($Command.Length -gt $CursorPosition) { $Command=$Command.Substring(0,$CursorPosition) } __%[1]s_debug "Truncated command: $Command" $ShellCompDirectiveError=%[4]d $ShellCompDirectiveNoSpace=%[5]d $ShellCompDirectiveNoFileComp=%[6]d $ShellCompDirectiveFilterFileExt=%[7]d $ShellCompDirectiveFilterDirs=%[8]d $ShellCompDirectiveKeepOrder=%[9]d # Prepare the command to request completions for the program. # Split the command at the first space to separate the program and arguments. $Program,$Arguments = $Command.Split(" ",2) $RequestComp="$Program %[3]s $Arguments" __%[1]s_debug "RequestComp: $RequestComp" # we cannot use $WordToComplete because it # has the wrong values if the cursor was moved # so use the last argument if ($WordToComplete -ne "" ) { $WordToComplete = $Arguments.Split(" ")[-1] } __%[1]s_debug "New WordToComplete: $WordToComplete" # Check for flag with equal sign $IsEqualFlag = ($WordToComplete -Like "--*=*" ) if ( $IsEqualFlag ) { __%[1]s_debug "Completing equal sign flag" # Remove the flag part $Flag,$WordToComplete = $WordToComplete.Split("=",2) } if ( $WordToComplete -eq "" -And ( -Not $IsEqualFlag )) { # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" # PowerShell 7.2+ changed the way how the arguments are passed to executables, # so for pre-7.2 or when Legacy argument passing is enabled we need to use # `"`" to pass an empty argument, a "" or '' does not work!!! if ($PSVersionTable.PsVersion -lt [version]'7.2.0' -or ($PSVersionTable.PsVersion -lt [version]'7.3.0' -and -not [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -or (($PSVersionTable.PsVersion -ge [version]'7.3.0' -or [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -and $PSNativeCommandArgumentPassing -eq 'Legacy')) { $RequestComp="$RequestComp" + ' `"`"' } else { $RequestComp="$RequestComp" + ' ""' } } __%[1]s_debug "Calling $RequestComp" # First disable ActiveHelp which is not supported for Powershell $env:%[10]s=0 #call the command store the output in $out and redirect stderr and stdout to null # $Out is an array contains each line per element Invoke-Expression -OutVariable out "$RequestComp" 2>&1 | Out-Null # get directive from last line [int]$Directive = $Out[-1].TrimStart(':') if ($Directive -eq "") { # There is no directive specified $Directive = 0 } __%[1]s_debug "The completion directive is: $Directive" # remove directive (last element) from out $Out = $Out | Where-Object { $_ -ne $Out[-1] } __%[1]s_debug "The completions are: $Out" if (($Directive -band $ShellCompDirectiveError) -ne 0 ) { # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return } $Longest = 0 [Array]$Values = $Out | ForEach-Object { #Split the output in name and description $Name, $Description = $_.Split("`t",2) __%[1]s_debug "Name: $Name Description: $Description" # Look for the longest completion so that we can format things nicely if ($Longest -lt $Name.Length) { $Longest = $Name.Length } # Set the description to a one space string if there is none set. # This is needed because the CompletionResult does not accept an empty string as argument if (-Not $Description) { $Description = " " } @{Name="$Name";Description="$Description"} } $Space = " " if (($Directive -band $ShellCompDirectiveNoSpace) -ne 0 ) { # remove the space here __%[1]s_debug "ShellCompDirectiveNoSpace is called" $Space = "" } if ((($Directive -band $ShellCompDirectiveFilterFileExt) -ne 0 ) -or (($Directive -band $ShellCompDirectiveFilterDirs) -ne 0 )) { __%[1]s_debug "ShellCompDirectiveFilterFileExt ShellCompDirectiveFilterDirs are not supported" # return here to prevent the completion of the extensions return } $Values = $Values | Where-Object { # filter the result $_.Name -like "$WordToComplete*" # Join the flag back if we have an equal sign flag if ( $IsEqualFlag ) { __%[1]s_debug "Join the equal sign flag back to the completion value" $_.Name = $Flag + "=" + $_.Name } } # we sort the values in ascending order by name if keep order isn't passed if (($Directive -band $ShellCompDirectiveKeepOrder) -eq 0 ) { $Values = $Values | Sort-Object -Property Name } if (($Directive -band $ShellCompDirectiveNoFileComp) -ne 0 ) { __%[1]s_debug "ShellCompDirectiveNoFileComp is called" if ($Values.Length -eq 0) { # Just print an empty string here so the # shell does not start to complete paths. # We cannot use CompletionResult here because # it does not accept an empty string as argument. "" return } } # Get the current mode $Mode = (Get-PSReadLineKeyHandler | Where-Object {$_.Key -eq "Tab" }).Function __%[1]s_debug "Mode: $Mode" $Values | ForEach-Object { # store temporary because switch will overwrite $_ $comp = $_ # PowerShell supports three different completion modes # - TabCompleteNext (default windows style - on each key press the next option is displayed) # - Complete (works like bash) # - MenuComplete (works like zsh) # You set the mode with Set-PSReadLineKeyHandler -Key Tab -Function # CompletionResult Arguments: # 1) CompletionText text to be used as the auto completion result # 2) ListItemText text to be displayed in the suggestion list # 3) ResultType type of completion result # 4) ToolTip text for the tooltip with details about the object switch ($Mode) { # bash like "Complete" { if ($Values.Length -eq 1) { __%[1]s_debug "Only one completion left" # insert space after value [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } else { # Add the proper number of spaces to align the descriptions while($comp.Name.Length -lt $Longest) { $comp.Name = $comp.Name + " " } # Check for empty description and only add parentheses if needed if ($($comp.Description) -eq " " ) { $Description = "" } else { $Description = " ($($comp.Description))" } [System.Management.Automation.CompletionResult]::new("$($comp.Name)$Description", "$($comp.Name)$Description", 'ParameterValue', "$($comp.Description)") } } # zsh like "MenuComplete" { # insert space after value # MenuComplete will automatically show the ToolTip of # the highlighted value at the bottom of the suggestions. [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } # TabCompleteNext and in case we get something unknown Default { # Like MenuComplete but we don't want to add a space here because # the user need to press space anyway to get the completion. # Description will not be shown because that's not possible with TabCompleteNext [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars), "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } } } } Register-ArgumentCompleter -CommandName '%[1]s' -ScriptBlock $__%[2]sCompleterBlock # bash completion V2 for %-36[1]s -*- shell-script -*- __%[1]s_debug() { if [[ -n ${BASH_COMP_DEBUG_FILE-} ]]; then echo "$*" >> "${BASH_COMP_DEBUG_FILE}" fi } # Macs have bash3 for which the bash-completion package doesn't include # _init_completion. This is a minimal version of that function. __%[1]s_init_completion() { COMPREPLY=() _get_comp_words_by_ref "$@" cur prev words cword } # This function calls the %[1]s program to obtain the completion # results and the directive. It fills the 'out' and 'directive' vars. __%[1]s_get_completion_results() { local requestComp lastParam lastChar args # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows to handle aliases args=("${words[@]:1}") requestComp="${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} __%[1]s_debug "lastParam ${lastParam}, lastChar ${lastChar}" if [[ -z ${cur} && ${lastChar} != = ]]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} ''" fi # When completing a flag with an = (e.g., %[1]s -n=) # bash focuses on the part after the =, so we need to remove # the flag part from $cur if [[ ${cur} == -*=* ]]; then cur="${cur#*=}" fi __%[1]s_debug "Calling ${requestComp}" # Use eval to handle any environment variables and such out=$(eval "${requestComp}" 2>/dev/null) # Extract the directive integer at the very end of the output following a colon (:) directive=${out##*:} # Remove the directive out=${out%%:*} if [[ ${directive} == "${out}" ]]; then # There is not directive specified directive=0 fi __%[1]s_debug "The completion directive is: ${directive}" __%[1]s_debug "The completions are: ${out}" } __%[1]s_process_completion_results() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d if (((directive & shellCompDirectiveError) != 0)); then # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return else if (((directive & shellCompDirectiveNoSpace) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no space" compopt -o nospace else __%[1]s_debug "No space directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveKeepOrder) != 0)); then if [[ $(type -t compopt) == builtin ]]; then # no sort isn't supported for bash less than < 4.4 if [[ ${BASH_VERSINFO[0]} -lt 4 || ( ${BASH_VERSINFO[0]} -eq 4 && ${BASH_VERSINFO[1]} -lt 4 ) ]]; then __%[1]s_debug "No sort directive not supported in this version of bash" else __%[1]s_debug "Activating keep order" compopt -o nosort fi else __%[1]s_debug "No sort directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveNoFileComp) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no file completion" compopt +o default else __%[1]s_debug "No file completion directive not supported in this version of bash" fi fi fi # Separate activeHelp from normal completions local completions=() local activeHelp=() __%[1]s_extract_activeHelp if (((directive & shellCompDirectiveFilterFileExt) != 0)); then # File extension filtering local fullFilter filter filteringCmd # Do not use quotes around the $completions variable or else newline # characters will be kept. for filter in ${completions[*]}; do fullFilter+="$filter|" done filteringCmd="_filedir $fullFilter" __%[1]s_debug "File filtering command: $filteringCmd" $filteringCmd elif (((directive & shellCompDirectiveFilterDirs) != 0)); then # File completion for directories only local subdir subdir=${completions[0]} if [[ -n $subdir ]]; then __%[1]s_debug "Listing directories in $subdir" pushd "$subdir" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return else __%[1]s_debug "Listing directories in ." _filedir -d fi else __%[1]s_handle_completion_types fi __%[1]s_handle_special_char "$cur" : __%[1]s_handle_special_char "$cur" = # Print the activeHelp statements before we finish if ((${#activeHelp[*]} != 0)); then printf "\n"; printf "%%s\n" "${activeHelp[@]}" printf "\n" # The prompt format is only available from bash 4.4. # We test if it is available before using it. if (x=${PS1@P}) 2> /dev/null; then printf "%%s" "${PS1@P}${COMP_LINE[@]}" else # Can't print the prompt. Just print the # text the user had typed, it is workable enough. printf "%%s" "${COMP_LINE[@]}" fi fi } # Separate activeHelp lines from real completions. # Fills the $activeHelp and $completions arrays. __%[1]s_extract_activeHelp() { local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} while IFS='' read -r comp; do if [[ ${comp:0:endIndex} == $activeHelpMarker ]]; then comp=${comp:endIndex} __%[1]s_debug "ActiveHelp found: $comp" if [[ -n $comp ]]; then activeHelp+=("$comp") fi else # Not an activeHelp line but a normal completion completions+=("$comp") fi done <<<"${out}" } __%[1]s_handle_completion_types() { __%[1]s_debug "__%[1]s_handle_completion_types: COMP_TYPE is $COMP_TYPE" case $COMP_TYPE in 37|42) # Type: menu-complete/menu-complete-backward and insert-completions # If the user requested inserting one completion at a time, or all # completions at once on the command-line we must remove the descriptions. # https://github.com/spf13/cobra/issues/1508 local tab=$'\t' comp while IFS='' read -r comp; do [[ -z $comp ]] && continue # Strip any description comp=${comp%%%%$tab*} # Only consider the completions that match if [[ $comp == "$cur"* ]]; then COMPREPLY+=("$comp") fi done < <(printf "%%s\n" "${completions[@]}") ;; *) # Type: complete (normal completion) __%[1]s_handle_standard_completion_case ;; esac } __%[1]s_handle_standard_completion_case() { local tab=$'\t' comp # Short circuit to optimize if we don't have descriptions if [[ "${completions[*]}" != *$tab* ]]; then IFS=$'\n' read -ra COMPREPLY -d '' < <(compgen -W "${completions[*]}" -- "$cur") return 0 fi local longest=0 local compline # Look for the longest completion so that we can format things nicely while IFS='' read -r compline; do [[ -z $compline ]] && continue # Strip any description before checking the length comp=${compline%%%%$tab*} # Only consider the completions that match [[ $comp == "$cur"* ]] || continue COMPREPLY+=("$compline") if ((${#comp}>longest)); then longest=${#comp} fi done < <(printf "%%s\n" "${completions[@]}") # If there is a single completion left, remove the description text if ((${#COMPREPLY[*]} == 1)); then __%[1]s_debug "COMPREPLY[0]: ${COMPREPLY[0]}" comp="${COMPREPLY[0]%%%%$tab*}" __%[1]s_debug "Removed description from single completion, which is now: ${comp}" COMPREPLY[0]=$comp else # Format the descriptions __%[1]s_format_comp_descriptions $longest fi } __%[1]s_handle_special_char() { local comp="$1" local char=$2 if [[ "$comp" == *${char}* && "$COMP_WORDBREAKS" == *${char}* ]]; then local word=${comp%%"${comp##*${char}}"} local idx=${#COMPREPLY[*]} while ((--idx >= 0)); do COMPREPLY[idx]=${COMPREPLY[idx]#"$word"} done fi } __%[1]s_format_comp_descriptions() { local tab=$'\t' local comp desc maxdesclength local longest=$1 local i ci for ci in ${!COMPREPLY[*]}; do comp=${COMPREPLY[ci]} # Properly format the description string which follows a tab character if there is one if [[ "$comp" == *$tab* ]]; then __%[1]s_debug "Original comp: $comp" desc=${comp#*$tab} comp=${comp%%%%$tab*} # $COLUMNS stores the current shell width. # Remove an extra 4 because we add 2 spaces and 2 parentheses. maxdesclength=$(( COLUMNS - longest - 4 )) # Make sure we can fit a description of at least 8 characters # if we are to align the descriptions. if ((maxdesclength > 8)); then # Add the proper number of spaces to align the descriptions for ((i = ${#comp} ; i < longest ; i++)); do comp+=" " done else # Don't pad the descriptions so we can fit more text after the completion maxdesclength=$(( COLUMNS - ${#comp} - 4 )) fi # If there is enough space for any description text, # truncate the descriptions that are too long for the shell width if ((maxdesclength > 0)); then if ((${#desc} > maxdesclength)); then desc=${desc:0:$(( maxdesclength - 1 ))} desc+="…" fi comp+=" ($desc)" fi COMPREPLY[ci]=$comp __%[1]s_debug "Final comp: $comp" fi done } __start_%[1]s() { local cur prev words cword split COMPREPLY=() # Call _init_completion from the bash-completion package # to prepare the arguments properly if declare -F _init_completion >/dev/null 2>&1; then _init_completion -n =: || return else __%[1]s_init_completion -n =: || return fi __%[1]s_debug __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "cur is ${cur}, words[*] is ${words[*]}, #words[@] is ${#words[@]}, cword is $cword" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $cword location, so we need # to truncate the command-line ($words) up to the $cword location. words=("${words[@]:0:$cword+1}") __%[1]s_debug "Truncated words[*]: ${words[*]}," local out directive __%[1]s_get_completion_results __%[1]s_process_completion_results } if [[ $(type -t compopt) = "builtin" ]]; then complete -o default -F __start_%[1]s %[1]s else complete -o default -o nospace -F __start_%[1]s %[1]s fi # ex: ts=4 sw=4 et filetype=sh __%[1]s_debug() { if [[ -n ${BASH_COMP_DEBUG_FILE:-} ]]; then echo "$*" >> "${BASH_COMP_DEBUG_FILE}" fi } # Homebrew on Macs have version 1.3 of bash-completion which doesn't include # _init_completion. This is a very minimal version of that function. __%[1]s_init_completion() { COMPREPLY=() _get_comp_words_by_ref "$@" cur prev words cword } __%[1]s_index_of_word() { local w word=$1 shift index=0 for w in "$@"; do [[ $w = "$word" ]] && return index=$((index+1)) done index=-1 } __%[1]s_contains_word() { local w word=$1; shift for w in "$@"; do [[ $w = "$word" ]] && return done return 1 } __%[1]s_handle_go_custom_completion() { __%[1]s_debug "${FUNCNAME[0]}: cur is ${cur}, words[*] is ${words[*]}, #words[@] is ${#words[@]}" local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local out requestComp lastParam lastChar comp directive args # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows to handle aliases args=("${words[@]:1}") # Disable ActiveHelp which is not supported for bash completion v1 requestComp="%[8]s=0 ${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} __%[1]s_debug "${FUNCNAME[0]}: lastParam ${lastParam}, lastChar ${lastChar}" if [ -z "${cur}" ] && [ "${lastChar}" != "=" ]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "${FUNCNAME[0]}: Adding extra empty parameter" requestComp="${requestComp} \"\"" fi __%[1]s_debug "${FUNCNAME[0]}: calling ${requestComp}" # Use eval to handle any environment variables and such out=$(eval "${requestComp}" 2>/dev/null) # Extract the directive integer at the very end of the output following a colon (:) directive=${out##*:} # Remove the directive out=${out%%:*} if [ "${directive}" = "${out}" ]; then # There is not directive specified directive=0 fi __%[1]s_debug "${FUNCNAME[0]}: the completion directive is: ${directive}" __%[1]s_debug "${FUNCNAME[0]}: the completions are: ${out}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then # Error code. No completion. __%[1]s_debug "${FUNCNAME[0]}: received error from custom completion go code" return else if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then if [[ $(type -t compopt) = "builtin" ]]; then __%[1]s_debug "${FUNCNAME[0]}: activating no space" compopt -o nospace fi fi if [ $((directive & shellCompDirectiveNoFileComp)) -ne 0 ]; then if [[ $(type -t compopt) = "builtin" ]]; then __%[1]s_debug "${FUNCNAME[0]}: activating no file completion" compopt +o default fi fi fi if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local fullFilter filter filteringCmd # Do not use quotes around the $out variable or else newline # characters will be kept. for filter in ${out}; do fullFilter+="$filter|" done filteringCmd="_filedir $fullFilter" __%[1]s_debug "File filtering command: $filteringCmd" $filteringCmd elif [ $((directive & shellCompDirectiveFilterDirs)) -ne 0 ]; then # File completion for directories only local subdir # Use printf to strip any trailing newline subdir=$(printf "%%s" "${out}") if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" __%[1]s_handle_subdirs_in_dir_flag "$subdir" else __%[1]s_debug "Listing directories in ." _filedir -d fi else while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${out}" -- "$cur") fi } __%[1]s_handle_reply() { __%[1]s_debug "${FUNCNAME[0]}" local comp case $cur in -*) if [[ $(type -t compopt) = "builtin" ]]; then compopt -o nospace fi local allflags if [ ${#must_have_one_flag[@]} -ne 0 ]; then allflags=("${must_have_one_flag[@]}") else allflags=("${flags[*]} ${two_word_flags[*]}") fi while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${allflags[*]}" -- "$cur") if [[ $(type -t compopt) = "builtin" ]]; then [[ "${COMPREPLY[0]}" == *= ]] || compopt +o nospace fi # complete after --flag=abc if [[ $cur == *=* ]]; then if [[ $(type -t compopt) = "builtin" ]]; then compopt +o nospace fi local index flag flag="${cur%%=*}" __%[1]s_index_of_word "${flag}" "${flags_with_completion[@]}" COMPREPLY=() if [[ ${index} -ge 0 ]]; then PREFIX="" cur="${cur#*=}" ${flags_completion[${index}]} if [ -n "${ZSH_VERSION:-}" ]; then # zsh completion needs --flag= prefix eval "COMPREPLY=( \"\${COMPREPLY[@]/#/${flag}=}\" )" fi fi fi if [[ -z "${flag_parsing_disabled}" ]]; then # If flag parsing is enabled, we have completed the flags and can return. # If flag parsing is disabled, we may not know all (or any) of the flags, so we fallthrough # to possibly call handle_go_custom_completion. return 0; fi ;; esac # check if we are handling a flag with special work handling local index __%[1]s_index_of_word "${prev}" "${flags_with_completion[@]}" if [[ ${index} -ge 0 ]]; then ${flags_completion[${index}]} return fi # we are parsing a flag and don't have a special handler, no completion if [[ ${cur} != "${words[cword]}" ]]; then return fi local completions completions=("${commands[@]}") if [[ ${#must_have_one_noun[@]} -ne 0 ]]; then completions+=("${must_have_one_noun[@]}") elif [[ -n "${has_completion_function}" ]]; then # if a go completion function is provided, defer to that function __%[1]s_handle_go_custom_completion fi if [[ ${#must_have_one_flag[@]} -ne 0 ]]; then completions+=("${must_have_one_flag[@]}") fi while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${completions[*]}" -- "$cur") if [[ ${#COMPREPLY[@]} -eq 0 && ${#noun_aliases[@]} -gt 0 && ${#must_have_one_noun[@]} -ne 0 ]]; then while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${noun_aliases[*]}" -- "$cur") fi if [[ ${#COMPREPLY[@]} -eq 0 ]]; then if declare -F __%[1]s_custom_func >/dev/null; then # try command name qualified custom func __%[1]s_custom_func else # otherwise fall back to unqualified for compatibility declare -F __custom_func >/dev/null && __custom_func fi fi # available in bash-completion >= 2, not always present on macOS if declare -F __ltrim_colon_completions >/dev/null; then __ltrim_colon_completions "$cur" fi # If there is only 1 completion and it is a flag with an = it will be completed # but we don't want a space after the = if [[ "${#COMPREPLY[@]}" -eq "1" ]] && [[ $(type -t compopt) = "builtin" ]] && [[ "${COMPREPLY[0]}" == --*= ]]; then compopt -o nospace fi } # The arguments should be in the form "ext1|ext2|extn" __%[1]s_handle_filename_extension_flag() { local ext="$1" _filedir "@(${ext})" } __%[1]s_handle_subdirs_in_dir_flag() { local dir="$1" pushd "${dir}" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return } __%[1]s_handle_flag() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" # if a command required a flag, and we found it, unset must_have_one_flag() local flagname=${words[c]} local flagvalue="" # if the word contained an = if [[ ${words[c]} == *"="* ]]; then flagvalue=${flagname#*=} # take in as flagvalue after the = flagname=${flagname%%=*} # strip everything after the = flagname="${flagname}=" # but put the = back fi __%[1]s_debug "${FUNCNAME[0]}: looking for ${flagname}" if __%[1]s_contains_word "${flagname}" "${must_have_one_flag[@]}"; then must_have_one_flag=() fi # if you set a flag which only applies to this command, don't show subcommands if __%[1]s_contains_word "${flagname}" "${local_nonpersistent_flags[@]}"; then commands=() fi # keep flag value with flagname as flaghash # flaghash variable is an associative array which is only supported in bash > 3. if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; then if [ -n "${flagvalue}" ] ; then flaghash[${flagname}]=${flagvalue} elif [ -n "${words[ $((c+1)) ]}" ] ; then flaghash[${flagname}]=${words[ $((c+1)) ]} else flaghash[${flagname}]="true" # pad "true" for bool flag fi fi # skip the argument to a two word flag if [[ ${words[c]} != *"="* ]] && __%[1]s_contains_word "${words[c]}" "${two_word_flags[@]}"; then __%[1]s_debug "${FUNCNAME[0]}: found a flag ${words[c]}, skip the next argument" c=$((c+1)) # if we are looking for a flags value, don't show commands if [[ $c -eq $cword ]]; then commands=() fi fi c=$((c+1)) } __%[1]s_handle_noun() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" if __%[1]s_contains_word "${words[c]}" "${must_have_one_noun[@]}"; then must_have_one_noun=() elif __%[1]s_contains_word "${words[c]}" "${noun_aliases[@]}"; then must_have_one_noun=() fi nouns+=("${words[c]}") c=$((c+1)) } __%[1]s_handle_command() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" local next_command if [[ -n ${last_command} ]]; then next_command="_${last_command}_${words[c]//:/__}" else if [[ $c -eq 0 ]]; then next_command="_%[1]s_root_command" else next_command="_${words[c]//:/__}" fi fi c=$((c+1)) __%[1]s_debug "${FUNCNAME[0]}: looking for ${next_command}" declare -F "$next_command" >/dev/null && $next_command } __%[1]s_handle_word() { if [[ $c -ge $cword ]]; then __%[1]s_handle_reply return fi __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" if [[ "${words[c]}" == -* ]]; then __%[1]s_handle_flag elif __%[1]s_contains_word "${words[c]}" "${commands[@]}"; then __%[1]s_handle_command elif [[ $c -eq 0 ]]; then __%[1]s_handle_command elif __%[1]s_contains_word "${words[c]}" "${command_aliases[@]}"; then # aliashash variable is an associative array which is only supported in bash > 3. if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; then words[c]=${aliashash[${words[c]}]} __%[1]s_handle_command else __%[1]s_handle_noun fi else __%[1]s_handle_noun fi __%[1]s_handle_word } ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿ şıÿ)!9ÿÿYA=Ii51-U]QE%am^Myu}ÿÿ*&[eÙµôÉv”Ìv¨ôv|Õ¤×ï#exî#èğ#œ&¬ !‰xÚ•î">Š‰$¿…hß"t!™+ r,ÙKl¶M)L[!ì[|[l.8![HK[”Y#´Ã"h¢\è]5ğ÷ZùZRi˜Ni¸œÔA 7Ü|4ȺU”ÂÙX¬.áıP „µ;¾;ÜT:„›ˆ…<«<¯<Ğ­<°<ü¬<`M=-\Å<„ÿ3äQ>t >‘xë=hT>yÂ1„X?Ğ°?ì­?½u¬@ˆr@¥ËAœ‹AÜìA”ÏA9 ©i@ºiøºid q0®rÁÅÉ#ré•”sxsIh0sE¹¡Üs0®säsh²sø°s„"uCÕÍxqDÚX|ED8”8Ø7¤ÆH èï*ôç*@n-©|ÔUğOtØV ÖVµå¤óV˜ WôTˆ¹W ÁW”¢YY¤ ,Y9ìbZØlZÁdĞ Ôıs${*•*xÎ*¬ÀD‘œì}EœE\KàHLI´:QOÔ±CDÔoDì[ğ‹[–ˆ¬`°éRd `ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿ¡ÿÿ¡ÿÿÿşıÿÿÿµU y i Y ÿşıÿşıÿÿşşııÿÿşıÿ­Ñşıÿ5  ÿ¥ÿ ÿ- —éşıÿ‰ ÿÿÿ ÿÿ ÿÿ ÿÿÿÿÿÿ ÿÿÿÿÿ ÿÿşıÿ ÿÿÿ ÿşıÿşıÿşıÿ ÿ ÿşıÿşıÿÿÿ ÿşıÿşıÿşıÿşıÿÿÿÿ ÿÿÿşıÿÿÿÿş ıÿÿÿ ÿ ÿşıÿşıÿÿ  ! ÿşıÿşıÿ ÿşıÿşıÿşıÿşıÿşıÿşşııÿşıÿşışıÿ ÿ ÿşı ÿşışıÿşıÿşı ÿ ÿ ÿşıÿş ıÿ ÿşıÿş ıÿş ıÿşıÿ ÿşıÿşıÿşıÿşıÿşıÿş ıÿ ÿ ÿÿş ıÿ ÿ ÿşıÿ ÿÿ ÿÿÿ ÿşıÿ ÿş ıÿÿşıÿşıÿ ÿşıÿ ÿGGGGGGGGGGGGGGGGGGGGGGGGGGGG         !  #     0!   *-&Kˆ*P$Bƒa*!  *  n     •3 '>>~Iå7 +¡"$—W+G­×AC; 4,tT(# CN$ş ıÿş ıÿşı ÿşı ÿş ıÿ şı ÿ  şşııÿşı ÿş ıÿ€ şı ÿşşııÿ  şşııÿ0ş ıÿ ş ıÿ       ÿDD şışıÿşı ÿ  ÿşı ÿşı ÿ şı ÿşı ÿşıÿşıÿşıÿşıÿşı ÿş ıÿ!       ş ıÿ!*  A ÿşı ÿşı ÿşışıÿP@ ƒş ıÿşı ÿşış ıÿ şşıışıÿşşııÿII  şı ÿşı ÿşı ÿ ÿ  Pşşııÿ X C@00 -)=!!(&" 10  K@şışıÿ!¡€şışıÿ%Uşı ÿc   a`ş ıÿ  ÿş ıÿ ÿ?     ş ıÿş  ıÿ ş ıÿ  ÿ   ÿ ÿş ıÿ şı ÿ # "    €€ %$€!  ) ++#3'! ͉a&KKKşıÿ! A@ ÿ!ÿ! Cşıÿ# ş ıÿ  ş ıÿşşııÿ  !!)  ‹‹şı ÿqşıÿ     T 1!11SAşşııÿ şışıÿÿş ıÿ31("(  £ :3   şışıÿ & şşışııÿ>şıÿş ıÿ ÿ                        LH,(  U  %    ˆ       - *=>  .  ”  ! !!     “  B -    P  *  %      0      0 €      **  $ !       •%!€€  †$   SSP! '#   C G #!¡¡€   C@A)©¡€ ! Cƒ  ) b ”     #ª  ~ ùùù    &""]  0 ¬CA@ $' ( !!TOK@ ƒ€ "'  +*--, $           UT  B  *     ]`a` &    ¨  `K 33 332 I  K ƒK K  IA      ş  ~ ş > ş  O  111   IIII   e  )!"    -=     « «Š‚;"""8a     ’    WV    — W W AA@'!cc` 7'!   ƒ #!€„€A  CAA   # u  @C # €€” ª c  ‚ Š   ME@&  A“   ) ! IHHV  S E  ‰ 1 c  jj ““ S3 $@  @     =  QPAB@  d    # SQA (   H ªª# "+# S I!?5  £ oma   30‰ ‰ ! N?)    ga 0   †!!322 ; “^ ¢Šşış ıÿ !! şş ııÿşşı ıÿ  şı ÿş ıÿş ıÿ ş ıÿ21<şı ÿ i( ş ıÿ ‰ˆ€ ÿşş ııÿ$ #ş ıÿ DDDD !%& şış ıÿşış ıÿ ÿşı ÿ     &&&"    ş ıÿU #  şışı ÿÀÁÂÀ @AG@$ # ş ıÿşı ÿş ıÿ !ş ıÿşışı ÿşışı ÿşışı ÿ ş ıÿ ş ıÿ•‘€  CC@A  (şı ÿ #! şı ÿ    ! şıÿ ş ıÿşış ıÿşıÿş  ıÿ 0000  şşı ıÿ      şışı ÿ  şış ıÿ##!!şıÿ  şşışııÿ((şı  ÿ  ş ıÿ  şış ıÿ   UTşşşıııÿ!  ş ıÿ   "gg` g`şı ÿşışı ÿşışı ÿşı ÿ3# ş ıÿ ?3şşı ıÿşı ÿ şı ÿ şı ÿIIIşşıı ÿ “€  O{[ şışıÿşı ÿ$ ş ıÿ ş ıÿ  ÿşşışııÿ H@DCaTJ ÿ şşııÿ ÿ  şı ÿ ş ıÿCBB@CCC@ "' ?5!$!! ! ! '   íÍÍÍşışı ÿSSP@#""      ! ş ı$ÿşş ııÿşşı ıÿ'/"€!!!!şıÿUTT    ÿşı ÿ((( ! $"# ş ıÿ   UUT   ş ıÿ:>;  % GGGG  ş ıÿşş ııÿşı ÿ G@@@ş ıÿşı ÿ     $$   ÿbc~r!!!  şışşııÿşşı ıÿşşı ıÿşıÿQPP  £(( ş ıÿTT67?&   aP!   Ğ€€  €‰€//# $' - *(    ³‘‘‘şşışııÿ|şışışıÿş şış ıÿ?© ((  şşı ıÿşşıı ÿşışışıÿ  şşışııÿ[ ƒƒƒ€@CF@ƒƒ‚€ !" şı  ÿ "!IIII LH BŒˆ  ÿ ú       M%$$$$ “¦¦  - CCAA@€˜“•      "3(    €  KIKKK   0B @@«©¨    ÿ  **(  ! $ '! A€¬ T@7_[› 2   0 $!C    $&$! )  “ƒ“  P    “ &ªFDDDD€‚„€  ! †‚‚€ †    I 0 0  A]]]]      %$   AAA@@      $ !! +++++   EJ €‰€   -    "&! €U«Zµ ­ZŒ"94 RP¥b &4< EDa`g `  g KK UUUQ      U L@ %  €   IH  “    + +  >8 @       µ·““     @  @  0 0@    "   B b "  $  !CC@CC@A@EO““€““@A@OE€"" ""€€Ÿ•   K + ‹ KI K+  « 7 §!    [[[XP $"!    K   QPA€  (*!!! AA      &$  I  "ƒaCAA@@Eeu}     c# +(())ªª*ÿ*ÿ *ÿ*ÿ 62 $ #  qq 1 “ “ ª  )(@AAA@  ‰‰ ¥…  M@ PP Æ      )      c ‚(18<6 2  +  ? ˆ€w   ä *** @@‰‰ˆˆˆ@CB@H         !!!   "330 *****0<   aa      !!  !! !+8(  @   #"©¨¨aqH   "   SRPPPB@@HA@MC@@SPPPP γ‘‘‘‘$    )   û     ú   8-   ÉÉQ@PP@)B ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿ ÿşış ıÿşşıış ıÿNn~şış ıÿşşış ııÿ şış ıÿş ıÿş ıÿ    şış ıÿşış ıÿ FLEtşşşıııÿ €„†…œ” şı ÿONLH@ ÿşış ıÿşışıÿ şış ıÿ şış ıÿ88 ÿşışıÿşıÿ6&&&&&EGd\t¤ şış ıÿ  + )( U1!    ş ıÿ@#ş ıÿşış ıÿ$$$$ $$$$ şış ıÿ) aaaa  şışıÿş ıÿş ıÿşı ÿşış  ıÿ@&   B@ şışıÿ    şı ÿ@Ll\ş ıÿş ıÿşşı ıÿşş ııÿ ş ıÿşş ııÿşşı ıÿşı ÿ  ş ıÿ+))(  ËÉÉÀÈÉ  " şşış ııÿ  ş ıÿUTşş ııÿ   AAAAAşı ÿşış ıÿ@DLAB@şışış ıÿşış ıÿ€‚€„ˆ"  "    şıÿşşı ıÿş ıÿ$4&,-%$$$ QP  şı ÿşış ıÿş ışıÿ ş ıÿ ş ıÿ ş ıÿ  şıÿ?  ----,şı ÿşı ÿ ş ışıÿşşı ıÿş ıÿşşşıııÿş ıÿCC@CCC™™˜™™™€€Ÿ‹ƒ   @ :€"  0(" UUUUPPşşııÿş ı(ÿƒÇõ‰!!ş ıÿş ıÿ@@H@EB# ş ıÿş ıÿ(((   WWSSQP€‚€€€€˜€„‚‘  @ şıÿ C@C@CCşşıı ÿşş ııÿ     ş ıÿ ''%%%%   ))) ) şş ııÿIIIIAşş ııÿ &$$ ş ıÿ ©© ©¡© " &"#$$ &&&&&& 5ş ıÿ 33000  !!!! ş ı ÿş ıÿ ş$ıÿ¡  ş ı ÿ  `PHDBAşşı ıÿ ]]]M  «© 6 ,? %=%!$<8;1!    şşı ıÿ    şşışı ıÿ„   !9şışşı ıÿ @)(((( ©şış ı ÿTP@!1 GH¬ªô    A    "     ‹ŠŠ€‹Š€@@DBAH@   #  “  @DEM@GF   #! “ )  -   -(  ZSsrT($"0             8042 028<5= 0   şÿ ÿ@  ÿ “ƒ"  U•ş  ??      Á" QC  BB@Á" ‚l   H  I  II q ac$      %!# "$@IAECI@ ,  10 0   0 5555  22  ­  €Ô€ù  QP$4  U   -@@@@`PHDBAøÿùüÿı   1Éd1Éd   5%%%  “    )    ¦U«  P     AA &&&& *          HH  $4         – %   D  IH        ÛÃÃà €€  L  Û ß  2@@@          ! #   D    B  )     (€÷  '''''! @EIACB@  €ø‡€*" ³³³³133 ! €  ø )((          0 3       ¢¢ÅÅÅYš$âš$⤣¤£¤£¤£¤£¤£¤£¤£¤£¤£š<âŸhšâšâ‹~cŸhñ^'n¾¥ù¬±¤£Û©¾¥ù¬±¤£Û©¾¥ù¬±¤£Û©¾¥ù¬±¤£Û©¾¥ù¬±¤£Û©¾¥ù¬±¤£Û©h{‚…?ÈÆ ¼ø1…0?•%°5['P|['P|¯'8)¯'4)¯'0)¯'4)I@Á,04õ´ës/\³1ìLB3 É)í)!…?…?P)Àú­7TYC, ['P|['L|O6YO6DYü7ŒZf) Wf)Wf)WDTœÕ¿,áGp7ID‡áGä7ë'0_1ì–>,5G4úU¨ G4x€£ä[X&ä[d&]T+~P tK lçcÌ0ˆd³O6Y+*$O6Y;llşilCÍlğıLm_ë' ë'(['|I$ÁÕõ4ëãp6ãp6ãp6€HIÕwd-—áy;õ8ëS{#|{ğ—Ø.<tØ`Ø_1ìK… …¬îØ.u†—u†—ş†@Võ@ëõ4ëõ,ëõTëH u9GnaG«¡zµ*P ŠBH?ˆ(7ŠB ŠB<ŠB0 ’0²ú’DÊØ.Í*$8 8¼È8ÆPÕ‰–ÔšIL ‹ÂU¿,@['œ|… (õëØ.u†,—¡t*P¡ >µ¡(C,4 ’x²å5€¨Œ§ˆx-¨@ -¨ u†—,4_1ìåW*-—õ5¼Põ5TPõLë+*$+*$+*<$ºH~šI( ©úP |ãpˆ6I$ÁI8Á2‹¿+¤ªë'P!Æ`á!Æ`á!Æá!ÆÌáT+(CtG¤êøD1Hu;Ìş;Ìş€H,IØ.0I0Á44Á44ÁÜÒÁ['H|ÉÕ§ğÕ°ÉÕ§ğÕ°|{$—¿+8ª3(µ3(µaG«¿,ë'p죰-¨@ [',|¿,œåW`*¿,5z@›g÷/M90X_ææ¸òó¾¥îó‰Œğ,‘‹P~Ìğ0O  › ›:õ¤; ;¾¥¾¥ù¬ù¬±±¤£¤£Û©Û© ˜˜µbµbµbÉ6¡@9ÔLÔ4_4A_(A_(AşàêXêXêDXiêTSêXêJØ@?u 8<¡49N06.@?ë8<49É06@0–0´ µï¨Û|ÚÛ|Úù\ ğ@Gğ`GmO6C6XC6€C¯H<¯ä<ùÌ Â˜Xt;”;”;t;Ñt?oL"o€":ŠtÚENxøNxø‚Ds‚Ds‚@sü(O |=S__hw< X(¿ ¦¿ €¦ P= t=JJod"Ğ& ¤£¾¥o\"¼(Ô b&8%b&<%b&%¤£·.Zá.üˆšù0¬`. Ê %U•1æ %U %U %U•1æ %U %U %U %U %8U %U % U %U %U•1æù¬•1æ %UÈ$4A %U %Ur44a”(ü-¤L£O3 YO38YO3Y´*‰•*vĞ%6Á1d$4Ãë1m/Ѳ$(È$A Š&®¾¥ù¬±¤£Û©¾¥ù¬±¤£Û©‹N|5ÎN|@OhK3KH¨K\Lw KBKTöKkèJ=]KOÒKeÖL•BM©®MIJLM¡ŠM¸‘LŠıLœiM²ySÀUySxU±Y[H[lÿ[<o­ZnˆZY„[$o]\{½]d‹4^yZ^}G^z‚^š®^˜^›íb"íb"íb"íb" H= t=¬d4#e,Óf4Bf4Bf4B÷hK÷hKæi”Fæi„Fe>ßj'S_KkHP¯|6 oÀ óo4ñ±rÏ—r ͱrÏÍrÑŸuˆ¢s<Äs<¢s<Äs<(wT–(wl–(wx–(wH–(wP–(wH–(wL–(wT–(wH–(wl–(wL–(wp–(wl–(wP–(wl–(w\–(wL–(wx–(wP–(wP–(w\–(wt–(wh–(wT–(w\–(w\–(w˜–(w„–(w\–(w\–(wL–(wT–(wL–(wp–(wL–(w|–(w„–(w„–(w\–(wl–(wT–(wT–(wd–vuvŸuˆèrÓ—rͱrÏÍrÑU}@s½àµâ@ò]no~8ço~4ç{~{~pÖ}<ù} ¥4<“ |= ¸= l=öHW-†L~öHWu†Æ…0,öHW-†Œ~!ÒŒˆdò!Òâ`ò‚øJ‚ …2Œ‚F ~›‚K:‚¬‚P+‚ş½‚\¾ƒLmƒ ƒú&ƒıWƒAƒ ƒߥå¾êÒï-L*-L*-L*ìn0Cìn0Cìn0Cæ”T)›\ŸìgŸìgS¤˜ÁÙ¦D9k§$˜k§$˜v¨@WÏ©$Zª ^Z«( ¼«$ë L„¼«$ëѬùÙ¦@9Ü­|]nѬù¼«$뼫$뼫$ë’®¬S¼«$ëx¯T˯,%˯(%ßÒ<ïöª´C¼«뼫뼫ëJ#öª€C-­0%-­%Ü­(Ü­OªLOOªOo«8o«8,¬¬>­?>­?U­GU­Gp­Qp­Q±¬pı±¬ıhHA ¼4D_Twa»gŠ»k 8=)Á”ïÁ@.N a H=9Á<è¾Â<ŘmŤm5Æ Ç´Ù:ìPŸLÈ`NLÊI‘É`9‘É”92Ë@?ğË8<‘É49È06Ãë‘Î(`Î(`Î(`Î(`ÕÏ îîÒl7ÕÏ îÖD5wלwלw× œØp ~Ø<~Ø0òÔ—òÔ€—ÌØl5ÒÙ( 0=~ØLsÜxŸCİ/'Õh=òÔˆ—'Õ,=½Ü+ÑÛãµäĞåH‚éñ8êH‚…íY îH‚íñé óH‚Âæ¤v¶  ¶  öKÌkX , t=-Xxz7¡ l= l=±Y T=±Y.N|a< < < o,"mD+ÚTWxÕ$-¬# }¬# }¬# }¬# } ”=¬-„õ/L±Y,‘5˜%60O60O+‚Dş7°± p= 8Ÿ×9ÀØP;§;7,±+‚şª5)Î50U6§“6â:%G:/‰:;¬:Cí:U§;¹<–<C?CwE$* G+‚ØşHDq IDzI€I€ G(2?|NP˜=2?ÄNQ˳Zj [( Ü=b`(à0.NafDySUmg9¼i_ t=ølp·2?€N³m>Op6œpx.çp°Iªq„[ªqœ[p nrÏr}ëw˜işxé-r„•rÄnrÏr}r¿øvçşxéyîOwy y êX­€¤Mn„^8‚ªnxÎåÈÎÚ“ GK”P?–‰ |Ô?–‰ |Ô?–‰ |ÔtMò˜ „;˜Vr}•rħ¤Ìiº§º§-©4‚‡ª7§ª`°§ªp°NªÀP‡ª7æ¬ğcF¯84°¯$ɺ°H6-²9*´¢n´xÆÛ´0P;ØVò˜d„q¶h¢W•„w•‰›•›•¨=¬¼ªöªLCo«(8u»P’J#@-©è‚0¼ağ¥L4ê£Éğ¥T4î½X6c­î[¾hzî½Ô6¿@‚£ª‚£ª‚£ªdÀĞ<ºÄʺÄÊïÁøpºĞæ\ÃÑÅg7ÅkiÅoœÅ<s=¬,ªÛ´,PÛ´,PÛ´,P’Ç,‚£$ª‚£$ª‚£$ª‚£ª‚£ª‚£$ª‚£$ªuÉ  „£ËdRÜ­.NDaÙ¦9×Í$×Í$×Í$×ÍÑx˜‚£ª‚£ª‚£ª‚£ª‚£ª‚£ªšÑ$•šÑ$•(Ó¸CcÓÄ‹Ñx˜‚£ª‚£ª‚£ª‚£ª‚£ªò¹ò¹‚£ª‚£ª‚£ª4Ù$ã4Ù$ã4Ù$ã @=¥Ú„I¥Ú´I¥Ú0I¥Ú€IºÃºtà °<@ºÃ=İ ˜;$V=¬Lª=¬Lª=¬Lª=¬XªI½¡5¤!M¤"HÇ »;™­¡³­¤4®ÕD®ÖɦÊ;OwOw ä=ÿò#eXÓò…òŠÚñu&òíñ*õ”Wo,"uX‘A÷$-ù$)BùD"±uX‘›ú$`›ú4`€ü·€ü”·Üû D |=6näİ ¬=°K–gLåék@<o”"oX"L!(ó4S6nxİ6näİ6nLİ ˆD (D¢¸÷E°¡¨í<oo"í<oí<oí<oí0o†^$³ŸÈà$İ%Pòk´$ÔP¯ ¨=ÀAü=8QaXB°W‚‚€ySèU‚<C“C(“C“C“]H™]™ùDù- G-G¨É&'lN¨Xˆ*vˆ*vo"õ.Uh8ì16ì1@62`:UhH8®^øj4öØ5q36ô36DåÔB36$p9¼ó€)D36d~< 9Uh8Ø?88Ø?x8x@`@UhH8Uh8jD6jDD6 E`:UhH8o"Uh8iM@8iM€8N`@UhH8Uh8ÉQ6ÉQ@6cR`:UhH8Uh8o`"UhH8c­îc­œîc­îdZ\OåhBUh8ãt@5ãt€5zu`=UhH86wÀ0*ı+s‡] æiFæiF\bX0\b\0\b\09„ \b\0\bX0¼‡®˜ˆĞ\bX0\b\0³ŠM{Œø60\b\0%ˆ˜U©·ÜÄ\b\0ñ‘ÖT’ƒ¶’¸G×9Èع“xêø˜Uø©%ˆ·ÜÄB•¼¨¢«6¢«6¢«(6 ­h %A ­h ­h ­h ­h ­h ­h ­h ­h=µ8Ü\bØ0xòö«~"ÔP"Pº¼Ş» †Û»(»»8†Û»(».l(°.l8°„½0Bék<<_¹(-_¹(-_¹(-_¹(-_¹(-å B_¹(-_¹(-_¹(-_¹(-Èl$#eìÓ_¹-‡6«ÊXß_¹`-İËd.¹áÃ8oÌÃ8t_¹-ÈÌ$É(Ü6w$À(5'(5'(5'(5'S5-S5-S5-S5-©:qÚÙÌJ»¸†]¾(Š„½0BUhÈ8.lì°.lÌ°.lø°„½0B)ä&)ä&ÁäCåMÁäC¯å`¯å`„½0BpÃDjÃDoÍÚÄé êJ4êMFì69ëd9 î@?ûî8<9ë49Fì06ÔïĞmğÈ]ñXè¯Ô6WDjš°DšÁ1dŒü¬ıñ$–ıñT–êşèO.ÿ8Ç.ÿ8ÇêşìOêş@OêşÀOêşÀOêşÀOêşÀOêşèOêş Oêş OêşœOêşœOêşœOêşœOêşœOêşœOêşœOêşœOêşœOêşœO¯ü6 =.ÿ„Ç8òÃUòÈ$VÅ<¯6£¤üO®cÊWjåBŒüqü i' Ú L ¡ŞĞ™ŒŒdŒüŒŒ7ˆ¡0i@Œ\bX0\bX0z7ş1ñIXö'øÃbÌhñIˆĞñTIh`Aşˆ#eÓt pt tt xék@<S8_Ë"8øË"øË"øË"ømşˆ'ÃÎ!ä"^(á0xÂA1L ö1²ö1²ë2L'ë2l'ë2t'ë2h'ë2\'ë2\'ë2l'.l0° x=´*„‰o,"™B,E¼ ¶EÄ(I8lRJ4vRJHvRJ@vRJTv Ä=oŒ"¯6ëp>NpqœP\U¹R¼éUh86U ñ«éÚ]4Ñ«é,c­ÄîskTˆlDŒLL‘ˆlŒL‘L‘ˆlŒL‘ˆl@ŒˆlŒL‘L‘ˆlŒL‘L‘ˆlDŒˆlŒL‘L‘LD‘L‘ˆlŒˆlŒL‘L‘ˆlŒL‘LD‘L‘L‘ãcøûÄéAÈ 8=p x=t,ttté“œ 8=üO`LD–`LD– Ÿ<"uŸ0ÈÕK LkòYAE¤ å¤$yS@U¦™ySLUùT™¥&™¥€&¦™™¥<&S8_²(R©¸—©¨—¥ |¥6"¥\¥.ˆ;ÿ[o'° ²PR „ %LA.N(aŸ²,» Ğ=i'P ¯-W ´ W  ‹  /‹ /@¶˜; ¹®ßº(±ߺü± ¼ 'À·?Ş·C¸N1¸UL¸#s¸*…¾ 9¾0*g¿ àQ„½Âˆ ğÃ@†lÆl¤Ğ@€XÑp=ÚgHuUh 8ôÔD"ÕK#edÓ¾ßÈ3Ş@¨Ş0¨áíŞ¨ ´=¾ßt3Kâ0Nß=×áâC“C“]H™]™} }4kk dd è=c­î×9ØÈõVÿõ_Æø0™ D=Ø bø$È‹ı˜^‹ı ^‹ıp^‹ı¨^ %„AîTŒUh8øøÈ1ˆ?#eTÓzja €Tœ §œx§z$Ù·ù4YV¼cå¼B@ ­_ ¹ü I_ ¹_ ¹¢(ƒÌ_ ¹ü Iü Iü I_ ¹_ ¹_ ¹ıL(œıL˜œü I_ ¹ü I_ ¹KâP0KâH0KâH0#ığ9¶ ĞcMC“Dk4k”àô”àôĞcĞMm"¥F## ék\<m"T¥‡$´XF## (, m"¬¥(, (, F## F## F## %ÏF## °kF## F## (, (, F## J Ô¾3(aJÛ 76,óF## ô=oà"ş<À”=¸3[ˆ' °=N>,ryA„„ = =.lÔ°]Eth õE°X yA`„Lˆù Nß=î$ŒOœ½;.”ا è‚îŒVW,\˜0j î$Œo)”¾)Ï^d@*H_:* `¸n* `Œn* `˜n*Ÿ`Te*¥ "¥\¥(.|¥6\c<YÁ4_øø1øø1Æø<™#eDÓ#e¨Ó3ùè¢3ùè¢øø1'°Ä |=?8? ?øø1Îl¼‘Îlh‘#ığÄé‹ı8^Äé«é@«é#e¼Óék@<€Ğm ÄéHÄé@ÍW@†Ô‡,*0ˆÀ4 |=o "c­|î技à „ T„‹ıP^Õ,B=‘êÆø¬™ À='•¼  „€œ„”Ë <5 ,ówÿ£t ÿ£ VW,\ø¥§*’«@?N¯8<fz49Òp06‹ı^øø1#dÀjy†z»×€·ùY·ùY(f(ª(fªÏûŸÏûŸée”ée”Ø0(iØ0iáfáfûf%ûf%@ ­_ ¹õ¶é• °g Íl ‘ÿ ;í È„Z’(z ù˜ ÿ¾ í   ‘ÿ ‘ÿ Y *Ö JÛ ^Ô)o)¾)Âg ò3ô$WşM"$ÊÎÅŠXQ(åXY(/ZŒ(ÖZš(-[¤(*]K)g]U)Á_E+•_C+rc’Ñy(Tˆ$X &·“‡½›ÿiÙ® ñÙ~&Ù5dˆÛùßÛ÷6Üõ}ÜÆ ½İQMŞ™«é„½BÙ¦9’á$BÂá4_â,!â^:âb^âf¼à.Şà2$á@¸âoIáJÌáVŠâkDéTt®éèÜêH{ë o\"•ë,gë'ñë`&ìdXìhxï0,xï4,xï4,³ğ4–®ñȨòèèé0Œª÷ E·.Zá. d= ä=¢ù´ ¢ù´ ¢ù° ş o\"©ş,zş'ÿS=ÿWpÿ[é0Œã |·.Zá.¥4N°/N°/NÀ/È$@A ±HŸfXͯ¤6L!\ÈçŞ%E&Ù¦49!<ˆ |3ék(<¢ÄxÚgPu!Tˆ³ à/®éèUhD8Q*xj.\3›.”Q)/†•/’51°N51¬N51N51N;6Œ;6t51N51°Nşˆ.l°›.Qå Bæi”F´*‰®éèï>´> p@D(šA =šA =¬R(>†Q6W¤$9X8wo,"w[¨w[ı^X fØ(fØ(g$UÑA'/ô` F[w[J\H%]j_v$v ZyŒÄ(x3Éy|Œîzl/îzØ/(xô3š~@µ¹w¨x]p‹]d‹]d‹ı€åı€$åı€Ìåı€Ôåz€M]@‹ı€å÷†8m‡`km‡km‡@kƒ†È|ƒ†|ЉH,Št(x@3È$,A /4Ñ/4Ñ‘$†\•[n—4wn—ˆwõ `ék4<ÊxX —§˜X!§í í í í í ­ }®é®éT®é<®éd¯\6®éìUhh8C§„Z`«X”«tÚgĞu?¸t;Şé<·Øùò¼5´¸ )à¸$.|»/ƒº4cƒ¼,1£¼,6#½4Lb¼$,N½|Qb¼,'¾01G¾06ǾDL¾ ,ò¾|Q¾,Ì¿01í¿,6qÀDLª¿ ,À|Qª¿,%Å<ÆP*ÆP*eÊ Q›ËLÜWÌH¨Ì$2ÿÌ%L!„ĞĞ,Q<Ñ<PØÑ,R?Ò4Sƒº cªºdh´¸,)”Ú)Ş$Ş$é€)‚Á.ZÁ*mİ՛ܠeÊQ¿ÖHG¿Ö$G×HI×$IíÖHHíÖ$HM×HJM×$J|×HK|×KÜ×HMÜ× M«×HL«×L ØHN Ø N=ØHO=ØOĞĞ@QĞĞQ<Ñ P<ÑP?Ò<S?Ò$SØÑ8RØÑRoØ8ToØ$TÓØ8VÓØ$V Ø8U Ø$UÙ8WÙ$W8Ù8X8ÙXÙ8ZÙ ZjÙ8YjÙYÒÙ8[ÒÙ [Ú8\Ú\ÔÁBíŞE?áfèbš Œzä :* ,Q |= ì=b¼$,N½Qtttt Ì= x=tt64"P?<¢h«“´½½æÆÏ4Ø[á‚ê©óÏüû! G o  — )¿ ;'%o," )C)ò).**7Ÿ*I1.Ì).NTa1.()ıLhœ˜-ï._±.Z/0s0­0—1 Ù1X2>39‹3JP3AÎ2e;¤Ld=XnGTJšNî´Lâ.Mæ@LŞ–` ²O@h< Ho<J\š†,cx¨¤œµ,cÖº,co¼,šh½H7™¾t o¼°šªÁ8`Ã8\}w8XHÅTn^Ìph0Åi&Yt x¨œÄĞ ‘İŠŒBaT\<ØÔp§0ä‚Iãt wDt Jš7B`ö?\d=XnGTç}Aƒ h<$H¨òèıL<œ‘L,ŠîìŒıLLœBX'­€MDıQ:şeúı`ºı[™Õ+9 °z Œ$T!$ü!$!9 z9 pz9 TzĞ!€B{!÷%%9 z9 z9 z.NTa.NTa9 zï.˜_û0¼29 zsÜxŸ9 hzí ;&*Ã>\[X?¢X?¢*AD,Ĥ £:ANğ#¢<T¿VL`xæf`.ÈfP™Èf™¥ Äii1~Xn—[4Æ#^4»t\h¢èY_L]WY TFS`B¦Œ 4¾Z$-²_$%\P9±¨K\9’Ô{’ø{±.±.33"hŸ¼ äŸÄ Ä=ŠM¸œP\Uã«°I™Í—1( Â-¤³~¹Ìü¹,²LXœPLU ƒ\úL!DtÄØ ŠM°¸øÅàs0( R73Ë(E3Ë(E3Ë(EXËÄÌl„ìÍ 0ìÍ 0öª8CqÑ€öª8CqÑ€9Ò(o L=öª CöªøCÔöªˆCqÑ<öªdCqÑĞ ¼=´Ú|´Úˆo„"†Şä•¨Ş¿Nßñ¢ßöß+!à0ôà˜JáÁ¸áîÿá âhâ â%;㇆ã™Ğã¨ä·3í\xÍî$7Íî$7Íî$7Íî$7Íî$7Íî$7Íî$7Íî$7DëDëDëDëDëÍó$Íó$Íó$Íó$õcõ ¸õöø80aø86œÙöœÙöşÙ şÙ ÍÙşÍÙş0Ú0ÚœÙ8öœÙöşÙH şÙ ÍÙ8şÍÙş0ÚH0Ú•ô œÙ8öœÙöşÙH şÙ ÍÙ8şÍÙş0ÚH0Ú3í\xn ‹ Èvr `‡Í 4ã H¢<‚ `On $n $ê, |‚ \O` æã ; ; V5 ¬‡7 G \67 ŒK7 ÀK¨Ê '™ @ı™ @ı; T ”= # ,•P¥A Ù¢<<ÄH L;<Vï.`_$!‡7 G] < A (Í+_ ¼B+_ B+_ €B+_ pB“a ô*Ğa ô2b F²g ô%¢<Äbj €½bj ½óm <|n ^|n ^Éq Q±.@Z‡7 dG‡7 0Gëy 9gh NÎ2Î2—1° —1° ‡7 G = =…£ Lä…£ LäA1T ,¥ ´¾A1\ A1\ îŒîŒš© 4Ç X=Éq ¼QKM |"ˆ#R±ı|–è XnÓì ¼hî Ğ;ë xM÷ PŠ÷ PŠŞ ,C @Ç—, ˆwVA @ÇPR ˆwëJ tPÄH 0şI  t ^ `V;ë `M’ „ûhî ĞÓì ¼G ·ÄF |®÷ dŠ÷— „‚·™ Koê F›E „9¶ ty‘ñ \q;§ ÆK »÷ ¢@ _İ W7 T,á `B ¬ 47â $-é $%´ Q‚ OØ> 4 ‰k yl` '«l ¥a =kl ¡c{ ¾{ )™ ıÙÀ Í „ô9 z\Ù ` \Ù   E× r× µÛ ñİ „ÚgHuUh 8JŞ Dãã dqãã qÏå X9ªÏ ,®ì 6·ù€Y·ù$Yò Èήì 6Èô (Èô ˆ(ªÏ 0VW,\ L=øø G¢<(¯t6 ü =”ü ä¯÷ 4_I Dœ{å <ªÏ ,Ï @?ê 8<Ïå 49®ì 06"ä {Èô (™! Ä£€* È­€* €­ 4„ 4„%1 %1 Ú3 ¤! 4„ 4„ ,„ ,„D FÈC |ÈC €ÈC €KD <­/4Ñ/4Ñ/4Ñ/4Ñ/4Ñ/4Ñ/4Ñ/4Ñ/4Ñ/4Ñ/4ÑùK (OùK POš°<šZP à9 =š° šÈC D˜U P¸ˆX @?"Y 8<rO 496N 06ÉR øÉR øÉR øÉR øÉR øî ŒîüŒî¬Œî„Œî„Œî¬ŒîHŒ 4„ 4„ $„ôÔLˆÔi ® 4„ 4„ ä=`‚ £û† 8t/ˆ ˆùÕˆ wƒ† $–gLå–gLå4™ ğ`º<› (Xš› (\4™ `4™ `4™ `¶˜ ¿¯™ Xlš <¦š <"Œ å’‹ ÍÖ‹ × ¤Å ÷ GR‹ µÕŠ Ÿ‹ ©¯™ Ù› Klš ¶˜ ¿Çœ s¦š "C š7 ¯^Œ fŠ  ÚgufŠ œfŠ ˜fŠ tfŠ ,fŠ Ç H¼‹Ì (XÏ zÕˆ w‹Ì FÚ x‹Ì ë´ .ÊÔ …† »°˜’SÄ_Yå +û† Lt0ğ (š0ğ Tš0ğ (š0ğ (šôò (ùôò (ùôò (ùôò (ùôò (ùôò (ùôò (ùôò (ùd÷ çş (çş (çş (çş (çş çş (kÿ çş (çş (çş (çş (çş ( (Å (ÅNë Aä ä ¶˜ (¿û†  tû† t”È !¶˜ P¿¶˜ ô¿û† tû† ta# (¸1 ¸1 ¸1 ¸1 s5 s5 X›8 (p: Tp: Tı< }Õ> ·Õ> ·Õ> ·Õ> ·vB èPD  8F 2H W¦ ì$ óä í¦ ì$ óä í¦ ì$ óä í¦ ì$ óä í¦ ì$ óä í¦ ì$ óä í¦ ì$ óä í¦ ì$ óä íK& z& yZ* Ö* ÕoL -²L .äK +)L ,2I !úL /@M 0P @ÙP AJP ?çY jHY føX e-Z k}W `Y iÄW a¨X d X bYX cg tgñ (Nœƒ P_œƒ L_oä"oŒ"¼ˆ 0¯ÓŠ 4˜üœšüš” ” Ï‘ ,MÏ‘ ,MÏ‘ ,MŒ vÏ‘ ,MÏ‘ ,MŒ vŒ @vª  }ª  }ç˜ hª  }ª  }/4ÑÕˆ wÑ DÕˆ wÕˆ wÑ DÕˆ wÕˆ  w¯™ T¯™ lÙ› TKgÓ D«Ù› lKÕˆ wÕˆ wÕˆ wÕˆ wÕˆ  wlš hÑ Dƒlš lAÙ £Ó D AÙ €AÙ (£Ó D AÙ hÕˆ wÕˆ wÕˆ $wÕˆ wÕˆ Ìw¦š h"RÑ D¦š l"Õˆ $wÕˆ 8wÕˆ (wÕˆ (wÕˆ Øwlš hšĞ Dˆlš lAÙ h£Ó D AÙ  AÙ l£Ó D AÙ tÕˆ $wÕˆ 8wÕˆ (wÕˆ (wÕˆ Øw¦š h"×Ğ D’¦š l"QØ X~¹‡ $ˆQØ `~QØ \~¹‡ 4ˆQØ Ä~QØ ~QØ X~¹‡ $ˆQØ `~QØ \~¹‡ 4ˆQØ Ä~QØ ~Ø x–|‡ (¤Ø –Ø |–|‡ 8¤Ø è–Ø <–Ø x–|‡ (¤Ø –Ø |–|‡ 8¤Ø è–Ø <–Ø hÊØ hÊØ pÊØ pÊØ lÊØ lÊØ ĞÊØ ¬ÊØ TÊØ TÊØ ØÊÙ h²Ù p²Ù p²Ù x²٠вÙ ´²Ù T²٠زÏ‘ 4MÏ‘ 4MÏ‘ 4Mû† ¼tÒ Ôáû Ô¢gÓ 4«{ 0îÈ$LA È$LA t 0…/ÑÈ$LA /ô` ²$(²$ˆ(/ÑŠš <(ÓŠ <˜ÓŠ 4˜ÓŠ <˜’Œ ”¸/ÑüÔš/¤Ñ/„Ñ/$Ñ/4ÑfŠ LfŠ p Š 4ZÈ$,A ¶˜ ¿/4Ñ” /Ñ/Ñ/Ñm‹ >m‹ >’Œ |¸ ¶˜ ¿>ù |>ù ¨>ù Tm‹ >aD ™aD ™aD ™ÓŠ ˜aD ™m‹ >Ò ÉÑ Hz” m‹ >¡¡ „Ï‘ MŒ vm‹ >ª  };˜ ‰¤‹ „™ Ê™ Šš (Ş ,” İ ¾’Œ ¸3ˆ YÒ' ( . LÍ- I»1 mé2 Öû4 ö3 ô=©  =©  =©  ±­ 8?ã® ,Vã® ,Vã® ,Vã® ,Vã® ,Vã® ,Vã® ,Vã® ,Vݾ ÷ݾ ÷±­ ?­ 5ÿ­ Cˆ;Uh8P;P;UhH8Æ  o,"Ğ !Ğ <!Ğ !Ğ <!Ğ !Ğ <!od"3Ï dG†Ó  ç4Ó ëñÎ -¯Ï t?Ğ Ÿ´Ğ ÅC§pZÛøQÚ €Í =ŠM\¸àÜ Y,İ Uxİ Qéà 4Eéà äE Ş 4Y Ş Y`Ş 4]`Ş ]¤Ş a¤Ş aêŞ eêŞ e4ß i4ß i‚¶ë $=ƒå ˜ò 47·ù8Yøø1öò D&­€ˆM·ù$Y „ „ÿòøø01øø1¯p6øø 1øø1øø1:<Š2?LNøø81Fş b ş X_û Jsƒ_û J_û J‡o¬"óS²HO‚D.qH˜­Ä).Nta.Nôa²LhŠhDà0Dod"o "‘LxŠ ”DOØÜP;¨¬" ­¬"T­2?Nˆ;ğOØ\h Ÿ '¨Îû `ˆ*vˆ*v-E-œEo<"-E-œEo<"-E-œEo<"Ml¡ıLXœ-E-E-œE²L@‘L4Š-E-œE-E²LL‘LDŠüOWj¯06u6H€u6Œ€²L´!h°oø"g:®Ö(8§¬(p g:®‚;ŒüékD<u6€\<PE©>L"ÿ[oiM$²ŠM$¸|? ¡¬" ­ˆ*v*AhùD¤7wHE ¼=iJE D=²L,-XE¬"­-E-E-œE-XE-E-œE-Eo$"o"o"o"o"o"o0"o "o"o"o"o"o"ùD7—b“Tê—b“‘h‚—b“—b“Ûb-Ûb-D¯D.Doß›s{û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `û `-E-E-EiJE‰–|Ζ†V—EΖ†iJE-E‰–|-EiJEV—EV—E.riJEiJEh"ï?"ç$Pş4?"çh"ï­RW¢Üıóş ôTi'` ğ¼¬9¾xUh,8MĤBMÄäBMÄàBc­lî.l°Âɘ$L!41Ñ2—â À/-Y–Bùî`ŒTè4ÀUhğ8ÂÉl$>R ËXà@R­€¸M0äîğä„Kğä„Kğä„Kzë7î$Œî$Œî$Œî$Œî$Œî$ŒÏÂ?«Ã g³¿§ª\° 4„ 4„š (G#n ‹fıg"ş´vRPiÒ Ò ¨CÒ àôÔXˆôÔˆÙ¦\9 p7­€(M3‡€ª N€ªNo"sÜÜŸˆ;“¥ ı¤JıJo$"‘L0Š‘L Š‘LtŠğ)|Yº+øMº+TMº+TMº+TM‚¶¬ë‚¶°ëôÔˆø8D9 D=ø8D9=T_=T_ „×A5ÃM€.òO<[kQ4TòO4[kQ(TÃM€.wV`¢HA¢HA°^ô2Æ 8 wh`6kAòO[kQLTwV`¢HAmF >°^`2aI$#c35ñ3KôÔXˆôÔˆÓ9©;û;!Û0t&1 ä=‚¶°ë¬¼X,ìİìİìİ«Êß D=É Tñ 6ì0İì0İÚÎ’Ï.~<9\Á ÏÓiøÔ&ŒÕ+Ö0ğÖXW‘ØÔYÙú+Úşış ıÿşış ıÿ€? şşıışıÿ „ „şış ıÿşış ıÿşış$ıÿşış ıÿşış ıÿş ışıÿ       şşış ııÿşı şıÿşşış ııÿ 5%%%%  46(şış ıÿşşşşııııÿşşıış ıÿşış ıÿ   @şışış ıÿşı ÿ  @ şı ÿşı ÿşı ÿşı ÿ  A‚–’şışıÿ ÿş ıÿ    şışış ıÿ  ‰  !10 ş ışıÿk¥  KCA@@AA@    UA(  şıÿ   HD    şı şıÿş ıÿÁ"E Á"%À"% )©©¡¡ €¡ ş ışıÿ   Á"şışış ıÿşış ıÿş ışıÿ   şşıış ıÿ  “ƒ“II’HI’¤$I şış ıÿ     ”•2"Ô ? AA@@@@AAş ışıÿş ışıÿşış ıÿşış ıÿş ıÿşşış ııÿ  $şşı ıÿ   şış ıÿ    şıÿ     H@ABbDP EEEEE@DAşış ıÿ  @şış ıÿ   şşı ıÿşşış ııÿ   €€ )   Zµ Zµ ªV Zµ Xµ ¥¢€¥b     $"!! )(  " 23s  "şş ışııÿ#şşı ıÿşşşı ııÿ  €À ˆ„‚  ÿÏÌÌÌ„„„ ("       şı şıÿşış ıÿee  <>(ü    şı ÿş ıÿşşı ıÿşşıışıÿşşş ıııÿ şıÿş  ıÿş ıÿAşı şıÿ ¢   şı şıÿ   7““     ))))))!        B ş ı ÿş$ıÿI€    €ƒƒƒƒƒ€€   şışıÿ şşıış ıÿ  şı şıÿş ışıÿ  &ş  ıÿşşı  ıÿşı ş ıÿ    04802     şışıÿşş ııÿş ıÿşşış ııÿ  •“Ğ““Ğşış ıÿ’ş ıÿVUWUIş ıÿşışşı ıÿşşıışıÿşşıışıÿ ş$,ıÿ ş ı ÿ ş ı$ÿ !! şş ııÿ   ªª         ³³³³3111  ³±±±±!!!   2   2!  &'%€şşıışıÿşışı şıÿ D4 şı şıÿ ş ışıÿ   şşışış ııÿ  Aq1}=!É   €Àà âø  >>şış ıÿƒ°ª   @H@  ####  %%(  DFD       …   -   … †   ¦¦† Aòûú ## !! #!ª* ÄÄ  üşÿ *(       ##  DH&6  æ   €@ "‚E* J ………„€… DP!BH CCCAA@AAA      IAAA 2:2    gE@UAI    IAA 0   4 ùú            ---  ğò /.,  UTT P ğ÷ÿ   « ªª«  €€   f@   ]YY#-R ©©           %  Q  €€     5=   9 IA IH ŠŠ   $  ••”R&R&  P‚"  &   "2 ·¿¾ ÿ÷õôt4 ?@    0  P&   ş  UT   × Ç Ç Ç  h  (<?* **ÛÛÛÛ KKHH  V --   T« u t t  êâ   ƒƒƒ"            @(„.   $  D  ÅÅÅÅ     10  €ÿûéà`  @up0 @}x8  ??<  I’$ «ƒ)(((           BB @ ùÿ   " .,   ‘‘‘‘€€€   €   0$%70 )(       !!  AaAÀÀÀÀ     €€À OCE   '" ME EM   £ €€ø‡€#  ³±±±±±!!! @   ø  )((  )!!!ÙÀÀÀ    †††  (€   @!À  #ÅÅşış ıÿşış ıÿşış ıÿşış ıÿşış ıÿ şış ışıÿ   ş ışıÿşışş ııÿşşıışıÿşış$ı(ÿşı şıÿşış ıÿşış ıÿşı şıÿş ışıÿşışı ÿşış ıÿ  PRR ş ışıÿ --------- 55555551!!şışış ıÿ    `PHşışış ıÿşış ışıÿşşı $ıÿşış ıÿşış ıÿşış ıÿ   ş ışıÿş ışıÿşşış ııÿş ışıÿ   ‰ I!1!şş ıışıÿ      şış ıÿşış ıÿşış$ı(ÿşış ıÿşış ıÿşşış$ııÿ OOOOHOONNJşşıış ıÿ  ş ışıÿş ışıÿş ışıÿ şı şıÿşış ıÿ  ÿ  şış ıÿ         014$"(şış ıÿ  ş ışıÿ ş ışıÿş ışıÿş ışıÿşşış ııÿş ıÿ TS  ]PP]\PXXXP   "!    şı (ÿşı  ÿş ış ıÿşış ıÿ şşıış ıÿşşıış ıÿ  +(*(++++((ş ış (ıÿş ış ıÿş ışıÿşşış ııÿşış ıÿ  şış ıÿ  4$!0 +)ş ışıÿ @BRC #!şı şıÿşş ııÿş şııÿşşış ııÿ  QPş ışıÿşı şıÿ   7333  @Aaq`@H  ş ışıÿşışşı ıÿş ışıÿşşı ış ıÿş ı (0ÿ <>€   ş ı$ÿ şş ııÿ )()())))() şı şıÿ  @ şı şıÿ  şış ışıÿş ışışıÿşşıış ıÿşşışış ııÿşı  (ÿ    0( $"!üÿÿÿhEğÿÿÿX' ´ÿÿÿX' UUU¬ÿÿÿX'øÿÿÿ\'ÌÿÿÿX'„ ğÿÿÿx' ØÿÿÿX'Ğÿÿÿ0 Œ' °ÿÿÿ\'Ôÿÿÿ\' ,((Ôÿÿÿ,,(„TTôÿÿÿ ì'ìÿÿÿ\( hEøÿÿÿhEĞÿÿÿ0(0(ôÿÿÿ\'ğÿÿÿ xEÔÿÿÿ, ,(ôÿÿÿ  (hÿÿÿ\'ğÿÿÿ\'ÔÿÿÿhE$$ìÿÿÿX'Èÿÿÿ\'ìÿÿÿx'Øÿÿÿ\(´ÿÿÿLH(”ÿÿÿ\(ğÿÿÿ¼(àÿÿÿ °(ğÿÿÿhEÀÿÿÿ@<ˆ'Üÿÿÿ$$È(Ìşÿÿ4hEdüÿÿ4hE 7u¤0¼şÿÿDD2Œıÿÿ\'˜ıÿÿ4hEÌÿÿÿ\'ÿÿÿ\'@@@@’@˜ÿÿÿ\'Äÿÿÿ\(äÿÿÿ\( ÿÿÿ``¬(Èÿÿÿ\'Èÿÿÿ80H( " -   ¨@èÿÿÿ\( ìÿÿÿœ'ôÿÿÿ ğ'Üÿÿÿ$$Ü(Èÿÿÿ84à( ìÿÿÿhEğÿÿÿ (\(   èÿÿÿÈ'¸ÿÿÿHH) ôÿÿÿhETUĞÿÿÿ00Ğ'°ÿÿÿPP )èÿÿÿx'´ÿÿÿLD()¤ÿÿÿ\T$)Ğÿÿÿ\'\(ÀÿÿÿhE  ´ÿÿÿLL\)Ìÿÿÿ4,`)äÿÿÿø' ğÿÿÿ ğ' ¸ÿÿÿHDü' øÿÿÿhE  )    Á"À"¤ÿÿÿx'Á"%À"% \(\'ş\'àÿÿÿ\'Ğÿÿÿ0,( $44Ô) €€€¤ÿÿÿ\'¼ÿÿÿx'@ÿÿÿ\' Øÿÿÿx' ”ÿÿÿx' B3ìÿÿÿ\'Hôÿÿÿ hEÀÿÿÿ@@*Œÿÿÿtl*8ÿÿÿ\'¼şÿÿx'œÿÿÿ\'Xÿÿÿx'  &ª1ª1Ğÿÿÿ\(ìÿÿÿ@)  CCÄÿÿÿ\(èÿÿÿ|( K ôÿÿÿ \'äÿÿÿä'ğÿÿÿ@(  xEøÿÿÿ ( 8şÿÿÈÄà2Øÿÿÿ()èÿÿÿt'  „ @( ÿüüıÿ”ÿÿÿ\'  èÿÿÿ€'¼ÿÿÿÈ'€ÿÿÿ\'  ¬­¯¿ğÿÿÿ ğ' (D.D)D(DĞÿÿÿ00¬*  TUäÿÿÿ€' ! àÿÿÿ Ì' 5-!!¼ÿÿÿ\' )    Ğşÿÿ¼(àÿÿÿ „' Pşÿÿ\'MbLbôıÿÿ¼(øşÿÿ0 Œ'c’É1Éd1Éd  ­…”ÿÿÿlhä*M(ÿÿÿlhä*Ğşÿÿx'ÿÿÿx'„ÿÿÿx'¤şÿÿ\' Üÿÿÿ xE”ıÿÿ\'Dúÿÿ\'lhä*`ÿÿÿ\'Xÿÿÿ\(xıÿÿx'Äÿÿÿ¼(ÿÿÿ\'¦U«¦U«¦U«€U«Øÿÿÿ xE‹”H xEPÿÿÿ\'   HD4+¸ÿÿÿHD4+   ¸ÿÿÿH@l+èÿÿÿœ'˜ÿÿÿhE 443   À?Á? II\'     01$$ @ğúòğÿÿÿ ì'     NF  fvgc`hd€  äÿÿÿ\'äÿÿÿhE Üÿÿÿx' 1! )èÿÿÿ ğ'  NG IHHH IIIIAAAAA@@   0p`  IA äÿÿÿx'Ìÿÿÿ hE  Üÿÿÿ$Ğ(ğÿÿÿ * • ” ” ” Àÿÿÿ \'  hE  (òúhEìÿÿÿ ì'¸ÿÿÿHDà*ìÿÿÿø'àÿÿÿ ì+hEğÿÿÿT(ğÿÿÿhEèÿÿÿ ì'ìÿÿÿ@(Üÿÿÿ$$ô+äÿÿÿh'ìÿÿÿ )èÿÿÿT(ğÿÿÿl(ğÿÿÿ ì' Øÿÿÿ($L( hEÄÿÿÿl(¸ÿÿÿx'äÿÿÿT(äÿÿÿd)Üÿÿÿ$ä'Ìÿÿÿ \'Äÿÿÿ<<è+  @œÿÿÿ\(ˆÿÿÿ\(`ÿÿÿ\( 0Ôÿÿÿ\( P@èÿÿÿø'  Ôÿÿÿx' hEˆÿÿÿxtü+Xÿÿÿ¨¤H0 ÿÿÿ`\) !! !! #####  “““““ìÿÿÿx' +*( èÿÿÿX' Â?Ã? ĞÿÿÿX'  5ƒ5ìÿÿÿ \'§€à4 <ÿÿÿx' sssc  s`s`ğÿÿÿ \' pÿÿÿD<$, áèÿÿÿ xE   ¡ ÈÿÿÿÈ'4,@,ƒ!!!ÿÿÿppt,èÿÿÿhEII’II’HI’$ÿÿÿ\(    HDL, üıÿ@µ@µ@µ\(  CC@@@CCCCCC´ÿÿÿLL ,  ¸ÿÿÿHDL,Œÿÿÿttd, Tÿÿÿ\'Ôÿÿÿ,(”,ğÿ X  «¡¡ «¡¡©¨    @ìÿÿÿ xE ¦ˆÿÿÿx'  WQPÄÿÿÿ<,8*øúûÿôÿÿÿ xEÈşÿÿ84l2@€%Hƒ%H` c Èÿÿÿ xE àÿÿÿ xE@şÿÿ\'ÿ% şÿÿ0 Œ'àÿÿÿ ,(Àÿÿÿ@80,äÿÿÿàD  Üÿÿÿ (!     ØÿÿÿhE`ÿÿÿ œà0ÿÿÿpl8-xÿÿÿˆ„80°ÿÿÿPL¨'àÿÿÿ *Èÿÿÿ84-MMèÿÿÿè' "&'"!Üÿÿÿ hEôÿÿÿ ((¨ÿÿÿ\'ÿÿÿ\' xE´ÿÿÿhEÈÿÿÿ8(d-  +))())))(()  èÿÿÿ\' eeeœHH NØÿÿÿ($È)($È) ÜÔ Hœÿÿÿ |' ÿÿÿàØ(1pÿÿÿH<ˆ-¸ÿÿÿH<ˆ-  ¬ÿÿÿ hE@    "" ÿÿÿpLH, ìÿÿÿ€'Üÿÿÿ$$È- (€ Äÿÿÿ<4Ä-     ˆ  xE  (ÄÿÿÿhEdbt}”ÿÿÿl`ø-  … BBBB '"°ÿÿÿP@ü-Tÿÿÿ\'  //,,,   \'( 448.äÿÿÿP(  €ìÿÿÿl( ))) ‰€€€€ ÙÙØØØ øşÿÿ\'  3%É!É!ÉäÈÿÿÿ4) àà AÔÿÿÿ,$Ü(€*€*** BBBB´ÿÿÿLD¼.şış ıÿşış ışıÿşşış ışııÿ  ./'-+   şşış ıışıÿş ışıÿş ışıÿ ş ışıÿşış ışıÿşış ışıÿşış ışıÿşı  ÿşış ıÿşış ışıÿş ışıÿşış ışıÿ şışış ıÿşş ışııÿşış ış ıÿşış ıÿşşı $ı(ÿşışış ıÿ      ş ışıÿş ışıÿşış ışıÿ  şş ııÿ şşıışıÿ    şış ıÿ (  -%%%%!! !!şşışıış ıÿ    şış ışıÿş ışışıÿşşşııış ıÿş ışıÿşış ıÿ ş ış ıÿşşı ıÿşşı ışıÿşşşı ııÿ  şı şıÿşşı ışıÿşı şıÿşşıışşı$ıÿş ışıÿ    @€ „‚şış ıÿş ış$ıÿşışşşıııÿşşış ııÿşı şıÿşşış ııÿşşıış ıÿ %%!! ş ışıÿşış ıÿ  şı ÿş ışıÿşış ıÿ  şş ışııÿşı şıÿşış ıÿ  şşıışşııÿşışış ışıÿşış (08ıÿş $ıÿşşı ışıÿş ı ÿ -,,-),,,((,(  0(!$2 şşışşı ııÿşış ışıÿ şşışış ııÿ şş ıışıÿ  şşıışıÿ 33333330000 UUUUU     3aaAA@ *7   ‚!¢"4 3333  ™ ­€€€€€ #%  / QPğñùòø  @ d`jzk !! BB @    SSCğüõ÷ğüõ÷  6666  ¨  € @   F    _R 8'   !!   "  «££ƒ€ 5 ED@  0<60! ggg   —————     p8>;  $üÿ IHH IHH @@   $ k# ( CC@CCC ?+#PPPPPP  ?øşÿıü   @   nll  A@ srr U rrr Uøùú  ‹êΊ˜   6666       WE( ° kX˜   7ŒŠ”U«  ôöõü 311110  %$6 MM   T ÅÁÁÀÀÁ ss@@@@CBB r`  ­©¨ (,- UQAA?ÿ( ¢        *( € €   € ’’’Q  @ ‰€€€€€œ  '2dH „ %şşış ışıÿ H$H H I A@şş ışııÿşı şışıÿ"ş ışı ÿ„a` ‚ şış ışıÿşışış$,ıÿşışış $ıÿUUTUşış ışıÿşşış ıışıÿşşışş ıııÿğñşış ışıÿşış ışıÿşış ışıÿşşış ışııÿş ışışıÿşış ışıÿşış ışıÿşış ışıÿğñş ış ıÿş    ıÿ ( ( (ğ------(-)))))-şışş ışııÿşşış ıışıÿşşış ışııÿşşışı ıÿşşış ııÿşşış ııÿşşış ıışıÿP¤R¤P¤# !I& !+  &U«ŒŒ-R-R-Rş ışış ıÿşış ışıÿşışış ıÿşışş ışııÿş ışı ÿ şış $ıÿş ış ıÿ[[[[[X@[[[şış $ıÿ ş $ıÿşşşııış ıÿşşşııış ıÿşış ışıÿşış ışıÿş ışışıÿşış ış ıÿ şış ışıÿşş ıışıÿ¨  "$  !„„€ş ışı (ÿşış $ı(ÿ…„„   !şşış ıı ÿşışış ışıÿşı şışıÿşış ışıÿ $!şş ışııÿşşış ııÿ #ş ışı ÿşşışış ııÿ  ş(08ı<ÿ(#Aş ışşııÿş ışı ÿàÜ?Ø?ß?şşı ışşııÿØ?İ?şşıışşıışıÿşı ş ışıÿÅEEEEEEEEEEEEE„ €€bò€   2$ UUUUQ@Q   -$ "LACAQş    üıÿ M ,:+ `˜€  UUUE  A@ %%%%! $²$°$    FD  ğôıÿûùüışôş üıÿUUúPUUúSP       0U•şş    üıÿ KIA PPP  ĞrEÊ )D   ‰‰‰‰€€€IIEIEIEIEIEDD ÎîƆ‡   ( VRR      )€ˆc’Éc’ÉY‰ê¢ªª¦Z  Á<Á<FfFSK **** ********øù!!! Ÿƒ I’¤ €€€€€ QPIIAA“‘‘€ ’ê¢  ˆŒ< g#™ K K sc € †  ccqieà `  \]h ^d;ª‚ 0>.!  µµµ5 !11 0“€€€€     CAE “““ ş   üıÿ r``€   ¢    € !$!$!$!$ €  SCCAA@ € € € ((VURUPU RP€€€€€€€Ô$À$QAA )(‰ˆ@(* B!­©©¡¡¡¡¡¡¡ €€ şış ış ıÿşış ış ıÿş    üıüÿşış ış ıÿşış ışı ÿş ışış ıÿşış ışışıÿş ışşşı ı$ıÿşşşşıııış ıÿ ş ışıÿşşışşı ışııÿşşış ışııÿşşış ışııÿşş ışışııÿşşı şııÿşşışş ıışııÿşı şşışııÿş ışşış ııÿşış ış ıÿşşı ış ıÿşşşı ıı ÿşşşı ıışıÿşış ış ıÿşı şış ıÿşşşııışş ı(ıÿş ışı $ÿş ışış ıÿş ışış ıÿş ışış $ıÿş ışış ıÿş ışış ıÿşış ış (0ıÿşışışış$,ıÿşşış ışııÿşış ış $(ıÿşış ış ıÿşşıış ışıÿş ışışıÿşışış ışıÿşış ışı ÿşış ışı ÿşşı şışııÿşşış ıı ÿş üıüÿşşış ıı ÿşşıış ışıÿşşıış ışıÿşşıışşı ıÿ şışşı ış$ıÿşış ışış ıÿşış ış ıÿşış ış ıÿşı şış ıÿşşşı ışııÿ -$ $IBBFBR 5U -  ­…€€€€€QUPU s7; (0 ay @Bva!(       €—Çáè†À* &4(/ €†À—Çáè,    ÛÙQqT   #   %%%%6>?0­H ­H   '#"  0€     ’’’’ şış  üıÿ   ••••••” N O O Ï N ÿ ÿ D T E O $PQUPX)ş ışı $üÿGFCDEşış üıÿ +*( KAA  gf`xx@@áã Ab!Â?Ã? aaAAAAA  scccccc f~P  9=0 @UUTTUTU 0!3  €   „K+ OOL  J$ ¨€  €ááà ` ` ş  ışıüÿ  àäğáè      028<445  “““““ r```„T†Tşış     üıÿ+IIIIIDE I     10B`@ @D@% eGWOGA@  ‡ËÒ%ò% @@ EE E E E E E @`ÅFÅFEFEFÅ@şşış ışışııÿşış ışış ıÿş ışış ı$ÿşı şşı ı$ÿş ışış $ıÿş ışış $ıÿşş ışıış ıÿşşı şış $ııÿşı şış $ıÿşşış    ışııÿş ışış ı$ÿşış ış ı$ÿşş ışışıı ÿşş ışışıı ÿşşı şııÿşşış ışıışıÿşış ışış ıÿşış ışşşı ı$ıÿO  şış ış $ıÿş ışış $ıÿşış ış ı$ÿş ışış ı$ÿşş üıüıÿş ışı ş$(ı,ÿşşış ış ııÿşş  üıüıÿşş    üıüıÿşış ışı $ÿşışş ışıı ÿşşı  ışı ÿşış ış ı$ÿşşıışışşı ıÿşş ıışşı ıÿ şışış $ıÿşşşı ışı ıÿşşıış ışşııÿş ışış $ıÿ'2dH(2dÈş ışış ı$üÿ '/' şş üıüıüÿK M @Š¢0´  şış ış $ıüÿ'şı  şşı ıüÿşı şşı ı$üÿ (  OM $şş ışı $üıÿ   Á"Á"Á"Á"ş ışış $ıüÿ ##! @ ş ışış $üıÿ ş ışşıüıÿ ®¬   şş ışüııÿ L€,€ €€€ €€€€ 5µµ€µµµ±±±±±±±±¡¡€€#ÀYÀÀ?À? ïïïïï ‚†@‚‹«’şşış  üııÿ"P¤" ş şış $(ıüıÿ "Ef!Cb@@@¨TÇ$“  %-R (R(R &­H '-R(R'-R-R-RĞ"eĞ"e  µµµµµµ€ ¥"¥"¥"¥"¥"¥"¥"¥"¥" I I IIH@@@@ €€€€€€ QPşış ışüıÿ IHHHHHHşış ı ş$üıÿşış ış ı$üÿ khh` ( @&$ (&  % FNn~€ş ışış $üıÿş ışış $ıüÿş ışış $ıüÿ s`bbb A@@@şş    üıüıüÿşş  üıüıüÿş ış (ış,4<ıüÿşş ışı $ıüÿ şş     üıüıüÿş ışış ı$üÿşış ışı $üÿ -----%€€ |~şış ış ı$üÿ ¬®´µäO«ªªªªªªªª* C#@ şşı  ışı üÿşış ışı $üÿş ışış $üıÿşış ışı $üÿ  Pş şış $üııÿ ssss € ° ¢ª @AFbdtfj ¥¤¤¤¤  TPˆ  0  Àğ0 È$$ şşışı ışıüÿş ış ış$(,ıüÿş ış $(ış,0üıÿTPUT EgewU]Mş ışış$(üıÿş ışış$,ıüÿ¢B   (8X SSQQQQAA@€œ€€şışşı ı ş$üıÿ /³£@şış ı ş$üıÿ †–—øğ€ş ışş $ıüıÿ– – ş” şş!%Işış şıüıÿ¤$ɤ$ɤ$ɤ$Éşşışı  şııüÿşşış ışıış ıÿ $ ääää   $"@¥@¥@¥@¥A¥ €Ô„†Ğ&IIH@@ÀÀÀàÀÀ@@AI0"0"0"ş ışış $üıüÿşş ışıüıüÿşış ışış $ıÿàòãâ üü°ü ş ş şşışşı şışı ıÿ8 şş ışışıı $ÿ-@@@ d@@şış ışış $ıÿI5‰%‰%‰%‰%‰%‰5%]µ ]µ ]µ ]µ Yµ şış ışış $ıÿ     @ @ @şşış ış ıı$(ÿşşşı ıış $ıÿşış ışış $ıÿ““ƒƒƒ@@@-A%A3 şşşııışşş ı(ı,ıÿşış ışış $ıÿş ışışış $ıÿ àşşış     üııüÿª ª şı şş üıüıÿşş ış ı$(üıüÿşş ış ı$üıüÿ“““’’P   @           äõşşış ıış (0ıÿ“‚‚‚€şışş ışıı (ÿ  F  şış ışış ı$ÿ ş ışışş ııÿ şş ışıüıüÿşşış ıüıüÿ5ş ı ş(,0ış4üıüÿ5`€a@şşı ışşı $ıÿşış ışş ı$ıÿşış ışş ı$ıÿO Oş ışışş ı$ıÿşşışış ışı ıÿ’ä’äääIòIòIò €À 57 +++ + !+)! Ëà A şış ış ış$üıÿ MMMMTQ şış ışışı $üÿ  ` 80%!  0 @hHÈHIXLJ 8\JAA ‚€@ şış ış$ı(ş,üıÿ  –’‚‚‚‚şşış ışüııÿşış ış ış$üıÿ  Á€€)A}|zşş ışış $ıüıÿşşış ış $ıüıÿşış ışış $ıüÿşşışış $ı(,üıÿ dDTşş ışış $ıı(üÿ   şış ışış $ıüÿ III IIIIII@@@  @ şşş    üıüıüıÿş ışış ış$üıÿş ışşış $ııüÿ   Åõ  ş ışışı ş$üıÿ A!€ 0!3 3!€şşş ı (ş08@ıüııÿşş ış ış$(,ıüıÿş ışşüıüıüÿ CCCCAAAAşşşüıüıüıÿşşş  üıüıüıÿ   şşış ış$ı,0üıÿ    ş ışışış $üıÿşış ışış $üıÿşşış ıışüıÿ +###  GFB x8@TTTşşışı ışşışıüıÿşşıışşışış ıüıÿ " şşıış ışışşıüıÿşşıış ışışüıÿ ˆÊú şşışış ış ıüıÿ şışş  üıüıüÿ   "0p18  9 Acs{&@f@nşışş  üıüıüÿ €ƒ¡‘ FCE"¢¢şış şış ı$üıÿşış ışş $ıüıÿ    (,1 à`bb CCBB@şş ışış $ıüıÿ ÅEEEÅ @ şşı ş$ış(,üıüıÿşış ışış (üıüÿşşş üıüıüıüÿşşş  üıüıüıüÿşış ışışış $ıÿşşışş ııış$,ıÿşşışş ııış $ıÿşşı şış ıış$(ıÿşış ışış $üıüÿşş ışışıış $ıÿşışş ışıış (0ıÿşış ışşş ı(ı,ıÿşış ış ış$üıüÿşşış ışış ı$ıÿşşş    üıüıüıüÿş ışış ış$üıüÿş ışışış $üıüÿşş ış ış$(,ıüıüÿş ışşış $ıüıüÿşşşüıüıüıüÿşşş  üıüıüıüÿşşış ışşşı$ı(ııÿş ışış ış$üıüÿş ışşış ı$üıüÿşış ışış $üıüÿşşış$,4ış8@üıüıÿşşış ı ş$üıüıÿşşış ışıış $ıÿşş ışış $ıüıüÿşşşış ışüıııüÿ',dBd',d dÈ?Ë?Í?í?Ø?şşış ş ış$üıııÿşış ışış ış$üıÿ€Q ş ışışşş$ı,ıüıÿşış ışışış $ıüÿ     €€€€@€€€`€€@€€€‘…‚WUUVUUTUUPUU #H%+­ªÒ_   ™U ‹Ê (@ €€ ø‡ ø‡€ À €ˆ„‚€ şşı $ış(ş,4üıüıüÿ   Ll@&&&şşşı ıış ış$üıÿ    ä?$4Ü?Í?Ï?E şş ışışış $ıüıÿäáãâ  äøéë…‡ Œ şş ışışıış $ıüÿşış ışşış $ıüıÿşşış ışış ı$üıÿşş ış $ış(üıüıüÿ:€˜d2 € UTT#Äş ışşış ıış$,üıÿ Ê   €DˆD¨DŒ©¨€Î I’¤I’¤I’¤ IHHHHHHHH ˆÈ  @Ppp{}yøùğ ``cbÈÉÊÎ^  €@ )şı şşşüıüıüıÿşışş ış ıış$üıÿ  „`   H„  2 01 0`0a0¢0 102şışş ışış $ıüıÿ:şış ışşüıüıüÿMIşı şışşş (ı0ıüıÿ ‘Ññq       @@$@@@@"@@@€@"@ €€€€àäåâğìşşı şışıış (üıÿşış ışışış $üıÿ€ ‚Bbr J J“‘‘‘€           “P‘P‘P‘P‘P“Ğ“Ğ“Ğ“Ğ‘Ğ‘Ğ‘ĞAµL@µL . À€  ŠRr/HI’€À‰€¢²¿N şış ışışş $ıüıÿNûö ¹¿ 2:>,(– – – ş” şşşş ışışüıüıüÿ EEEEEEEEEEE¤£Ÿ(¶·DšHâ÷üš@â½T…½¨…ÚYš4â¼Sš4⦀¤ £¤ £OZ¤ £Åˆ¤ £<µY0㤠£‚פ £ßõ¤ £‰x¤ £ip¤ £1¤ £¦€¤ £¤ £Åˆ¤ £<µY0㤠£ßõ¤ £‰x¤ £ip¤ £1¤ £¦€¤ £¤ £Åˆ¤ £<µY0㤠£‚פ £‰x¤ £ip¤ £1¤ £¦€¤ £¤ £OZ¤ £Åˆ¤ £<µY0㤠£‚פ £ßõ¤ £‰x¤ £ip¤ £1¤ £¦€¤ £¤ £OZ¤ £Åˆ¤ £<µY0㤠£‚פ £ßõ¤ £‰x¤ £ip¤ £1¤ £¦€¤ £¤ £Åˆ¤ £<µY0㤠£‚פ £ßõ¤ £‰x¤ £ip¤ £1¤ £¤,פ°×TI… ?ë'Àë'DP)8úf)€W*+*$C+<T+dCŞ)oí)!Ş)oí)!õë(ÕÃ24ë'XÃ2ë'Lˆ4$Gœ4(Í4TKã4X…(?…Ü?¿,l¿,„ 7X~ü7TZå5¨å5D¨“9Nª9¹~>)–>5+*4$š?àƒO6hYO6DYÖA¤Ef)`WÖA¨Ef)WIÁlÕŸB¼@BìLC(õO6<Yf)0WŒ6T”f)WíC8˜å5$¨†D(­I$Áõ$ëáG7ËI„6pHø“pH“ÑJ8-õë€H0Iõ5´PÑJ8-õë^…?ÕMPĞITÁf)°Wf)ìWG4G”4Ø.ÂU´€H Iõ5dPG4­LTDG4­LXDG4­LTD=H €=H €[|08[5[X0.\`:G4z\ñ»\û J;=^B=^(BIÁõ,ëIÁõ,ëO6 YO6\Y`€‡„‚P)0úO6(YP)0úO6(Yå5L¨ë'ü¡´z¡àz-kˆy@Lz-kôˆ°Yl™°YÀ™°Y™IÁõDëIÁõ`ënѽn`Œ€HI­Z,Y€HI­Z|Yf)Wär8UŞ)oí)$!J,fúhdzh€z<#0{>ë'<ë{#ş{pş{ş{Hh {`‚¼)4/É)8_1ì_1PìÕM(ĞIÁÕMĞIHÁ¼)</É)@Ş),oí)0!?ˆ78ÕR‰`À9GnC+,<T+”CBŒ5ŠP'€H I€HHIŞ)oí)!ŠB †,@ŠB È,FŠB $<ŠB<Ô”@ËŠ8'Í*@8+*0$ŠB\µ* ‰–°†—tT˜T|0{œ>,œ40{>0{Ä>€zL# ’0²C+$<?ˆ,7¼›( ï|\X¼)\/É)„Ş)|oí) !®,¤/¿,¨. Ä ş{¤á¡l“^|¬/᡼“^|¨/åzÊåz@Ê-£(åzPÊ.¤ 죰ş§h8{m©yf)ÜW_1ì,L4©dú©pú©«@ıë'0©«@ıë'0©«Hıë'8ô«`Hô«ÈH˜(!¬¬A©<ú!¬<A€HI€H@Iõ50Põ5XP€HI­Z´Y!µP n8ÑƼ¨ãæ¼ ¹_1$ì˜<_1àìë¾ë';À[_10ì„0*,Œ4, 4ë'8,L4OÅ<A,€4»Å 6»Ål6êÅ DêÅäDÂÆ$œÂÆtœ€HI­ZdYLʵF8.LʵF8.LʵF8.LʵF8.LʵF8.LʵF8.LʵF8.LʵF8.LʵF8.LʵF8.LʵF8.?<ªO6YJ$fJLf¡Dz¡dz’‡ Šåz,ÊJ‹–åz0ÊJ‹–åz,ÊØ.Ø.ÆÖP!€™Tã3×P!€™TãaÚ0½['$|O0Z¤£¦€¤ £ip¤ £Åˆ¤ £¤£¤£Ìğ O@÷@_¦€¤£¦€¤£¤£¤£Åˆ¤£Åˆ¤£<ŒµY<µY$㤣㤣‰x¤£‰x¤£ip¤£ip¤£1¤$£1¤$£QŒîóT‰QŒîó8‰É6.`?É6.X?5<nN06ͬÜÍÀÜêJiê4SêDXê<Xò Î l„VtLQ¹Ì4$2"€08ù< ùÌ "8ğ°GùtNÔ"ùÈN8"ÂtXYø‚n|˃ˆ;UëÑ`?ü(OWXjü(OWÈj‚Ls_hwŒ(KW,jŒ KWXjŒ KWĞjÑ<?S_ €= ä= ¤= =J#J#ˆ'(6¤,£'6¤£b&%¼(Ô '(6¤£'(6¤£'(6¤£'(6¤£'6¤£'6¤£-*pRĞ&t z€)ŸPhüˆš¼(ŒÔ ¤£”(È-¤£”(È-<(µYLe-l/e-p/¤&L¹oh"1$&³1LL•1æ2$ï•1æ2$ï•1$ær4<a­4 %<U²$(•1 æ %U6„- %U0˜ %U0˜•1æ2$ï•1æ2$ï­4•18æ­4 %8U­4 %8U­4 %<U­4•18æ­4•18æ­4 %<U­4•18æ­4•18æ•1æ2$ï•1æ2$ï­4•18æO\Z¤H£2ï•18æ•1æ¾%$¨`.8ʽ#P# @˜¤¤£<˜¤t£<˜¤ˆ£O3 YĞ% 6¤&¹ot"r%% %4U#3® %4Uä3^ %4U4¥ %4U$9h %4Uã2 %4UH%¹ %4U^%i %4U…%° %8Uª% %8Uø$¢ %0U¾%¨ %4UÄ5´ %DU3% %4U—%s %8U:9 r4Pa¦€¤ £¤ £Åˆ¤ £<µY0㤠£‚פ £ßõ¤ £‰x¤ £ip¤ £1¤ £¦€¤ £¤ £OZ¤ £Åˆ¤ £<µY0㤠£‚פ £ßõ¤ £‰x¤ £1¤ £õS”T€ õS TŒ õSdTP iM`²iMh²ıL œM ¡ŠM̸ŠM¸ŠM¸ŠM¸uX‘uXl‘I\.M8¡„_PH˜_œA„_PH˜_¤Aíb"_°w €= ä= ¤= =#e0ÓJgà[–g$å¬gHWÑ8?ÚgÄuıg0nhˆzıg0nhLz]njnTÇ]nhjn$ÇPp‹tpT¥ph¶ÆplYsåÍrÑìn0C(w¤–ìn0C(w¤–ìn0C(wÀ–ìn$C(wØ–ìn0C(w¤–ìn0C(wÀ–ìn0C(w¼–ìn0C(w¤–ìn0C(wÀ–‡u„Ÿu,ˆsÕ±r<Ï!s×—r0Í?sޱr<ÏYsåÍr4Ñ”} à£}tä}ƒ}HƒÙ~8©Ù~©†œ×a¨ªa4ªù}4¥¬ƒÄ(¬ƒ|(LL²a@ªLP²a4ª† ×aLªù}¥aDªä}Vù}8¥X‚{~0]~Ao~Pç‹~Xo~Lç«é4Ä逕Pt¥‘h*L“XÉ¥‘\*L“XÉ¥‘\*~—0—4Ù—49¥‘”*L“XÉ¥‘\*«é(ÄéìL“hÉ¥‘l*L“XÉ¥‘\*=¨<ƒvuävŸ¨<B²¨‹ö¨<d¾q_0©<h¾q_h©R—rÍ!s ×—rͼ«$ëÒ«d¼«$룭ˆ-¼«$ëW•T„¼«$ëw•T‰¼«$뛕Tn°Ü.°Üe"±0"± "±,ó¬yù³ßк°¥  =§¼ ÀƼT°=½T:M½|6½poŠ»dkù¾T³ù¾ ³?ÀteÀ$_½`o½ oh4A¿Á$h9Á@èlÂÄÔ4Âäó \=5ÆRÆHšÈL6qÆp°LÈHN7ÉŒVxÉÈ4‘Éô9ÎX`ÎX`3νÎD`¸Ï$éÕÏ îÏÎqÎ,`3νÎ8`¸Ï éÕÏÄîeÔL¾eÔ¬¾Ó;Ó,ÕL`'Õh=Õ `'Õ<=æ×­ƒX;Ó ;Ó@+ÚPWÌØÄ5Ô`Ô'Õ8=CİÜ/'Õ,=Ö@5'Õ@=Ö°5'Õ<=Ö5'Õ<=Ö5×DvğİP&Ôpì4ÔLù†ä(µä@†ä@µäHÂæ8v ¤=Âæ0vpå|0îè(é@ñîè€éˆñ*ë8v ¤=*ë0vØé|0Ví(…í@YVíh…ípY’ï8v ¤=’ï0v@î|0¾ñ(íñ@é ¾ñdíñlé úó<v ¨=úó4v¨ò€0úó0vúó<vYP‚YT‚CV` eVğ CV` eVğ ãÄ‚ ğ=㔂 \=õSXT@ õSXT@ :oD"OظO؈xÕ$-xÕ$-xÕ<-xÕ°-xÕ4-xÕ4-OØŒOØdOØ°OØxxÕ$-xÕ$-…-@¬-$„..Hs Ô=ÒÓ<hîÓHvàÓ<’şÓ` s.(Ûš._ Ì=¸7Ìi#ehÓ#e´ÓA<¨A<¸¨+‚şö=<eÆ; §;0wE$**F$fwE$*šF$} G4 GÜ  = P=CV eV˜ ¨=PÔ7.N`a.4lĞxÕ$-xÕ$-b`0àÒKŒeCV@ eVˆ CV@ eVˆ .NahœŸ®gKyS,U.Na.NÔaÛÔ"òÔ—CV eV˜ .N¨a È=ân“6tâPq¬Pq´¨rÉnr(ÏnrÏër¨[nrÏ)sHk×t×tdªqx[  =Ow4‚x42yîşx(é¨rÉnr0ÏCrp@ _y 'şx@é¶wTr0}Q<Œîól‰Q(ŒîóH‰܉Dߊ`ã܉Dߊ`ã܉Dߊ`ã܉Dߊ`ã܉Dߊ`ã܉Dߊ`ã‹@¬‹Ä¬ @4^˜ Œ4^øÆ’Dø ı’€^n“H ı’Œ^ÇŒ@ı €Ô܉ߊãÇŒ|ıÇŒìıl£@Õ‚£Hªß£4Ôê£$É椄ïM¤´"Cràp ×ÇaXª¬©Ñ-©ğ‚Q«\Ü­€0Mn„¨^=¬¸ªò­€ÿ­tò­4ÿ­<.N a.N4a°¯LÉÿ¯ØëV°<(t°xq÷¶,öªTC÷¶<öªhC÷¶<öªpC÷¶DöªpC÷¶DöªpC÷¶\öª˜C÷¶höª˜C÷¶höª˜C÷¶<öªhC÷¶PöªxC÷¶DöªpC÷¶DöªpC÷¶döª”C÷¶\öªŒC÷¶\öªŒCöªœCöªtCu»¼’öª<Cߣ8Ôê£$Éߣ4Ôê£$Éߣ4Ôê£$Éߣ4Ôê£$Éߣ4Ôê£$Éߣ4Ôê£$ÉÖ½^%4ߣÔê£ Éߣ(Ôê£<ÉCrDpŒ ‚£ª]¿dN‚£ªÌ¿P9‚£ªÌ¿d9‚£ªÌ¿l9ߣ<Ôê£$ÉߣÔê£ÉߣÔê£Éu /‰Â  ߣPÔê£lÉ䥰ãğ¥Ä4•r8ÄOw,°¯¸Éÿ¯¨ëc¶ğ{-©(‚‘Æ$Bpº„æI¨(¡Û´¬P’Ç,ù¬¤«âÇØaôÇoc¶ğ{-©0‚c¶œ{-©À‚;¹lØÎht4¡TÌöªTC4¡TÌöªTC÷¶<öªdC÷¶<öªdC÷¶<öªdC÷¶löª”C÷¶ˆöªìC‚£ª]¿dN‚£ª–Ğ0.‚£ªÇĞ02šÑ$•°Ñl^šÑ$•Ò0ŸšÑ$•W•(„šÑ$•{Ò<£ß£<Ôê£$É÷¶<öªdC‚£ª]¿dN¶w”Tr }‚£ª»ÕPA‚£ª»ÕdA‚£ª»ÕlA»ÕTA»Õ Aߣ<Ôê£$ɪq˜[Ñx<¶w(Tr4}‚£ª]¿dN‚£ª–Ğ0.‚£ªÇĞ02‚£ªÈØP,‚£ªÈØd,‚£ªÈØl,4Ù$ã°Ñl^4Ù$ãW•(„4Ù$ãñÙ<Çä¥ãğ¥X4ߣÔê£DÉK¾˜[¾0zp¾¡î½H6l£Õ‚£ ª?Èß‚£ ªl£Õ‚£ ª?Èß‚£ ªl£Õ‚£ ª?Èß‚£ ªl£Õ‚£ ª?Èß‚£ ªÎG×Í ¶wTr(}¶wTr,}" €0$" €0$iM²ŠM0¸ÌõoD""±<"±`û±Yû ±Y$CüLL!@ |=U6¤§Bù0ék¤<»ÙL'ÒÙd–l–l4o<"lH“6ğâoT"ÔŒ¯ÔدÔ0¯Ô¯Ô¯cì§Ê(ìâ4€ ( 4E( ^<³‡(:Ÿ4ÈÆ(Tà<İ $n%`òP(ˆk4˜(£´<#eHÓék„<¿Áh‚LC8“Ch“C“}œp$aÑ?æi€F %€A¢(XN¨€W)€)˜DW)€)˜DO+$€)\DO+$€)\D-‰€)\D-‰€)\Ds0 €)(Ds0 €)(DT3€)˜DT3€)˜D¯5\Ø5q¯5\Ø5q¯5\Ø5q¯5\Ø5q¯5\Ø5qÿ7î36<¯5\Ø5$qˆ;à—;ü¥g>€) Dg>€) D9A€)˜D9A€)˜DùB€) DùB€) DËE€)˜DËE€)˜D¯5\Ø5qàH€) DàH€) DpJ€) DpJ€) DL€) DL€) D¼N€)˜D¼N€)˜DhP€)(DhP€)(DS€)˜DS€)˜DÂT€) DÂT€) DøV€)˜DøV€)˜DŠX €)\DŠX €)\Di' c­\îUhH8c­,î[€)˜D[€)˜Dp¾¡î½46á\ €)\Dá\ €)\Dz^$€)XDz^$€)XD`€)TD`€)TDqb €)˜Dqb €)˜D´e€)˜D´e€)˜DUh8ˆ;Àoœ"å`BUhH8ˆ;ˆg€)ŒDˆg€)ŒDUh8ˆ;ÀUhH8ˆ;hi€)ŒDhi€)ŒDVk€)ŒDVk€)ŒD m€) D m€) D¦n€) D¦n€) DHp€) DHp€) Dêq€)(Dêq€)(D†s€) D†s€) D/v€)˜D/v€)˜Du|<Ÿ#eœÓ·.Zá._€0j\b¤0°€XÔ€Ô\…*+…à.]críb"]críb"]críb"]críb"]críb"]críb"””0P”ñ¹“˜êB•¬¨¹“0êş•d‡"–ì£ñ‘ÌÖ²•œQh—ŒUhL8;S\bh0;S\bh0;S\bh0²$(È$A ­h%­Tò­$Lò­˜L²$8(È$`A %@A\bà0èµ0Fr¶ièµF?² 'È$,A /ÜÑ.¹á_¹(-.l8°UhŒ8„½0B]¾ĞŠ¯5\Ø5q_¹-óÈ8sĞHª(5 '#eÓ#eÓ6w ÀÑ4$ ¯5\Ø5,q6w,ÀÑ40 6w,ÀÑ40 6w ÀÑ4$ ¯5\Ø5$q©:q©:|q¯5\Ø5,qék@<ék <İ08SİtCŞ0*PŞt"P"`P¯5T\Ø5hq¯5T\Ø5hq¯5@\Ø5DqºhŞ#eÓmğ|ğ’+H¼(tÔ £õ‘5%²$(È$,A ;àVüšª%d %UÈ$,A Vø,,¾%H¨ %4UPıÄ(_Äw.ÿ8ÇêşlO.ÿ8ÇêşÌO.ÿ8ÇêşPO"$€0\ú€ıúTı¢Tü4OéŒ X= 0¡ x) ¡ p) ¡ hŞ ™Şà™™Ğèºô4HlHl" €0qk1L! ·.øZá.ø©\b`0~)`¨8ò<Ã~)`¨¹)(µ~)`¨¹)”µ~)`¨¹)$µ~)`¨¹)„µ~)`¨¹)$µì*$ +ükï+xE',´Mˆ¡²LHıLØ œ‘L ŠõSTD  >oD"CVl eV¨ 8FL8FpLöK8k8F|L‡I$gªI,\‡I$gªI$\ÛLÈõ „=¬N@±YœPlU±YdìP`( (= à=L!  t=8ZtÂüO£0¤8ZˆÂ8ZÂüTO8]pJ8ZPÂ8Zø ¸=8Z¸Â-Xš-XTšeÍepÍc^Dñ ¤=FS$á =ü$Oc@OL‘L\‘d€Äé XU$>{U@4eœÍe¼Í…ˆ@¨ ˆp'FS´á Ü=·úm›ú$`Ö÷0eA÷L- T= ¤=CV  eVÀ ‰M (=ùìùપ æi(F#elÓ#eXÓÜ­Po«8scŒ/B(Wä²`†"¥Ìi·XG‡·Ğ4¨¶”喝¨ïG¼ş ¼('«é(9¾D*ç¾L…¾ !À$GÀåQ”säɢÄ0€äÄX”¢Ä@€äÄh”òÆGçÅè¸ıLÔœıLØœË$P3ËàfŠÖ^QÂ8áÖ$b ×$ZÆİt-Şğ¨°ŞÈáíÆİ`-Ş䨾ß3Nß =çél|çéÔ|²RS`_ ´= ü=3õ;bõ@å4öm×90ØbødÈøĞ}’+´¼(ÜÔ ŒúF ú Møø 1Ïû´ŸŒúF ú Mğ÷ï,•c­ŒîékŒ<ùX'"¥tøø1Gløø1Gä×ÇaLªù$'"¥˜·ùdY·ùŒY.NaıL`œf p'~ d@ø  ûÈÌü I¢(ƒ‘LŠıLPœü I¢(ƒÌF¼ıLlœıLÀœıL<œ>ÀÙø  ûdÌÌFÔoˆ= KâL09¶ #ı˜ğék`<ék¤<['[4'",MÀTí$ F## ­€ˆM.N<aL!ÈF## O*Ì@(F## œ*Î)F## >´ÙF## § Ø‚¸.>0Ù#ığ[P'×ÇaXª} ò3|ô['[ˆ'iÌ÷ü ´I×Ça€ª`C4 QX0¡}@˜t'"=x'õEhX xHh(JÔ4302X°k_ ¤¹Xk_ „¹O ½%àÏæ@Ğ_ 4¹w<­2Xh·ù$Y!À$W4j¯d6W0j¯Ø6x`¸ı*Ÿ`\e*^ÈÔ)x`Èı*H_:*Ï^8@*j”×9|Ø °= ô=øø1 H=Òg.bõ@åsÜ(Ÿ3ù ¢®˜ ¬=øø01˜0DjFc”U\c˜Yù,'"¥<o0“Ï>œ/o0“Ï>œ/Òp6Şé,,JB|WüäP|¥è6ù'"¥$ ƒ,u «éÄéÄé<í  ƒLu «é8†°° P„ #qk1L!Zl\Ğ‹t_ühP|¥l6#ığĞi˜^k46L!@ €= ˜=8„R BŸì/Ú]tÑ­€”Mù '"¥$לÇaت²,R²hRDó‚¶,ëN0¥0 üP|¥06ù'"¥0/c:\¥@.FcU\c,Y}fËøø 1}fËøø$1 fšøø 1 fšøø$1 q _ ¹ q _ ¹‚d ü  I‚d ü $I´i _ ¹´i _ ¹ßm _ ¹ßm _ ¹ˆï0ˆĞ4Cà@د6íáZâ(!láN’á(BŸáRÂá(_",P"tP#eHÓˆ;X.lä°¯T6€ğ‡³ğP–ª ˜t |y\  è=N´/yä N´/yä Şñ˜Ò®ñ¼Èo8ÂoX³𜖯p6LĞW3ùˆ¢C§ÈZCàøØ %A % Asc/B\W"´P"PCà8ؼ®UhT8ˆ;¨æiFò(`]æiFò(T]æiTF6+o.H3–0ˆ¾k&Õ51|N›.Q#elÓ›.Q#e@Óp@Ô(p@ˆ(GB^šA=GB^šA=D,,KDÔE4ˆJE8éJØ ¯\62HxÄGÜrG€ ÄGèïZ ·[ ÒÆ](/¯¸6È$,A ´*ЉÚgduı^ dĞ_BdDÛ¾%(¨ %Uø$¢ %@U´*ğ‰ÚgTu¨[w[йw4xŞw„:¹w(x(xx3(xP3oˆ"¨x>Êx`y$`#epÓL!4]Ô‹z@Mù‚|¸jz@Naƒ|Áù‚̸aƒ$Á]˜‹úƒ°L‰…$0š~€µ|Œ8f³Œ0qr%D% %U…%<° %U—%<s %UN8…~@o~¤ol‘P¢~Lo‘H†~o‘ì†~8o‘t†¼@j#eHÓK†vš~lµK†vš~HµB—\sn—¸wL˜˜«n—ĞwL˜x«n—°wL˜T«n—ŒwL˜X«n—wL˜ «n—XwL˜«n—TwK†<vn—Äw‰…d0n—ğwn—Hwn—¬wK†xvwœô‰¼j#e`Ó\§ —§hX ª@`®é´¬N¬d3°hk°L>­x}sܤŸUh 8–³ Ã0¤"±4WHjåÀBœ»(ƒºPcœ»(ƒºDcV»‹|»/ÕÄ t1ÃäĞõÇ°«_ȬÍLsÔÍ<V»$‹|» /)»\€4ºŒXê¹Nê¹XN4º$Xªº$hôÜ0´ôÜ0´Æx*ÆH*TèÀâdû»éP-ãéX4FÓèÁ´¸8)FÓÁ´¸@)"-_2xpEÛp `=8(tb¼,Z´yN½ÄQ.ùH#eÓDóL,ópw¸D~¸D~UxÄ8tb¼0,ZyN½0Qº)$oD"±.Zï.8_ 4Œ7P4¨;=~d=XGÒnGT±IÖJšBa@\@dŒ\ºs}[sŒMߣÔê£0ÉêjXPh89m3hDşÌ@—ÚLÛXP§8aŞ 3§HıV‘L(Š ıMıL(œ#ĞL!<6 †6ì†n'$l! T=İœÈë4ë`4æ{!4.N¨a{!È.N”a9 z9 z9 z9 @zˆ# RıL@œ9 z9 zĞ!ôB.Na±.ÈZï.X_ t= Ø=9 z9 z9 z9 z T=«&d{CàTدH6Æ;œj <Øb¦=<Fã:hPñCnã:DPÜN„ANè#YTèY_èYD_¾ZD-×$ÇadªNe0DŒeÈ6Ìg$dÌg”df(.¥qpF× ÇaXªi?j\Éh‹?j@ygFS,BygFS,BñPñÌ‚\’#„8çÌ‚H’€…$ÜÌ‚P’ކ,ÑÌ‚<’¢<,c‘ôv\9¢<&\L9&\L9CVl eV¨ X LX pLöK8kX |LŠM¸Ä4 Æ¥`( (=Ï™P1®ü.Â\- ƒ\úsÜŸ½ğiÍ°›ék<<½`il6˜Ş«é¨™,¨Êp'«&H{zÌ,qŸÌœzŠM ¸ŠMt¸iM²iMȲ T= ¤= P= ”= T= œ=Dë0ÍÙ4şÍî$7‘ïˆÍî$7Æğ¼BÍî$7Æğ¼BÍî$7Æğ¼BÍî$7Æğ¼BÍî$7òp0Íî$7`òdFˆì„m3íìxˆì„m3íìxê P} T=õ ˆ v%Œ@ø „¾7 <T 0ª ªf/ $f/ Ø$ÅJ9 \zÜ T¢Z4 Ä{¹6`íV5  4= ”=×4Çapª 6 \6ê& ,G¨Êt'ü2Á`.87­€MÄ A ”ÍÚD 06›E (9ëJ ˆP T=pQ <Q @9a9 ê, Ha9 ê, HyU ĞC±.˜Z\W |:W Ä>«&{+_ „Br<} f ¸n«&ˆ{«&Ğ{÷k L^bj h½şo 0>p !‚ HO‚ @OÎ2¤c{ ¬Î2—1 …£ Tä…£ Àäªq8[]K8O °= P=•r Änr@ÏX2Ø>,¥ ´¾X2Ô>,¥ ´¾š© Ç 4=«é‚ |Oà g,á ,Bà g,á ,BUJ œ3ÄH 82  PñB¡ \’»¢ 8çB¡ H’:¤ $ÜB¡ P’º¥ ,ÑB¡ <’?2¶2$v%  ™ Pı¿  ™ Hı¥¿ " ™ 8ıøø01øød1ªÏ 0.N¨a9 4z9 ğz9 4z9 ğz¤Ğ À¨9 zCà دŒ6Whjå@B[Ö l|[Ö Ô| Ô= P=9 ˜z9 ˜z¶ ÜëÄpš XG  H ’+¼(TÔ ’+$¼(PÔ XA"Pµ4 $%1 hù|'"¥è?ȼ߂£°ª?È$ß‚£,ªKD <­ÈC ØKD <­ÈC ÜKD <­ÈC ØDE 8º,/4ÑVH À;ª%  %\U´C ÈC 8óJ ’6N \6´C ˆÈC D6N 06ÈC |6N ¼6rO T9÷Q tÎR °¶÷Q tÎR °¶÷Q ¼ÎR P¶’+¼(4Ô .N\a.N\a܋ Dm‹ >Ü‹ D>ù >ù HÓC 0˜D ŸÓC 0˜D ŸÓC 0˜D ŸÓC 0˜D ŸÓC 0˜D ŸaD ™aD (™aD ™aD (™ÓŠ ˜m‹ >Ï‘ PM/PÑÜ‹ Dm‹ 0>Hš Šš d(wˆ Z¼ˆ 0¯o3 Ü Š 0ZI8 1/4Ñ’+¸¼(äÔ 4È 4×9DØÍÒ ŒïÑÓ ŒSÑÎ o0"æÏ ƒĞ 8!zĞ ®Ğ 8!ñĞ ÏĞ 8!ñÎ ¸- œ= P= ¸=¢Ú  ¢Ú ˆ ¢Ú  öK kïæ " Ø=é P [é ´é ˜ é Ø [é ˜[é ØN0Ä¥È í ˜0jøøÌ1şø @8şø @8ظ 3ù¸¢^`^`úVù ìŒ979€7¢|mx,º­<)JÈј@±¿`½›!<´!d°#eÓ¬"è­›!X L!À ؠ؄ sc4/B˜WMl¡M@¡ıL,œıL\œ:6x¾:6(¾+8€eY8`Xߣ@Ôê£tÉ‘LPŠ‘LŒŠ²L²LdD€¯Dt.›!¨‚;Pü#edÓ#eD ÓwHE²Lœ ˆ=‘LœŠ ´= = D=‘LhŠ-<E =ߣhÔê£Éߣ˜Ô꣌ɑL„Š²LÄ—$ȲL,o$"oT"û `*A„o"oP"o¬"oä"û `*AToÀ"o@"o"o "o "oì"û `*A@K¾˜[¾¬z—$ȲL,·$¹·$x¹·$¹Ûbx-Ö$×M,¡Ûb-Ûbt-—$ȲL,—$ȲL,—$ȲL,—$ȲL,—$ȲL,—$ȲL,—$ȲL,—$ȲL,—$ȲL,·$¹·$x¹—$ȲL,Ö$×M,¡D=hÁ‘L$ŠED<²ED¼²ED<²hmDÊ>ĞıL$œD=hÁ‘L$ŠD=hÁ‘L$ŠD=hÁ‘L$ŠD=hÁ‘L$ŠD=hÁ‘L$ŠD=hÁ‘L$ŠD=hÁ‘L$ŠD=hÁ‘L$ŠED<²EDÀ²D=hÁ‘L$Š>ĞıL$œû `ÿ[@oû `ÿ[@oû `ÿ[@oû `ÿ[Hoû `ÿ[ˆoû `ÿ[@oû `ÿ[@oû `ÿ[„oy5W,j&5ü8O¡5¯H6>´p.´$2´´2>´P.¨òè¨ò¤èH¬ÇRğ‹ék<ék<,"ì-‡hb»t ×ÇaLª‡ b», È0S#eÓÈŒSc­øîwÊ©±Ê”£%ËxÍ`Ë|Ç×9<ØáŸ\%ìLİìĞİ&ÓX”Bù&Ó”Bù&ÓX”Bù&ÓX”Bù&Ó$”Bù(&Ó`”Bù×ÇaXªBùBùxìPİìPİ&ßÈt#e(Ói'L !ØPŸğ Ò 4l£Õ‚£ ªl£Õ‚£ª?Èß‚£ ª?Èß‚£ª"€04  „Ü­T  7 ´7¯ä6 = |= È= |= È= |= È=£ğ¤¯t6.ª4ÓÀÚgu |=Lß'T ±¬œı±¬<ı¸©4©Ï©$Z¸©©Ï©(Z橲ª ^橲ª ^ù'"¥˜ߣ¼Ôê£@Éo"‚¶맪°BŸŒ/K4w¢HPA²E•mF>³[\ˆy\„lêm\ˆMo„l²E•mF>Kw¢H0A³[,ˆy\<lc­äîÉ–äl£Õ‚£ ªl£Õ‚£ª?Èß‚£ ª?Èß‚£ªøø1R´i 0= =ÔD; X=Ğ"”-ìÈİ @=ìøİ p=ì¸İ $=ìÈİ 4=ì¸İ $=ék@<ék@<",P"pPìİìİìİìİìİìİìİìİìİìİìİìİÛÂ\^Ûˆ^ ¬=¬¼Ü,ù€'"¥¤À"|-ìİìİh"-t"-şşış ışışıış $ıÿ'2$@Hşışşş    üıüıüıüÿşş ışış ış$üıüıÿ(  %şşış ış ış$üıüıÿ&şış ışşış $üıüıÿşı şşışış $ıüıüÿşışş ışı ş$üıüıÿ"(şış ışış ış$üıüÿşşış ış ış$üıüıÿ!ş ışışş ış$üııüÿşış ışşış $üııüÿşş ıışşış $üıüıÿşşşı$ş,4<ış@üıüııÿşış ışşşı ı$ış(,ıÿşşş ış ış$(,ıüıüıÿşşış ışış $üıüıÿ!¨*©*% €" $L’$"@şış ışış ş$üıüıÿ D@BÂÀÁaq@H €@ACB(  ---))))))) €şşış ışışış $ıüıÿşışş ışışış $ıüıÿşışş ışış $ış(üıüıüÿşşış ış$(ış,üıüıüÿşşı şış ıışş$(ıüıÿşş ışış $ış(,üıüıüÿ €ÀàĞÒ– "d 0 #"H¢ µ¡! ! ! €@q‘q b"b"jHdLdşışş ış ış$üıüıüÿşışş ışış $üıüıüÿ şışş ışı ş$üıüıüÿşış ışışşş$ı,ıüıÿ ““““““ 7''''   ‚ ’ ‚ ƒ   I I I I IIAAşşış ış ış$üıüıüÿ – – – – – – – – – –  €[ şış şış (ış,üıüıüÿ şşış ışış $üıüıüÿ))))))))))))))))))))))))(  BJj*  şşış ıışış ış$üıÿşşış ıışış ış$üıÿ „„dDTJH@ S A A A A A A A A A  A#  B "  f ƒƒƒƒƒSSRRPPPRPPRRRPPRPPRRRRPPP @Á@@…@‡h‡@§@­@%@@@@şşşış ı ş$üıüıüıÿ èèèşışş ışı ş$üıüıüÿ ##¢#"## #''&†&&"   B@ÀLşış ışşşüıüıüıüÿ DFD@ üüü0 €  ş şşP@    8 88 8 88€88 T5    şşış ışışış $ıüıüÿ @‚@ $ ,L şşış ışışış $üıüıÿ G'W  <  È?é?É?Ë?şşış ışış ış$üııüÿ Q-P-P    F!1ÉdŠI&şışş ışış ış$üıüıÿ   şşış ışışı ş$üıüıÿşış ışşşış $ıüıüıÿşşış ışış ış$üıüıÿ @H0 "ˆÈB  :€ÿ ğ ğğğ € @  ø ø   ¨*        - )           J   0Åşéşìş  K! ĞÔØÚÓÛ  @QP  € &2*€ &€  BròıÂıóışı IòIòIòIòIòIòIòIòşışş ışışış $ıüıüÿ0şÿÿhExşÿÿ ğ'xÿÿÿX'Ğÿÿÿ0 Œ' ÿÿÿ\'¨ÿÿÿX'ˆÿÿÿ\'ÿÿÿX'°ıÿÿ ğ'¼ıÿÿ ğ'ğÿÿÿhEôÿÿÿhEdşÿÿhElşÿÿX'şşşış ışış $üıüıüıÿtÿÿÿX'„ÿÿÿX'2€!C dÈ!C°ÿÿÿ Ì'Ğÿÿÿ00Ğ' ÿÿÿ0 Œ'Ğÿÿÿ0 Œ'ğÿÿÿhE hEôÿÿÿ hE hEèÿÿÿ\'ğÿÿÿx'(ÿÿÿ\'Àÿÿÿ@84(Ìÿÿÿ\'Ôÿÿÿ, ,( €€ ¡±¤dèÿÿÿ\'ğÿÿÿ xEÈÿÿÿœ'äÿÿÿœ'ğÿÿÿ\'øÿÿÿhElÿÿÿä'¬ÿÿÿTTÜ' ôÿÿÿ ì'hEØÿÿÿ\(ìÿÿÿ\(Üÿÿÿ¼(ìÿÿÿx'äÿÿÿt'\' €€€€€€€ˆÿÿÿ\'ÿÿÿ\'Ôÿÿÿ\'Üÿÿÿ¼(hıÿÿ0,(˜ıÿÿ4hEØÿÿÿ\'àÿÿÿ hEàÿÿÿ\'èÿÿÿ\(üÿÿÿhEhEÈÿÿÿ¼(ìÿÿÿœ'äÿÿÿ ğ'ğÿÿÿ¼(äÿÿÿ\'ìÿÿÿ\'Äÿÿÿ\(Øÿÿÿ\(\(\(ÜÿÿÿhEìÿÿÿhE¸ÿÿÿ\'Àÿÿÿ@@)Øÿÿÿ\'àÿÿÿ Ì'Èÿÿÿ\'Ğÿÿÿ0 Œ'Üÿÿÿl(ìÿÿÿ )ğÿÿÿ\'øÿÿÿ\'ìÿÿÿhEøÿÿÿ\'ìÿÿÿ\'ôÿÿÿ ì'ìÿÿÿ\'ôÿÿÿ\'¨ÿÿÿ\'°ÿÿÿPP )Àÿÿÿx'Ğÿÿÿ0 Œ'èÿÿÿ\'ğÿÿÿ ğ'äÿÿÿ\'ìÿÿÿhEşşış ışşışüıüıüıÿìÿÿÿ\(\(Àÿÿÿ\'Èÿÿÿ88,)èÿÿÿ\'ğÿÿÿ\'äÿÿÿ\'ìÿÿÿ¼(ˆÿÿÿ\'Ìÿÿÿ0 Œ'Üÿÿÿ\'äÿÿÿ`'¬ÿÿÿ\'´ÿÿÿLL\)øÿÿÿhEüÿÿÿhEàÿÿÿ\'èÿÿÿP(Àÿÿÿ (Ğÿÿÿ0 Œ'äÿÿÿ\'ìÿÿÿ ğ'Äÿÿÿ\'Ìÿÿÿ0 Œ'ğÿÿÿhEôÿÿÿ\'èÿÿÿhEğÿÿÿ¼(ôÿÿÿ\'\'şışşış ış$(ış,üıüıüÿ*+*$$´'$$$´'Üÿÿÿ ´)\' €@ ôÿÿÿ ì' \'Èÿÿÿ\'Ğÿÿÿ0,(şşış ışşıış ış$üııÿÌÿÿÿ hEØÿÿÿ ì'äÿÿÿ\'ìÿÿÿx'äÿÿÿ\'ìÿÿÿhEèÿÿÿ\'ğÿÿÿ¼(€ÿÿÿ\'ˆÿÿÿx'¬ÿÿÿ\'´ÿÿÿx'ìÿÿÿ\'ôÿÿÿ hEèÿÿÿ\'ğÿÿÿhEèÿÿÿ\'ğÿÿÿ\'ğÿÿÿhEøÿÿÿ\'Ìÿÿÿ\'Ôÿÿÿ,,`(èÿÿÿ hEôÿÿÿ hE À ÁÀ € À’–ˆˆ Ôÿÿÿ\'Üÿÿÿ$Œ)şşış ışışış $üıüıüÿğÿÿÿhEøÿÿÿ\'°ÿÿÿ\'¸ÿÿÿ hEĞÿÿÿ\'ìÿÿÿ\(Øÿÿÿx'èÿÿÿx'Øÿÿÿx'èÿÿÿÈ'äÿÿÿ \'ğÿÿÿ@(ìÿÿÿ\'ôÿÿÿ \'àÿÿÿ¼(ğÿÿÿT(àÿÿÿ\'T(àÿÿÿT(ğÿÿÿ@(èÿÿÿ\'ğÿÿÿ@(àşÿÿ@(ğşÿÿ@(Ôÿÿÿx'äÿÿÿP(àÿÿÿ\'èÿÿÿ|(èÿÿÿhEğÿÿÿ¼(Ğÿÿÿ\'Øÿÿÿ\(Èÿÿÿ@(Øÿÿÿ\(œÿÿÿx'Ğÿÿÿ0 Œ'Tÿÿÿx'dÿÿÿø'Üÿÿÿ\'äÿÿÿ|(Äÿÿÿx'èÿÿÿx'Èÿÿÿ\'äÿÿÿÈ'èÿÿÿ\'ğÿÿÿ ì'Øÿÿÿ\'àÿÿÿ Œ'ôÿÿÿ\'\'àÿÿÿ\'èÿÿÿÈ'äÿÿÿ\'ìÿÿÿ@)ğÿÿÿT(T(Äÿÿÿ\'àÿÿÿ „' €  Š@$¤Üÿÿÿx'ìÿÿÿ ((èÿÿÿô' hE (¼ÿÿÿ ((Ğÿÿÿ0 Œ'ìÿÿÿhEôÿÿÿ\'Øÿÿÿ\'àÿÿÿœ'  @€€ Øÿÿÿ\'àÿÿÿl(2XX8ÿÿÿä'Tÿÿÿ¬¬à.Øÿÿÿ( ¤'<<$+ ÿÿÿ\'Ôÿÿÿ,$ +˜ÿÿÿ xE¬ÿÿÿÈ'şşş ışış ış$üıüıüıÿXÿÿÿ\'`ÿÿÿ0 Œ'şışşş ışış $üıüıüıÿĞşÿÿx'àşÿÿ Ä1œÿÿÿ\'¤ÿÿÿx'Èÿÿÿ\'Ğÿÿÿ(àÿÿÿ xEğÿÿÿ xEÔÿÿÿx'äÿÿÿx'"@¥°ÿÿÿ\'Ìÿÿÿ0,D)Øÿÿÿ xEèÿÿÿ€'şı şşşış ış$üıüıüıÿ¸ıÿÿ\'Àıÿÿ¼(Ìıÿÿx'”ÿÿÿlhä*Gg%…!øÿÿÿ\' D@(+şşış ışıışışş $ıüıÿşşıış ışşışış $ıüıÿ¤ÿÿÿ \'°ÿÿÿPL¨'äÿÿÿ\'ìÿÿÿ xEÀÿÿÿ\'Èÿÿÿ¼(Àÿÿÿ\'Èÿÿÿx'6-RV­-Rÿÿÿ\'ÿÿÿ ğ'ÿÿÿx' ÿÿÿÈ'şşış ışış ış$üıüıüÿäÿÿÿ\'ìÿÿÿl(1Ë Øÿÿÿœ'ìÿÿÿœ'¨ÿÿÿ\'àÿÿÿ d)¤ÿÿÿÈ'Üÿÿÿ$\+şış ış ışşş$üıüıüıÿôÿÿÿ\'\'àÿÿÿ\'ğÿÿÿ\'¸ÿÿÿø'Ôÿÿÿ,,`(ğÿÿÿhEøÿÿÿhEØÿÿÿ\'àÿÿÿ\'èÿÿÿhEğÿÿÿ\' 33330003äÿÿÿ hEğÿÿÿ¼(¸ÿÿÿ$X'Üÿÿÿ$X'       ÿÿÿ0,(Hÿÿÿ\X¤+<ÿÿÿ hEHÿÿÿ\X¤+ìşÿÿ\X¤+Hÿÿÿ\X¤+  (  (øÿÿÿ\'\'\'\'ìÿÿÿhEôÿÿÿ hEôÿÿÿhEøÿÿÿ\'àÿÿÿ ğ'ìÿÿÿ\(ôÿÿÿhEøÿÿÿhEÿÿÿä'¬ÿÿÿTTÜ'äÿÿÿ ì'ğÿÿÿ\'\(\(Ğÿÿÿ\(èÿÿÿ\(ÜÿÿÿhEäÿÿÿ€'\' \'Ôÿÿÿ ğ'àÿÿÿ P*¼ÿÿÿhEĞÿÿÿ0 Œ'pÿÿÿ\'¤ÿÿÿ\T$)Ôÿÿÿ\'Üÿÿÿ$ä(ôÿÿÿ\'$\'3|ÿÿÿ\'„ÿÿÿ\' sbbbbbsss`` ss``bbrr ss``bbrrÀÿÿÿ\'Ğÿÿÿ0 Œ' ”p  ĞÿÿÿÈ'èÿÿÿx'Àÿÿÿx'Øÿÿÿ((+¸ÿÿÿx'Ğÿÿÿ00Ğ'°ÿÿÿx'Èÿÿÿ88°*Ğÿÿÿ\'Øÿÿÿ((¼*ğÿÿÿl( HDL,Œÿÿÿl(œÿÿÿd@¬,ğÿÿÿl(HDL,¸ÿÿÿHDL,HDL,¼ÿÿÿ\'Äÿÿÿ\(ÈÿÿÿhEÌÿÿÿhEÈÿÿÿx'Øÿÿÿ( ,(Äÿÿÿ\(HDL,ôÿÿÿ\'LL ,ôÿÿÿ\' \(ôÿÿÿ\'HDL,àÿÿÿ\'èÿÿÿx'èÿÿÿ\'ğÿÿÿ \'àÿÿÿ\'èÿÿÿx'Lÿÿÿ\'Tÿÿÿ”(àÿÿÿ\'èÿÿÿ xEàÿÿÿ ğ'ìÿÿÿx'ÀÿÿÿhEĞÿÿÿ0 Œ'¸ÿÿÿl(Ğÿÿÿ0 Œ'pÿÿÿx'€ÿÿÿÈ'ìÿÿÿhEôÿÿÿ\'´ÿÿÿ\'¼ÿÿÿ@80, ÿÿÿ\'äÿÿÿôDÌÿÿÿ xEÜÿÿÿx'€€˜’‚@  Øÿÿÿ xEìÿÿÿX'Œşÿÿ\'œşÿÿx' €€€¢€ €€°üÿÿ\'¸üÿÿx'@üÿÿ\'Hüÿÿx'´ÿÿÿø'Ğÿÿÿ0 Œ'ÈÿÿÿhEĞÿÿÿ0,(°ÿÿÿ\'¸ÿÿÿHDà*Ôÿÿÿ (äÿÿÿø'°ÿÿÿ\(Äÿÿÿ\(ÔÿÿÿhEÜÿÿÿ$p'àÿÿÿ hEìÿÿÿ ì'äÿÿÿ hEğÿÿÿ ì'èÿÿÿ ğ'ôÿÿÿ ğ'Äÿÿÿ\(ØÿÿÿhEèÿÿÿ ((ôÿÿÿ ((èÿÿÿhEğÿÿÿx'àÿÿÿ\'X'àÿÿÿ\'èÿÿÿX'ğÿÿÿx' ğ'ğÿÿÿ ì'0\'Ôÿÿÿ\'Üÿÿÿx'Ôÿÿÿ\'Üÿÿÿ \'Ğÿÿÿ\'Øÿÿÿx'  ssssccccccşşışşı ış ış$üıüıüÿ´ÿÿÿ\'¼ÿÿÿx'àÿÿÿ ğ'ğÿÿÿ ğ' ÿÿğñÌÿÿÿ (Üÿÿÿ$ |-Èÿÿÿ\'Ğÿÿÿ\'œÿÿÿx'¬ÿÿÿ Ì'ìÿÿÿ\'ôÿÿÿ  (°ÿÿÿ\'¸ÿÿÿ\'TşÿÿhE\şÿÿ hEhÿÿÿ\'pÿÿÿH<ˆ-àşÿÿH<ˆ-(ÿÿÿH<ˆ- ÿÿÿ hE¬ÿÿÿ hElÿÿÿ\(äÿÿÿ\(àÿÿÿx'ğÿÿÿhE ÿÿÿx'°ÿÿÿPP )œÿÿÿ\(°ÿÿÿ\(¨ÿÿÿ\(Ğÿÿÿ0(d-„ÿÿÿ\'Œÿÿÿ  (ğÿÿÿ ì'\'èÿÿÿhEğÿÿÿ xE€ğÿÿÿx'hE„ÿÿÿ\'Œÿÿÿx'¼ÿÿÿ\'Äÿÿÿx' ÿÿÿ\'¨ÿÿÿx'ğÿÿÿ ì'\'Äÿÿÿ\'\'Àÿÿÿx'Ğÿÿÿ0,(Ìÿÿÿ ì'Øÿÿÿ ì'Äÿÿÿ ì'Ğÿÿÿ ì'øÿÿÿ\'\( 4I"4I"4I"4I"4I"4I"À$ À$À$ À$˜ÿÿÿ4)Ğÿÿÿ0 Œ'ˆÿÿÿ<,8*Äÿÿÿ<,8*¼ÿÿÿ\'Äÿÿÿ<,8*°ÿÿÿÈ'Èÿÿÿ4) \'hE¬ÿÿÿ\'´ÿÿÿ\'üàü üüüÜÿÿÿ\'äÿÿÿ4)ÈÿÿÿÈ'àÿÿÿ Ì'Èÿÿÿx'ìÿÿÿhEØÿÿÿ\'àÿÿÿx'Äÿÿÿ hEğÿÿÿT(ğÿÿÿx' (şşış ışşışüıüıüıüÿşşş ışış ış$üıüıüıüÿşşşış ışış $üıüıüıüÿşı şşşış ış$üıüıüıüÿşışşş ışış $üıüıüıüÿşşşış ıışış (ış,üıüıÿşşış ışşıışış $üıüıÿ  !!A!A"! "!"3" " ˆˆ@ ! € @ X\ €‚D #+0 W…# %# # …% @AAaÁPÀH@DÀBÀ  .F0"0" %%-" €¨  $"" †„„DLD”%$$ êjjjjjbb@@j)-R-R(Rşşşış ışış ış$üıüıüıÿ )I’¤’$€$€$ PPDA !€€€X€`/$@0%H€  ˆ   ,$ @ "   @€ $PPP `l`l`llll   ss``bbrr  02 0           '$AAAAAAAA À@&+…@a@ !1)†şşış ışşıışış $üıüıüÿ =----)))((((((€@  8    ó (8&ó  ÂÃ3? qb@ &J-AâÀÂ"  @  €n€ €€ ˆˆ €JjJEUE C ca‚‚ ™˜˜˜˜˜˜˜ ™ ˜ ˜ ˜ ˜ ˜ ˜ ˜  "::"û:û;û>û   ¦À§ÀÀÀ  @B@ €„€ şşşış ışış ış$üıüıüıüÿşşışşş ışşüıışşüıüııüııÿşşışışş ışşşüı şüışüııüıııÿ %%­ˆ @@€¼¼¬ E ÕÕÕUEEAAAA @€€  0  " à@ °@¢Ä`¢Ä@¢ÄC¢ÄK¢ÄD¢Ä  $ ……………€€€€<¬Du)¬Du!¬Du; &  "              @-RóT-R PP  ‰A! I I I I I I I IIII I  P€ˆˆ‰¨ €€P 0 0°219¹ "¢¤$ "  ‚@DÀDÀ$ @"@a@@„şşşşış ıışış (ış,üıüıüıÿ HHHHHHşşàâ €   @şşışşş ışşüıışşüıüııüııüÿ !%5±a+©((  $ù– – – ş” şş@@  :0¨0¨(( "H"H"H H H H"H H HT       ( ¨€¨ :  ŠÏï‹›º üşü!üş Î ÀÀÀÀÀ‰À™À8ÀÌÀè ÿÿÿÿ¢ !  .>"" ! 0’(’ ’  À!ÀaÀÀ€    €(ğ` `¤ €ª@,         “Ğ““  øø   áဂà   A ƒ    !    ”Ô˜Ø0°ğ“ DFFDD„0 ( 0(” &#b""  IAAAAAAAA@@@@@ÛÛÛÛÛÛÛÛÛÛÛÛÛÛÛ &'6&¦F4<..   € D" 8ÀˆÀˆ#BB†" &n N6 $„ !I&SI&SI&SI&SI&S5°#$'ªŠªŠQªŠ ªŠªŠ"È@Â@ÆÀ#@( $ 5%%%%     €" @P@JJK$jBBD FUUFUUDUU@UU+­ªÒ_2­ªÒ_2­ªÒ_2 -÷,  H7  !$4666&$H  €€ (,*:   ¨¨ c’Éc’Éc’Éc’Éc’Éc’Éc’É  `a}A  . ª*  ¨ª0 33303 @ˆˆ ˆˆˆ€ˆˆˆˆ ####ƒ @DDD@€DG €€€ H                      @D@DPDĞDĞEğE°E E D€D€@ˆ@@@@@/HHHH     * * * * * * * * * * @@ğàğÀğPğDğBğHğAğ@ò  !2   Ğ€`€ “P“P‘P‘P‘P‘‘‘ “Ğ‘Ğ‘Ğ‘Ğ‘Ğ‘Ğ‘‘Ğ‘Ğ    ! @   ”C—C”ô EÀb±X,‹¾ /  ¢  € @   "@ @2@*@$$&¦¤" PAC!!!.@ € ‚J  C3c1# ŠŠ LHhhJ   L™, ………………………„„€€WWWWWWWWWWWWWWW //// GGG G „ŒŒ Œ„  $ ssscs`cccccccccc Ááù ««««««‹ŠŠŠŠŠŠ ==== ==0&  A 0™™  €@üü(0üüüBü`ü D  €@@@@ € HP@„†‚ „€@Q$   0 $¤ A*"de IIII&II@ÀII  „…ƒÂ¢   € € “Ğ“Ğ“““““““““  -  @%@!@ @ @ @0@(üC @@*üC(@ €ü üÉü||| ÙÁÁ  0È À "€!£!£†%BB c c f ÀÀÀÀÀÀÀÀÀ "22 $ $,, `@! ! €! @@€€ € € ‚ ’ € R‰S S ‹Sª`'«¦“'@."‘ U T, T, T,V T,V “ ‘     Dt45='    * &&6  `      ! ŒL ,    ä  Œ†t G'  "°% € €(@‚(40÷üšLâ'n¼LSšPâau¸ uà @%°$^%´^%ì¿+HªÕ+Œ‚Õ+Œ‚C,T ë'Ôd,œ"®,ü/¿,ô-—N1ª_1(ìv1 f)LWf)ÈWf)ôWå5„¨Œ6p”Œ6 ”»;D„ë'd-:|ÌÕ>8h<{P)xú+*@$–>Œ5*°'@IP)Lú@@P 474²–>`5478²ÖAE.?|ÑP)úÕM4ĞIDÁH„u€HI#8¸—['è|¼)/É)ÖF<“JfZ,j¡Lz"Y0“|[DØõ5LPFLÇ£FÕIHÁMjMjxfj à hH¶jŒ¯å5¨°Y°™fj8àfj`àÕM(ĞIÁtKPl rX4“i€™"Y€“¼)/É),ITÁIÁõdëI¤Áú,ú€J”f£yD)ÉyX áy ;J,fœ4,áyH;”Õã4J fåz,Êåz ÊùzØ ˜{\˜{€˜{^|/şd§h`{N1ª_1$ìï|XP8å˜À©°ú#R /~>)–>5ùzt ItÁItÁ^…?IxÁC+<T+dCT+ÀC˜Š`^ÕM|ĞIˆÁナBl†x@ÙO¼dšI° ÙOXd¿,XŠÜ'?ˆì7+*$¿,X?ˆ7‰–šIT šIŒ Ú¨!€™¬ãÂUD|{t—úUl ÂU¼®,H/¿,@-\—¡*µ¡x¡„*…£˜ ˜{ÔåzØÊIÁõdëõ”ëC, ë'ô죿¤¤IP)ú¿¤IÕM4ĞI$Á_1ÈìN1ªN1 ªN1ôª[ª õª„&©„ú[ª õvªŒ"ª$&éªŞ«Thë'œN1$ª_1ìv1$ I$ÁŠH'õ5ˆPC+<¼)P/É)TŞ) oí)$!T+DCå5 ¨g½x¦g½„¦C+<Š8'T+|CC+<Š8'T+|CÕM$ĞIÁ@›$g¿,¿,PtKÈlG4GŒ4GŒ4€HTILÊTµF8T. N4Yş§h({¬Ó(ÀÓ`2aGd«ã(¤£Ÿ<¶‰x¤ £îó4‰Åˆ¤ £÷<üGôW¦4€¤8£fô_i4p¤8£ŠôgÅ4ˆ¤8£É6.„?É6É6.ô?Éø6É6É(6.D?Ô`ÔğÔlşàşPà͸Ü:ìŸÃ딑Şëä”Ãë‘ì8šÃët‘“".d\©„ºùT ù ùü oT"T2 T=oT"T2 T=ºPóì%º¤•Póè%•Ünğ Gƒ<wäT÷Ñp?ü OWHj‚\s©“¼ÄÙŸ¤0£È$LA C&t„'6¤£´'(SO0Z¤£”(-'6¤£¼($Ô '6¤£Ø(ø'6¤£÷,ü'6¤£V<Ô/r ø$@¢ %<U¤£Ûd©”(Ğ-)5&O3DY¤D£)5&O3DY¤D£ %U6l-6l-­4 %`U24ï&œ¤8£ùD¬¤8£ùD¬L˜O3 Y…% ° %0UO3 Y—% s %0UO3 Y^% i %0UO3 Y^% i %0UO3 Y…% ° %4UO3 Y—% s %4UO3 YH% ¹ %,U…%<° %UO3ØY—%<s %UO3ğYO3 Y3%  %0UO3 Y3%  %0U¾%`¨ %LU¾%䨾%L¨ %8U¾%¨ª%d %UO30Y=‰=x‰=̉™6" %0U6<-µ66 %4UH˜Ï6C %4UH˜ V€eõStT\ ±YÔYÄ ÔYX Ä_€;Ä_¬;Ä_ì;î_H*î_˜*î_Ü*K`<IK`LIK`pIü`€;ü`¬;ü`ì;aP*a¨*aô*`a@I`aPI`atIf4BHfÔfef´wòmt n\ ³n\ °ìn$Cìn€C(wü–ìn$Cìn€C(w–wsìYs@åÍr4ÑÖ}È<ä}xVù}¥g€¬E  = ”=.(;Ì´ L=öhWL|²a¬ªöhWL|²a¬ªù}d¥†×a ª‚øù}p¥ ~pr Ά$×aPªrΆ@×alªr(ΆD×apªLL²a@ªù}L¥LL²a@ªù}L¥L@²a4ªù}@¥–„¨L ²aPª† ×aLª¬ƒ(¿†ˆ¿†à¿†