ELFG 4P4 (444dd##'~'~'((=LQtdp|#/ Ro#$$Dp `` <<@@|N 5('(' -,0, =.=- ` /` . bd.C*p SGoGIr_DwAGwJ4eVj-mNoJS/9dPwqLJi9L0dENx5oToK/Wm8V2Dz7halEdtQuq5iy/z-F5f_sC96D8KmfCGuaz+= % '{ <ۨ!$$ { 7{ w| { { < !$$ { { w| { { '!$ !$+'4'!$ !$%%5'!8F$%(B$e0` F, C,`5'!0CŠ%(%0+'!H$%8'$0! , ,! "+'!H'$!H!H$)%tJ5t%HDTHLu`J5?P<`!$  P ?d$$#(/0L$!(*@%8\5'&@   P\L$+($g#(&$#07$ ! h*8%0d&8  P\pA@D+($FT#(%$#8?$ H$! *@&%@%@%+'&P$@T@XP  p\XP@HT+H #!$#(/$(! *(A%l&(  \x`'%%_ %%_ %%_ %%G % $G % $G % $G % $G 4% ,%?2% .%e@% A*% B,% C.% DE:%(6FD%0<%(GB%0>%(H%0I:%0J<%0K>%0LMJ%8'FNT %@HL %8'OR %@HN %8'P%@(QJ %@(RL %@(SN %@(TUZ %HiV Vd %P\ %HiWb %P^ %HiX%PjYZ %PjZ\ %Pj[^ %Pj $(,8wb$0','!$7W!$B$0 SZ 8(` ` $$d4'+= % 'wb$'8'!$7W!$B$ SZ (` ` $$d'+= % '("C$(# B8@"#"#"#" #"#"#"#"#( "$(# SZ   $$"(" B8@$$"'+= % '','!$ !$a<%0'!0ǬŬ!$%(0#$4'!$7W!$B$a4 SZ <(` ` $$d8' X <0,'< $+0%8%($ 0(!(pa".<>-</".<>-< /".<>-<(/".< >-<0/".<0>(< ,(<$,(<(,(<,, /<  <6$7$$7$$7 /</</</<<!$/""@ # ("/<0"c$@#+# ~V (D"/@C`/@C`/c$c d! +(f!0c!%`'+= % '/<Ȓ!$  /<c$ !"+" .$!!b p$ !A+" ! !b(,$'+= % '.<8JD`.<<c4+b-`x<6&W`<6&W@@X"L#H$D !@{ LHD @P~ { 7%08&0'(B%8(D%8(F%8@&8&0f&8B$!$$+0D,$&2% &4% &6% !A!$"&2%F&4%!%"&D &$B0!0&Ɛ2% !0A$Ɛ4% 0&&b&"&a&A&"'$J  #p+ #  % p $## !d d(% $d$(,(g$ , $ 8(8c$#0@(eBI+H #H $8 , @ c, (%%c0 !#,)`W!A$  '7!$$  '7!$$  '$K += % '0".!$! "!%%B$!$  Cdc/< !$ 'y $$#$ `+= % '< k!$ /$  "'+= % '( $C`% $CD  $%(!0Dd$p<d$0 f!&<dd%0+0 (,A,0'{ <!$$ ~~ < ($   :< 84    %%8484<-   <9c4@"B0 @"C06`D#$+"`BB0@%!B$\! #c $(' $('  $(' $(' %0%(%@7 c$$! + d$!(%% %(%+ $#0B1$! +0G#0$0$@ , @ % $#0&@ , @'0$ $ $ $( $(#$B$ Bp $#F0$0& !C $(' !"+(d{U+8F#'!Aw&&p!8'#A$$7!$$W!"#'+@H!+$@B%8 $(,'BA#a $Pi c, P# !0ƌ$f#$+`#$c$$ d f, $ $# d c, '$C $(,' C,$F ##$$+`#$c$ f f, $ $# d c, '$C $(,' $(,'`j 'PL%"T%c00`/c$e%0%(?e$08  e+(EHe+(EH'ŏ|<Xǐ@0>cc0`%%0%8Ìc%0X%%@ b LT<%@%PS H' *%X k% +EE%0%%@%8LT !  $( L#8P!8< *J% ++Pj@840,D@oX 40,8DL@P<H' Ɍ%P J% ʬ%%0%%@%8LT !  $(< nj$ Ȍ+840,D8oX 40,8D<$$%8ƌhȌ+HH lɌ+HI #HŌ ԡ H'c`ec%(%$c$`%0p+@Gt+@H#G ԡ H'H'<$!$($ 'LH%"P%c0`/0%(%0%8Ō%0T%(%@" b H@P%@%(LD' %P J% *%0%(%@%8HP !  $(H#(L!(@ )% +HI <40,8oX ,04<8HL@D'<$!$($ += % '>"B0@D"$+b@A" @ݞ   '' "C8` !!$@$$(,'@ !B!!A##  $(,'"@BD$  !!"#C#a!0(c$!0$!(!b $+8f#a$%$( , ($ e,B$b %" "$ , c$$b '0"#D8!!,%(%0n, ",$$ !$$DDݞ $ B(#bc0! a  $+@%#8+@F@@!@ $P , P $HIj%#A$+&-`$!%#$ D B, #$C  %C"+ F!D$(% !, ($a' $$d%#A4 '%%K %K %%K 8 ,8 8!E%'!e+8D+= % '<O 8C@c0<`@>d&B&0SAB !$$$7 !$$$7B <Ԁc$ '$( ') 8C !#C# c c$/ D,'<'!$ $ += %j 'Ž/$ { 4L$L4D $#0,8a$D$ Fp! $T 3 ,' $@$'$ $ %$d&D @0D!"3T a .<,Nc$ M %, .<,Nc$ M .<k %%J] !@@` @7"$Cw$Wc$"C$#A8 i $$L(  +PH'%$K %$K D$G += % '<"?@/<04#D$4%$&d`D$"`#<$#d`wc$BB0$p!b3T w8c$BB0$p!b3T ' ' x<!$T$- $<$    /".<>/< !$ %%D /< c$ /< /<  $/0 D$+(.B.0!$x&(%H njƌ,H|ǐ08f@"ǔ06 ǔ8  ǐ04$$$!8&D&@q1 9T  1%@$$C 1%@:1 $+H(  $+H(  9 ,$*9&($$9$$0$ $+H( 98$$$ 9 $$90$ $ &@ 9|(t% $  H@Dg "Ȕ 1 %% ɐ)1 4$$$ ɔ1!@ 1!0&<+@K% + aD#a#$#!%<!$ht'lh') p'p'% & Ȑƌ!H)%#@$@ $B$!@a$$$78 <\!$Pt'T|'X8\D`HdP') p'%s g q L <@q  I a"$b!8 i $ '+= % '.<$b\%.<$b<J!$.< bB$$ $ $ߪ .< b!$ .<(b!$!/< B8@!$+A .< b!$ '+= % '0<0 /<!$!+$ /<  4 '$H "8/@/< !!$!# 0< !$  %A`(#a,#+a#C(!$') ' .< b!$ /Mf += % '.<> .<J.< J`!$B$@#/ 'Ri /<`!$ /$ += % '.!$! "!%%B$!$" Cldhe# .!$! "!=%%9.!$! "!%%/< 8R`.$ %!0D A$$(<c$ DH $`j 4{  .<b!$ '+= % '.<b!$ /< !$!S .<b.<b\.<b`% \d%.<b.<b/0<+8  &(e,0 4" #D! $+!C " ' '(,   $4 &8 $,$!A# !$  ' '$G $K { #D$$ %?&$0{  4(0B1+@d $P&q#jB)!@(%q# <(\4(!0H!@ ` $ p!d+ ! BB!fC+f!dCA$( $ '+= % 't7"$#$T$$P%$l&$h'$d($`)$\h*$X } T } P } l } h } d } ` } \ } xtA|AX  tXa\b-    ?< LH ?<   ,0_  L H  < D@33<33c4ӿ<334    $D@33<33!4 ?<33!4   t` `0,G,0_  L H   ,a$0c$$,!0,0,_  LH<&7 LH-   LH  ta b0,/<` `% . 4 BB!+0@!0d$@p p# $#8h`$@p!8B8(B)<(\4 ! !(8!0+8+!!$4@Dp@!DD,4<+0$ %<& "+0"+8e,$ % # e#"+d##&"+0"+8c,$%f`%%(T#& b+0C,!+8$ % %%X\P'T"!X\P'+= % 'D6  Dde&0+8+@D,8$0%0&@+H+P-$@H%@(%0%8%@%0% %8%(#@'#HF+P(#H*Q N A%@ - $ <8H*q8!Hi<!`g!H&+X!Hi&X+h+pk-$X%X`%H%`=$<8 p8! <!8! +(@<+0+@J,$0! %( J5IHBI d $`iq#@ +`  ! !  p! B((B)!0(p# <(\4(!(8!0`$ p! +8!0B  B!! !D+8D+ ! !d!$&(d+0d,'+@G$(%(% %8H"$#$L%$H&$D  L $ 0H T "$# , ?<  ?< @8Txd|c$! 0!f+(!e !(,!f+ !]  @8   D  P'+= % '"""<`B$ /  '+= % '`7 `"&^:@.A`/<0 %$$Ep!#vU 8!$!"B$vU %%$(!B(0$#(/<$! , .<[!$ i0 '%$K .<$N!.<$N.< N!$ $.<(N$` .<,N!$"<$W`D$%(7W%(%/<0/<0a,`'$  @.<,Nc$ M $' .<,Nc$ M 'z $74"$B& bc$&b@ '<K!$"$ '+" % hh'"@"@!&>u "` W?A$/<0$%0L8.4F$&0),L.<k%(%0 J] $L%(%0,%dA@  _ d7"$Cw$Wc$"C$#A8 i $$,APC$/#D$(pttE08p (,)7P0 $0!H**$`!@18pttpA$  . ,H( $!8M%(F%$%(%(<j_2@P%/ %5,,B+0/<08!0@,ŒWB$!G$$0WB0$8G'80$('(0E%G$$.<k@/<@,"Wx|("W%["%(&+(,%0('B0!(!8'8$(0EB0 @0= ,(0$$ ,<C$0D%(#0a+(<A@@.<k |!0DEep< %!< #,A(AAP/ ,,A0A }v ,Z "B0@C8`,4dL&(\$$&0P$& L4d$Ad>;@D@%$,0 / h7"$Cw$Wc$"C$#A8 i $$,8( $/<%0'|%08x$x|@(|$%08${@(w!8$ <)5+8%@$K %$K +@9 "!Ftpì . (,<%H(< $tY+@StP+@L )!0& 9 9pttpA . ,H(< $`j 4AD{  \'''!$7W!$B$ax\'l'!$7W!$B$a x<  @Ï|c`d $, e$0!(d%(%h%(%%  %%(% %%(% 8XP7 P %%83"$<9  @%$e'  @ 'H<9  %%H8PHX# % X HXP88PXH/<(!$  /<c$cc0`%%4(/6B64@C0 D$8*D&,@(<k$!BD>0@$+0 B1#0x@)<@B$!A!8$ $P/ (,AA4C$?D$P/ ((A$#$ C4 6# 2 ( c $,//<W!A!7!$?B0!"$$7!0Bc0$dc0#W%W$7!$4#!b7!b '$K `j `j D$G += % 'Td"/< h$X$$$(@+!0E!8f$#$g+ +@8,"$ $ M %Thd&0$!%ha%6da# %+L<4/<8"!$ I /<e!$V 7!$4  /<e!$,W T"$d#4 r1 LT<4% db!hb/< dd8! ! D$#$DW/<@"!$  (/<8"c$  !AH+A (!d!aD/<0"c$ H!"H+A ${  D L P @   ( , 0 ?!$%"+= % ' "& Cb&"@"b"$Db&"@"b"#C   '"# { !|Cwl c$!0   $!$$(<!$ H "C$#A8 i $$@('/< !$ /<\ /<@ #"/<\ /@@ @$!#!CR5  0!8 ($R5 ' d,@01?<6$87<!(,@$<$@78!0Ɍƌ!8'P@'8 $(,F(,%(#<& %<<6$w<6$#<6$W%a% <!4 $ $(;70!0njƌ#@$@#H$H+P#P 'P@% @q)% H)q $#Hi#@h$@H!@ ?1#HhP'0` %8 - ` 0 (- P%0F - 8%0$$@,!8$8%8$%@% % % <& <%<6$w<6$#<6$W%a% %`%H% %0 k?0#HdPhp,$ , h%` P -  $- p% % % $$H+0!0$0%0&% '0#H$H+0#0'0)% H)q#Hi'P#h $PJ% PJq#Pj$0!0?0#HfPh, $` , P  - ` &- h% % #0 $0#H$H+`#` '`$ 0p#0f$0)% H)q#Hi!0?0#`i $hp*/%P )- p - P - h % % D$$P+H$!H.$H.!@%H* v# @8+H ?0#Pih,p&xL0%  )- h %` p I- x %H . %H1%0&$$P+H&!H$H%HI M+= % ' "8@7$$@$+A@$ GE (,'$ E (,'B$C,`!#dc' '`%(d #$#($e+ # ' B$ Bpc$ cp $##$d!C!"$(,' $%(!$&,uW0!0Fnjƌ'@'H%P(@@$%('P@Q#X$X #` $`,+h#h 'h% `qk% Xkq $#X#`$`!X! j#P$P#X$X+`#` '`k% XkqJ% PJq $#X#P$P!PK!PE+PC8@e$ $A@$"?0#PX`pI$ , ` X E- p%(n - %($H$@#( $(%#H$H +@#@'@$ (p#($((% @q#@!(@,6 (p#(+0#0%0 0p#0!(@$#( #%$#(@P +XE`?K1#`pixhq%) k- p $H. - x %X ,. %Xr$@ %X ` ! % $$!$% ',bW8!8G'H'P%XI`%8'X`Y#` #h +p #p'p$PJ% PJq $#P$P$H)% H)q#H!HI!(+! H q+@#@%8 8p $#H #8!8'!0@$#8#H$H #P$P+X#X 'X`)% H)qJ% PJq $#P#H$H+!HI!P$+PC@@)- ! H q#H+@#@%@ @q#@!@(!0@$#8@$+ $+= % '7@"$ ,@  @ '+= % 'd8XB$d$$+ (B$/c$d+/< !$ .<,>!$"@ <|!4/c$a%(/< !$ (8%(<%% %8h!@J!@ I$$&(4!0b:!09&08!0:&0t!$ !8 .<(>!$.<$>!$$dD$Db"/< !$ H,'$$*0%0c8!8&`$40z/< !$ H,'$$*0%0c8!8&`%$480H,'%<B4G B$B" F "$!!D$E! $$E! $$E! $ $ E! $@@@ @ "%@'$K += % '/< !$!B"$c$$@(,H4L8D0$') .<@.<+ #!A@B/a!$ 'b$$+(,c ! +( + $ '* "+ "!#!$ ' 'G %G %%G += % '40+A`# "% M,Q  ,%$+0;(!(0&(,,0%(*@" +@"%@!@4&@ -4%@@I+("%$@!P+X `(!(G+(A#8#PW $@H*$#XA!@+`Ja%$#8P ?$8!(*8+% &8   ,04"$+b  !$+"`!') +"`!'&E$*@e/+8e#$+8#@ %#P W $C#PA!+X`E%#@XG$@ !8*@%( &@`  ,04T $@ $ S ,AC+(d^ +(dW$&0%   , $F$+8AGH#0#@$%#@HG$@ #H$#d#P$j!8!e*(&%H&(g   ,%% 04+"`!A&) #&% !A ('G %_ %W %W %_ %%_ %W G G W % _ _ %G G G %G { <:!$$ 0  04t $x &D!(t %+ ! x $$$(,  +($(,!($4$$(%( p+ gl "$ ; 4 !$hX 0'%W %G %$K S 7 !$ <6$W$ @,<6$(&(0+0&08%87%8'$@4<6$0&0+= % '/<!$"@/<!$ /<!$" @] $/<B$A/<!$ '+= % '7"$#$  "B$"C`Dc4Dc4 D$!<6$7 %ae0%(%0w%0 7 "b# '+= % 'r"8@"8@WI%w#8`!8 7%@ d\Db  b\"a'#$d8$%0w%0f8 % !$% %C$d8$%0w%0f8`% c$$% %+= % ' $% wW% d /$ g $$($(  }k 7 C/   $% '%D$D$$/   '"""  '".<4>/< $ .d  /<{  /.B$%W7%C` `W  .<8>B$A &" <l!$$$  d$@ <~!$%$  '+= % '07L"$Bv@/<4!$ .< J.<JB$.<J+ " $&"@/B$  (.<<>B$A.<J/<8B$A/<4!$ ,'%%G B$B% ! Dc$ + a'+= % '%!$.

///B$  $.B$A/!$+$ 0h < !$ $ 4  <!$ $ 8  w| { 07(L"$BT# X${ <:!$$ 0h   /3  %$ ' $d ".<@kc$&b@" .<@kc$"pV .<@kc$"&C`A ! X 'B$b$C{`& a#/%0$  LP| $$ $$-<ƌ  LP| $$$%P%X7%X +`%P%XH` $  )/< l / l / p /  /  0,4(  '$ += % 'L '+= % '^ '+= % 'p '+= % ' '+= % ' '+= % ' ','+" % '/<!$"@h@C`T'X8   !' !(   /!$$ ~~  $R < / .@/<* HL4400+= % '/<`!$ 04%% c$.<|J*(eN./!8$$@#0j.!8$$@#0`..'!$ !${ <$!$$  !$X\`d@'D,F8#@H0#8G#X_ $H+(!Hi*`h+@%#h%%`(,%@ *8&+0A %%%P%X % 40#  g8b@#8H<#@#`g $H,4!H*`+8K% %8%`!8%*h+h:h!hm%h *h!h+h-#!g?<6$ ! !A@D+G +  LPTX\`d@'% %W %% W c$c>`< ~!$ 6$CB /  $ ' '+= % '.!$!.B$B@CB%%$ Y  6-#.

$b '+= % '/⎀!CB#  .//B$' -@K`/""" # ##### # "  & d$e%0G%0%(%@%%  &8 % +F@$$ @/0'a .<`>Mf 0",D@/<(c$!b%$%(Ww%(E#0'('!$ !$a' d 0",@/<&B$!A"0<B$'a .<`>Mf  $+a`/<&$!dcc8`%1/<&$/< `!#8`$%#,O` $ap.<$!ec@e0%/<{ /8'P  0D@'8@.P  0D@'!8@8@/< @ `P8'c 0D, @ $p.<c$!bB$8c`P$&w`PC0 `Poet%&($P,< !u  $,8c`$& w$0),`$&w`#0 `D  ,8c`$&w`DB!,/<$!Bd0$ $@@'D"0@ ,D !0 $0AP% xA/C <@!$a /".<`>᮰".᮰".<\>@$$C B, D#%'#% `c#<#c$<##`A* ( '$W4B$!b@ /<c$!aC D  (%$(d c, (%B N  #" @$+ a  AA '$G += %b '% @@!$ "0B,@"0@/<$! $74"$!bC 'aN  $% ` += %b 'Ïd& D$$( /<4+(%%B %%"/< !$B$#$A/ 47"$Cw$Wc$"C$#A8 i $8DH!AL@' ,7"$Cw$Wc$"C$#A8 iÓ`$ï 04+(w%% %,w/<W!A!7BB0!"!7?"$BB0B8G@/< @"%/!$$ h %iB83@"()@!$!#BK$+ GD8$KB8@$ MD8$TB8@$$%([@DH4'@DH4'@DH4'!   @ @DH4'@DH4'@DH4'!   @ @DH4'@DH4'@DH4'2=B$%("@,(! D A $ $( ,z  +"$&(d+d,$%a" (A0,bp$p0!a!"`8& "# !(D&+@eLH <C!$p  HLLH<C!$#@#Hb, $Jp#H O $"! 3 HALA/B$  4.B$A8'%%G 'X"# !(D$*0&%8$' %$*@%@Ɍʌ+X`+X`k$&Xg`&PD@Ì!d#(i\!+%` {  Hp!Hi*&XF*`Fk--+p9$Xn%Xl`+X",`Xp!Xk)mj/d@('% $%H '4'!$ !$A B$b(04 $ '$Y 8'+= % ',0$ $ Y .<,k.<0k#(4 ƌ# +0#(B3B#,% $ $ '$Y ('+= % 'HL$ $ Y @,(.<,kP# +(.<0k#0#(0 @/% $L0`$(p.  $<@$ $ Y .<,kD# +(.<0k#0#(2"@-% (, 0$4 $('$Y 8'+= % ',0$ $ Y .<,k4# +(.<0k#0#(2"@-% $ $ '$Y ('+= % '"$$"@ !p $#A% cp#C!A '<,!$($ += % '&`Ïtc&~`' `'( 8C`<D%( DC0E % % D@'4'!$ !$($c$8 E  d$%(H't'!$ !$H''4'!$7W!$B$lpu|H'!$7W!$B$D&d`(@&" <&$ 8&"!,%|$ ? x'C0=`T"<X#8D{ <.!$ $ <8~~ < !$$ h <!$ $ D  w| { "!' P B0 @|,"$!$ !$Ax'<~!$ $ <!$,$ += % 'H"C`(D)E8$$(M$$(&'p-'0W$' &H'Q t N *&@HJ 808D@40#$ $(  #$$(7H04,@!t!%H$aa!$(#$$(7%04<% $) C#8  H"&<0d)E$d$cc$(#(,##D $( H"!C"#,(0` "0`L`-$0 -$0<` L`"#+C@"@"B""""B$ "" ","B8@" C` #B}' H" B !bB$ "D'?B D'@%%8${ #`d(8(a $d+("- !DB!$(a $R  %('$c$* b % ! ('('G '+" % 44'0''!$ !$A% (A (%%*(#ZEW(AC0' $ B ,B    ( $:+ # )# ( '$ #(! , $+Xb{`*XE`%0'&X`  $0'(!HI',Ġ%P% (@%'' L, ('* '@ ( % <+ 2WY!PKD0J9@,ʐ K9 `K9`J9@%+P'@P !PjL$L)%O % %_ % %G %(%0(B%0(D%0!%g%,! @$#(008 , 8 0$0 0)1P# +- P %8G $# D0P , P %8 (' ( %( % Ž{   {   { ?DH%8$L$LP$PD$D%8%@H$H$%@3@%&{ $+= % '!8 C ("C8`C8` C8` 'B8@  '/< !$!!0!, ' !' !( %   @'4'!$ !$A@W%7@7%8{  % @'+= % '.

)`/<c$c`Ïtc&~`'% @ ' '%%G += % '0  "4#b4*C$#@,(0 (, S 8<@#D$'+= % '  $<$' $(M !$%0<!$$'$ / "$0@B$@T$X!8%$ B$$+b D!0`$$p.<8g$! ' f HL8'O  #,?`T(X$.<ƥ$!%4! { B$B@CDE% %%(]D$#B0!bc$x'B$$%_@,deF<gcÌ`<B$ ǐ .% + a7#a# @'$ ! LH%4$LH*8&8!@+H# 4!B t  '$'%G %s g %s g %G %g g += % '<1!$y '+= % '('a .<\>.HLPTPD'TH@'LH'(' $$ = @5 #,\` $ ap.<$! 0&8/<掽/<{ /Mf  n   += % '" @Cd$Db8@i“@$¯/<B$ $ '+= % '0" " @ <,B$ ') / /$  "" '$K $ += % ' /<*!$.<>$$  "/ $$   "#/@"B0 @0! -$%0%@%H'% *@*J%+ $*h m1hBh $hq+P@ $%P  $+P@ $*k1 $Xmk1+PK@n4%P 2J%X! D$J%K-`!Xl0&h $+h0MpMqh 1Oxq!h%x!p%! $% %0 0(,0KXKq! $4Kk1`$ A6L HD4$,(0D4"B0 @ "$L ؠ D0"1#dp!b4!bB$a ׀D0"$!HHD0,4Cc0`< A#$  <7/0! -$%0%@'% ) ))%* $*`i L1`B` $`q+H  $%H  $+H  $)J1 $PLJ1+H* a4%H 2I%P! $$)%*-@!PJ0&Xj ` $+Xj`%0%@ @P H%`! D$&PK@% D&pM%P,$0 V !8<,$0$4%P@@% D/Ꮃ<B$0 4 "!E`$ ⎳<c$0 4 $" "/".<>'+= % '<@!$$a /".<>᮷㎤$$`d`d\%`&$'  $k/ t("$]. t .04/#! ("$hl.<0>㎤$$hlhl\%`&$'  $k/ $tA%.04/">@"#&&%b@&D`@d"B$d""#+* B,$C% @@h"$PT.<0>㎤$$PTPT%&d' <JB$ $k/ t5h"$]. t -"#* +B,$C%D"@ @h"$X\.<0>㎤$$X\X\%&d' <JB$ $k/ $tA%%@`"A[%H#a+%DL H $Z D $Z @ /B$'  '+= % '<`!$ /B$' '.!$! "#!%%%,(P<$ (@Pd,$#(/0!(el/"" ("4 "  /!$$ @  `| p4 <#!$ $ |L w| { 0%@ }' D" + b $@$!c}' P"< ($&(DbT%&(e^#$x$L$e$\'%!$7W!$B$hl&@Lxd V  '"|!L\t`H{ <!$$ |L Ꭰ(  c K  ݏ'Ď#'.< `' ¯^]$َ  4ݯ ߯0ï(֯Ǐ"  0    ݏ'W 4%%j$+  $' % w7% d' "'C'"7' 'A!+= % ' "'C'") ! $b>$&D;@?b?$&D6@@b@$&D1@AbA$&DB8+@BbB$&&@DbD$&!@HbH$&@LbL$&@PbP$&D@TbT$& @XbX$&@\b\!&A!,  "d&@b!&"!,  !B&A!, "d& @b$&D@b!&A!,  "d&DD@b$&D?@b$&D:@ b $&D5@b$&D0@b$&D+@b$&D&@b$&D!@ b $&D@$b$$&@(b($&@,b,$& @0b0$&@4b4!&A!,  += % '" #& &%b @$$#&bB8@%%#&bB8@((#&C@,,#&b @$ V % '$ "!d&c&b%"!, "d&D@b$&@"d& $ e& %D@b$&Dd%& %D@b!&A!8  += % '"#&&E%C@#&b@ #&b @$!$$ V % '+= % '$ V  % !$!$4 V  '"d& @b$&D@b!&"!,  += % '"d&@b%&E @!b V % '"d&-@"d&$e& %$@ b $&D$e& %@b$&Dd%& %D@b$&D @ b $&D@!b!!&A!8  += % '"d&D@b$&@b$&D@b$& D  ! c V % '+= % '"d&1@b$&D,@ b $& '$e& "d%& d%& $e V  !CB V % '+= % '$"#    ] $" d % f   N  "$d%f   ?  "$d%f   0  "$ d$%$f   !  ("$(d,%,f     0"$0d&DB8 @1!1b&"!8('('+= % '"d&D@b$&@ b $& d%& ~d%& yd%& t d %& o$d$%& j(d(%& e,d,%& `0d0%& [8$8e& V@$@e& QDdD%& LHdH%& GLdL%& BPdP%& =TdT%& 8$e V  % "d% V  4"4d8e V  %<"<c@! V % '+= % '" d&@ b $& @"d&@% %$'$ D( !(!  V  $+= % ' "d& @ b $&@% %$'$ D( !(!  V  $+= % '" d&@ b $&@b$&@b$& @$"$d&@% %$'$ D( !(!  V  $!+A%CW+  % wW% d !A%CW  % w7% dC!aW!a += % '7 '+= % '7 '+= % '7  '+= % '7  '+= % '7 $  (,'+= % ' 7$( ,0 4'+= % '7 $  (,'+= % '7 $  (,'+= % '7 $  (,'!A%CW  % w7% dC!aW!a += % '7 '+= % '7 '+= % '7  '+= % '7  '+= % '7 $  (,'+= % ' 7$( ,0 4'+= % '7 $  (,'+= % '7 $  (,'+= % '7 $  (,' "@/< c$&C `!$!  += % 'K "@/< c$& b /< B$    /< c$&C@!$ ] '"$ ] ]  ' $''%!0" W/<!$ "#! $ !+!C "/<!$ $ (' !(7.b!A"#<$& D( $ ^  (%%( $ $/@ b $&D9@$b$$&D4@(b($& D/,d,% _ % 0"0d&D@4"4d&D@8"8d& D%<!<c _ %%% '+= % ') '+= % ') ' !"!(d+"!!!+%!A $d%d' $#%A$( #"#(d+"##(E#&+E#" '`$D&d'`$a%A$( " (#0!0+8@!8H!0+0H!0H!H'+8'P!8!0+0!0#pq!D!A += % 'HL    $ HL   !8 HL$ <4   $ $<0 4   0 4   +e$!(*8&a$+8A{g%@+ +( 4 '$*(&>a%$0?$+(0$*0ce$0+(4 '0?0#%D?!0 %A?b0%A$ '0?0%b?!0%A '4 '0?0%C '4$ '%%' $b!0%"$ '4 '%G += % ' d%((<$!(%0,t0./0@((<@>$!(*8&a$+8A{g%@+ +( 4 '$*(&>a%$0?$+(0$*0ce$0+(4 '0?0#%D?!0 %A?b0%A$ '0?0%b?!0%A '4 '0?0%C '4$ '%%' $b!0%"$ '4 '%G += % '$ #$ !ce(#$a%%$,$0'4,0'$*0 +04!0Ɛ08%(+%$`(#E#%#07$0!  6 !"$&C @4,$0',0'%%_ %%G += % '  #$!ce(#$a%%$$$('4$('$*0 +01!0Ɛ08%(+%!`#%#$!d7 !" &C @4$$(' $('%%_ %%G += % '$+ q #$ '$+ $+ "^ $%7A?a0$%7A$ '<4+ <(6! w$+ 44+ $+ "5 $%7A ?!0$%7A?a0$%7A$ '$+ " $%7A ?!0$%7A ?!0$%7A?a0$%7A$ 'G G G %%G += % '<$+A+@4B$8+ b00 $<`!$p  % <E$!(1$%0?!0$%7@DH,')%(<$!(%88%$( <@>)%0!@*@h%$( <@>)%./0@(($( <@>)%!(%+P?@!@+P @+($"8%$+@'!($0?$+($8 %$+P@!($0+($!( '%%G %%G %%G %G += % '%%B$%*(#d+(#r!(%0,%$(<$( <@>)%(<$!(%88%$( <@>)%0!@*@h%$( <@>)%./0@(($( <@>)%!(%+P?@!@+P @+($"8%$+@'!($0?$+($8 %$+P@!($0+($!( '%%G %%G %%G %G += % '$#(/0!(ef2%(f4%(f6%(fg:%0g<%0g>%0%(<6$(%%*($j+($x!(#%0, %$(<$( <@>J%%@(<$!(%88L0!@*HB ./0@()$( <@>J%!(E+X$N`!Hi)+X+,`+((8%$+H9 !($0? $+(%8!$+($'!(#$0+(% ' ' ' ' '$ '%G %%G % %G %G += % '$#(/0!(ef2%(f4%(f6%(fg:%0g<%0g>%0%(<6$(%%*($j+($x!(#%0, %$(<$( <@>J%%@(<$!(%88L0!@*HB ./0@()$( <@>J%!(E+X$N`!Hi)+X+,`+((8%$+H9 !($0? $+(%8!$+($'!(#$0+(% ' ' ' ' '$ '%G %%G % %G %G += % 'F dI$+(+8-8-8$$$$#(/0!e$I80% $% N8i8% $%(%(%($%0Tn8$(%%$%  $ ' $ '$*(+(+!($0$+0 $,0<\$!8&(% 8 $<$ $$ '%$G %G $*8+87!8f琿$1 $+@( $,'0  T  ( +b (  ]   +b (<!$ C $(,'(<g H32D@ A K @H3D S ; 2,`@"$+AD!"H 3S $     '' 'L't'!$ !$+ b$L' = Q  %%    %#+# 8ABN%@ +H+@,$8%(%0c$f,%("! a$$$,!+ B,!,!8$"%$  <6$%"\@<%7`$dL'`dL'`dL''+" % LL' d8 @c8`(<c$  %(''!$ !$ fH9qG$+@  EH9 GH9 eH9($%gH9  $%%@%%$|%P?'V'!$ !$a  $*Xh`?'$a'# ` >|$$ $*Xh`w?'$a' #a >|wh9%%@%P^  $W (,0'W'v'!$ !$AW' $b' #d G$+b `EC8 `GC8`eC8`c$a%fC8 `#d a%gC8`>%P*@ '''!$7W!$B$a(,X 048'  $W (,0'  ] $(,'$R x'$ * x'x'$ ,! %89,$$ a1$a$ a$a!$$a% $G x' a d $ %, !(a08$` $G $G % $G % $G += % 'P H$L+0D%D $<`B$p  $!(%-$LDH`XST0$$+0D* $<`B$p  *$!0&ŠhX`$+(D $<`B$p  h$!(%.$`f$*8%0$*8$\+@ ,!@%T$#8?0!8$+PH@84< <`!$p  8<4<84!$  h$,84<$+ C $<`B$p  d$! $ld$`% # -$+$0c$+0C* $<`!$p  0*f$!0&Š (c$+(C $<`!$p  0e$!(%0$0$^d('c$<̥4(!(( $0p# +0C84 $<`!$p  48f$!0&0$Š0$Ġ5c$Q<4<̥40(!((0$8q; $8p $@p#(# +8C84+ $<`!$p  4+8g$!8C10$0$0$ptx@'$!8'0$$*8f>$+8D, <`!$p  h$,%%W %%G += % 'P H$L+0D%D $<`B$p  $!(-$LDHd$+ C $<`B$p  d$! 0$S`*8%(\T+8e,!+8C8< <`!$p  8,<<84!   8<4,$!00$Ǡ$%d*(%$+0e, $<`B$p  ,% %%%hc$+(C $<`B$p  he$!(.$%( lpt@'g$!8$*0d!0`*8 X+@T!0Ɛ0$c$+8C0+ $<`B$p  h0+%%G %W += % 'H @!$D+A`%<D< $<`B$p  D$! $-$@D< LP $$ l ($B$ + " $<`B$p  D$! dp$XT# B$+("4 $<`!$p  4E$!(e+$  $*$ l $(\`d8'+= % 'dh%"`%lp<$# $#8@H$A ,  J-  , @%H H%"@' %@H c$%)@<$7B,B0@\D,K #8@PX$h , X P , @%8  - h%8<6$8# #(0@H , @ $ -  , 0%0%&&0%0<+@+0<&8,$0 H %0&$+8!H%0  8( ( % %$ 8 <$ 7 B /%8Bc$%8 `%(X8<:!$<$D@H<8a'T%X+P(@PP $<`B$p  8`<H@%P%HD\ %!XK- $lXTP%+X(` $<`B$p  D\8`<H@ %!XK0 $ldg10%l _%aD9@!A%X'`%+@" $<`B$p  D8`<H@H$!@H. $ E@%+X(` $<`B$p  D\8`<H@ %!XK. $l 4!0&% p$P$%+ "* $<`B$p  *8D$! Da#-$+$B$+ "8* $<`!$p  *8D$! Dda() A$ 4 B!d$@p#@(%H%(9B0 ף<> 4B0 0B1d $Xp#X  <(\5` $XqBq!+x+!0&!0&!0pNq#p.!XnBX gXBY ! pDX#X++H++p!0pFq!p#p#Hd$%@ %(ף<> 4@P@H G%@ I%+-!X `+-`k,$ < %!H+pk!X)i|H-u!$h!H+P(@j+8 $8%8@8@P _ %8gJ%K-!(gXG-Q!$g < k%!Pj+`'Fg!8'J < k% '-8$ % @ 7 @8 %(.,'!$d!(g+0$d! $ aB$d e$+0$ d! $08!Ea'%G %K %$K %$ %K % $K % $ %K % $K %(% $ % % K % $K %( % $ $G += % 'tx%"`|6`# $ $#($(E+0#0'0$ (p$ p $# #($(! #(* "p# 08 , 8  , 0%&$#b c, %" $ !Tg l' $#8$HP$`h , H , P&8* j- ` %H&HI%8'#($&(@(@?%$,J$$l-!H*!PLc$ (`o%$,M$$n-!H!Pc$`@<`\80,#` d! $08d d&e+e08$ dd$ddef$$df# '0! / 58B9d $P'q# @ $K-7`Œ < k%!Pj+`-̌!`J,"@Œ$! +`B&8 Œ+8 Œ!0$D!$ a$ '%G % G %$K %G % $K += % '06 \"$$+b=`+<c$!bC B!d$+(!% ( ]*  B&%!B%#%!,0<54dp,!dc$48<$'( 4,!$8$<$' 4Bd$8fp# @ $,WH$ < )%!8'A -L@''!@H,AG$! $A,6@e$,-F$< $!(A,"''!H% ,d,D$!A, !(c% ''%%A$G %$K %A$G %$K %A$G %$K %A$G %$K !PK$% |B8ף<> 58B9d $Pp# @ $K-*`$ < %!PAm-''!XJj,@$! A,@ %A$G %$K %A$G %$K % A$G % $K o B$+ " $<`!$p  D$! d<@DH('+= % 'HD&"Q \A8N I2 A( %w D <!$@+ a88 $<`!$p  % %D%$!(LPT4'w N J D4* |-<2-<2%%(Dq<!$@+ a88 $<`B$p  % %D%$!(\$!$+(a $<`!$p  D%$!(LPT4'D$+A@<B$@+ b88 $<`!$p  % DE$!( 8<@ 9 LPT4'% $*"p A8K A8&  A8q <"$@+ b88 $<`!$p  % <!$<<%&<"$@+ b88 $<`!$p  % <!$<<%&v<"$@+ b88 $<`!$p  % <!$<<%&T $*"   A8  A8  A(a A8^ 4*W < 6!W<c4+a* <*W' <#$@+(88 $<`!$p  %(% <D!<<&'$K40<#$@+(88 $<`!$p  %(% <0!%<<&' $<#$@+(88 $<`!$p  % %(<D!%<<&'a$c0<$!fc+8+ $<`B$p  D+<$'$!8!$B0!FB+`+ $<`!$p  +#$!b<"$@+ b88 $<`!$p  % <!< <%&h<"$@+ b88 $<`!$p  % <!$< < %&F A8# <"$@+ b88 $<`!$p  % <!$< < %&!<"$@+ b88 $<`!$p  % <!$<<%&LPT4'%%% g$!8%% c$ &,$%@ "!0<$!&!+8,+ $<`B$p  +0<$,%g$!8%% c$ &,$%@ "!0<$!&!+8,+ $<`B$p  +D<$,%*0#0EC0!0+8!@8!8h0+8$%*0+0 @!$!b0&A y%%G %%G += % '$ %%> 7 +A9`#A#$# !$* 8 8  (  8 `8 8 ('('('$('_ += % '% C %(&0'8"8-<-<$(,048',\8$*a`C%$#070%8!Fb$+0T7$+04"8'80,(c$% a-<-<$(,048'& %%-<-<$(,048'\$+g `U80`\8n \$%a8 $%b8` $%r$+gC`u$+g `t8`u8 `L $%v8,`x8B`U8`$u8`$x8`$%* % %(-<-<$(,048' $%lf8  $%en8  $%^r8  $%W-<-<$(,048'-<-<$(,048'$(!$#c0!b,048'7 +A!` $$(#A#$#!a,048'-<-<$(,048'_ $(,048'1$%(*0.!0Ɛ$ $+P(@$$ $+@H$$ $+@H$$%@%0-<-<$(,048'##!$# '$d!Cx8`%% %(%4+ `< 6!<4+`$% %(%-<-<$(,048'8$%(!($$+8-<-<$(,048'!$# '0!D$* %(%%k-<-<$(,048'+= % ',0$ \u  -<-<48<@(' $48<@('+= % 't"(-@pC*D$\%$0 1W  ,*%("$@"8U'8R`8?x3`t+ bRp $ 1W '  <`!$,C$L  p,tL$%8,$t+(b@#(/0p!(%t+ bp% %(-<-<|ptl't+8bXTp\$ 1W '  % p@ $ 1W ' !,n T ,$t+(b{@#!0p!A< @% ,X'8&,$t+0ba[@#!0p!A7 "$@&C @ 8$ $8+ % @% (x ,$+(b0*@#!0p!%,p% %|t#"!$#$b!l'x %%<`!$$,CpC$!CB$CH  H%xX*0\%@(-<-<|ptl'-<-<|pl'*% %%@X%(%%8 w&H&l HDdh Fs h! !8L  I x= `4($D$H+8d8d $<`B$p  x8%8%0`4$!@dDH 9 x`4DdHX'8-<-<|ptl'%%8% %%(%%8% %%(2`F& .d$#070!0 t#(#$+("1p|l'Ph m |hPl'-<-<|ptl'%O $%_ O $%_ O $%_ O O @+@g|#a!$#$!l'%%_ O $%_ O $h$*@'+@0!@F%H )9 $+H <+ $<`B$p  p,t<+$!H)( m ,tp%%G O += % '$* <* w -<1-<1%%(-<1-<1%%(a$^$+A a( a8+ ' '$ '*0#0EC0!0+88!8+8$%*0.+0k$$0+8b0!0ƌ+0f 4+0T(! + <* w -<2-<2c$ $ 7-%%(*0+!0B0+8- $@p!@ +Pi @ +Xc `@$%"8@$#i A!, ' '`j %%G $*(# $0p!0nj+@'Ȍ+@ŒC8`$#'@"!, ' ' '`j += % '"@#$ p$! d + ! ' $' "@ #d* !  $'$'+= % 'ba* "&D$+(?d$0Ep$!0Ɣ +0+0A0c#a#Ap#(/$%! ' $' a  bD* c  $'$'_ %G += % '$d,(,0%%0 48< '% % *8C!8B8+@D$Hp!H*%%X '%`% !$7W!$B$A *P @*h @$%X'!A!`,#A##(/$%! P+XI`#I#I# '$ $!  6 ,!H"D\(<L4$%PT!P+XI`#I# I#(/$(%!( X` ,!H"D\(<L4$%PT+X`#X#` g $` !`,+hI+h*#h*#pJ#pw$PN!P*p%h 0&XL`8  DT\(<L4$08!@+Pa@#P#X _ $X !Xah*h%P %` hd&pr$8  DT\(<L4$0h8d]+(3#(#8?$8!8'P+XI&`#PI#XI#X _ $H+!0*HE %P&( <  D($<!H+(tx|H'%W % % _ %%_ %%_ % % _ %% W %%_ % % _ % % _ += % 'X $8L& Aw* An/<* # A@T'%$(H%%P# AT$OH*%X&PK"@P+Pg@&a$#B0!" W  $$XLT&H$`D'% $+@i!8'&0V!$P+0b]+0DW0#d#$!" V @ 0`D'$`D'$`D' TH V  $`D'`D'T!HLP W `D'`D' hL%8'D%0 hJ%8'F%0 h%8 hB%8 hD%8c%g $(,$%&#$0 %8G&8g!8+@"6 a b2% .D%(4% B%(6% &$% *% ,% a%&A aj A, '$_ G %G += % '048 <$$((@Ʒ <(&"+`%'''!$ !$@# # '$ $$ #b8!dD($'& a  04' $Ʒ ,'"#%b #%b #%bB$$* # $%"+= % '<}!$ D`d\TXP,%#@G14#%#HO )1@!8HE$<! 8%D<84@0,H(.hWLde$  h @0, <84D$ $ 0A, .(@hWLdc$  h @0, <84D$ $ H'$_ += % '8 "8@074&A` $  0$"O $,'4 <K $8' (& B%$&"$,'j $*2>%0<D%8BN%@(0#$%!&'("$ $*2>%0<D%8BV%@H# $ % ! & '("('+= % ',048@,'\ `dK @,'P TXK ,0`'(&%,B%a&A048T' (&%4B%$&A8@,'j H$+"M`0,L$#070G$FD(D(B(#BV%@ (DT%@H(B%h#$!&+ ')846f4f2fa2>%0f4<%0f2%&adh7 $ $ <'%G G += % '8 !<@D H H+b $ (0 4@  $L P(T,'W += % '"d& D"d% _  "d&@ " d& @!$a$$ V % '+= % ' "0'C'"0 "#$ ! 48<O $(@DH,'t += % '"d& Dd% _  "d& D%  c ! _ % '+= % '`C8`B8@ ; D%"0dcB8@"!, \G ,&$ % V 'B8@C0X$+ d$$+ d8 $+ d8+(8d8x%( D0%(+08nj+88&(Ōc8`< Z5 <&e|` I  I &"a | <!$  sH ,!  T! !8 %.  "#$ n> @(Ž @ $'$'+= %j 'ŽCd0EB8  :  'X'!$ !$( $ '99   '7 `   \'\'+= %j '"C0$c8` ! \G $%$ * b6! #(d$  \y   } < B$(,( `d0 04%(%%4Ž @ 0'0'+= %j '"C0$c8`! Z5 %b$*A&` } < B$  `d0 04%(%%(Ž @ $'$'+= %j ',"#$ x* ,/4nj<5nj:6nj73'% % <)5PpG$!$&( "(@/<!$O $"p! e/$ $(C,C8B$!$ !$A ' <@}c$ "/  @DHL0'( $,<@}c$ $"/mB$""< B$z += % '(`"0@"0@ (!0"8@$7/  @DHL0'( $,<@}c$ $"/ (,04 't += % ' " 'C'"  "#! $(,I? 't += % ' "'C'" "#! C 't += % ' "'C'" "#!  't += % ' " 'C'"  "#! $(,@ 't += % ' "'C'" "#! v@ 't += % ' " 'C'"  "#! $(,@ 't += % ' "'C'" "#!  C 't += % ' "$'C'"$ "#! (,04A 't += % ' "'C'" "#! $B 't += % ' "'C'" "#! $\B 't += % ' "'C'" "#! 8 't += % ' "'C'" "#! 8 't += % ' "'C'" "#! B 't += % ' ",'C'", "#! 048<@ D$dC ('t += % ' "'C'" "#! !E 't += % ' "'C'" "#! $uE 't += % ' "'C'" "#! $D 't += % ' "'C'" "#! 4 't += % ' "('C'"( "#! ,0E  48<$'t += % ' ",'C'", "#! 048F  $<@D('t += % ' "'C'" "C0$c8` ! \G  $'t += % ' "$'C'"$ "#! G (,04 't += % ' "$'C'"$ "#! (,0G 4 't += % ' "'C'" "#`d0<!$ ! sH  $'t += % ' "'C'"L "B0! $+b`C8`!%#C8`!% C8`!% C8`!% C8`"#% C8 `!% '<@}!$ $"< 9B$""< B$z t += % ' "'C'"= "(@"B0@!.@<3B$&A9 $!  ab+<0B$&A!  !  A<4+ D~<"4+ /p!|DHD <B$%%B @ <4+ 28<6& w<6&w@'+" % LL'0 $+0x$+0$+0]8 Z5 H%c"$ +@b>+@A9plƌ#a#8?$'!$  "C$#$E$+0+0%&'#B$# '$d!g$ lp "B$"%8 "D%8 0 <!$  sH @t ; P%9 $+ Y 8&"$+(b%+(A EBƌ#a#8?$'!$  "B$" 8 !N   #"D$+(d+( %&'#b#07$F!$  "B$"8&"$+(b+(AEBƌ#a#8?$'!$  "B$"t"!pN l hpN p dlh #"D$+(d~+(w %&'#b#07$F!$  "B$"pd #"D$+(dQ+(J %&'#b#07$F!$  "B$"$+ $+ 68`c ` ba+ "b!A$"  ba+ " b!A a!$a8` ba+ "Bd!"a!$a8%"$+(b+(AB #a#07$&!$  "B$""$+(b+(AB#a#07$&!$  "B$"$+ =8'"$+(b+(AEBƌ#a#8?$'!$  "B$"]8Z` ba+ "`Bd!"a!$aJ 8$"$+(bJ+(AEB #a#07$&!$  "B$"$"$+(b!+(AB#a#07$&!$  "B$"'_ W _ W G _ W _ W _ W G G G %%_ %W %%_ %W _ W %%_ %W _ W Xc$P%*A`X  + `"0B8@$%`|x@0"tX @' '<'!$7W!$B$a!8 $!_!8+|x%` @   ? CD!(+0e+0E#d#$! L LC!aA%%_ %W T S.   T#$D*(b2%%_ %%W _ W \ S.   \"$H*A` C "D~<"c4+b`C<4c4+b`3<~c4+bC`-<;c4+b&`/%<c4+b `8<6&W`<6&W@$"`!Xk!!H++X"5`!XkXp#H+&X`+X&'`(#$!( V  4<8 0( <J5@,'$@,'%%_ G %G _ %G %%G $% +0!0Ɛ%8&`$@,'%G += % ',",3@"8@$(%:4+7 @< 6!7<c4+b@'  $( s 0 '$0 '$( 1W 0 '%* b! #(e$  \y $(80 '$0 '+= % 'p( #8`h$* &%'8'!$ !$l%Xl!"(@4dh  t`'$t`'%ph\* C#d!((F$  \y p\l   t`'$t`'6B700'!0Ɍ0 $8%8'Ǭ!$*0"!8%@-'%8<'!$7W!$B$d%%B$* C! ".B/0(<'!(0$ $ t`'$t`'+= % 't/ ld8$* -%$'@'!$ !$p%hBC(`4p   xd'$xd'$xd'$8 p!$(4h%6h%hl%t`+(C8 pt #"@xd'$xd'%%%O hl%%%`+(C 8  #b&a xd'$xd'%%%O 6B700$'!0Ɍ0 $8%8'Ǭ!$*0"!8%@-$'%8D'!$7W!$B$d$h%s$+0!0Ɛ>B?08D'!80 $0$0xd'$xd'%%G += % 'L; D'@ !8<@ ) !$D<d$*(% $H'HTP!(L+8e,@< <`B$p  ,@<<8X!   8P<TXLL%#P+# hl\'@x x H'HTP!(L+8e,@< <`B$p  ,@<<8X!   8P<TXLL%#P+# hl\'@x x  ,D"H#-+@k<l"W!E\B4gLh$ V !8 L$ V !8 $ \4L $V * #8tp@<%d #+8'8!8+H H!H*+/+@g<l"W!ETB,gDh V !8 D V !8 $ T,D V * #8tp@<%d V+(a!dEGA/"..ᎳᎳ⎳\"@E,"@8"-@T&/ \("<$W@L| c$cX,%%%(%0a' "< ̄$  "!%(%0@!@B$$%*8G*@'%%@%%8+@T,E8E'$ <  T$E<$0(F<$0A4\F4TF0/<} %0'('!$ !$$TG$XA$(\A ''%H H S$X$ > !4'$ >   @L"@`$$$ = ( %,"@8"4@$ =  '$ $= @!8 $  "@$ =  "@"@"$ =  "#@" @$ > '"$ &" $ >  C$ = " d$*0$ <=  d$T% 52/B$*8F*8!8*H L&H $$ <=  Ld$T%$T* FB ! '8 &8D(<$ =  $ =   $ = $ = &$(`#`$qT$ =  #`"$T$ $=  X@$ $  #`$ =  mh d `hd`$ = Q%%G %%G $K %%G %%G %%G %%G %%G %%G %%G '+" % dd'%% %(\DH!  !$XB$HD\g@X\DH"#T$P   LT   TP   %`''!$ !$Ld`$lB$] $" ! $'# ('+= % '\`d%%%%88'%X% L'!$7W!$B$J%$$PW! % ($*@+@#@#HO $H)!H#P@+ l-+`KW J-$PL @    %  $ >  !0 8I!0 '  $ > D&A   8!08A0$"!0&" '  (!8 #'H$Lhd<@ x|P'H'4$8T,'p d:  `x|P'@Dx|P'+= % ','D'!$ !$Ap,t0HL\ XHL#h/@ ($$T4$ ('$'>  (!8 #'H$L\hd<@ |P'H'4$8T,'x :  h@\@%|P'|P'+= % 'DHD',,,$4< 8@`= (( $+A @"8@-<-< "8@-<-<"8@-<-<  }  $8<@(''+" % \\',''!$ !$Ap$ ,''9 ($, %%( ,'Y   %('''+" % ``',''!$ !$Ap$ ,''9 ($'. /!%0123''+" % ``',''!$ !$Ap$ ,''9 ($'.*/!(ŬDŬ$4'%0%C'!$7W!$B$''+" % TT'<''!$ !$A  <'$! (,084 '> ?!'@ABC''+" % TT'<''!$ !$A  <'$! (,084 '>:?!8T%D'%@%S'!$7W!$B$!''+" % HH'<''!$ !$A  <'$! <(,048@%%<'Y   '+= % 'X %%  !\ !  <@D HLPT $`(m" ,04dhl8'dhl8'+= % 'X"4+b @ X\@'%%G += % ' "8@/<~ @$, (&A!,% `.<|>!$] 8<$'+= % 'D@!C+ C! %%#&%&%# H".<>'+= % ' %$!$*8$ %8b*@c%@-<-< $$(,04 '%*H !H+P&@)!PhJ%X %` &X` )5 J5J1+1&Pj@)%)1 $+HI $##$C!F(,04 '%G += % 'd"!\$`+0XX $<`B$p  %(%d$!0F-$Ǡ#0%0`X\h8.d,+$ 48B<̄4@@ $@ qPP   pH*q#h# D#0+@0,(L $<`!$p  0,(L($!@B:0$0c$0$0$lptT',1% <)5&P0 %<H#0$!8G0 $$$+88 $<`B$p  H8<!0*8+ %TP+` <`!$p  <D@P#!A HD@P%0$!Pb0)%Ic$% $,`<̄488 $Hp#H)+Pf@+ f !b0!$alptT'%%G %%G l %%W += % 'H"0c0#B8@`D 8L<P@T4'D .$,$,+0<$@+888 $<`!$p  D%8%0+$!A  $0C , D(!A"$+b  %0 LPT4'% @D$!($08@+&(% %W += % ''l'|'!$7W!$B$a<ۣc$'$rH p $<$w`DdtxA##+0#f-$+$+LH;<ʄ4 z PTHL;<c4 z HPT;<ʄ4 z X\PT;<c4 z %,'C'!$ !$a<,<-<.,-.+/\X%# %$$,'`,'$$ 0C  % %( $%` 0C B$+ " $<`!$p  D$! d.$ H $0C  m dD H h''+" % ((''''!$7W!$B$a t $ , xpe$㎳< $  !"I`"<!@< z 4+"8&(d+d,$%%# <4@8p!8 p|+H+X L-$H! %8i<%4<]  <@]        4!"+A!!a<+ a<&(7+0,$(% s!(D!0+ ! +0d<&8+@,$8%0.S 048&$,'((&H*8+@h)-9$@ %84'&@*8-0)+Hi$@(%8!$+ an< 6!(w+!"!$!$!a [ 0!"+An< 6!(W+4!$!#!$!A%%(<6!P<6+W<6!7!AT8'+= % 'L .<@YB$&A@R @<$W`<@@ %b@ B$'%d<6! w+!CDHn< 6!n< 6+(wF$!(.<$&0&9408&,'((&H+@h*8)-9$@ %84'&@*8-0)+Hi$@(%8ÌŌ  [ 40! +0n< 6! n< 6+8G!!FB$!G%% $%($ E,!(Gm $ ( B)Xp#XK+pBy!pxq#x/h!h!p+(!(q!X @BA!@ X#XK+PK+h !(`p!`#H,#H*%P+ @$+H !H&P%  !$ $, !'-$C%,'%G !`0o%%X%+0 +P ,-$0%0+F$ hL%8'D%0hJ%8'Fi%8'iJ %8iL %8iN $#P W J1"$%0%8'!C$+H6 hiJ %@(iL %@(iN $#(/0"$%@(!$+(" eiJ %(,,< $(p$+ "b!(E0D7/ 6Hq$q#0H‰/r#PR< R6RH!N`$PTq!0+Pr+p!p.H!p!PB001!0+p!PHp#p+  J5*H A  $X q#0Y `iq#8 < ׌5`!h`$8p!0+8+@!@h!@ !8B001!0+@!8&@#@+X 8+("-'@C$#(/0F$!(+8&,0#"!$#$F!D48$< ',048< '%%_ $%_ %O %*A9`!ce(E$  \y ($f$$+0c$ $+`C( `,048< ',0#"#$C!D48$< '"( @,048< ',048$< '+= % 'd+ `d+8 $$#(/0!e%(%0 -8%$#070!f%(, $% %%%aX$%% hlpt\'%%* %A! a('$H< \y H<X$$ $+@( $HHp! $ $*P$@% %%%% A $% %%%+ D# #(/$(%!e $$A $% %%% $% %$, $(pg:8$#8?0!g8; $% %%8%q0 T,%%8#(hlp$t\'hlpt\'% *H"D !H#)*)@*$D8 \y D T,08 $+% $+X`8p!8'$; $*X'`% %%8%& ; $% %%8%+HA # $#HO $H)!i; $$; $% %%8%; $% %$, < $8Gq!(g:8$#8?0!g8 LP(%%83%%%% #(hlp$t\'hlpt\'`!#hlp$t\'hlpt\'% *P"C@!P#JK)`+$@4 \y @P(L4 $; $L% $+` 8p!8G$*P'@%%%%  %%%% +@A#@%#@G$@(! h%$%%%% %%$% _ _ %_ '+" % xx'''!$ !$a8'H'!$ !$6 J8"$#070!(&8,%0%8g%%%(%0KM8"$#070!(&8 $%@%(%8%(%0%8%%0'!$ !$a'%*8A@!8E琀(H$dL \y d'H'L$ $+HI  $0p!0$m$*P@%8%0%%(!@%8%0%%(+8"q#8"#@G$@H!($ %8%0%%(%8$%( $8<'!$ !$a'/8 $H'8'!$7W!$B$$'$#B0!m   H'8'H'!$7W!$B$a$'''!$ !$A'%%%_ %0 *@D!@ ) $pX \y ('H'pX % $+Pj@ $8p!8$ $*P@%@%(%8%& $%@%(%8%+@F2#@&%#HO $0!( $$ $%@%(%8% $%@%($ .)9 `%#HO )1!( 9 %@%(%H%f$|4%%H'!$ !$a'% *P"C@!P%JK)`+$lT \y l$'H'| $`4TL% $+`H&q!HI)% $*`I%@%(%H%"  %@%(%H%+PA@#@%#PW $P*!($  %@%(%H%%@%($ .J9@%#PW J1!( 9 @ x0%%P-%%%(%0'!$ !$a' $8<@D%8%('!$ !$a'% *X"F`!X%kl),$hP \y h 'H'x $`0Pm% $+hPFq!PjJ% $*hj%%%(%0 A%%%(%0+0A#@%#X_ $X+!0%% $A%%%(%0%% $%0_ _ %_ 8<%8%(:'!$ !$a'%0 *@C!@ ) $t\ \y ,'H't\ % $+Pj@ $8p!8$m$*P@%%%(%0%%%(%0+@F#@&%#@G$@!0%$%%%(%0%%$%0%_ += % 'd`d8[c8U` #$'<4!# c$#d $p##$* $%0?Q<5HCI #8'd $P'q#0 $Cqj$_ <̌5P!jc$#k!fWW !0F0!f77!00!@0#ff$?I <$J5F0!0f$0#0$0p#ff$f$#fac$$8%*0*$( < Sk%!0 L-2ƌP !PjJ#0g$*0!$ &,"(< SB$!"!!#0@C1#00&q&0#b$bp&@!$PHD@$*x, 9$o%!x 9%X%h %a% m P$>LH@%X%h$D%X%h%X%hp%@%*H -*) @ $%P%Xk%#` g 1!`L)% $%X  $J)I@jlb %Pld %Pk^ %Pj_ ' K  \DpL> $ $hq!h+P@!PJ%X *Xd'`*P@!XHk+X @*p !x+x -<-< '-<-< '-<-< '#@@$$ %8ǬB$F(( %%8 )%#P W J1!P$$f(-<-< 'W += % '0$*A*@"$,!bD.8$Dz8 Di8BpB8@4 8@  $<@DHL(', 84 %0@> <!$$ <2!$$ $ ,T(Ž, 0 @ $<@DHL('4, 0ݞ  $<@DHL('+= % '%% t$\$%% %%`xS@\t"# ΢ $ @  ,  %%``N @ (' o     %%``!8a$1 $+@(6 <5+H 0 $*0E %,X $ $+0%OI$!$#B0!  `  $#(%4!8#$1 $+@(6<5+H , @/8$H/<`!$  T@D<8H+(d{*(% 4&0  TP0@H+8&c<!0/$ǠH$H$$$%% d!$.$$p!$pd x|+ b-lp+(d%Tt$' m T H  x|p!$+b t'O %W O G %O G !$*0"{!0Ɛ%8/8ud:L#p`*P @+P D@\!PHJ&8%pP<`!$  Phld`p+(d%*(% \&0  LHX#hp+H d!8p$p%%G %O %% G %%G %O %%G %8%G %O %G %G %O %G %G %O %G '$pp*8ad h+H( !8'`+@' \!@(0/8%G %G %G %G %G G %G %O += % '   1W  -<"-<"%% %% $(,'-<"-<" $(,'+= % '  `<6$7c,c07` ' @$ $,g$,$H($*!0%!4  #H$#k+ #d%%+ c$!0d@  4 8n <6$7!8!,!0H<' HL#0 4'-m 4'+= %j ' "'C'" '+= % '0'HL87  8%%8&"@-<"-<" HL'0 4'-m 4'+= %j ' "'C'" '+= % ',#DH47  4%%4&"@-<"-<" DH#, 0'-m 0'+= %j ' "'C'" '+= % '4#HLP<7  <%%<&"@-<"-<" (HLP#4 8'-m 8'+= %j ' "'C'" '+= % ',#DH47  4%%4&"@-<"-<" DH#, 0'-m 0'+= %j ' "'C'" '+= % ',#DH47  4%%4&"@-<"-<" DH#, 0'-m 0'+= %j ' "'C'" '+= % ',#DH47  4%%4&"@-<"-<" DH#, 0'-m 0'+= %j ' "'C'" '+= % ',#DH47  4%%4&"@-<"-<" DH#, 0'-m 0'+= %j ' "'C'" '+= % '8PTX\`-<}!$    % !  &bB,B0@%!$"(@$,<`B$  ,%`dhlpT'%%484D<#(C#07$0f!0& | 4!A8+bX 4' *C! a$+ aDD $<`B$p  % %4!$!$ +b /D-< & 0@-<  _  48%%(480@D`dhlp+P T'W W -m T'+= %j ' "'C'" !/ '+= % '04$ D$ - $8< @! $`.<0D.<4D ( a/  (` %%HL,'HL,'+= % '0 !4$(, 4+  8<@D$'+= % ' !/  '.<0D.<4D'+= % ' <ܞ!$4$0 8('  J`4$<!$$, G  C/c8B`8(> 9 $    4 (,04'+= % ' $ $G? (,04'+= % 'PT%  La/ <`q!$  (Cw(#$  (@"e&9@"e V / "d e V " "d% V  "d& D% c! _ % '+= % '|  ) ,",d& D"0$0e& 4$4e& 85$5e& 86$6e& 8 (c(! V % '!B&A!, += % '"d&@"e V  "d& D%  c ! _ % '+= % ' "'C'"7  $'+= % ' "'C'"7u '+= % ' "'C'"7] '!+= % ' "'C'"    $(,'+= % ' "'C'"!|>   $(,'+= % ' "'C'")  '+= % ' "'C'"!)  '+= % ' "'C'" %%.<0D.<4D@%% <`!$ /   $(,'+= % ' "'C'"!|>   $(,'+= % ' "'C'")  '+= % ' "'C'"!)  '+= % ' "'C'" %%.<0D.<4D@%% <`!$ /`D(C a8l 8vC8#`D,C`(CD$E+0d $<`B$p D/<4+0+x<6&0<ɥ$&(%ac Do #><6&(<ʥ$&(%a $m C<46&0< ʥ$&(%a $m rR<\6&(<̥$&(%a m k<<4+0+d<< 6&0<`̥$&(%a m k<<6&(< ˥$&(%a $m v< 6&0< ͥ$&(%iaef c $n }%!0 $*P!@ʐ +PjF@Ɛ+0B$*P @ K-:` $+Pj@4$ ",@8$!(% -< &H@0(-<  _  8$%% 0(<@DH4'(0$, 6 * #38 $+8=$#@#HO $(%!(+8a1#a#0#07$0&,!0*8h%8%8%&@ $   $8 ! 8'@<@(D0H4'%_ %%_ $%G %%O += % '"@ 2 H  $H  $H !8V PD't!85 H ! H  $H !8 $PD'PD'-<-<<@<@!$<'| <@B$z -<-<<@<@!$<'| <@B$z 0'    $(, $>  $" ! m 48 '  <߃!$$$($,'     h<(B$$ >  @%XDh lv!8 @%XD hg  Hh  L4H @$^M g @$p#d a(b f, (  d g$@ , @ BQ+P #P  $%` f 8i $#0H , H %(%(e8$8( ( % % & $&C%d`txd'<)!$$ L4H 8P  h<(B$$ >  @%XDHh  L4H @$J a @$p#d a(b f, (  d g$@ , @ $#PCXA L- X %(%(e 0(E ( % 0 % & $&C%d`txd'  % ,  ,<ÚB$$ $>  , ,<ŚB$$ $>  % ,<ÚB$$ $>  ,<ǚB$$ $> 9 ,<$B$$ $>   $  $<߃B$$<ɚ$ $  , ; ,  $>  , ," ! m 04(',  ,$ $>  += % 'h<,B$$ $> #h? X Lh `<$$ $> t h" #$' m PDh? T Hh<0$$ $> = # h<!$$ $>  PD THH XlLptxd'-<-<\`<@!$\'| <@B$z -<-<\`<@!$\'| <@B$z -<-<\`<@!$\'| <@B$z += % '<@%%*(D!("(F$   \y < @p8$@%%D FH  HL4',0<@!$,'| <@B$z c$*(d !(#x8X8+( D FH P` d$@+0F($#!$#$<!C O  ($/ HL4'@<!$!  <,c$$ H L@<!$!  <,c$$ H H L!$<+(bC+(D=#(d#087$04!08+H. , #@ H$( ( 8,* b<# #(0/$(4!(#C ( 0'%%_ %_ W '+" % xx'*( %8x@E$(!(g$8!8&(@E$(!($H !H*&(%%0(<*H% %H%X!(*HE +HE, 8@ -QM$<%!@+xF!xm#X@l l- @ $#X!X#g@ @% $8>, I$ $K !xm@ @#Xd% +`d$`>-M$<%!`+x %% G %>$K %% G % >$K l- % <%!X+h%%G % >$K `j %% %``  ,$(t`%H %0!p0%͡%% $ `+Xb8`pq!"DKL  $(,0 !t#A+AQ`%%%% % `m$+p$xq%!x *x_ %G $"B$"D t ( $ h"@* C$%(!b8@B4+A2 rO<5B4ApB4+A , '$"# $ (B$$"  % $"# ! X$ , ', '%0+8{!8 %@9 A0%@($0<-!$, $0, PT<,fB$X\<'B<y6& wj<c$&a P: d%($*0&8 !$!0#Ɛ$8 , 8$$ 0L(P8HD@<I8 )u)9 )t)9 )f)9 )8)9  $l$I( %H$%"f,('@-$0%0%0!@$*8#8$8 $#@HP$Ba+` #` m-$ XXa$Xl , P - H%8*%8g+@ '%%G += % 'd "@%#`$$oaHLPTH'&AL`#$%(%0%8)8 8%!$+0*8,$0%0$B$!(* A ! d7%8$%8  'A@N% (1$*@+H,$H*%@ %G %%G += % 'P Ld($ p$+(Ae! /%0$%0%8%@I@V% I)%+H*P,$Hi%HI % %(D0%X`%H+%!Xl$7 $XFq $#`hdpo%B +# -$ xQx$x - p k- h %X%Xl1$%`w)%+X `8+ <`!$p  P$LD08 $+$$*((!(e7%P@ $%P%X%`%( %0 ,<@%H'i@v%(1%+h*p,$h%h,%!`J%@ $`Kq $#hpx%B +# - p .$ L`$`, - x %h%`1@$%h)%+` 4* <`!$p  P$L<@,4 $*%G %%G += % ' %c$* aD! C$0$+($0+($0 $+($0$+($0$+( 8:8=8?8*8$% ,g('@`-$0%0%0!@$*8#8$8 $#@HP$Ba+` #` m-$ XXa$Xl - P , H%8I%8g+@ '%%G t += % ' "'C'"' "!$*6c$% $+(*0',$(%(".c$% D,%('0 ,$ %  't += % ' "'C'"H  #'B'! d$$ #d$#(/B/#($$$(!e%#$/@! (c$#c0B$!* "%% %%& e   &A '(D)J *+b ^ .lt/~!!+!!x!+h!!XoD!+`o!!A+P`!*!!!*!!*!!*!+(&! !A!d+"!C!!!+a!"!+`!"!!"!!"!!" !S+3!"!a!+#!b!a !+a!"$!A+`!"(!a!",!a!"0!a!" !A+A4!a!b8!+C!a!b<!+b!A@''+" % LL'''!$ !$a#$'!$7W!$B$at''!$ !$aT'p'!$ !$a4'P'!$ !$aw' w t'' p 't' w ' p T'' w $ !$0T' w 0"(@T'' p 4'T' w $ !$,4' w ,"(@T'4' p % !$(T' w ("(@t'T' p T't' w $ !$$T' w $"(@'T' p T'' w $ !$ T' w "(@t'T' p T't' w $ !$T' w "(@'T' p T'' w $ !$T' w 0"(@'T' p T'' w $ !$T' w "(@t'T' p % !$t' w a"(@'t' p ''!$7W!$B$a'$A@@$ AAA$A@+= % '8'W'!$ !$Ad8' X \'7'!$ !$h' X&b@ \% %(%l`'!0DƐ!8$&0$%(*00B$+= % '8'W'!$ !$A'7'!$ !$A\'  B8@ %%%`X'! A8'!0EƐ& B$%d D(b0B$#$!$7W!$B$a += % '<@!$   $('+= % ' '('!$ !$A0W 'L 4 '! 4W%! !$#( `$# a!(" , 8 $<@,'% $G '+" % ((' B8;@''!$ !$A''!$ !$Ax''!$ !$A$x$$''x' ҙ '7'!$ !$A'' %2<(L D8*Z V 4,-n 0.t,/z(0$1 3589< " # $." &<4 (JF*+^ ,d -j ./z13!!+!a!T!!+r!!!TQ!+x0!!+p !.!!.!!.!a+X1!+A!*+H*!@ !!0+8'!0!A! +(%! !d+ !d!C!D!!D!"+!!A A!+8!!a!+#!b!aA !+#!b$!b+ !C(!!C,!!C0!b+!!AA!A+A4!a !b8!+C!a!bB<!+C!a@!a+@!#D!!#H!!#L!a+B!"AP''+" % ll't''!$ !$a#$t'!$7W!$B$aT'p'!$ !$a4'P'!$ !$awt'" t' ) t'" t' ) T't'" $ !$0T'" 0"(@T't' ) 4'T'" $ !$,4'" ,"(@T'4' ) % !$(T'" ("(@t'T' ) T't'" T' ) 4'T'" $ !$$4'" $"(@T'4' ) % !$ T'" "(@t'T' ) % !$T'" "(@T' ) % !$T'" "(@T't' ) % !$T'" /"(@t'T' ) % !$t'" "(@t' ) t''!$7W!$B$a'$A$CC @A@@@ @$@(@,@+= % 'H'w'!$ !$AH'e x |'G'!$ !$'e x&b@ |% %(%'!0DƐ!8$&0$%(*00B$+= % 'H'w'!$ !$A'G'!$ !$A|'e 0B8@ %%%x'! AH'!0EƐ& B$%d0D(b0B$,#$!$7W!$B$a += % '2*(L D)*Z V (,'-n &.t|%/zx$0t#10p"3,l!5(h 89d<`"\#X$.$"T&< 4P(JFL*+^ H,d D-j @.</z8143568 9 < " $,$ &:6()N *T +Z ,-v j /|1!!A+A!!!!+x0!!x!+h!!+`!,!a!,!A!,!!+H!)!+8(!0!! +(%! !a!D+#!b!+ !C!"!C!!C!+!!A !+5!b!a4!+#!C!a8!+#!C<!b+ !C@!!CD!!CH!b+!!A!A+AL!a !bP!+C!#$!bT!+C!aX!a+@!#\!!#`!!#d!a+B!"(!A+Ah!a,!bl!+C!a0!b p!+C!at!a+@!#x!!#|!!#!a+B!"$!A+A!a !b!+C!a!b(!+C!a!a+@!#!!#!!#!a+B!",'T'+" % ''('!$ !$a0,#$'!$7W!$B$a''!$ !$a''!$ !$al''!$ !$a<'h'!$ !$a4w' '4  ' '4'  '' $ !$8' 8"(@''  '' $ !$4' 4"(@''  l'' $ !$0l' 0 "(@'l'  % !$,' ,"(@''  '' l'4'  'l' '4  <'' $ !$(<' ("(@l'<'  <'l' $ !$$<' $?"(@l'<'  <'l' $ !$ <' ~"(@l'<'  % !$l' "(@'l'  % !$' !"(@''  % !$' ^"(@''  % !$' "(@'4  0'('!$7W!$B$a08,' <"     $ ( , 0 4 8 < @ D '+" % \\'Z''!$ !$AZ'  'Y'!$ !$' &b@ % %(%'!0DƐ!8$&0$%(*00B$'+" % dd'Z''!$ !$A'Y'!$ !$A' BB8@ %%%'! AZ'!0EƐ& B$%dBD(b0B$D#$!$7W!$B$a += % '<`!$   $('+= % ' 'P'!$ !$AXW '0 \ '[ \W%! !$!#( `A$# a!("B, `B$dhT'%B$G '+" % DD'BB84@t''!$ !$A,'p'!$ !$A'('!$ !$A<t','' 1/ 'Y'!$ !$At'' %a?a@b %AAa'+" % 'A"P@$ ?%.>&4=':<(;)V J :+d \ 9-r n 8/ 7061524334L26H19D0" /#.$$-%*,&+'F@:*)T <L )+b 8^ (-'.v&/|%0$1#24"40!6, 9<"#|$x%6(*t'D$<p)R N l+,f h-l d.r`/\0X2T4689 < " #& %4, 'B>)*V +\ ,b -.~r02!!a+a!A!3!+Q!!0!+p!!+h!-!!-!a!-!A!-!! +@)!8!!(+0&!(!!!e+ $!!C+ !A!!A!"!A!!A !!+6!!aT!+#!b!a!X!+#!b\!b+ !A`!b!Ad!b!Ah!b!A! !A+Al!a$!bp!+C!#(!b"t!+C!#x!a+@!"|!a!"!a!"!a!"!,!A+A!a0!b!+C!#4!b "!+C!a!a+@!"!a!"!a!"!a!"$!8!A+A!a<!b!+C!a@!b("!+C!a!a+@!"!a!"!a!"!a!",! D!A+A!aH!b!+C!aL!b0"!+C!a!a+@!"!a!"!a!"!a!"4! !A+A!a!b!+C!a!b8"!+C!a!a+@!"!a!"!a!"!a!"<! P!A@!+"!AD!''+" % <<'|''!$ !$aD#$|'!$7W!$B$a4'x'!$ !$aw|'  |'  4'|'  $ !$04'  0"(@|'4'  4'|'  $ !$,4'  ,"(@|'4'  4'|'  $ !$(4'  ("(@|'4'  4'|'  $ !$$4'  $"(@|'4'  4'|'  $ !$ 4'  "(@|'4'  4'|'  4'  % !$4'  @"(@|'4'  4'|'  4'  % !$4'  "(@|'4'  4'|'  4'  % !$4'  "(@|'4'  % !$|'  "(@|'  |''!$7W!$B$a'+= % '<` !$ <` B$  $"" "    <` B$ $?Dnj ' $ ɋ O$ $!B$"$#$$$%$&$'$($)$*J$+|$,$-$.$/+$0$13$2W$3k$41$5^$67$8$9@$:h$;7$<$=Q$>$?D" ' $ ɋ D"$C@@$ CCC$C@H@'b%$!$7W!$B$b%$!$7W!$B$b$$!$7W!$B$  '+" % 'ld8OhL '<'!$ !$a''!$ !$a$$ $''!$ !$a 'P'T'Xdb$$!$7W!$B$bT$$!$7W!$B$bX$$!$7W!$B$tx|`'hAb8|@B8x@''!$ !$A'pC$$ $ ɋ Z`H''!$ !$A'pB$h!c$ $ ɋ ;@@Hr tx|`'dbH$$!$7W!$B$b@$$!$7W!$B$d$$ $tx|`'tx|`'tx|`'!b8@C8`B8@''!$ !$A'pB$#c0! $ ɋ @D`'|'!$ !$a`'r LL~ a@@'\'!$ !$ALW@' ҙ '?'!$ !$AL ' $+"o`h!!0 BB0&A!0Ld$\ @' d"Dd$%(%!$7W!$B$L\!$7W!$B$a$"  $ """$" tx|`'8$?U$@$A$B]$C$DE)$Fl $G: $HI^$JKr$Lv$M $N$OT '0 $  6$ $!$"J$#$$&$%,$&o$']$($)$*$+$,-$.)$/$0$1$2$3($4$5$6|$7$8$91$:$;$<$=$>$? $@`$A$B$CD~$E$F$Gz$HC$IJK$L$M$N_$OT" '0$  T"$C$DD @C@@@ @$@(@,@XP'b,%$!$7W!$B$b,%$!$7W!$B$b,$$!$7W!$B$ '+" % 'd8SP''!$ !$ap''!$ !$a$p$tx@'l'!$ !$a'p'@'b,$$!$7W!$B$b,$$!$7W!$B$b,$$!$7W!$B$ 'ab8@B8{@'<'!$ !$A'C$$0$  ]`' '!$ !$A'B$1c$0$  >@  'b,$$!$7W!$B$b,$$!$7W!$B$d$$  $(, ' ' '1b8@C8`B8@''!$ !$A'B$#c0!0$  @''!$ !$a'  d@P'|'!$ !$AWP'  'O'!$ !$A 'e /$+"r`!!0 /BB0&A!0,d$ P' ",d$%(%!$7W!$B$!$7W!$B$a$"$## "   $ ( ,  ' (,048 ''+" % 88'" !8a ''!$ !$AC'| `''!$ !$aWcw`'  W$'S'!$ !$a`'$'e  0$+(%0$T <`!$p  % %(T\X  \X'$-$.f$/#$0$1$2B$3$4d$5$69$7 $8? $9 $:! $; $<( $= $>` $?k $@M $A= $B $C $DK $E^ $Fw $G $H $IY $JK $L $M $N' $O$P$Q$R$S3$TH$U$VWXj$YZ$[ $\~ $]^1 $_ $`$a$bch"'B$ 7 $"$#9$$)$%j$&x$'$(;$)$*$+\$,$-_$.$/,$0}$1$2$3$4$5D$6I$7W$8$9:h$;$<$=$>?'$@>$Af$BC$D$Er$F$G^$H$I&$J@$K$LP$M$NO?$P$Q$Ra$S5$T<$Up$V$W$XY$Z[$\$]$^v$_$`$abchC"'B$ 7 hC`<d` ````` `$`(`,`0`4`8`<`@`D`ld'bD%$!$7W!$B$bD%$!$7W!$B$bD$$!$7W!$B$ '+" % <<'d8HE\''!$ !$a'X'!$ !$a<''!$ !$a\'''bD$$!$7W!$B$bD$$!$7W!$B$bD$$!$7W!$B$'b8@B8@''!$ !$A'C$$B$ 7 b`<''!$ !$A<'B$Cc$B$ 7 C@1 'bD$$!$7W!$B$bD$$!$7W!$B$d<  $(,048<@D'''Cb8@C8`B8@'8'!$ !$A'B$#c0!B$ 7 @''!$ !$a' % i@d''!$ !$AWd' 1/ "'c'!$ !$A"' A$+"w`!!0 ABB0&A!0Dd$ d'Z "Dd$%(%!$7W!$B$!$7W!$B$a <"     $ ( , 0 4 8 < @ D '$%$&a$'$($)$*$+$,-!$.$/$0$1@$2$3$4$5r$6[$7$8$9$:$;$<$=$>$?@$A $B$CV$D$E9$FG$H~$I$J{$K$LR$M$N$O;$P$Q$R$S5$Ts$U$V$W=$X,$Y4$Z[$\E$]^$_k$`P$a?$bc"'B$ 7 /$%$&$'$($)$*k$+$,$--$.$/$0$1$2n$3$4$5A$6$7$8$9$:$;P$<$=$>Z$?$@V$A9$B$C$D.$E$F$G*$H$I$J$K$L$MN$O '0$  /$;'$<$=`$>K$? ' $ ɋ /%8b %P^ l %Xd %Pj %Xf %P%Xb %Xd %X.%(#P*#X+H*#Hi#XB+PK#H*'P$P&('($(%%(!$H#( `##(/$(%T'!8$+H  A8!,!0'%%G %G %%G  h iJ %@  iL %@(iN jkZ %PK k\ %Pj c% %(%0(%je@& $+HZ &($+HP &0$+HF  茂H&(%%H%P%X%` $!!1!KR&QR2!LR&2R2!NR&Q0!OR%&Q%% %( %0%X%`e+H H !H)VP )  h iJ %@  iL %@(iN jkZ %PK k\ %Pj c% %(%0(%jf@& $+H[ &($+HQ &0$+HG  茂H&(%%H%P%X%` $"!1!KR&QR2!LR&2R2!NR&Q0!OR%&Q%% %0%( %P%X%`e+H H !H)VP ) < k%!PKJ&HITJ1P ) <%!PLJ&H*RJ1P )<%!PNJ&HI0P )<%!POJ%&HI+P@P!PJ! &P 2! &PP2!&P 0!%&P +"!!+1&012!,1&12!.1&0q0!1%&0+B|  )<$!dc, 0!(,%* 0!(*%1!(6 !0Ɛ6D 1!@D%0B 1!@B%0h1!@v !pΑv| 1!x|%pz 1!xz%pO1!xV !PDJV \ k1!Xdk\ %PjZ k1!XdkZ %Pj)1! $%%(%0% +@Q@ !@%&h+@"F@ !@%&(+@";@ !@%&0+@"0@ !8& +8"&:FLR^djv|!"'#()*%+ , - & . /0$ 'G % G % G % G % G %G %G %G % G %%G %%G %%G %%G G += % ' %!@ !$*@#$@+HH #HH#P#P W $P !P $+`iILb %H,Ld %H,JV %H*+P$@8!8!$*0$d&$+80!0`ƌ#'@8$B6%0F) <)%!@ FTJ1!PIJT %@ RJ1!PIJR %@H0!0Ɛ%0,(<-%!8>&0$$*@H8F) <)%!@(FTJ1!PIJT %@ RJ1!PIJR %@H0!PIJ%0H) <)%(<-%#8#+Pw@8!8&0+8$k( ,% 'c$*0d#0%8  'H !H)($(!@%+HD @!@.`i$*H$* N)  +b #(%0 8!@ !8&8$8&8'$*84$'W ` !h!x&$&p!`!+p!0+0' J%#h,#h$L&`,'`$`%`L!H_ *`BW W W += % '( *0  ( +0bh<`!$   bb/ @I80 d($ ''!$ !$!@Ht $*PI@$ '<`!$  $d0 (t%P% +X)`x%X%`''!$ !$%%''!$ !$%%  ''!$ !$%%! $ p 4 "$ '!C T!(+ \!(+0!$E!0 \ '(`4!HcD$ $V '!"`%# +$ $ $V  % #+#  $ D "0dpp T$ $V p # +#j $ $V _  % #+# V$% (% " $\0# e,> $#<`!$ $   $$bb/`.<(K/B4$"S<9B4("^<%B4,",+<lB4("h?d@iAjBkCe"$+(DD$$+0$D <`!$p  D%(P40HDf$@&$  P"0#bC$4+(Y#!B$*6<DJV%(%0%8I+@H,(@<8H $<`!$p  (<8%@% ,@I$!H V*T*R*#%&'!TX\`dL'%$+0*8H,$0%0%%$4c$`$0ep $#8@H$BY+X #X , @ , H%0  G-$ P8B$8%00`$%8'}( $R$? ' $  /? ' $ r5 /7W(#$p(D$P%$lPF$|x'$hxH$x-<LJ$tK$  p!$7W!$B$al|!$7W!$B$a-<hx  '$!0Ɛ+8+  $+"` d$+ h,$+(''!$ !$8'\'!$ !$% 8'!8+,j %Xmf -t %`l %X-r %`n %X-%`-j %`-l %`)N %H,!$'(8+@G#@G#H#H O $H!Hi $+XH`$($@ , @ , ( $#H# )-  %h$i$ -!H*%%% *,{@?*0@ $#`di+`L-` 8'!`#x`LNR%pN J- ` - %` O. p %P3-i` 8'!`#O`LS%xo T- ` . %` p. x% %`-Mh !h#j#h o&x . h  . x p. %h%h%M%P8'$`)$PH!PB+pBO1-!`1*$'Bp+x&`-Bp%p+pN$`%`'!p,ʡ%'!p,#PEʡ$!P$l''!$7W!$B$`'% $K % $K % $K % %G %_  $+"a` d$+ S8'w'!$ !$%!(Ɛ670!$ %(+(":@(!0a@,18'!@ɐ)1 $@,"%8'!(#$>?A#0!$!(#!0?#(`'8'!$7W!$B$x'%@$G %@$G G 2<(L D8*Z V 4,-n 0.t,/z(0$1 3589< " # $." &<4 (JF*+^ ,d -j ./z13!!+!a!T!!+r!!!TQ!+x0!!+p !.!!.!!.!a+X1!+A!*+H*!@ !!0+8'!0!A! +(%! !d+ !d!C!D!!D!"+!!A A!+8!!a!+#!b!aA !+#!b$!b+ !C(!!C,!!C0!b+!!AA!A+A4!a !b8!+C!a!bB<!+C!a@!a+@!#D!!#H!!#L!a+B!"AP'+= % '0<@!$! 0<@!$ U 'P'!$ !$a'R ''!$ !$a'4  $*($ $%(|&@ t  $t| ,$$# ' 0! *(a%&   x'%_  @<H''!$ !$A$H'w % |@/<` B$H' q sH's'$ q  /<` !$H' q H's' $ q H'pt xq 3'r'!$ !$AH'3' @$ % ('D'!$ !$(' }=   @'$'!$ !$a'R L''!$ !$a$'w % |@/<` B$' q s's'$ q  /<` !$' q lB$td c$D''!$ !$L'4 ' q 'D $ tq 'pt xq '2'!$ !$A'' @$ ''!$ !$' }= i@x''!$ !$ax'< @H= ` d,PH''!$ !$AL'4  C(` $ X&(  X\ C,+``c$# c0B$8!P''!$ !$H'> 8* C% P& a  T' $_ $W  C@x$''!$ !$a$'|~; ' '!$ !$a't xS #'B'!$ !$a#'4  B8@%   $ V '' Ld %,$0& 0$ d@+ "0!a$$x|P'-

q !B&"!,% ' '7q   d(&0%,',','$( *0$b+0"! f8!0+@" !GB>q ,'$,'G G += % '  $ &A % %(%!8!,('!0dƐ!8$&0$%(*00B$+= % 'T?0<%!8+H !H%'$0!0+@%%G %%G %0%(*8!8e琀($ \y x# $*P'@ 8 @$ $&(E,"8!@#8@,<$6<$3<$*P @$ $+Pj @;( @%>8@\8@$+0E $< B$p  x# $$0!0&\ $ʬǬ$+PF@ $< B$p  x<$# $$P !P*G\ $%(p0' ,   | %+/&  $p \/@'X'!$7W!$B$aHL*&% 08'@'X'!$7W!$B$aHL$,% 0@'X'!$7W!$B$aHL&%c0c,%%lT'@'X'!$7W!$B$a.<=P& .<=& lT','X'!$7W!$B$a0c0c8c,lT''+" % dd'.<=㎰&$`'''!$7W!$B$at''!$7W!$B$a.<=䎄& M.<=& H% C8,0=''!$7W!$B$at''!$7W!$B$a`''!$7W!$B$a.<=p& .<=&( tx%(8,0'''!$7W!$B$''!$7W!$B$a.<=䎘& [,%$%*%&%c4%.<=L'\'!$ !$TX\'L'$ V @$+$ !"#8'H'!$ !$A !,%$%"*%&%c4#%@D.<=H'8'$ V Q@$'4'!$ !$A.<=4'$'$ V @%'''!$7W!$B$a c8`%!'''!$7W!$B$aT `%'''!$7W!$B$až c8'''+= % '@'X'h'!$7W!$B$a'X'!$7W!$B$a.<=(& M.<=& H@D% CL8,0=@'X'!$7W!$B$a'X'!$7W!$B$a'X'!$7W!$B$a.<=& .<=&( %($8,0PX'@'P'!$7W!$B$@'X'!$7W!$B$a.<=P& k@'X'!$7W!$B$aHL*&% 0 8$'@'X'!$7W!$B$aHL*&% 08@'X'!$7W!$B$aHL$,% 08,% $'@'X'!$7W!$B$aHL*&% 08@'X'!$7W!$B$aHL$%c0c8c,%lT'@'X'!$7W!$B$a.<=P& .<=& lT','X'!$7W!$B$a0c0c8c,lT'+= % ',%$%*%&%c4%D.<=,'<'!$ !$48<D','$ V @$'('!$ !$A.<=(D''$ V X@'+= % '''!$ !$ag .<=& d[.<=&dD` $*a``#$B   <c$$ >080 $#@(A $#PHJ1 1%1 L- - n-'P'TP'!8@ @ PO P 8g 8%8%80,%(%0 $%8)'+" % ll'.<=& d.<=&d`-'S'!$ !$a%'$-'% '''!$7W!$B$aY '$!p̡͡ɡȡ$%%0,($+(D $<`B$p  ($!(e:$:$%('%8''!$7W!$B$FF1@0 $#HII $#Xik1,1)%)1 - n- /-'`'d`'!@@XpH0 H X @ %@h%@ L_ a1+,`$ <k%!`an 1!hmM )1!Hi1!@h)+p,+*) $<`B$p  :$()* $ <k%,+%(u.<=厨&(M$+(D $<`!$p  $!(e%$'%(l''!$7W!$B$.<=|&0%%!0+8T\X <`!$p \TXXh! d  Xh m '$G += % 'l.<=& d.<=&dv`D'\'l'!$7W!$B$a0'\'!$7W!$B$a.<=@& 7.<=&2 DH%A- P!8!,!0' <`!$$  '%\'l'!$7W!$B$$ $(,ptx|X'<`!$.$  '%\'l'!$7W!$B$.$ { $(,ptx|X'<`!$$  '%\'l'!$7W!$B$$ Щ $(,ptx|X'/<` !$ptx|X'+= % 'P H7/B$"/?8) #$ '!$7W!$B$a' '0'!$7W!$B$a <=>?4't += % ' "<'C'"< #$$'!$7W!$B$a'$'4'!$7W!$B$a(  @DH8't += % ' "'C'"! #$'!$7W!$B$a.<=& d% .<=&#  $$ 't += % ' "H'C'"H& #$0'!$7W!$B$a'0'@'!$7W!$B$a'L'\'!$7W!$B$a ,`D't += % ' "'C'" #$'!$7W!$B$a.<=&c, 't += % ' "0'C'"00 #$'!$7W!$B$a''('!$7W!$B$a.<=&d`.<=&$ %A $!8!,!0%4,'t += % ' "'C'" #$'!$7W!$B$a.<=&d`%.<=&$+ 't += % ' "4'C'"4 #$'!$7W!$B$a'','!$7W!$B$aP 80't += % ' "X'C'"X_ #$@'!$7W!$B$a,'@'P'!$7W!$B$a.<=<&/`.<=&*`,'@'P'!$7W!$B$a'@'!$7W!$B$a.<=&`.<=&`,0% `8c8c,c0`%'@'P'!$7W!$B$ac0c8c,\T't += % ' "4'C'"4 #$'!$7W!$B$a'','!$7W!$B$ai 80't += % ' "4'C'"4 #$'!$7W!$B$a'','!$7W!$B$až 80't += % ' "4'C'"4 #$'!$7W!$B$a'','!$7W!$B$a 80't += % ' "4'C'"4 #$'!$7W!$B$a'','!$7W!$B$aT 80't += % ' "4'C'"4 #$'!$7W!$B$a'','!$7W!$B$a 80't += % ' "X'C'"XP #$@'!$7W!$B$a"4% ,%2%.% 4%e.<=,'<'!$ !$48<@','$ V `$'('!$ !$A.<=(@''$ V \T't += % ' "'C'" #$'!$7W!$B$a.<=&+ 't += % ' "\'C'"\2 #$D'!$7W!$B$a0'`'p'!$7W!$B$a'D'T'!$7W!$B$a'0'@'!$7W!$B$a ,'`c,tX't += % ' "@'C'"@# #$('!$7W!$B$a'('8'!$7W!$B$a  $DHLPT<'t += % ' "D'C'"D$ #$,'!$7W!$B$a','<'!$7W!$B$a $ (HLPTX@'t += % ' "D'C'"H'X'!$ !$aD. #$,'!$7W!$B$a','<'!$7W!$B$a ,''('!$7W!$B$aH','<'!$7W!$B$a@'t += % ' "X'C'"`'t'!$ !$aX= #$%<'P'!$ !$%<'!$7W!$B$a'<'L'!$7W!$B$a\ 48<''0'!$7W!$B$`'<'P'!$7W!$B$x|T't += % ' "D'C'"H'X'!$ !$aD. #$,'!$7W!$B$a','<'!$7W!$B$a ,''('!$7W!$B$aH','<'!$7W!$B$a@'t += % ' "8'C'"8 #$ '!$7W!$B$a' '0'!$7W!$B$aY <@4't += % ' "8'C'"8 #$ '!$7W!$B$a' '0'!$7W!$B$ao <@4't += % ' "D'C'"H'X'!$ !$aDB #$,'!$7W!$B$a','<'!$7W!$B$a','!$7W!$B$a.<=&d`.<=& d % $8,0<H','<'!$7W!$B$a@'t += % ' "L'C'"X'h'!$ !$aL2 #$4'!$7W!$B$a'4'D'!$7W!$B$aPT` 4' '0'!$7W!$B$aX'4'D'!$7W!$B$aH't += % ' "'C'" #$'!$7W!$B$a.<=&`%% $'t += % ' " 'C'"$'4'!$ !$a  #$'!$7W!$B$a$'''!$7W!$B$a't += % ' "P'C'"P& #$4'!$7W!$B$a'4'H'!$7W!$B$aTX \$ (,0`dhL't += % ' " 'C'"  #$'!$7W!$B$ac$$'t += % ' "P'C'"P& #$4'!$7W!$B$a'4'H'!$7W!$B$a'T'd'!$7W!$B$a 0hL't += % ' "8'C'"8I #$'!$7W!$B$a''0'!$7W!$B$a-`''0'!$7W!$B$a'','!$7W!$B$.<=&(% .<=&  $$b$&"!,%<4't += % ' " 'C'"  #$'!$7W!$B$a+$'t += % ' "L'C'"L$ #$0'!$7W!$B$a'0'D'!$7W!$B$a ( $,PTX\`H't += % ' "L'C'"L$ #$0'!$7W!$B$a'0'D'!$7W!$B$a ( $,PTX\`H't += % ' "p'C'"t''!$ !$apB #$<'!$7W!$B$aT'<'P'!$7W!$B$ahc$T'h'!$ !$'<'L'!$7W!$B$ T''0'!$7W!$B$at'T'h'!$7W!$B$al't += % ' "T'C'"T& #$8'!$7W!$B$a'8'L'!$7W!$B$a'X'l'!$7W!$B$a 4pP't += % ' "@'C'"@ #$$'!$7W!$B$a'$'8'!$7W!$B$a  DH<'t += % ' "@'C'"@ #$$'!$7W!$B$a'$'8'!$7W!$B$a  DH<'t += % ' " 'C'"$'4'!$ !$a  #$'!$7W!$B$a$'''!$7W!$B$a't += % ' "P'C'"P& #$4'!$7W!$B$a'4'H'!$7W!$B$aTX \$' (,0`dhL't += % ' "T'C'"T& #$8'!$7W!$B$a'8'L'!$7W!$B$a'X'l'!$7W!$B$aǶ 4pP't += % ' "4'C'"4 #$'!$7W!$B$a'''!$7W!$B$a.<=,&+80't += % ' "L'C'"L$ #$0'!$7W!$B$a'0'D'!$7W!$B$a ( $,PTX\`H't += % ' "L'C'"L$ #$0'!$7W!$B$a'0'D'!$7W!$B$a ( $,PTX\`H't += % ' " 'C'"  #$'!$7W!$B$a$'t += % ' "@'C'"@ #$$'!$7W!$B$a'$'8'!$7W!$B$aA  DH<'t += % ' " 'C'"  "#$ !  $('t += % '"d&B8@b$& D !c V % '+= % '"d&B8!@b$&@b$&@ b $&@b$& @b$!$1 ''+= % '"d&DB8&@b$&!@b$&B8@b$& D $ e V  !B&"!, ' '!B&A!, %c$d(  !(! &  $ !B&A!, += % '$  !$ '+= % '"d&@%$ V  '+= % '"d&@%$ V  '+= % '"d&B8@b$& D !c V % '+= % '"d&B8!@b$&@b$&@ b $&@b$& @b$!$ ''+= % '"d&DB8&@b$&!@b$&B8@b$& D $ e V  !B&"!, ' '!B&A!, += % '%*"` !"B Ď  a$ $'+= % '%*"` !"B Ď  a$ *"@%  Ž @!,%$('+= % ''$'!$ !$A'<B$04,<$8 '` @('+= %j 'Ž+"`ŽÎĎ!A"! V * !8 'G += % '4 (8,( `d0 04, %(%% 8%(%% $ $  <  !p $#A 0'+= % '0 $4($ `d0 04( %(%% 4%(%%      8 ,'+= % ' "  @$*A@'   !p $#A; '+= % ' (+"`!,+("bc!$! V * 0'G G += % '+"$`!de +0"!"$fb/ ($a$e$$<$8H$4I$0DH  ') ,DH< (8 ') (DH4 $0 ') ,(DH  ')    !8 T$X@'TX@'T$X@'+= % ' ,( 4"B$"(,,( 0  4#c$#0   4"B$"8'+= % '$!$  Î `"$ !$*A`'+= % '$%  (,  A$0* a(,  ,(0$% *(@(%0%8&! *(  ,(0$'  !  !(,(0*@e+= % 'TP#"c8`XX# a8%p! bB !($*0#0%8%8% %0@ PX @% T*@!B<HŽ#c$ @  <<&$# 4*(*($HL  PX4@*F * HL  X4@* * HL  D'T,* A!$! AB @HŎ  @,@b$$Lb$8 ,8*C D'%P0* #!(! #B @HŎ  @A$(@0LB$8 08#$*C`D'+= % '@<#"D#a8&(C *(b#(",%0M!(##0"(#( %80#b#"$%(!0!0% @%$@$8*00'!!% '$@ 8 (*@!!% @&$@ 8,*8#C+= % '("$$ ,$*0E%0'B$ $( %$ ,*8"%8E$ $ ,%8(+= % '4 ,"0$ @ @C$8*(d2E$*0 ,#0<!EF$B$ `   ,D0<!&!8f$  ('('+= % '84#" #$$'! $C ,0  $$ 4$,$0!0b ,0 4 #$4a('+= % 'PT`\X$$ PT<% %0%8%% % #@ $*P(@`,!"HD@  @#$PTDH< r #8`D% %H$PTH DH $H#"D#a!$$8"!8PT f p 8HD"!!@% PdTF$ !8HD"!% 8PT  %(D"!tPT 4 (H#"D#(!,8*@e04PT <; 40*A!8(E$DPT*(#&$ <; #!8H(!5L'  L' R L'+= % '$"(,4 @,"$0c$B$* b% $d( % ,c$* b%($D( !8%(,$$( !$B$$B( @8$< '$d( !$B$`6!$*A`%$C(, `%`B$*A`% $#(, `!8% $!(, 8< '+= % '$"(,4 @,"$0c$$$( "$#$,6B$* b% $d( !8% ,c$* b%($D( %(,8 '+= % '4"$8% $% (&)&(CF#(a2(=,#0E$$ ` 4#"c(`$g8# a($$<<('B$ *(C%(,#0E$ `!8 8%(4<('$<(',"0$ @$$ 48*(,"0$$ @  48,"0$ @ 4$`,"0e$$ @  4+= % '84#"#(`@!b$ $p $# $( ,f$ ((' ,#0! ` &$4$d$* $@K@S&PG<%8&8CBL&8BL %@ &@ @I@Q&P $ DF%@ &8*8# += % ' PL#"!a@ $(ep!b! !%(M2!(> ($a$e$$<$8H$4I$0DH  ' ,DH< (8 ' (DH4 $0 ' ,(DH  '    !8 T$X@'TX@'T$X@'+= % '$"(0, @ 8"B$",00,$$(4  8#c$#4$!(  8"B$"< '+= % '(!$$d  "$!$*A`'+= % '$%  (, R A$0* a(, R ,(0$% *(@(%0%8&! *(  ,(0$'  !  !(,(0*@e+= % 'TP#"c8`XX# a8%r! bB !($*0#0%8%8% %0@ PX @% T*@!B<HCL#@% ` <<&$# 4*(*($HL  PX4@*F * HL  X4@* * HL  D'T,* A%$! AB @HL  @,@b$$H"Lc$8 @,8*C D'%P0* #%(! #B @HL  @A$(@0H#LB$8 `08#$*C`D'+= % 'D@#"H#a8< &0C*0b#0"0%8P!0##8",#0$%@2#b#"(%0!8!8 @&$D (8<*84'!! ($D 8<$,*H !! @'$D 8<0*@#C+= % ' "'C'" ! 't += % ' "'C'"% " + b$!d$+("bc!$$! V * ('G %G t += % ' " 'C'"  "#! $( ,'t += % ' "'C'" "#! ݋ ".<>'&A@ 04$' (!,<1B$/<B$ d '+= % '$<1B$&" @(/<c$ ^  $ CB ( ,0' 9 hC4'`'!$ !$< $4'  '7$!$  d'"!Bp t0 @4'Ǖ 4 /Ǡà!$C+00 $<`B$p  80&$!0<>Ǡà!$C+0. $<`B$p  8.&$!0<>Ǡà!$C+0, $<`B$p  8,&$!0<>Ǡà!$C+0* $<`B$p  8*&$!0<>Ǡà!$ B+`( $<`!$p  (#$!46fbHLP4'+= % ',#$$* C -ǠŠB$+0"6 $<`B$p  L6F$B$!b<>GE+(&< $<`!$p  <L$!(><:$+("82 $<`!$p  28E$!(e<>dhlptxH'@,D<~B$ $"ǠŠc$+(C0 $<`!$p  0e$!(%46dhlptH'4<@8,D<~B$ $"B$"<!$l$ m $"/c$ $ $"!$  XDP@HT %%`%!$7W!$B$a!/!$ '  HPTX '0'!$7W!$B$b+ Bd!'$%@ '!$7W!$B$b+8g!+HB !+0/4'\'l'!$7W!$B$A.<=D!&04'H'X'!$7W!$B$.<=D&0F4'H'X'!$7W!$B$.<=D&0F4'\'l'!$7W!$B$.<=D&0Fn&P@p&p @ $t'n&PNP@&P@m&h @ $t'c&C2`+hC'+j`+(+f `#9`%8#94`%t'$t't'$t't't't'$t't'% 9`9G`%I% t'`,p0'\'l'!$7W!$B$a M5 $('H'X'!$7W!$B$p,0 M5 $(*(d * t'$t'% %X!$ #(`!+c` cc8` cc8` c%% %X!$ #(`!(c` c8` c8` %% G %G % G %G % G G % G G += % '|''!$ !$a8'h'x'!$7W!$B$a.<=H& -'h'!$7W!$B$a 8''''!$7W!$B$a'8'G'!$7W!$B$a h''$'!$7W!$B$ax'\`T$4$x'3 4T$8'%!$7W!$B$'8'L'!$7W!$B$'h'!$7W!$B$a 0`|'8'P'!$7W!$B$aX'|''!$ !$AX'+= % ''X'h'!$7W!$B$a `'X'h'!$7W!$B$až `$lT'@'X'h'!$7W!$B$a.<=P& % 3.<=& % +@'X'!$7W!$B$a,'X'!$7W!$B$a.<=<& .<=& @D% L8,0% 8+'X'!$7W!$B$a @''''!$7W!$B$a+ 'X'h'!$7W!$B$aT `+ @!8 A!0!8 $lT'$lT'A!0lT'+= % 'Ld8 d8kH%m%HP@%PH($,4''D'!$7W!$B$( (&(d$*($$ $,%T0'$#@G1$#HO )1!$!(c$!I$ `#%HJ%X &H+ $ T0'B$%@%PB& B&e00&(!A!$T0'%%G %%%% !$ %(!( 8 8 $P$%$% += % '%:  $8 Dg8Do8,% -<!8 Ac!8 Ag!8 Ao!8!,%-<A-<#-<! !$ "/ 048@<OP<`p!$ $" @<"@0\4Lh''!$ !$$%$h'!$7W!$B$%8%@XH<`p!$ $" @<"@0\4Lh''!$ !$$%$h'!$7W!$B$%8%@XH<`p!$ $"?0!8+P@, $<`B$p  (,D <)% $+`0 $<`B$p 00H!&<4c$ $  H0 m '%G f'!@'0i$ !$% d,<̄4(( $8p#g',.$,(f'! "0c$$# a#(/$%!"' m %D@$$$<$$<%(R'e'!$ !$$R'!P)0$K!$%  ,<488 $Hp# ), &,R'!"0$d$# a#(/$%!"' m @% %(D$<  &$<$$>%8>'Q'!$ !$$>'!`+0$!$%0 ,<5HH $X*q#0+,`(,>'!"0$d$# a#(/$%!"' m @ <%0%8D$ ( *'='!$ !$!$:$<$%%HL''!$ !$APL$XB$p  $@p%!/!$`'  |D@t$`'p'!$7W!$B$\$PL|V / |LPT'J%Q@+XH`!X*k%k9`H% %_ % %O % %G '+" % TT'' '!$ !$Ad8 a8 %% %(e E8%(%X_:  .<@W!$B$p  $0p$!/!$\'  X4$%0\'l'!$7W!$B$ k'l'k'!$7W!$B$'$a : $X' |'%''!$7W!$B$l'|'{'!$7W!$B$M` `k `'l'k'!$7W!$B$a$XB$p  $0p$!/!$\'  X0$%0\'l'!$7W!$B$ GkD'l'k'!$7W!$B$8@%B @  "@ $0"@8'  3@ ! '''!$7W!$B$a@"$/ 8-@H-<$h, <`B!$  $"<@B$"H"/B$ $""T<+(/!$ P<}B$ ,"-"."/"0"1"2"3"4"5 "6 "7 "8 "9 ":";"$Pbb<$@+0/  % $(,  !80 '"8 @!8 % B$ C(`!"c` "B8@ "B8@ !$$ !$+= % '$"8@"8 @ ,0(4',04' "#$!-X'D'T'!$7W!$B$h.<=&(% .<=&  $$ "8@"8@%%=*#@8<`B$0  08% %%&!$ 0f  %4'h'!$ !$t`p\hd4'B$ $""(B$/$ $""/!$ $""8B$/q<:6&(5$ $""/!$ $""TB$/$ $""/ m<[6&W@!$ lph"#/!$p  %$(p$!(/!$h'  HLd`h'%0%x'!$7W!$B$%0 "$!B4B8@!$ ,0("#/$?|''!$ !$|$$%!$"(x@\ $$$  @\$P-<$x t $  \$ P z%  \$\ $ b$b-m '-m '+= %j ' "'C'"֎Ž @'+= % 'PTX \`dpt : $(HLP Thl X$\(`,d0x4I 8<@|D'+= % 'L'`'!$ !$a@ . P-!$  T%% %(<@DHL'< !$ | $H$X*(d)HD$%(l'%0%!$7W!$B$ ! <>$l'| <>$/O -m \'+= %j ' "'C'"! !/ '+= % '/<$ /<!$ @@'P'!$ !$TX\`8' # `$'''!$7W!$B$a!   %@'% $'4'!$7W!$B$TX\`8'+= % ',0 $ .  <`B$<  $<B$ /<`p!$ $"<B$"$C8d4c $/<`p!$  $" h%d`X%(jX"a U  8<<C8`B8>@!8; $ 44 $ '$_>  %% (,<`BB$  $"  %% $(<`BB$  $"  %% $(<`BB$  $"`48-<<`p!$ $"<%B$"4C8d4c $/<`p!$ $"<4B$"4C8d4c $/ (".<Xc$ ("$ <$ $""/`48-< (".<Xc$ ("$ <$ $""/?''!$ !$A<=,%$%>*%&%c4?%D.<=⎬'''!$7W!$B$at''!$ !$a'%''!$7W!$B$'''!$7W!$B$a''+" %  '"0C``(BD8x B8G@abd efc 9 TP%'% 'L'!$7W!$B$X'''!$7W!$B$`'! X'z  'abc i <`?c$ $"!$ CB#/!$ CB#/!$ CB#/!$ 8CB#/!$ XCB#/@!Be * !8,( +(!b$/ 't += % ' "'C'" "#! ś 't += % ' "'C'" "#! / 't += % ' "('C'"( "#! i  ,048<$'t += % ' ",'C'", "#! 048מ  $<@D('t += % ' "'C'" "#! i  $'t += % ' " 'C'" 8 "#D8 D8!&%%%!abdc-B$'$"+*9@8-'$8@8@)- %@h ,)TX\L%@4%@='$$ `d?0<:!%!8+H; ! d$$0!0+8/! dƐ'$%h+ $`d+"`t! #x'$%h+ $ m |'G %G %G G %G $*0!0Ɛ 8 +0!0$+$Ǡ+$ m |'%G %O  "!   " #!  += % '41 "#$ Nl 4d,(a b$ Nl ,( @4@ qu , (8<#B$ $"X'Xd`!(\+8e(D@ <`!$p  D(@@<h!   <`@dh\`\%#+A@txl'`x x $%H%P%`<D0!G0% @8% @8 @@ O %@(J0%8/<.%!H @,@,%h%x%12$ 1.  -  $#p1x - x%p%p1$##.&p .  0.  . p%p%)%%`%PS -)%@$G $,& &$d0&D&b<6$7<6$ W*&(6&2&&a&e&b<$7<$ WE0&0&8&@K&8#%d&h#3&f&b%d&g&a3<36$73<36$ W<6$(W<6$07&8&@I&8!%d&h!1&f&b%d&g&a<6$7UU%(0;T %80R%(E>P_ %PKJ1\ %(eT %8GRJ1^ %(eR %8G*1%8GS ]%PjJ1R %8GRN %HI)1L %8'A1F%8!$"(@L'! C/ '!FB!%(%0<D%8BN%@(8#$%"&'(!0'%$G %$G %$G %$G %$G %$G %0<D%8BN%@(8#$%"&'(!0'%$G %$G %$G %$G %$G %$G hijkD*4>lmnoD*4>pqrs D*4>tuvw'h'!$7W!$B$ax'jT %HI?k^ %XiI Bf %`,!`$h&h!h!h@%h'{'!$ !$aD.4:hijkD.4:lmnoD.4:pqrs D.4:tuvwD.4:xyz{'h'!$7W!$B$a|'?'@$@i$*0!HI*$PG%@ ($88,&$0,@'!0Ɛ$0%0&'3a$Lb$H@$ ^ '2'!$ !$AT4'H!$7W!$B$a4'3% !0Š!$$("%0>$8,'!H'$L$H",@!8$J$H",@!8$$(E,L%!$&0@,8,&0!0Š'%(&$0,p'0!8'!0ƐT@$ ^ 4'TH!$7W!$B$a4'3%! $(%%(!$c$d(( ,>%'!8'H@V$P*%@H$,-!8T$P*%@H$,!8R$P*%@H$,X''2'!$7W!$B$aP'%$G %$G %$G %$G %$G %$G %$G %$G %$G %$G '+" % ll'''!$ !$A4''!$ !$AEg<#B44 40,8$"p<H<DH@<'l  ".@!!"0,`$%70!$4+(8+8 $<`B$p  %(% +,ptx\'%%G += % ' $( ӯ  o ,048<'+= % ' $ m  ,0''+" % $$'%* b$! #(c$  \y $ $+(.8-%0+88!8e %@9 A0%@($0  $$( ' $`$$ < B$p  4(<4%08$@!@( $ $+@f $< B$p  84(<4 $$@!@($( $%H<4%(]$+@f $< B$p  84(<4$@!@(%(( $%H<4<LPTX<'LPT$X<'4'+" % 'P%$+bG` C8`C8`T%X% B8~@T%X% dTX\ P;  TX m `dhlL'@X"0%@"(@"$T!bB @"$! bT%8 %%%b$+@ $  $(0' '' $  <$&WB0 $(   @D,' $  !!8 LPTX\,' '$ e   $(LPTX\,'$ H Dd$ H <\$8 '!8 <6!$R$ ,0H 48 '$L' $2Y dhlT'_ %%_ += % 'X LPr T`$4Td.80 X$#070!fX<,r  $*A `0`&A@( %Y\`dH'@D<, !0b+@& $P< <=!$p  P<$%8%<<=%#@#H#p#( /$e! 3 <'%%W ''!$7W!$B$a8b%f%<$D%PlmXT8AC o Tc$@''!$ !$< !$ $"$#$$X+0/$"!$$   $% ,TX\`d'$"!$'  $$$ wa$Td$'!$7W!$B$''$'!$7W!$B$0 H','<'!$7W!$B$L<$8H@0@@?%0@87 $G%8<6!@+8!0PTH?<6$0HLX'H'X'!$7W!$B$4'@'P'!$7W!$B$8<$84@0@@?%0@87 $G%8<6!@+8!0<@4?<6$048D'4'D'!$7W!$B$'< !$<$!$7W!$B$'p''!$7W!$B$'''!$7W!$B$a'''!$7W!$B$a$ $ db''!$ !$A-<--<--<-厬bdc ݋ c$('| <>$ *]  $TX\`d'$TX\`d'TX\`d'$00$!0fnj&@' $3} += % '< !$ 4 <@D ݋ <`B$ *] D  $" c$+(% $<`!$p  $$(p$!e/$ += % '/c$,40f-<@R$ $?0@8( <@>)%!8' $*XF`+X`+8$*X `,` $+(e $*($(&(" / nj$($*@$!$*H $<(6!H+@ $4*@$ <5*8$$0Ȍ80<HɌ $'%%P%%( %%H8% 0T< ː<`|@ Lf<&6& w<$& 2@"<^6& w<$& &4*<6& w/!8!,% '<6& wc8`$ 'f!8 Aa!8 Al!8 As!8 Ae!8 $ ' '$ '$8f $8p$!8'&PI @c$ ~ %⌑@$"B8@ !"fB8@"aB8@"lB8 @"sB8@!e!8!,% '+= % '<d4b,%!$*(" !(`8%$%0ab! $*aT`#8`Cbc8`Coc8`Coc8`Clc8`%%#8`Cic8`Cnc8`Ctc8`C6c8`C4c8`$< B$#8`Cuc8`Cic8`Cnc8`Ctc8{`C6c8w`C4c8s`$<>B$n(0$* a+$8 #8` #88` At!8: Ar!86 Ai!82 An!8. Ag!8* @Dl,"0# @"tB8:@"rB86@"iB82@"nB8.@!g!8* @Dl "$# !$$ += % '! $ !$$<$P!$ $ <`B$&"` !<@D,'(<@D,'< !$ | += % '@4A0<(!$ 8<D H$; ,'+= % 'H4A0<(!$ 8<@DL P$; ,'+= % '<`!$ ,@"4<(B$ 8<D H$; ,L0'+= % '<`!$ ,H"4<(B$ 8<@DL P$; ,T0'+= % ',0 $J  (48$'<į!$$ += % '! $ +A9`%(8'H'!$ !$$8$<#0E#8?$(!e@D4H $048$/  +A]`#A # '$$!a<~!$ $f T " #!b " #+ b@$#+ C9$#C#(/$e!$+`% '0'!$ !$a$ $$##(/$(E!((,40 $048$// t"CD$ E+0d8 $ \'$G += % '8$d$(<@ $d$%& 9(d(%& 4,d,%& /4d4%& *8d8%& %d% V  "d e V  0"0c4! V % '"d&@b$&D @b$&D@ b !&A!8  += % '"d&@b$&D@b$&D@b$& D  ! c V % '+= % '8"4d&x@b$&Ds@b$&Dn@ b $&B8h@ b $&B8b@b$&B8\@b$&B8V@"d&$e& %M@"d&$e& %D@ b $$e$&   7 4("8(d,%,f0'(0h$4) 4j,   ( $ ,  $A 4<"8<d& D 8c8! V %<0'+= % '"d&,@b$&D'@b$&D"@b$& D$e&  $ e V  !CB V % '+= % '"d&$@b$&D@b$&D@ b $&D@b$& Dd%& !c V % '+= % '"d&@b$&D@b$&D@b$& D  ! c V % '+= % ' "'C'" ! 't += % ' "8'C'"8 #$ '!$7W!$B$a' '0'!$7W!$B$a <@4't += % ' "'C'" ! 't !!!!!!!!!!0!0!!!!!!!$!$!!!D!D! ! !!!! ! ! !+= % ' "'C'"7< LB$  & "%#!+A@ '`x x  !!+= % ' "'C'"7& ' !! !! !+= % ' "'C'"7< LB$  & "%#!+A@ '`x x  !!+= % ' "'C'"7& ' !+= % ' "'C'"7< LB$  & "%#!+A@ '`x x  !!+= % ' "'C'"7& ' ! !!!+= % '< !$/<` !$ "C0 B0@c4%%%.`<c$  sH % a !8 %Q@<|!$'| <|B$<B$$ '$S    8, } < B$dhd `d0 04%(%%, $' 'o '4#$L'!$7W!$B$atLPTX\` t' `a$4b$@$' 'o '(HD@ 0S. tDH( t' 0"$<@<0`Č  Z5 @0<* D } < B$lpl `d0 04%(%%$' 'o '-m '+= %j '8<Î(dŎ$ Ǝ ^d8$*H  "! DHLSR  "! PTXSR ($$ XPT'A$+ "$8p$!8X/B8@pD0<$  sH % ' '!$ !$A<<@ @D'%'@'!$7W!$B$'' '!$7W!$B$`p $, ( $t,%0'%8''!$7W!$B$, l<@ _!$$ 2Y tx|X'tx|X' "0C$$+1`$+b `$+b `A8 .$+b`"0@%!0 !+!8A8 B+A8$'$'$$'<@}!$ $"8-<Q-<Q-<Q-<Q-<Q-<Q-C8e`\B8Q@-<0Q-<4Q-<8QP T  .-".<>'+= % ' <B$<:c$ $ <@xB$"/c$ $ < B$"/#'+= % '<0!$$, "8@ C0c8`   4 ,  '+= % '(,04<@ ,'X'!$ !$a< c$,'  #,'Ǖ ,q !(H"@ / 48 w   ,0 <@T DH(' !z += % 'L @<HD<@7 4$DH7 $4$4 0<$e$  ,%ab$,* C < c$ $(p!(($$  (bb/Ž @l? lB l: l"#$%('. 8(":@0CD$E&!+8d!(, $$< $  & .<>Ꮃ< B$$ t 7/ `! H  8<ČB$>'' P* >@%;(<@-C`DAHCLD ݋ <B$ $-APDCHD%(#%%(| /<` !$$ $' !  lPT ݋  <X-<$$$$ $ 6 .<>⎳< c$ -<$WC$!d$w$w HtXLF %P T% !A(X+@\l #.<>᮵".<>'+= % '<`{!$ 0 <B$484 "C0 B0@c48%%%tp @ ' ", # "+ b#$+0E ƌ!#D#dc$# B$'$ !$  '%_ W %( $$  $ "C8`B8(@ " # "D$+(d$+8$#E#ec$#8?$0! 0 l  ,-`," @  $ 4 $ RO  x* %% %(%8H< $ ( !" 4'S'!$ !$A4' $ ,M L < $ ( A P(%=&3,'tp%@%H%PhE"6@x|, ݋ 0  i <!$1  $('  LDH<`ʄ$@ @  @ LDH\` d$h(Q 8 <lptx|P',04lptx|P'lptx|P'+= % '$"!B @ `8,'04$ .6 / \<B$&"@@`k .hX'.<>hX'$+A)@"8@"8@!8) \`J hX'\`E hX'l $m (0TXhd<$T' Y Z (T0Xhd<$T'  7h"9<(*c$48(<0@4'\$#tp$"l x* dh xy h"B$"""0@$$7#\ `'h7K9`&K9i`+X"%`)8#X"!`d#p#pw$N!+p 4D <`!$p  D<4<D4!  4!$)c0<$!dB0!DcB<+0D+*D $<`B$p  *+<$%()$!H\ $*u $+0 $,,#",C$\8%%@%8,H`I9 )$*P%@*$+XE`!PJJ9v@+P%@!H*J1J9m@+P"@D#P"!XGd#h#h o $!+h 0<@ <`!$p  @0<<4@!  4!$DBB0<c$!CB<+(@+@ $<`B$p  +<c$% %$!(\ $u $2 $0 $,$H%8%@%\` +0`#!'d#(#(/$E!+ 4D <`B$p  4D<<4D!   Dh4l<pL'%%_ %%%_ % %G % %G %%%_ += % '\+QU D9<GB$TXT'\$+p%xht|dl%P%X%`P%K$pDxt|h% %H%(%@%%% *hfu0PM(%p <9>9&9p*p5+pl#pl!x##Ç$` !`l+/@L< <`!$p  <L@L@8!  DPpxt|h0(@8L$f g 1<%!`1!x+%*) $<`B$p  DPpxt|h0*(<%)$!\$u$0$ l% <%\$u$0$<%\$u$0$%x 9o%*p%+W!p:w+K!xo2:n*<+l;L#l!##ï$`!`l+4@H4 <`!$p  4H@@8H!  DPpxt|h0(<%L\$u$0$8@H$1!`+x%* $<`B$p  DPpxt|h0*(<%\$u$0$$!x2$l%@,8L6Ž @ "(G@ #8K`0,*"`@8L7+A`#A8!(dx#8#8?$'p!@+H L@HL <`!$p  H@8% %H%@@8L!$  0@8LL$0,@8LD,@L8@L<,U  !8 h@+b` D$!L+\ `'t,*"6`+AD`#A<! Cx#(#(/$p!%@+0L@HL <`!$p  H@<%( @<L!  @<L@<L+\ `'_ W _ % % _ %%G %%G % % _ -m `'+= %j ' "'C'" "$*b @  / +H !@%Hb $+PI)@' $+PI @"*9 @')9  /*9@\*9 @+HDb !HE(($I$b(9+@DR!PE $K($I$n$+@ f(9 +@D=!PE $K($I$xn(9+@D,!PE $K($I$kr(9 +@D!PE $K($I$^t(9 +@D !PE $K($I$Qu#9``#A8d#(4$h$#HO $H)!H 1  <(6!7 $0f,J@+0E,4!$8B$#$T!d 1 4*7 <$6!wd,,"% $+Hg   Hap!%/`@'$`@''<'!$7W!$B$%XLH\TD$*@+@w@p! @*$'!$7W!$B$A$+X,d`%!i@#$'!$7W!$B$aĎ''<'!$7W!$B$H'''!$7W!$B$ 1a'!$7W!$B$a/`$@(q!8/ HDHap!%@/'$'Ll'|'!$7W!$B$0%<$8*@+@w@p! T*$l'!$7W!$B$A$+X,d`0P%!iL#$HX'!$7W!$B$aĎ'l'|'!$7W!$B$'X'h'!$7W!$B$ ,1al'TP!$7W!$B$a/`$@(q!8/ "d& D7 $ e _ - "d&$e& %"@b$& $$$e& d% V   ! C$B V % '+= % '," '$ @<c$%%`! <B$%%,B @ 04('04('+= % ' <B$%%@$! <B$%%,B @ (, '(, '+= % ' <B$%%@$! <B$%%,B @ (, '(, '+= % ' $," '@<c$%%`! <B$%%,B @ 04('04('+= % ' <B$%%@$! <B$%%,B @ (, '(, '+= % ' "$'C'"$ "!@$ FH (,04 't += % ' "('C'"( "! $ @$^M  ,048$'t += % ' "'C'" "! 't "!#""#!#"# '$D!b += % ' "'C'"b a+ Adc#a#A#(/$%! '_ !+= % ' "'C'" W #+ b"'W  '+= %j ' "$'C'"Ž$ (,045J '+= %j ' " 'C'" $ (,01SI '+= %j ' " 'C'" $ (,01H '+= %j ' " 'C'" $ (,01F '+= %j ' " 'C'" $ (,01B '+= %j ' "0'C'"&&'!$7W!$B$a048 <$@(A)B ,'+= % '"d&@b$&D@b$&D@b$& D  c ! V % '+= % '"d& Dd% ^  !B&"!,% '+= % '"d&@b$&D@b$&D@b$& D  c ! V % '+= % ','x'!$ !$A$0$ $ $"# #/ )$+P ^@+P!X@<lP:\##(8/$(!E$   $<%(\ %%%(% njP :$ 'BP+XI` $Pjq!H*1(!(!% % K % _ % %W += % 'T d@Pd(%(4'H'!$ !$fnjȌ%Ɍ+P"@0 $i. $+PI@( $+PIa@$'9$'0  $۶ "B4"$۶ @$#(/0P!(x%%>%(%0('9l'@0G(g?8  %>%(%0x"B$"$۶ xC0#@#$#!0P!>%(%0)*9&@+ $+PI@.'9+'0$۶ $۶ @$# '0P!%>%(%0xc8 z@@$# '0P!%>%(%0xL\ $+PI@?*9@['9o\'9'@0G(|gC$+@2A8B8C8nR $۶ @#$#!0P!A%>%(%0x $۶ @#$#!0P!A%>%(%0xQ8-b8z8= $۶ @#$#!0P!A%>%(%0x $۶ @#$#!0P!A%>%(%0xA$#B0!bTt(8$%H%!$ !$<`X!$ x,"B$,"@P>%Ht$(H(<hp 9@P95 $$ (,0``P@ $tĬŬ/%(%0E@Ptx $$% (,`@P $tĬŬ/%(%0x<" @t<@v$  x"/%(%0  /%>%(%0x**9@$ +*9@$?)9 $> D$#(/0!(e $($ 8,04%>@Px^*9@'0 $۶ $۶ @$# '0P!%>%(%0xn{*91@|'9 @#$#!0P!A%>%(%0xW  P@x; x@P>%(%0;`H   x{$; @$$#!0P!Ax%%(%0%$$+0*8*8x$ P@ `$H($ 8,04x%$@Px?| '?| '%(%0-m '+= %j ','!$Ž ÎĎ(p i  $< c$&#`<_c$ ^ 4 $U`< _c$ ^ K $  .@D$T+(d0+(A48#A,# '$$P!Di , D%e%X\`dH'PTi $ -'88(0 "' $%i$*@U(8" 5($i!8K "5($m(8"$$($s!88 "5($TP%;:&8*( A!@"'8@TP%)":!8 $@"L$۶ @$"L'X\`dH'TP% X\`dH'#A+(A%<! $ a &a /8 %(% $ j ,'<|!$ $ <!$$q $d& /$c ($c da!"B8@@#`@Č<Ō$8nj+H$ dtp $<B$p |@/@!('8`%%H$"`!0 @ 8,H4pd$ $T%8%0Y%9`(# `$#`("$+"!`$!%$%%%%% 4  44 D (,4 <  "C(`$@$ @ "#+ C$$0p!0%\`dL'\`dL'8p!0ǐ$+@ 88nj%G8 8ƌ+8$H<  0<`fB$ T"/`Î֎Ď#A#(/$%!a 8!A <+04(,4 <`!$p  ,%0%((8,($!  ,L(P$T0'_ O %G %%G += % ' L|d*0% d+(W( !(%+8L+8E#(D!@#`g $Xl!XlL+plLhl <`!$p  Lh%p%@%hDLDl!  DLlx%(%0,%TLDl% %@$$%%(% %_ %%O % % G % %_ %%W % % G % % G %%_ %%O %%G %%_ %%W %%G %%G += % '8 4{8&$#8?0! %0($,%<@DHLP0' !G,$% (%0*8&\+` ##$#!7 $+ a $0)<$! `0+  -<w $)<$$9$%8 $*0 0&(9$*889$%8-<w $$)<$9$8_'8 ,($ +@d !c}c8`#$ <@DHLP0'%%%(<@DHLP0' $Hp!8B$$*8A!8%@0 - 9 $+@(<6*@$! 08$*8$+8##07$f!<@DHL$P0'%%_ %%G %%O %_ += % 'L"B PTX $(,04^ 8 LBB$<@@D%%%\`dH'e$(!(%$*(bc$+( $< B$p  D%%(%%+= % 'HLPTd"B hl $(H',0$4^ 8 \d!!$D<X`$#8#@G$(!+(f,4  D%$LXTP8<@ ( $= #8 `8d$TP<%*`)%8,L"PT X<8{<  ,*))<) %$T+8(P!(+@FL 7H!H')*( X8 < %88*)qTPL  X8;; 0<#"8#($)48*@e*g+L$PT X@9 +!80G$8*+L$ePT X($@9 +!8<0)$! > H'! Q? H'H'%%G %%G H!H&* +$$*@ +@@!@+H # A# d$$&%%G %%G += % ' +"`!(+0(!(gf%$$$$*@+@@!@i*@ $*@+H WP!PKl*`l+@v@!@o  I$$'+(a!DAd,$0 '%G I$$ .+@@@!@ 7$*@+@9@!@i*@ $*@+H$ WP!PKl*`l+( a!DAd,0 '%G %G %G %G %G %G %G %G %G %G G += % ' +"^`!(+0T(!(gf%$$$ i$$ .+@3@!@ *$*@+@,hH!H)*@ $*@+H WjX!Xl*PL@, '%G %G %G %G %G G += % ' d$$%!$)(* "&HA #H2))8 +Hx $P!P+X'n`X !XlMLm#PJ)T@#H)) $,( '$*H +H] H$!H+XGS`ˌw)P !PJ*H* ( '$( 'Ml)%*P(@+P'@P +%!PE+`g ̌LX !Xem*p% %G % %G M ʌWP !PEK)%` !`*pm% %G %%G % %G %%G += % '(`\#"!a@ $(ep!b! !%(a2!(M 0,L%f$g$$D$@J$<K$8PT X(' = L"B$4PT XD0@(' = L"B$0PT X<,8(' = $40L!PT X(' = $(  !8 d$hH'dhH'd$hH'+= % '$+"``! +0Vnjc8!8*g`,g$g,%$(+@;@!@+H3 Ɍ)7H!H$)*@ h%h%8+((!(+@"ŒBW(! *D@bB$b%0 'G %G %G %G %G G += % ',(#de( /(@(!( 0fp $#0$8 ,$ 8  'P!PK,+L%$*H( $ @c @k &hT %P&Pj[ Bd &PLBd %Xl&Xm@a @i &hm$H^ %Xl&Pj *P#@#H#+P @!$H!H&+P"@G %G += % 'HD#a(d$,/!($C($4D8< @> $%$D(,4@<8 8!8 g > $$4D@<8%%4@ +8"!8@!@+H 0'%G G += % '($  I%@ @H*%*XG1`+%*`g!H$!%+`#5`!%!H+`#,̌)`!`*H, %X !+@#@!d!@+H# Ɍ7 P!PL*h, ' '%G %G %G %G += % ' d$$$$*H % ',j*Hd +H H$!H'+P @ W*X!Xgl*hL%%G %%G += % '"d& Dd% _  "d&DB8@ ! b&"!,% '"d&@b$&DB8@b!&A!,  += % ' "'C'"7 - $'+= % ' "'C'"7[ ' +'+= % ' "'C'"7[ '+= % ' " 'C'" 7  ' %#+# $('@x x += % '< < !$  .<0F/<6& w`Ks<6& w<6& w<6& w<6& w<6& w<6& w<4+ r<׮4+ )x<6& W<Ʉ$& Wab\`dhP'<׮6& WH< $& Cab\`dhP'%<6& W <ʄ$& a $ j \`dhP'C<44+ 1B< 6& W<=$& ab\`dhP'C<46& W< ʄ$& a $ j \`dhP'V s!8   ):  $+& 8 %"8 % 8- % 8 %  8  8 % %"+v@  8(  )$  8 8 N      !8v@ V4T8W S88   \G 8TX48GF$*8 G0818BF8GT89f8wt83w83GT8 IR)9 IU)9 IE)9  Hr9 Hu9He9t8SGr8OGu8KGe8G%$%88?GF8IA)9 IL)9 IS)9 IE)9& Ha9 Hl9 Hs9He9f8Ga8Gl8Gs8 Ge8%%0%8P%%0(H  dH(  d#(+# %d$D``@"8;@`P!  T!   %0GHB%8HD%8HF%8HIJ %@ IL %@(IN %@(IJR %H*JT %HIJV %HIJKZ %PKK\ %PjK^ %Pjlptx|%l''!$7W!$B$de*% e,% e.% ef2%(f4%(f6%(f g:%0 g<%0 c%$Ĭ(Ŭ,ì'3&u>?3&u? ss& s8!3<b&4!Da&xH@|t%%x@S(p`@3(m`HDP@<L apah iJ %@  iL %@( iN j kZ %PKk\ %PKk^ lmj %`ml %`mn noz%po|%po~pq%q%0qrs%Ss%rctu%u%uvx%x%xy |%< |%ș |  a %a %s% %(%0 %8K%@%H%P0%r%X%`%h<%p%pa%%q?%%q@%rA%rB%rC%r!%!F+%!t! +h!(m$hF%F'$Q%h-o !0+h!8%@%p% ]* h L P]* d |L P]* ` xD H]* \ tD H]* X pD H]* %"`%d` CDE FGH'%0:DN !"#$%&',LC ` '$ T ('%0$+8"$$#8?0hiJ %@(iL %@(iN !g%8(8/<8/<$( 'G B$D($c$#(/0&!%8/<8/<$( '+= % '/`.<(K/iT L %8G%0& $+P"@jZ V %0F%8g $+XB`' '!$7W!$B$ '% %G % %G %%G %%G %%G T'+" % '@'>'!$ !$A'('!$ !$A$l@$$$p'04 8 <''$  #''!$ !$A'#'$  ''!$ !$A%1#'!c.7?0BG1O)1VJ1^k1B.0c0@`'!`!ec0!(j0*$@P !PM!@(1!00#e#(47 $0p!f470p!(!$E#( `!aCd,'@''!$7W!$B$a,'%$G t'+" % '''!$ !$a ' '!$ !$a%4 0 '! @P )`0*%( J- @j,/@0@P<'!PKFc$<'f(,-0 ,f,@0!0Ťc$e(% ':'!$7W!$B$a'%$G %$G %% G %%_ %%G %_ p'+" % '$'"'!$ !$a8 ''!$ !$ %#".<>᮪ 0#$.<B$.'  $"'$,<!$0,'  $"<$*<!$0*'  $"$(<!$0('  $"$&<!$0&'  $"$$<!$0$'  $"/#.<>;  0$"<B$"'  $" $ <!$0 '  $"/#.<>/< /<%/< /< /<%/< /<' /<( /<) /<+ $/<*%/< /< ࢪ 0/$<B$'  $"0$<!$0'  $"+$<!$0'  $",$<!$0'  $"$<!$0'  $"$<!$0'  $"/".<>4'K %K %K K %K %K K += % '".<>$'+= % ' $$<B$'  $" $<!$$'  $"/$<!$$'  $"5$<!$$'  $"<$"<!$$"'  $"$ <!$$ '  $"$<!$$'  $"/".<>('+= % '  '+= % '.<>Ꮃ<`B$,' Y  "!B$"$'$ \c$`+(% $< B$p  4$0p$!f/@ADF G$H(I  # $ l" #h`-<:$g@A   < c$& a%(%(%T"@,"B}@C8`0"$*b@d$C8 X\P'B8M@"$#$% $%0W%0F(w T(A t`<d$d$*  $C8  >  \$ *: @8 @C-<<$Gv%:\"#$0 L \0$0   $dh&T X'%dh"0@$$7&T X'@\8C/-<4q0,!(%(+8E%0  8<4"0@$$75$ ('<!$& "%(%(%d,i  8<4"0@$$75$ (',,"$a  % cdE, 6$#070!( F8% Ꮃ<c$ !  -<8 -<8 ",BTB@.<>#w<$ !  -<< -<< "!!8A '!($C8  <   <$&(%%% E "+B'@@D/  " ' $C8   %%l 'x  $C8 x '  |l%0<%&H( %P%P%0Z *` _ <$&0e%%% \+a$hHd$l'!$7W!$B$LdPeTc'l''!$7W!$B$8<@X H\&(:D%(%0TdT` $C8 Td E < c$& #ACB@`d/  t dL8+P@D 0'% ''!$7W!$B$ '0'?'!$7W!$B$` '% LPTXH'%@C$! a.8TXH'O $%_ += % '4x J D"H @L8<@ DH ( $,<@݄$ ("$#/ Y <c$& a%(%(%%/ v <$&0e%%% @BDwnj,<$"<ۓB$" + <c$&#`% % %$`/ < <@c$& #%(%(%-  # $'$@g@%!@ &P$ @c$ 3} $HH )%!H*&XE`$@3} $+= % 'h"L > T $njcVP4dtP$C8 P !d  <c$$ H <X$njE<4$ <  <0"$l<dTeXf\g$   <,"aC)`C&`l<"L#P$H%D&@' ?$?T@@B$B(@?'$ ?\Sth$(?hldDdi<=$=\S tp h!$!( $M''''''''''''''$''%%G %%G %%G %%G %%G %%G %%G %%G \Q`dhlX'$d' & = h:`PdLe$Hf+8 $@%@H %+X4`K--`k$#h o 1!h+p k $xp!Xohl+`*/  $d$+ A4,e$+(A**e$+(A!d#B0$!b*8%0&(D   (,048 '%G %G %G %%G += % '"(@B$!$ab#!0 !A/ $d$+ A4,e$+(A**e$+(A!d#B0$!b*8%0&(D   (,048 '%G %G %G %%G += % '"(+@ CD"%D%!$&a`a!$a#!0!A/c$d&;%  ", @ ( A,  8<$'0 !4 8<$' !, 0 !4 8<$'$88$!8&HH $3} (%%'+" % hh'  W (Cc88`< !$ `"$!$ !$A/ [ $njHhH-<8,&A @-<<, _  xP$C8 xp$C8 Hh'=@ A D "K<]6&W `$njHgxP$C8 !d  |Cw<$ ! T@ -<8 -<8 T@,aT! .<>Cw<$ ! T@ -<< -<< T@ A($,!@($C8 Ꮃ<B$*' %T@8,H%)% %P %`&Xl`*.<>Ꮃ<B$*' %T@8,l'+" % '",Cadd:)O ''h'!$7W!$B$a,"VŽ dhlp % '''!$7W!$B$ x t,` '| ' $lphGHI p $( i u dew<6!0+($! ''!$ !$-< '''!$7W!$B$,<8L$% '''!$7W!$B$a'''!$7W!$B$'''!$7W!$B$S} ,0)<+a<&c4*b<&6&WB,$A%a ("d&@ D(,! ' ' ' ' '$$/%0g&(,"<  F<$'$ '"  ,CHd088   'aY]c`<8Lc$a% '''!$7W!$B$a'''!$7W!$B$a0"@,#cw|d$lc$'%!$7W!$B$'''!$7W!$B$a'''!$7W!$B$aCq ,`  ' ',CHcc( ``` '(` Ɛn` c` ( ,dH<$&8%%%0Q' '!$ !$ČŌnj'' '!$7W!$B$ D-`c `XdTa!P"T!%%  5dh\'Hdh\' $C8 LP ^ <@c$& a%(%(%*(#c,`dEcQ#   /$C8 dh\' $C8 LP<@!$TX _ <$&0e%%% \+ a$hPd$l'!$7W!$B$TdXe\c'l''!$7W!$B$8<@oX H\&(:D%(%0TdT` $C8 Td   $'!$$" $' $' $' $' $' $' $' $' $''+" % HH'"<c$ /$"<B$"$"Ꮃ<B$2' %h<H%)% %P %`&Xl`2.<>Ꮃ<B$2' %h<<'+" % 'H",Cac` #de LPD'$$1%08de&(c%(,LPD'/$C8 $G3$C8 c$d!p,  !8  ( <z ,$ @C-

$G3% @D0'@D0'@B(  @ @D0'$@,D0'@D0'$@@%!@ &P# @$ 3} ,$%%$0%0$!0nj&@ !$3} }+= % 'd"4@ "#xD"T\$L%<FGH*-$nj "$ "dhlX'C  $nj "$njc{'$%<$ < , "B@%%"@%% $""Q=  %% @(",#$$" rL $(% <%B$$ L "0#4$8%$(, rL $( @D/$njcQ'8,HTP$C8 8H'8,HTP$C8 8H'' '!% *ƌ;$B 'Č<\$ < e <!$ $" C# CP D  P;`dde$ P$C8 ' '$XIX k%!X l&hJ%dL3} XL%(de,  .<F.<F `DH @40@cd c`T|-<?$njhS(,$ / X; cd$c(!ecB(%(%)%*%,%@! cp $#!%P$$,U-  <`$&0e%%% 8$'%!$7W!$B$a'''!$7W!$B$ D`,",B#@)O ''h'!$7W!$B$a,",VŽ%'''!$7W!$B$ `hP Bm@ > < <@c$& #%(%(%- D $"-<-<HL,'@P"T##   gHL,'-<-<HL,'-<-<HL,'HL,'  j@@C<D$8E+0d $<@YB$p @/  `@@C<D$8E+0d $<@YB$p @/Ꮃ<B$' ! $-<8 !8 !1!8 .<>Ꮃ<B$' !% $-<< !8 !1!8 .<>Ꮃ<B$' !%'+= % '$+4" @6$<Uc$$$+@t!($$$($g $8%  8 $e$0,1 8`$$0+P(E@,!XIe%%-< &C` -<  _  -< -<  %(%0( "B8@-< -< "C&a /  `D.8d8/B$c$(!$,+(8<08 $"!   T)$1 $+@($+@ $<`B$p  Txt)$!@ $$+@ $<`B$p  Txt)$!@7 `d.< Q!$!$*$P' $2Y `a/%$+(*%( 8+.B$P  ,LP% 0'@'!$7W!$B$!$$%*(7EF%80'@'!$ !$<>%&HL $Hp$%%00'!$7W!$B$A!/!$0'  $P$(,<>%%0'D'!$ !$048XD\<`@ vÎ'0'D'!$7W!$B$ `H'< !$ | += %j '6 ''+" % xx'^ <`B$`d` `d0 04d%(%%  x* <<`ń$X\X 0 04\%0% %( x* |x8< 0<$ sH 8<%(%0|x(H%8 ','$(H,h ,*A <  + tp4`d0<$  sH % %D$T @!8 |x8 , + "00$+(E$$+($E8 $+0 F8b+F8"0 @"0@b%+@l04E04h+8$$+8$8 $+@ 8p+88E0pE0pp%@+@%8rt $m  PTP "C0 B0@c4T %%%%%% @L< $ H 6Ž @@@ '+= % '8%D$$% *(%P %,X(!(!(0$+(bL%(+0EE$$#E!H#Pe#P W $(!(+@,(0 <`!$p  (0,,(0!G  (8A,A/@B<>@,.02.`<>@B$&(*)0,% d  L dd$+(Ay$#0A#8?$8'=D!H(!(p+8ii+8!c#8a#8?$8'h!8'*P@%@&0 H  D$pdHh<>@B468:6!0'$$4 ,^ $t`'t`'% $G P!PD   KLMH%8$ (,@!@ +P@ ,@ $%G $G % _ % W _ += % '$+(A$#0A#8?$8'9!(4!((0+Hb +HA{ #a#$a!*8%@&0e"  $+8ba+A\` #8?$8!g*8%@&0e  8:<>(`c$f$ ,`!$"#$%'% $G 8!8ȄɄʄƄ%($ &,0!0ǐ+8g , $%G $G _ O _ W _ += % ' d%$+(A0d$#A#(/$%! $8 "B$"" D,!"D$%(%!$ !$DCB$'% $G _ += % '( #,-`$w ! %$+0A!c$#A# '$$!a ,8 C$% %!$ !$aAD '_ $G += % '( $,/$(!(!00$+0b%+(A$#a#A#(/$%! 6 , '_ O $G += % '(,0 4<T6!(7I<$4(!(<T6!()#( $0p?a`0#$D$#(/0(!( $dp #ac$8 "8@,C,`0c$B$# '0(!  '!$ !$A '4   8:<>'+= % '8'>'!$ !$A '4   8:<>'+= % '('.'!$ !$a % 4+($''!$ !$A$c0`A0 A0!0(*,.'%K%,a,>4 ''!$ !$!$ -,2?0!d$0K&,@!0%ƐFF0%840J,K, c$a0K#,'`!%!0 (*,.' (*,.'$)'K$G K$G K$G += % ' d b$+(A4c-<#a#A#(/$! 4 (,'b$+ A-<c#A# '$!a 3  (,'_ _ += % ' d b$+(A4c-<#a#A#(/$! e  (,'b$+ A-<c#A# '$!a j  (,'_ _ += % 'd@ b +(Ac#A#a#(/$!D(,$,(%8% ,8,$+ % , 8$,%  6 <$'b + ADc#A# '$!aC(6`#d,2$e8%c,c8e,$+"`%d, c8`#c,%`7 B8@$'$'$'_ _ += % 'ld"C$$* d/@B<>@lTVXZ㤔/:@@BDF02465c0c,%`> "$d%% l@p@/ e,(!(%(*,.$+0#0#8?$8()!H )1!8G+P|@+P(u@*$#H(#X#X _ $@ !@H*P&@%H&0P\  dPH$\  $+(dN%h'x'!$ !$a`pTtXxh''x'!$7W!$B$L@BDF "$& AL!dT+A `X#a#Alp#$A`!A/=1$%.8A.83+X`$#p#x$xO!Xo*x%@&p+  K$<! 0+ $% @BDF024650$%$8h/@BA0$%$8$8 V++ a% q/<!ef0+`$%`@BDF02465c0$%#8 `#8j`/ "$d%% c$! $%*(e? e,Y(!(%(*,.$+0G#0#8?$8()!H )1!8G+P7@+P(0@*$#H(#X#X _ $@ !@H*P&@%H&0\X`  d\X$`  $+d '%O %% _ % %O %%_ % $G '@'P'!$7W!$B$8:<> "$& X  \`dT'X'+" % '4'D'!$ !$a0<4@8D-=09QR\! %(f&  %$`'`'$*0]l+8<h!0Ɛ,QX`'\%\%X`' $`'X$`'@BA?!0 > %%$'0!@E+Hh +Hz #HO $H"!H8*J9 @+k9`+k9`$  @%8%8$-  < /!$ <@|B$"/<` c$#$(,/!$ <@|B$"/<` B$"$4b8b/$C.<>8'H'!$ !$a<w<c4@$D-< H/#<1c$#.<>'+= % '<!$ $ ǐ  <B$'  $"/#$'+= % ' $  $<c$'   $"/ $".<>('+= % '<`!$ $ ǐ <`B$#'+= % 'T"B82@"Chc8-`Ctc8)`Ctc8%`Cpc8!`BsB8@XCc8`BChc8`Ctc8`Ctc8 `BpB8@dhP'`.@0v  Tc`HLm ('<!$$H LH $ $dhP'\dhP'+= % 'D d a H @ Yde-<-<H 'L'\'!$7W!$B$X ,&`$D C`8"Ep  D CBcH  `8`dhl@'(0`dhl@'4<"H <!$4B$@D+= % 'P'`'!$ !$ALCD*(+ c,$d%8`j 4'''!$7W!$B$aL"!%'% 4'D'!$7W!$B$| 4' '0'!$7W!$B$aP'4'D'!$7W!$B$aH'H'T'+" % '04 dhd! a $b !   ( \ ,'$,';<*6&W`06&W @<@qB$&"@$,' !$ <B$%%B @ !8 <"!$$ V  ,'$,''+" % ll'@'''!$7W!$B$aD@<$0@@'%@  !$%<6!W<6+ W!HL%" ?<6$ <N!$ JÎ$B! `'+= % 'L" ,H C`%L"< B$$ ݂ +H%,` L"0 w A%0<n!$ /#8`An!84 Ao!80 An!8, Ae!8( $HA$%!8 As!8 At!8 Ar!8 Ai!8 Ac!8 At!8 $HA$$HA%4XH$HA%4XH|<]B$$ V  <<b/`C8`B8@@'&C@ 'd$+0Dt $<`B$p  ttp!< !$$  pttC88`@'&C@'d$+0Dt $<`B$p  ttp!<'1!$$  tp:B87@@'&C@'d$+0Dt $<`B$p  ttp!<!$$  ptL!6  '&" D' C$+(#t $<`B$p  ttp!Ꮃ<B$,   "!04(' $, } <`B$ $Ꮃ<B$,' Y  "!04(',<`B$ )< yB$!A$< j!$$ ' $g 04('$"!0&"!, += % '<5!$ <>B$ $  $(,  ]$  " #+ C$!#C###$a! m $<%!$04 '%_ += % 'I.3.<>⎳<c$3' Y  "!<`!$<.)< yB$!A@< j!$$<' $g T  J TᎳ< B$I' !<B$2' " @!T  !<@$8A1  } < B$<@<@j!$T<$ $<'$g /$4 += % '@DH4 a,R 8<, $ 4 0C,<`B$$+"5`Ꮃ<`B$7' ! !$!$ <!$'| HL<@rB$PT$'8<1LB$$ $<%!$$ <!$'| HL<@rB$PT$'%W += % '48< @DH $ (,LP0'+= % '48< @DHLP T$ ( ,X\0'4   X\0'+= % '@ <$7@<<XC`X!`$* XDT%(%0-%0<`G$ ,04"#$ """ "<!C/<: $PATD+/B$!$ DHLP '4c$t$<'|.<$@$ p' (4,cc`$dhl<{!$`'| <qB$# '<!$,# '<!$<q!$<!$# '<!$,<q!$<!$# '/< (`LPC`cBLPp''!$ !$AK< B$p$x!$$ ' $g 04('+= % '<@!$a 7 /B$$ 9 HU =.<$?&6A .<(?&6 .<,?&6 H' (HU !v!$$' $g  $& $&%C7@48<@$"(#u  @"5@<"B8$@$L$PTX<{!$L'| hB$$ <qB$! '`<at<@oB$ d/Ꮃ<B$ "! ( $ j $48'L'!$ !$,  j @'''!$7W!$B$a`d%'% @'P'!$7W!$B$| @' '0'!$7W!$B$aX\$!'%@'P'!$7W!$B$ `8ptl+(A]X\(#0a#8A#@G$@(!@  8!A84<p*0E %.<`D. `0$*0X4LP ,+ @T0 @4`cX/< 㒐`; /<  @!<4!$%$ q '8 <'-m <'+= % ' 74"$4#$% $%0W%0F w M<|B$'$P"  '-m '+= %j ' "'C'""W$7B$@ '+= % 't#|W4C$4D$%($%8w%8g,w |,M !$+A`Hc!8) |X$$0<@X"B } <9B$<@ (,0''+" % XX'"@#  $( 8<T )  % 0""@<~!$ <"/B$ $ '$*(^!($0$+0 $<$!@ %)1+8 %10&(W$*(@!($0$+0 $<' $!@ %)1+8 %01&( d8 %($*0!0Ɛ$0$+8 $<$!H)*%J1+@  )%0(1&0e8 %($*0!0Ɛ$0$+8 $Ꮃ<B$   "!(,  } <`B$(,< !$$(' $g (, `.<0?`C`c% `b% @  8d!8 A 6 A('Ri @''A$tC$P% 7% $w `@A ~ `!d t"W$7B$@P <q!$<|!$x'x'A㎳<$   "!@D  } <`B$@D< !$$@' $g ⎳<c$   "!PT( } <`B$PT< !$$P' $g <9c$$ H 8 ,$ 0@DHL<{!$@'| <<qB$S% <"$4$@,D H0L<{c$@'| <LB$4<qB$  dhX'dhX'+= % '<@!$a <<@wB$ hh$ W  p74"$@4#$4% $%0W%0Fw pt"<`c$h Y  @"W$7B$@4 pt"<`c$h  7/  h" #!8( 1z L4PTX\8( !$ "    *@8PC` /!$!$ DHH  @ "2@$""C B c''!$ !$ `<[B$ O!$(8,('0$'"@$##d c '.<O!$.<O$!$7W!$B$ '0 4'A 8C`BC B c''!$ !$A `'0Ž @4'-m 4'+= %j ' "'C'"7"$Cw$Wc$`!$ '+= % '"VŽ @!78!$! "$$%DW! 9$\>;<Ĵ6& & % %8$%8? de-%0n< 6+w!$!a %%  X ,@6 LPT D'D' D "H @8,$e V 3 ,`  #8`%( !8 <љ!$,$0 ',0 'G %G _ += % '$ "(7@ CD"%D$%D&%*#" a0 -<@!8 -<@C$$ V  ( $04'04'04'!$*0$0 &8"$+0b1+0A,-<@#8a#8?$8!88-<@$ V  ( `hdl'' '!$7W!$B$ '.!$(!$, 'B$"!$$ !$$ $*A'@$*A@!8 <$!$ $ <$!$$ !8 <!$ $ < !$ $ $*A@!8 <>!$$ < !$$ !8 <|!$$ !$$ "8 @!8 !$ $ $*A'@$*A@!8 @$"$ "8@" @, 0 /@bAB8:@bRB86@bCB82@bHB8#@,D8B8&@<]!$$ V   <۷!$$ V  l" !+'$''''+" % XX'!$$ !$$ ' $g `dX''+" % '37S<8B$"$B@"$' C`D  /@ d <t$a  @t<   /@ d 8p$a  @p8   L/ !L -< &A@`D|-< _  D`|'L{D 2 hA %C<N!$ 3 ' !,!8h-  A $C ! hAB ;x  n 0<@Z!$ S<<8B$"/@bpB8:@bsB86@(C,B<  1 < ' J  @`%L'x'!$ !$A< B$L'  %1  B< @ -m '(",!@C ` !  %$'H'!$ !$$,<ɜ$(40$$BT@AC|<@e$  /`Cpc86`BsB8.@"B8&@"Chc8`Ctc8`Ctc8 `BpB8@%%+'#  % % '8'!$ !$ $EF(,04B8'+= % '$" !k  D%($,%<  -< &A@$0 -<  _  $8QA$ 0$ 08TEXF#8TG+(?#0#(XEHLP4'W D += % '7|"$|#$% $%0W%0F w !D$W$  + '+= % ' $( 7|"$|#$% $%0W%0F w R`CRc87`BIB80@"@B%$@" Cc8`BB*B8@"B8@%  !<!$$ V %%% %%%% $,"$0"$@"-m '-m ' HDHap!%@/'$'Ll'|'!$7W!$B$0%<$8*@+@w@p! T*$l'!$7W!$B$A$+X,d`0P%!iL#$HX'!$7W!$B$aĎ'l'|'!$7W!$B$'X'h'!$7W!$B$ ,1al'TP!$7W!$B$a/`$@(q!8/⎳<c$#' Y  "!<`!$$")< yB$!A(< j!$$$' $g 48,'t += % ' "'C'" ! $"!0&"!,'t += % ' "'C'"  "#!  't += % ' "('C'"( "#!  \ ,0$'t += % ' "0'C'"03 ! .<>⎳<c$   "!$(  } <`B$$(!$$$' $g 48,'t += % ' "8'C'"8- "! $(,0| !8 $<љB$%%%G G %_ t += % ' " 'C'"  $(, 0  48't += % ' "'C'"9  +A2`#a#$#!#AC$!$ %c% $+( 8 d$0 $+ c$c0$+`%%$@d%&$'+@#(0, $<`B$p 4/@d%&$'+@#(0, $<`B$p 4/ a8 y  + 'x|<#!$L'| <#B$x|S!$$H' $2Y (@< c$ </S!$$D' $2Y (@< c$ </S!$$p' $2Y 0H< c$ D/ Pc$T+(%8 $<|B$p  $(p$!(/ $#"$*((+ a   /> '%W += % '" B8@('@ " @$!Cc$bbp #d*`-<0g-<4g-<8g !C!$"l> ''!$$ $ #"l> ' 80",!0b-< g-<$g-<(g /> 8,H4' J%!$,*`(0L(M$  1-<@g- 8D,  $0($P*`,L!bB > 8D,  $0k1,`(!+Xbn`+XFh`, #f#$!# /> 8P"*b@L" !DB$ > 8,0P*X+`L!bB > 8D,  $0((!+Xb'`+XF!`, #f#$!# /> 8,%8D  $0%X%0S%_ W %_ W %_ W %G += % '@Pd8LDH%$*@mDb+@@h $P'q!@ %*@, > @C,L8%8$] $H1%4THPI)%LK+` #0( $< B$p @T/ P<'$% *H DI+P@@I $XDq!H++k%*X`)Xp!H++L!`l*hl%``#`%@W %% G %G += % '<d;84a!$4a(>8%8"$b,a+ A# d(e#(#A#07$&! 2: 4"!b4"$#,##c0`B$4"%$a,a<`'_ += % '8'!$p >@ $Hd8 DF8l8u8s8h8 <> $ HDD< $&(E"!@b/ 4'G "d& @b$&D@b!&A!8  += % '+" `!d +("!"d/.!$$ V %%/< B$3$ '$bo @\'4`"H$(| } < B$|H( d;4d0e$,f+8!l8 $''!$ !$A < J%'@<!$%%P&" % _ p $TA !8!,p $#TA !8 p$p p $"; p$p p1   ' # p '   @ $''TA !8 pT" @!8 %p )   '  < !$ $ tp N tW'pT" @!8! \`p "%\` 7/@\"82@,0   ( '  <!$$ H 48$'(  48$'%0B%8D%8F%8%0<6$0%0%%%*E`+E`!c%0, )<$!cH`C$)<$!c%88eg0!@*HX c0@I$( <`?J%!C+X%k`k!H)+X+?`c+i;`8`C$+HeV !dcc$c0? $+#$`8 `C$+8eC!dcc$c0+#`)<$%!"$ '!"$ '!"$ '!"$ '!"# '!"$ ' '%%G %%G % %G %%G $B$G(1%8)<%! !A$ '+= % '{ d%(,%) c8`H I ( $,LPTX\8'04A<`c$0)< yc$!#4$H d$0p! &!0Č%$"b+0(f8p!0Ȑ $Ƞb+0a!  " + b'%G %G %G G += % ',d$/ `d$d<`!$$$  $,b$d/,'%'<'!$7W!$B$p'l$h @iB8:@nB86@eB82@$ B8*@$,``%'''!$7W!$B$048  <@DHǐ$%:L ' '''!$7W!$B$a<'''!$7W!$B$a T`X\d ' $%% j{x$|'%P%!$7W!$B$! %tp  tpxj |$ '''!$7W!$B$a<=@DHLP `"`\X$T+0d $<`B$p  $!0 $Ǡx $%%(%d '$ $%% % xkt$%P|'%X%!$7W!$B$! %l  tlxkj "@`$+H  $<`B$p  xj$!Hi $* $%$+` $<`B$p  txkj$' $2Y '| `L PT: $ (04DǐHCd8c8`$ 04 LPT @ 04X\@'X\@'X\@'8<A } <`B$8<  $Ď  $ C `( '   @ 8A  / $08($,<@ , @  PT8'@" $*bp`$*b-`C8`B8@<( ,$/1 PT8'<( ,$. PT8'C8*` B8@<( ,$4 PT8'<( ,$75 PT8'<( ,$9 PT8' $*b*` B8@<( ,$ 6 PT8'<( ,$2 PT8' C8-`C8`B8:@<( ,$)2 PT8'<( ,$3 PT8'<( ,$`3 PT8'04! } <`B$04  $ : ,. (  $ @ 8"@/ "0@<B$  sH %%,A  RO   @  x*  |` : ,0 (  $||  x*  |@ ` '0 '+= % ',"0$+b `C$$+`C8 ``$+b `C8`(C+C8Q`"0@(;"0@(C(%+/` #0`<c$$ $ sH %% ,a  RO $(, @ ,($ x* 048 '<@}!$ $"$ '+= % 'H.% !8& "!B8!@"!B8@"nB8@"uB8@"lB8@!l!8 LXP\T`de@'LPTd08(Ce07f0F%0. 80<$  sH %(%, @ RO 08 @ 08  x* (e054, +  $m < @-<_c$dFd%@ `-<_B$Df@(`,4(DH qQ ,X4\`$de@'X\`de@'DH Q ,X4\`$de@'$88$!8&H $3} <㌬$88$!8&H $$3} <$%%+= % '@.% !8! "!B8@"!B8@"nB8@"uB8@"lB8 @!l!8 \`d8'PHDLT  + 4!$(E$(4&$\`d8' x* 4($0800H%@0, <$  sH %8,  RO ,0 @ 0, '+" % pp'(d$(d0d,d$,d,dd$* p(d$*(k<!4*$ ?<B4zŏ<-6&0<˥$& v"!]   B $'Y<-6&(Y<ͥ$& T"! B $'֙xd8.B$3$' $g C D$E+@d! $$!! !8  :m  0"B$" 4'  ,m   "@$"$ #c$#"$4'4'G '+" % HH'7#$0'!$7W!$B$aldhe$df+8 $<`i!$p l/$'("&/(t!(|x$+(b1x\A$+(")X!!T`\"$+b \$8,'8,'8,'8,'8,'W G W G `j G += % 'o A  5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ8!$+0"$!$!!8 $Ta $Ta$ ' ' 'G G += % 'o A  5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ 8!$+0"$!$! !8 $Ta$Ta$ ' ' 'G G += % 'hbpa+ "pdd$(p!0ƀ%8$*80"8@aI!8S a bd!Dd!c!b: '08#0A(!$+0"=$!!!8 bd!Dc!b ' 8!#0A(!$+0"$!! !8 bd!Dc!b$*A!8 ' ' 'G G G += % '"@"B,%@dd$",$"/$$'$  1 ( '( '( '$( '#$ i  $" @#$   $( '( '( '+= % ' "%$*,`B0C8`B8_@"#$% 8 $'"#$% 8 $'B0C8%`C8` B81@"#$ ӓ $'"#$  $'"#$% 8 $'8" ?8 %x$S@8N]$+ [8]8 B`8&0$+89$$5%?$+,$+ #8;%%%,';! :';%x$?';]$+8 ['; ]'; {';}';$8'%%8 8$>0<&$ !#" I/  <d$+ DDL<D$LPH0! "$#&'%8%%D/%, :4 $&HI)-%`%p.%x%H%@  :8 :5: $+ !@9):L$+Ȃ !;$+~`!cc8`DD4n 0$+e!@9'%@*2@ $*2J9@ $*2J9@ $ *2J9@ $%P!XF&Xbk-%hm%0 $ $T%H%@ Pj$bbbb``````` @```@`@`` ```T@'%G %G %G %G %G %G %G += % ' / <I$*H 8 %+@"%!! !8/    0+"`,! a0$08$08$ 08$% !   'm  0,$ *94@ *91@*9 @ %+XB`!PJJ9%@*9B@ %+`b!h9 %+x!pΑ9.@*%+P@!@9! '9 :m Z 04,(  'vn F ($2  M 04,(8 +8"g!$!'!8 '$m 2 04,(  'm  (`%%,% 0 <$'<$'<$'<$'<$'<$'<$''$'$   ( $<$'<$'G %G % G %G % G % G G G %G += % '"$4'$ $  (%H0'(<* CC8@ I/  4Ld<8 (<+ "8!($+(@8$+("8 $+08$$$(+8u!8 8 88 $+Hc !@98"$+P"T@!Xkk9 `$+hH!`9<@ `$+H3 !@9"8\8 8,eDRO iHj*HIJ HI$*0D  (a$<+"`8! # 8 4\$m  <8(+ "! #0$08$08$ 08$% !( @('m V <8 @('m K <8,!,$$$<48$(+8!8琀00$090$090$ 090$%@%8 $< !(\$m :  $*AV`$* a$ $8 $84b$m 4a$m 40$m  $*( !8 4t$m 4n$m  !8 4v$m 4f$m \$* a5$*( %8 %8N4e$m 4r$m w"%8 \%864\$m h4"$m _$*(%8 %84_$m L4N$m C( %89) %8-$$$*(4*0 4u$m $4U$m $ 4x$m $B$ 4h4P$m 4L$m M <8%H0'H0'H0'H0'"$4'$   4 $H0'H0'!PJY?J1)%!8j*P(@!P&+XB`-H0'H0'$$ 4 @$ A,$ C"0!0 B, @0!$m 7!$m % G %G G G %G % G % G % G %G %G %%G %G %%G G += % ',W (d 8? 89 838 $+(ABe8-$8>+(A2f8 $+@&h9$*&+ d8$$$$D#0c$'   ,$($%$4 '$+0!0eƐ08 84 818 $+@!8g琅8%8-$+@!Hg))9 $+XA`!PjJJ9@ $+8!0fƐ8 $%+$$-$ '   $4 '4 '$+0Z!0eƐ08 84 818 $+@C!8g琅8%8($+@3!Hg))9 $+XA&`!PjJJ9@ $+0!e!!8 +$$$%%G %%G %% G %%G %%G %%G %%G %%G %% G %%G %%G %%G %%G %G %%G %G %G %%G += % '|$('$ $ ) (,0 4  (  $( 40,$8$'8$'8$'40,$( *@v+@!@ 94  91  9 $+P"u@!H))9% 91$+P"f@!Xkk9 `$+hZ!`9N@`$+@E!8琩8  'vn ! ($   0(4,  'm  (`%8$'8$'8$'8$'%G % G % G % G % G %G += % '>$('$ $ ) (,0 4  (  $( 0,$$8$'8$'8$'$%0, *@+@!@ 94  91  9 $+P"y@!H))9%  9- $+XBj`!`9 $+p^!h9 R`$+HI !8琩8   9%0 |  0+"`,! # 8$ 8,$,%(F +8o!8 8=$+8c!0Ɛ 84H*0/ =  0+"L`,! #0$08$08$ 08$% !  4 'm  0,(%(:8$'8$'8$'8$'G %G %G G  4 'vn  0,($ 8$'!0+8!8%@ 94  91  9 $+P"o@!H))9% 9@$+P"`@!Xkk9 `$+hT!`9,H@(`$+H? !@90$09$09$08$%84 /  (:m  0(,x8$'%G % G % G % G % G %G %G % G % G % G % G %G += % ' 40,(%%40,%( *@+@!@ 94  91  9 $+P$@!H))9% 92$+P$@!Xkk9 `$+h!`9@`$+@!8琩8  'vn I ($%  J 40,(#@ +8$Y!%!#!8 #$m  $ ( $m !8 40,(  'm  (`%$j8$'8$'8$'8$' :m  ($8$'8$'%G %%G % %G % %G % %G % %G %%G += % 'C*`C`$CCDC0A$/ x* |t  /8|t n 88z|t & |t t ' A E "  "C0 B0@c4%%%|t  '$`' $g  `Cfc86`8Y$*`CYc8 `DE8DS8$&`Cec8"`Csc8`Cod8 Df8Df8 yc8 `Cec8 `Csc8`$%c8%%% %% "8@!@ 9&@$!H) )9 #H# )%$di# '$$ ! / 4$(|xtpl,%p%x % `dX%H%P\T% %`%( %h%8% %X%0J 4h(0,@PHL`d0@%<% %H%P<,'<,'0(E$+0($!( ,($+(b(%' '!$ !$a$C EFCEF C$E(F4W/ $EpB$0e!EEFB4d$ '!$h $$h/d8; c88`,"(#c$$$+(C $< !$p ,/d8; c88`,"(#c$$$+(C $< !$p ,/ $pB$0!EFB4# '!$$$/d8; c88`,"(#c$$$+(C $< !$p ,/ #d8? c8<`,"(#c$$$+(C $< !$p ,/@b+h"x<n$q!pЍ& %8t V 0,LXTPH+$%8@ $k $m/|  0  X` *@\T#@#@G$@#8!P *X`%8    ``#(&8`%(\X$ $'$$'%d*86 xp&8Mh   BP jPPP\#+ b%X"$'T!8$*8X+8\+e X$$'%W %G W d%dxp&8A|l#HA8@@+8"!8琀0@$0k9`$ 0k9`$0k9`$*H# @00)9 00)9 0 0)9 0%8 $$ $+Pj@*)x@8+PJ1!PA+XB`,0!8!XH+`k!`b !Xl1܍9$،9))V I%+P"@$!H(+P@)!8:!809h1B0!8H!$4$ <ٻ!$$ $<!$($, 04  !@"T#0#07$0!0+8h0, <`B$p  $,0,(0!  8`"$!C`"% ,(0!$!$d!$dHLP4'%%_ %%W %%G %G %W 8f  t-m l''8"8\e /  pCpXb`a+ "qTd! -87?84:81,8.[8+]8({8%}8"#8&8*8!8|8>8'8 "8 %8@8`8cXb`a+ ".Td!(-8 &$+8!!0Ɛ 8 8Lf?8:8\e !$/ !8p%%0 abd$e!$$e/"$,(p$!EE FB$'$$'/ biJ$%B%d''!$ !$ $dhlptx|d'''!$7W!$B$$' G bA$+ "3 e! dde$+(#$'J%%8% @+XB`T $`Kq!`,$*   %&h% %W G % G '+" % HH'$bde$f+8 $< !$p / HXb`a+ "Td! $ 8= 8:$a$$a/!8/ $a$$a/08 @%d* d!$%3$"$$"/8"'$+@n!H))9 *$+XBb`!PJJ9)@V !$+0"N! 8* d"@$  '%P@X$`%+0$T&!8 86 83 8 $+P$@!H))9' 8" $+XD`!`9 $+p!h9 ` $+P$@!H))9 4 818 $+H !@9%8<$+H !PJJ9 @$+`d!Xkk9`( $@$+8! 8d$( $ ~ P@'$%&DHL< `$!<<tx|<'t' plhD'f  dd $ %%%(%0%8%@%HB''$"$$"/ $+P5@!BB8@  3 dXT$  TX'''%G % G %G % G % G %G %G % % G %%G %%G % %G %%G %%G % %G % %G % %G % %G % %G %%G G %G % G %G %G G %%G %G %G %G += % '(def@,% (efh@, %  de$  (,@f*@&%% *@% Xb`a+@"Th!@ 9Xb`a+@"Th!H) *94@ *91@*9 @*$+XB`!P JJ9%@)9 *$+XB`!` 9 -$+p!h9 `!$+H" !(!!8  da!( $ | (0"$%   0/@$#+ b@Ď%  '  !  <c$ $ H $$/$ '+= % 'LPpt]< !$@p'D@'L$<`B$ .$ ''+" % ||'|]$ ''+" % \\']$ '+= % ''!$p   !(e8%8%&$+8/!@f9 )$+P"#@!Hi))9  !$+("!a!!8 $, 'G %G % G %G %G G += % ' ",'C'",0 !%@%-<_*C`<B$ !0)< yB$!A$<*(!$$ ' $g -<_ !dab04('t += % ' "'C'" ! 't += % ' " 'C'"  "#! $(  ,'t += % ' "'C'"7 "+ b/$ $p!df+8"$p!$"$%ghb/".<>'+= % ' $,0 <c4+b,`x<6&W`<6&W@  +A< c$ T # "!'  !8 Ai!8 Cnc8 `Ctc8 `C1c8`C6c8%` Cnc8 `Ctc8 `C3c8`C2c8` An!8 At!8 A6!8 A4!8 h!    !8 Ai!8 Cnc8 `Ctc8 `C1c8`C6c8%` Cnc8 `Ctc8 `C3c8`C2c8` An!8 At!8 A6!8 A4!8 d!    @H(t"#d8 $ A$+"`,D!bDB7 \0DX,*<c$  ("/ !%<B$ ǐ /".<>.<> !%<B$ ǐ /".<>'+= % '< !$$  ".<> '+= % '0'@'!$ !$Aj '''!$7W!$B$a0''('!$7W!$B$a,'+= % '"p '+= % ' <B$&" @ <B$'<<!$ D| += % '.<,@ `-<`xB$ <`B$&"e`|d lHÎ'''!$7W!$B$<$ `<`B$|ld DᎳ<B$4' Y "!,`4{ (< )< y$! $(,<`ʄ$ $ Ꮃ<B$4' Y "!,`4 (< )< y$! $(,<`ʄ$ $  $+## a8 @-<08c$dF   a8 a8l c@-< 8c$dF8%%a8$ a8 H"  @l" @%%h"  @%%$+ ad8Lc8``*(,*8;<6+@w9$0%0%(%%&(0;<!4 { ;<c4a<((#(+ bp<!f0##da!$C$$,;<6!(!d%'w<6!(7F$w<6+8!0x''!$ !$x|-< ㎈T'x''!$7W!$B$a<$&(`.<Ą$& %X<$(T@ @0/% @(' $7%(<6!0+(! \`T?<6$ TXdx'T'd'!$7W!$B$aPd 'x''!$7W!$B$ m*(,*8;<6+@w9$0%0%(%%&$,;<!4 { ;<c4a<$(#(+ bp<!f,##da!$C$$,;<6!(!d%'w<6!(7F$w<6+8!0@'P'!$ !$@DHL-< Px'@'P'!$7W!$B$aPd 'x''!$7W!$B$ %%x''!$ !$a< $&(#$x'!$7W!$B$aPd 'x''!$7W!$B$ %%]L"  @%%K$+#& a8 `"  @%%2\"  @%%"a8 X"  @%%d"  @%%4 4hpt <!$z| < !$ | < !$ | < !$ | < !$ | $88$!8&H $l3} %l⌴Dd  < !$z| $88$!8&H $l3} %l⌴ d  <` !$z| += % '$H&"k  D&Aa@@ V W $$+A @D $+A0@!8 ;"8"@8 I@0$@DH L @!4"#$!(d&+8E, <`!$p  ,$8,(!0  ,4A(A/ `(4Ld$r!0Ɛ,$+@  8h,8e :8`[8]{8Z$+@ < $<`B$p </$%6D860D8P8A8 N8 I8C8d8p8a8n8i8 c8$%$0%(_8  $*aT`: !8K AW$*a" AI#8 `CNc8 `CFc8`COc8"`W!83 AA!8/ AR!8+ AN!8& %Ai#8`Cnc8 `Cfc8 `Coc8`, w!8 Aa!8  Ar!8 An!8 $,A#8`AP$*aW`E$*a* AD#8`CEc8 `CBc8 `CUc8`CGc8W`E!8 AR!8 AR!8 AO!8 AR!8\ AF#8`CAc8 `CTc8 `CAc8`CLc8_`P!8 AA!8 AN!8 AI!8 AC!8d e$*a2 Ad#8`Cec8`Cbc8`Cuc8 `Cgc8`$,Ae!8 Ar!8{ Ar!8w Ao!8s Ar!8o $,AgAf#8`Cac8`Ctc8`Cac8 `Clc8`$,ANp!8N Aa!8J An!8F Ai!8B Ac!8> $,A6!86 AD#8`CPc8`CAc8 `CNc8 `CIc8`CCc8`d!8 Ap!8 Aa!8 An!8 Ai!8 Ac!8 $,A$% <@(' $048 ݋ 4'`'!$ !$a<c$4'  "4'Ǖ 4 !!8B"#{  ")< y$!dhlpt<`ʥ$hl (0<$#'  ("/$,<$#'  $"/#<Kc$#.<><;<B4 { ;<c4#  #(+08Cp !8<#8#0!$F$',#(d!'w<6!07G$w<6+@!8$'4'!$ !$$(,0-< 4/"a.<>㮪 H<B$ /".<>X'$@G $@ q$!@  &XA`B$@~ 8D -<2B$E$88$!8&H $3} 830<6!$z| '+" % ,,'p''8'!$7W!$B$a`<c$$'p''!$7W!$B$a$h l<$<@DH'+= % ''t''!$7W!$B$ah l<$p'+= % '<!$   ⎳< c$  ! vÎ'''!$7W!$B$ `hplt {Î `' <4+ 3<~6& wR<0$& $v ''!$ !$a #d''!$ !$dh$lpt'd''!$7W!$B$ad''!$ !$adh$l'd''!$7W!$B$a'''!$7W!$B$a'8<6& w0<$& $ "#! ݋ %''!$ !$a$<6& w <ʄ$& $ c'''!$ !$ $'''!$7W!$B$a'C<44+ r@<6& wR<2$& $ ''!$ !$a #d''!$ !$dh $lpt'd''!$7W!$B$ad''!$ !$adh$l'd''!$7W!$B$a'''!$7W!$B$a'C<46& wl < ʄ$& $g c'''!$ !$$'''!$7W!$B$a'I<$& $9"#! ݋ %''!$ !$a$<4lᎤ'''!$7W!$B$a'#< 4+ <6& w-<̄$&($CB''!$ !$$u <$& $9"#! ݋ %''!$ !$a$ 7 `H0 @C-<3$G%dT<dhlpL4  '+= % ' "'C'"d de& b a+ " bt$#p!A 'G  '"@% "!&A!,"@! " #* C#C#C#!C+= % ' "'C'"< !$  bb/@D"Dd&H$He& %D5@L"Ld&P$Pe& %D,@T"Td&B8&@P"$Pb$$ V   "$$C$$ V   !$$!$$ V %('+= % '"#&E&e%C8@#&b %&%C/@L$L"$R & $ V  $"$$C$$ V  8!$8!$$ V % '+= % '"d&B8 @b$!$U ''+= % '"d&B8 @b$!$R ''+= % '<  ,     $a,4bp,!"  { G  `?<  ,$($ { G  ><  ,     $a,4bp,!"$bda!D+ D!C B%"a d0'0'$A (A"@" # "#&"* "+8c,$8% (*A+$C%A  &"* " +8c,$8% *A+$C%A $$$$$$$$$+A & C*(b,&8$0%(&8 +@(*(,9$0%($*C$$%" $$$$+= % ' $(,48u fg#@E#8#8?$8!0*8 %@ &8   ,4f+8 e!(E!&+!"D$H0'D$H0'DH0'%%W %_ %( += % '<@D e # -< &"@40-<  _  -< -< 04LPTX8'$,(<@$ $"("L,PTX8'+= % '4!$8+A`%080 $<`!$p  D$! $$, e  @DHLP('+= % '$"!?$+b$,c8$d`$ ?$+bc8$d`$?%0@0'%@%!$7W!$B$aR% $*"{@$+P@lSh $<`!$p  Shl| $$!PA)'%!$7W!$B$a=+8"s!+``T <`!$p  T`d`\!#$X)'  X\+A`d%%(d $<`!$p  d\X`!|%!$$  d\Xx'pt } < B$pt=? e `+({##C# '$! e f + A_#A##07$0?+@D&H+8)-$H(!0F%8!$+P'@ $<`B$p  %H $X !XKlm $+pl-9$p$+:$a%x[9+ $+x+,$x%x+(d$*xj'~'!$ !$~0+ * %%% j'&   $ $ $$~'P$%%%j'!$7W!$B$#r#$A#2!0?$>?9%  $+ 1:$x/ 9%`% $)$ $?=>$?z(88%@<@!$ "(@& C $  $#(/0!/%$+:$x9%xY $+h+x,$h%h+(d$*h U'i'!$ !$i0+*%%% U'&  $ $ $i'$e$%%%U'!$7W!$B$#q#$!#!0 $$?=$L9%x 9%x#d#$#D!0$ $$?=>0?,8h $+h+x,$h%hV<@w!$ }@+ bv$*(j%(@'T'!$ !$TG0+@Y*@G%%%@'&H   $T'('%8@'!$7W!$B$%('<'!$7W!$B$% #g#$#g!/%%? 9%-. ,8     #$#$#!0$ $ $$?=>{$? '   ## '$ #%!0$ $ $$?=>N-<)-<)'$' $2Y '-< -< 'u i!$7$' $2Y '-< -< '-< -< '%$_ %% _ % O W %%G $_ %%G $_ $%W %%G += % 'PTX e @d&" \$+A`d,B8$Dt@$+AB8$DW@"8%b@<@B!4(*<c4+b&p(!$$* %8,$%`$*<B4LDbHal"8%b*@,,$A L,%0&^04u @?$+%+,$#%" <@B!4(L b&p(!"$a\8<@Du !0b+8 <`!$p  %(% !'  LL"@ $e  LL0$D$%8'%@%!$7W!$B$)!$)%,! e LLd$F$'%!$7W!$B$'''!$7W!$B$ CDEF+A`% $<`!$p  !CDEFdehiLLd$'%@%!$7W!$B$$+0 $<`B$p  L%@$$!HTV *%Le$,$'!$7W!$B$'''!$7W!$B$ 3''''!$7W!$B$a+(%@%0 $<`B$p  !3'$  LL"WC$,B$% '%(%!$7W!$B$!$+ a $<`!$p  L%$$&$!0DFȠ L׀0$D$'!$7W!$B$+@d $<`!$p  L$!@L׀0$D$q'!$7W!$B$$+@!D+@a <`!$p  ! $$q'  LL"W+(, $<`!$p  ,%%% !EA$$  L%8%@%0P$%8%H  $  $(, $e  Le$4y$0%8'%@%!$7W!$B$ e  % \'%(40!$7W!$B$p$+0"!0b+8 <`!$p  %(% !\'  h L|C`c $e  L|$%8'%@%!$7W!$B$ e L|"C$ %8G'%!$7W!$B$a[$+b !F+` <`!$p  !G'  LLEF'8'@%8  $  $(,PB8"@.<(B@E%(('$'!$ !$a<sc$'  (TX\H'!  'Ǖ 6njGƌ e   e ! b+0$ <`!$p  % %O %O %O %O $_ W += % '<@D HLe P?$+ATd,B8$D@$ ?$+AB8$D@$?$+A* e,$%D@%>$*`d,%,$ %@%$$" bp !A(CD4!(+ 8!+(!%&(#*#,$%# $ A%@*B,<,8$%C@ !%D$'$D$'A A"# &(D*D+d,$%C@ ! += % '@ " d&$d$%& %5@("(d&,$,e& %,@0"0d&4$4e& %#@8"8d&<$<e& %D@@"@d&@D"Dd&H$He& % @ !$ a$$ V % '+= % 'd $"$d&D@("(d&D@,",d&Dz@0"0d& Du4$4e _ k 8"8d&B8c@<"<d&D@d@%& %Z@DbD$&HdH%& %Q@LbL$&PdP%& %H@T"Td&B8B@X"Xd&D\$\e& %9@`"`d&Dd$de& %0@h"hd&Dl$le& %'@p"pd&Dt$te& %D@x"xd&D|$|e& %D@"d&D$e& %D @"d&D@!b&"!,% '"d%& e&%D%@b$&D d %& %D@b$&B8@b$&Dd%& %D @b$&D@ b !&"!8  += % '$  @$8$''+" % pp'j \'''!$7W!$B$a `dha$xxd$H'!$7W!$B$LH<$8@(@8G%(@@/ $?%8<6!@+8!(PT%(?<6$($t|'x!$7W!$B$'|''!$7W!$B$a'\'l'!$7W!$B$aCq ,`'|"# B @: 4'xt!$7W!$B$a84<$(w@@%a@ !$%C<6!W+b!"<@%a ?<6$ |"#B '% ''!$7W!$B$N`#/%F@?<6$@PCTE%e9` C6`|A!$|AA!$AA $AA $A? ' '% ''!$7W!$B$)`%"8@e#8`e $c0$+`eX>T  e|a!$|aab ! 6 %  )< y$! $| } <`B$b/ "LVŽ|# @"B$"T@$"mXC8`$"eB8m@$  "CD'(`'0 %( e$&0+!&%fX`LH\GH)< yB$!A j '''!$7W!$B$a'''!$7W!$B$>3 P$t\dXe -<`a$ @3Hf0j '''!$7W!$B$a!DCHDLB@D %('%0''!$7W!$B$$(,048 Pt? '$PP J%!P K&`f$`3} PtEa!/`!$6$,' $g $<<`c$ $ " $"/%0GHB%8HD%8HF%8HIJ %@ IL %@(IN %@(IJR %H*JT %HIJV %HIJKZ %PKK\ %PjK^ %Pjlptx|%l''!$7W!$B$de*% e,% e.% ef2%(f4%(f6%(f g:%0 g<%0 c%$Ĭ(Ŭ,ì'3&u>?3&u? ss& s8!3<b&4!Da&xH@|t%%x@S(p`@3(m`HDP@<L apah iJ %@  iL %@( iN j kZ %PKk\ %PKk^ lmj %`ml %`mn noz%po|%po~pq%q%0qrs%Ss%rctu%u%uvx%x%xy |%< |%ș |  a %a %s% %(%0 %8K%@%H%P0%r%X%`%h<%p%pa%%q?%%q@%rA%rB%rC%r!%!F+%!t! +h!(m$hF%F'$Q%h-o !0+h!8%@%p% ]* h L P]* d |L P]* ` xD H]* \ tD H]* X pD H]* %"`%d` CDE FGH'%0:DN !"#$%&',LC ` '$ T* (' 8<@x|D'+= % '("!B,0 48<@D @$'+= % '! "!B @ ' "!C$d,! $( $#00$H$0P , P , H00 , 0%(7!8+0!0C@B87%0#8 $+P#X#Xj$ d % %k#XF#`(+hK#`k%+hc9k-!X&`d*X-$`%X`+8g@ <#Xe#Pj&XD*Pk-$8%8!i!+(#! E%!!+0F!&B$+0CB,!"&$*$B,$%A &+i*0!,B8$"%& #i#+a# C%+= % 'P"$p&,2:lN%8LT%HIR^%Pj$%&#')*($TX \$` d$h(t,x0|4> 8<@D-  a/4\D `@ $l ( ,4ptx3T X'4ptx3T X'(ptx3T X'%W W -m X'+= %j ' "'C'"ŽWB$ f<`B$"/!$  ""/  c@DH$'%%G += % 'X\` dhlpt k $(,8<0%0%8LHD@P4x | D@P%0%8LHT'+= % 'X %%\M <@D HLPT $`(l ,04dhl8'+= % '\C " !$ ""/?@<u ?8@DH(' $| ?@DH(' $| < B$ $<!$$ ' $2Y <>?@DH('"d&@b$&D @b$&D@ b !&"!,  "d&@b!&A!,  "d&@b!&A!,  "d&@b!&A!,  "d&@b!&A!,  += % ' "'C'" "#$! 't += % ' "'C'" "#$!\  't += % ' "('C'"( "!$ ɕ  ,./048$'t += % ' "'C'" "!  't += % ' " 'C'"  "!4 $&'(,0't += % ' "'C'" "!  't += % ' "('C'"( "! $ ɕ  ,./048$'t += % ' "'C'" "!  't += % ' "('C'"( "!@$ ɕ  ,./048$'t += % ' "'C'" "!  't += % ' "('C'"( !$$$ ɕ  ,./048$'t += % ' ",'C'", ! $ } <`B$ $<*!$$ ' $g 04('t += % ' "'C'" !ˌ   "#$(,'t += % ' "'C'" !   't += % ' " 'C'"  "! $&'(,0't += % ' "'C'" "!|  't += % ' "'C'" "!B4 't += % ' "'C'" "!  't += % ' "'C'" ! !4 't += % ' "'C'" !  't += % ' "'C'" $ 't += % ' "$'C'"$  @<t -<@TB$Ef%|D/'S'g'!$7W!$B$`<@!$a .<0G.<4G$! p'R'!$7W!$B$xd/@"8#@!8 $(DH4'8h"l!PB @<@[ DH4'8TX`$\<@ 3 DH4'DH4'DH4'$PiP J%!P K&`fc$`3} 8 C $PP J%!P K&`f$`3} 8E 7&" %<!$  CD#$vĎ<@$ 8"$ #$% P'%(%!$7W!$B$&A <!$ j d ePĬTŬO'+" % PP'<dd &8+ +(,$ % d5t''!$ !$tx|'''!$7W!$B$'''!$7W!$B$<c$ 't'!$7W!$B$ ' &H&P%P*G@+(+8)-$(%( &(% D'p'!$ !$DHL'''!$7W!$B$a'''!$7W!$B$&0fn<$ 'D'!$7W!$B$< [$'$ V . )!$'$ V C u  ,`0  c '$c ' '''!$7W!$B$aW ,cÎ `'-m '+= %j '! ! "B$ "@ '  3|' |'`|'_ += % 'h "$#l p l #v$ ' $2Y DH8'DH8' $(,<@w!$<| <@wB$ $4| <@wB$(,<9p!$8$ ' $2Y DH8''+" % ||'p"<#dc#$HEDF+8*@,$8'%8 &8,*@+H$8'%8%(%0&%#$/!(+!dC $*08,B(%e<ȥ4+($(%($<c4<%`&8*@,\+He$8'%8% %|#$P#T$<c `|("bbd$B%& @`"| d$e$D(E\"de 0 |"4@<@!$ X"|$%8%%!$7W!$B$HL%" /d%%\l@ D'p''!$7W!$B$ ,H0L4P-%8&g`\g!@+H?!8!8i+@(9O &P*8I-$@(%8v \\>\>@lH"L$B  @?` lH"L#B @P l"i & .@70 h'XPh'l\b$/ $$Kl9$ l9$k9`$hl8cTIXJ  $'%@''!$7W!$B$a $(,048<@DEHLP `4d8s8$ 8$8$$08\dY$Y  N#2`H$X$X'%8%!$7W!$B$\X<$H @0@HW%0F@PO %H*<6!P7+HI7 $!0&`d%0?<6$0f hYXxCc$xCHLB!  @' e 8 $$hl8ijklmn op$q(r,c'''!$7W!$B$ $(,048<@$DEHLP %%G &%%%Hƌ e;A$-$W'!$7W!$B$c de fghijklBmCn$o(c'W'k'!$7W!$B$ $(,048<@DEFHLP% '$*(e<pa!!!"8@$ "8@$!8  $V+(7$e /$<$ ;$<$%00,&($$ % &(,0D%!  &(,0D  !  <@zB$ (,0TX\'< @'-m @'+= %j 'P!Mf ''+" % 88'8d$d$;a-< -< -m '=d>dDd%%%(DaHb-m '$;a@a<0zB$-m '%%*0$@2p$f(f4g*0 \w @p2$f|z ](b4a*8A+8c#P#P W $P*#X!P+hAV,m#pA#h#h o $h-!0*h%p &X`<  2p@<4f!04f!0@=i halb!  $:$2%(&%@p4i(j*H* 8i cDaHb-m '-m '@%2pDf=f>fdf$Tg$%@t'%H%!$7W!$B$\'t''!$7W!$B$`\<$P@@P@0_%0@XW %PK<6!XW+Pj7 $!0dh%0?<6$0tj '''!$7W!$B$a'''!$7W!$B$a't''!$7W!$B$aq ,> 9 $a $%8Da $%1$>a;b@=b@%&9ad<a$ ;d<a$%d$w$   @ab !d e <@zB$   halb ! "#B$ ! @'+= % '%$$% w7% dw $( y $<d% d e' ?<6&(% % >d$<d$ ;d$<d$% e$w$  $halb ! $"#B$ ! @,0 '+= % '8" #4hl$'(!H,+"G!!C(  S 8"@,4b( b4>b>@d$<d$ ;d$<d$% e$w$  $ ab!d c ,0 '+= % ' D"b@h"l#$B$ $ @K $"#  =<@hl ! >",@$="@"C BD8 4& b*b0+a,$a%A! ,dNabB$$db#B0!"/@"C BD8 4& b*b0+a,$a%A! ,dNa bB$$d b#B0!"/@0"CBD, (& b$+*b,$a%A!  4d)0a8bB$$4d8b#B0!"/ <`!$ X"/$ $ @p! 6x|/$ $ l'T'+" % '(_|0w8a$$Hd$|'!$7W!$B$<$(|@8@0/%(@0?%0<6!0<6+8/ $!(%( |?<6$(% K'$!$7W!$B$'@'P'!$7W!$B$a'''!$7W!$B$Cq ,'`'@'P'!$7W!$B$a''!$ !$aj<0xc$0'''!$7W!$B$'($_0% ^XT(EȐ1AȐ>Ȑ;Ȑ8Ȑ5ab!+= % 'T''!$ !$A.`CFd8EA8 EL8 ES8EE8&Da8 Dl8 Ds8De8fc8`Cac8`Clc8 `Csc8 `Cec8`%%     #+"H `CFd8EA8 EL8 ES8EE8&Da8 Dl8 Ds8De8fc8`Cac8`Clc8 `Csc8 `Cec8`%%     #+"  <8@4-$ $ @<!$ <$'3'!$7W!$B$a47<B$ l$#/>*0%c$#7A !%C`c%&&..* %!$A'+= % '"C/>*0%($#7A !%C`c%&&..* %!$A'+= % '<"#$ %@$nj DHLP $ <! @BD HLPTC y!<!s @BD HLPTC a<"@@#D HLPTC <TCD$E& '()+Pd&@40,(@T" $p T/T!' ' !T!' ' !$ >",@ m 04$'>$G += % 'P "-% $hlptx\' d% %<@+!$ `"/$+ "ud$$+ "la!$# '0! $F$ g / "$@+ bQD#(#0a$$#(/$(E8 <!(%*P@%@&P@   @D8 <!($+0a(#e#B$c$#$#!)* b%& A    !e!$H4'$H4'%_ %%_ %G G %G G <0!$$ $(,0% $+8A&Ġ$<% $+8AĠ".% $+(AĠ$+ Aà$@('%G %G %G %G %G %G %G %%G $u LP A H"CD$E+0d8 $<`B$p 8/0$+(A7,F$#8D# d$# '$$!$+@f@<X8 <`!$p  X@<8X@<#GB$!  X@<\'_ W += % ''H'X'!$7W!$B$a 'c,`$l$pJ$tx<@$|<"$J%+`" $<|B$p /<B4+C2@x<6&w@<6&w@ "<c$&C0@"#'& ($` !$V  % #+# $(,'@x *y x x $"$"/0!@E+Hh +Hz #HO $H"!H8*J9 @+k9`+k9`$  @%8%8$-<[..+0M-<[(0!(,A !('08%+("5!&%& 0"8@!8" <Q!$ 4"/` 't'!$ !$Ap  <~c$ C/@<p,# `d `$ <e!$ d"$d+Ap<$d`!%D/B$"- <`6)%*K<d_- #".<>'+= % 'H'\`dPTX O `<,Pwd$e$%0$%@%@ 4w <,P4q<$?$@D@'H$'d< $  l <ɜ!$$< ,K O`8(B$(,('0$!< B$  0 4'-m 4'+= %j ' "'C'""W$7B$@ '+= %j ' "'C'""W$7B$@ '+= % '<ɜ!$$( ,  048< '  048< '+= % '.<> $ N  (,04'aU  (,04'+= % '.<> $ N  (,04'V  (,04'+= % '< !$a <@B$a <@DB$  "/*CB0 @ $@B $<!$$ ' $2Y 48(',",@.<>(B0  @ $@B $<!$$ ' $2Y 48(',!- .<>)Ž#!0 @@ $@B $<!$,$ ' $2Y 48('48('+= % '// !.<>!.<>!<`K!$.<><\K!$.<>'+= % '<!$ 4<B @l 40!@dh@Bdh<=!$$d' $2Y x|:l p'$;P;'$ #o !@dh@Bdh HL<@D C $ $0(,4.@"5@",@ "#@"@"@! "! < !$ $ AB AB AB AB AB AB < !$ $ += % '8" #$#"(.!$$<1!$ t /< W@@D@B@D E@H84&/ LP8 "%LHP E@H84&/ LP8 "%LHP V@X\@BX\ V@X\@BX\ @ @xT<$ $""/ #T#$t%(p@B  @t"!C8K`B8/@%0L<8&/ PT< "%PLT W@L<8&/ PT< "%PLT 2@84H z% E@L<8&/ PT< "%PLT<!$$P' $2Y @X<`pc$ $"<6&P@ 8<`!$  @"<+bp <& # 4(  4(    TX\`dhL'TX\8`dhL' $*vJ9@+rk9`+fk9` : $@*tJ9@*iJ9@q8 *i $*Pj<@*bK9`+ok9`+nk9`+dk9` t, $^iJ9[@*pJ9W@*iJ9S@*pJ9O@ 7 $A*vK9`,l9,a9,n9 ) $#`+tk9`+ik9`+6k9` \: $xJ9@*fJ9@*rJ9@*mJ9@ K> $8_ *iK9`+pk9`+ok9`+ik9`+bk9` #? $vJ9@*xJ9@*lJ9@*aJ9@*nJ9@ R* $8 *g $*Pjp@*bK9#`+rk9`+ik9`+dk9`+gk9`+ek9` &; $tgJ9#@+ek9`+nk9`+ek9`+vk9`+ek9` t3 $OM@*rJ9I@*eJ9E@*tJ9A@*aJ9=@*pJ99@ 4 $+*6 $*PjK@*iJ9#@+pk9`+6k9`+gk9`+rk9`+ek9` 95 $@*pJ9@*6J9@*tJ9@*nJ9@*lJ9@ 8 $*iJ9#@+pk9`+vk9`+lk9`+ak9`+nk9` 1 $@*pJ9@*vJ9@*tJ9@*aJ9@*pJ9@ 1 $(8)  8 Df8:Dr86Dm82< !$ p琬 h,2.<G.<G !$  (A0%(, h,.<G.<G !$  (A0%(,f $+H(O  $+H(  9 SK 9 h,.<G.<G !$  (A0%(,. h,.<G.<G !$  (A0%(, 9  h,.<G.<G !$  (A0%(,9 h,u.<G.<G !$  (A0%(,  C/ (/ h,.<G.<G !$  (A0%(,$ $+H(  9 范9t  $+H(#  9  h,a$ /B%8$98 g,,B%8$*$'a, .<G.<G!$  (A$( '$W $W $W $W $W %%G $W %%G %%G %%G $W $W <B%8$l8 g,,B%8$]$Za, .<G.<G!$  (A$(B '$W $W $W $W %%G %%G %%G %%G $W $W <ؘ%08f,6B%0D%0>%0(8 /`.<G.<G Bd$%$#070$!0  @4A#, `.<G.<G Bd$%$#070$!0  @4A #,`.<G.<G Bd$%$#07 0$!0  @4A$#,`.<G.<G Bd$%$#07$0$!0  @4A(#,`.<G.<G Bd$%$#07(0$!0  @4A,#,`.<G.<G Bc$!$# ',0$!   @4A( .<G.<G !  4A#,x`.<G.<G Bd$%$#070$!0  @4A#,Z`.<G.<G Bd$%$#070$!0  @4A #,<`.<G.<G Bd$%$#07 0$!0  @4A#,`.<G.<G Bd$%$#070$!0  @4A#,`.<G.<G Bd$%$#070$!0  @4A#,`.<G.<G Bd$%$#070$!0  @4A#,`.<G.<G Bc$!$# '0$!   @4A( $+@8.<G.<G !  4A( 8@.<G.<G !  4A( .<G.<G !  4A#,f`.<G.<G Bc$!$# '0$!   @4A(  $+@4 $+@8.<G.<G!  4A#,+`.<G.<GBc$!$# '0$!   @4A(  $+088,'%$_ %$_ %$_ %$_ %$_ %$_ % $_ %$_ %$_ %,$_ %($_ %$$_ % $_ %$_ %$_ %$_ $_ $W <8 $*# a8 $!$3$d' $2Y l'l'L$8$8Lf%8hi8@8 4 m 4H0 a( DD  0Ha&TX\`|  <"# !,04.<G.<G<@jc$( `$%$F'+@#| $<`YB$p /$ 2Y ': 08!8 %08 08&%%%p!7‘3Ñ/đ+-$ 2Y '@l$K9 ` 9:`9%@ 9 ` 9.`%0%@%8)<840,-''!$7W!$B$ d8<$P$'!$7W!$B$'''!$7W!$B$ d&d`$  V !88<$% $@Dp0e X&($@Dp0 hg&($@Dp0 Pg&($@Dp 0 `g&($@Dp@0dg&( $@Dp%<@$'P''!$7W!$B$D+@pp $< B$p  <$%%88$Hq|)%!)/8,08'''!$7W!$B$a % 0123012,-./,*-<%4%(.:%g6%(4%d.<=䎨''!$ !$'''!$7W!$B$''!$7W!$B$.<=䎜& % *% &'''!$7W!$B$.<=&@% .<=&8 $$* $$% % '''!$7W!$B$''!$ !$'''!$7W!$B$.<=&0.<=&0 '''!$7W!$B$.<=掸'''!$7W!$B$''!$ !$'''!$7W!$B$t'''!$7W!$B$LX$''!$ !$A   '' '!$7W!$B$a'''!$7W!$B$a''!$7W!$B$ax''!$7W!$B$a.<=⎈&bH@.<=& dC% >8,08'''!$7W!$B$a % 0123012()*+(*)<%4%(*:%6%(4%d.<=䎨''!$ !$'''!$7W!$B$''!$7W!$B$.<=䎜& % *% &'''!$7W!$B$.<=&@% .<=&8 $$* $$% % '''!$7W!$B$''!$ !$'''!$7W!$B$.<=&0.<=&0 '''!$7W!$B$.<=掸'''!$7W!$B$''!$ !$'''!$7W!$B$'''!$7W!$B$LX$)9   "%+HbE  m LX$w i,- .<G.<G !$  pLX$] $+PI;@*9@ )9S  i, .<G.<G !$  `LX$9 i, .<G.<G !$  PLX$ )9  i, .<G.<G !$  LX$ i, .<G.<G$!$  lLX$ $+XI` $+XiY`+9?`)9  i, .<G.<G !$  #b,k@<.<G.<G !c$!$$  T  m LX$+9}`+9?`)9~  i, .<G.<G!$  #b,@6.<G.<G!c$!$$  :<@B$ 6":"LX$C i, .<G.<G!$  #b,@4.<G.<G!c$!$$  8<@B$ 4"8"LX$ i, .<G.<G !$  LX$ $+Xi>` )9  i,w .<G.<G !$  ' @LX$ i,W .<G.<G !$  ' @LX$)9  i,4 .<G.<G !$  XLX$ i, .<G.<G !$  dLX$v$W $W $W $W $W $W $W $W $W W $W $W $W $W $W $W $W W %% _ %% W += % '<`!$$  D<`B$$  %,'@'!$ !$a$04D,<@8.<G.<G B,04L  @.<G.<G !8<@LƔ  ,'$ +'  $PTXH'+= % '<`!$$  D<`B$$  %,'@'!$ !$a$04D,<@8.<G.<G!,04Lnj  .<G.<G!8<@Lƌ  ,'$ +'  $PTXH'+= % ' pc$ ,"("/$ ?m 9 $0$ ?m PTH'+= % '<!$   < B$ w<8 B$"/et87cec80` Cc8)`Ce|8!c1c8`C@X";@\#B @3 <!$a /B$"/B$"/>0!80$#@), (''!$7W!$B$ah'('8'!$7W!$B$a.<=x&X`'T'c'!$7W!$B$a (''$'!$7W!$B$ah'('8'!$7W!$B$aT'('!$7W!$B$a@'('!$7W!$B$a.<=P&d`.<=& TX% `8,0x'h'x'!$7W!$B$a|''T'c'!$7W!$B$a (''$'!$7W!$B$a'('8'!$7W!$B$a|'$G += % '''!$ !$a'`'p'!$7W!$B$a` H' '0'!$7W!$B$a't''!$7W!$B$` 4' '0'!$7W!$B$a''!$ !$a'H'X'!$7W!$B$a'4'D'!$7W!$B$a\','<'!$ !$a,'''!$7W!$B$a,'<'!$ !$a,''('!$7W!$B$a'+" % hh'''!$ !$AD'h'!$ !$A-$ 1W '@k`+ bA$+ a4# b$8#(/$(%<|''!$ !$ <!C '%(|''!$7W!$B$D'|''!$7W!$B$@'|'!$7W!$B$` |' '0'!$7W!$B$aD'|''!$7W!$B$|''!$ !$@8 |' ''!$7W!$B$X'|''!$7W!$B${`'|'!$7W!$B$` |' '0'!$7W!$B$aX'|''!$7W!$B$a'D'h'!$7W!$B$a ,`'D'h'!$7W!$B$a'lptx<@!$D'| <@B$lpX'| <@B$tx?d'L'`'!$7W!$B$a|'L'!$7W!$B$ac$|''!$ !$'d't'!$7W!$B$ |''0'!$7W!$B$ad'|''!$7W!$B$a'd't'!$7W!$B$a( $+"`de*% e,% c|'L'`'!$7W!$B$$% $+ DH<`!$$  H%M%%'$+(;DE*% E,% B%'@%CC0&,2<=>?<=>@ABC@"A4% ,%B2%F.% %C4.<=䎤''!$ !$'%%G c$%d(D,! a$D$!(a F,$8G 8'0$% D%$G += % '(,$  x<$c$$'$ @(, 'x   (, '-m '+= %j ' ",'C'" $"@B#"@B! $'$ t (''+" % pp'  \'' '!$7W!$B$a 8!<+(bDP$4+8XTX $?@A$+0Hf>$+0(f?$+8f@$+8fA$#8?0$''!$ !$A>Z V ?l %Pd %X@j %PMf %Xlk5A%P.<=ꎨ!8$+P)b@䐰'''!$7W!$B$"%d`'t'!$ !$`'''!$7W!$B$t'`'t'!$7W!$B$a'`'!$7W!$B$a'''!$7W!$B$aP `'|''!$7W!$B$aL'''!$7W!$B$awL'Dd$$ V `'|''!$7W!$B$ad& ,% '''!$7W!$B$d, `a$,d$'!$7W!$B$'''!$7W!$B$|''!$7W!$B$.<=厌&(!'''!$7W!$B$a( d($ $&8  '!$7W!$B$d$46堰'%!$7W!$B$'''!$7W!$B$|''!$7W!$B$.<=厌&("'''!$7W!$B$a( d($$&8  '%!$7W!$B$$&'''!$7W!$B$a<Ʉ$'''!$7W!$B$a( d($&0  >|d$46堨'!$7W!$B$'''!$7W!$B$.<=䎠& #.<=& '''!$7W!$B$a( d($&0  d,.ŠĠc`/< /< <=$+"*`<$+"!`= ׽    ' '%G G %G $%W $_ G $W $_ '+" % 00'$+"`d&B'0md0$+ "d*% 0.($$+0%0ǐȐB%80+( $+8 e $+8 e$+8xe$+8ne$'4'!$ !$:.L%8'D%(J%(%F%84%(,0.<=4Őǐ:%($'%8'4'!$7W!$B$$'8'!$ !$$'''!$7W!$B$8'$'8'!$7W!$B$~$+(Ge~$+(Ge$+(Ge$+(Ge$''!$ !$~*&L%(%D% J% $F%(4% .<=$+ "ÐĐ$'''!$7W!$B$"%d''!$ !$'$'4'!$7W!$B$'''!$7W!$B$a$''!$7W!$B$a'$'4'!$7W!$B$aP `2%(0+(bE,E$c$#070! ''!$ !$&`'$'''!$7W!$B$a''!$7W!$B$a '''!$7W!$B$a'$'8'!$7W!$B$a''!$ !$' ''!$7W!$B$$'''!$7W!$B$a ''!$7W!$B$a' ''!$7W!$B$a'$'8'!$7W!$B$a''!$ !$'''!$7W!$B$$'h'!$ !$a,'''!$7W!$B$aL'''!$7W!$B$a'% |''!$ !$y<0$|'''!$7W!$B$<ҥ$ '''!$7W!$B$,0'$'h'!$7W!$B$a|'xj ''$%T %8L %@(&R %8GN %@ 5'%848.<=<h','<'!$7W!$B$T','!$7W!$B$.<=d&8!'h'x'!$7W!$B$a( d($ $&8  h'@'P'!$7W!$B$T'@'!$7W!$B$.<=d&8 'h'x'!$7W!$B$a( d($"$&(D   ܼ  P |'%G %G %G %G %%G %%G %%G %G %G %%G += % ' 8$+(A'$E,$#070!0h,hl'|'!$ !$A$  l'' '!$7W!$B$a('l'|'!$7W!$B$D,$#070!0,dl'|'!$ !$A$  l'' '!$7W!$B$aP'l'|'!$7W!$B$a<'l'!$7W!$B$a.<=L&b!@.<=&d`'P'`'!$7W!$B$a( d($h&0  l'('8'!$7W!$B$aP'('!$7W!$B$a.<=`&!`.<=&`'l'|'!$7W!$B$a( d($d& A   ׽   '$%W $_ $W $_ %G %%G '+" % dd'+"d e# %!!D `y'()* $+P@ ǐ' $+P~@ ǐ($+Pt@ǐ)$+Pj@08Hǐ*%8L'\'!$ !$A'Z V (l %PMd %Xl)j %Pf %Xk5*%PLTX.<=\L'%Px'\'!$7W!$B$ad'L'!$7W!$B$a.<=t&X)`k,'`'x''!$7W!$B$a( d($H$&8  H80H` $x'''!$7W!$B$ad''!$7W!$B$a.<=t&X&`'x''!$7W!$B$a( d($H $&8  H80H` $ B%@ 1+@bȐ1@1+@A#A#@a#X_ $Xa!X+`" %#` g 1M$noz!`l%p+x-ln l n ml # L,|L$ %#h o 1!h+p,o$LN 0D/< /< %&$+ "Z%d$+ "Q&a P ,4D  D,4  H08 P ` nj# ÌŒ+(b#+(Aƌ#a#A#(/$%!&  + '_ W %G G % % G $_ % % G % G _ W $W %%G %%G %%G %%G % %G $%_ %%_ %W %%_ %W %%_ %W %%_ %%W -m '+= %j ' " 'C'" ''+" % TT'-"d e# %!!D Ty'$,g`%#X_ k1!Xfl,\4<PHl.''!$ !$A$  '' '!$7W!$B$ap'''!$7W!$B$aX''!$7W!$B$a.<=h&b0@.<=& d+4D,<$#(/0P!(g, 'p''!$7W!$B$a( d($&0  '''!$7W!$B$p''!$7W!$B$.<=䎀& !.<=& '''!$7W!$B$a( d($&0  4(D,<$#(/(0lǐƐ2%00P!(+@f$+@&$#@G1$Z !@%Pj+X)`L N  LN ,o$$#H O )1!H+P(c@.(H(0  /< /< +,$+ &M+$+ FD,8L0 ׽ L08  T # + b#+ Aƌ#a#A# '$$!%  - '_ W %G %G %G $%_ % G %G %W ($_ $W $_ $W $%_ % %G $%_ %%_ %W %%_ %W %%_ %W %%_ %%W -m '+= %j ' " 'C'" '+= % '  <`B$ '$"/?08/@&($+8+8e./0>?0&('$+8+8c&d0`'$+8+8e&($+8+8e.B/0>B?0&(t$+8+8c&dc`hf(p!(e`0!(0&(,l$,! 0+ Ae#A%_@" 6%+A '$'''6!&G#@4@%+"`+A % '$''''''''`j _ %G %%G %G %%G %G %%G %G %%G %%G %%G %%G %%G %_ %W %_ %%W _ G += % 'E $$ $$D!(A<#8@+@eP+@J#@a#HO $H)@P!XA8!H+hk<+he50,$ #e#B# '$ !  7_ 0<+A`$(@# #(/$%8!%, ^ ' !0!,H4'_ %% _ % W %_ %W += % 'l2d3e,a!(t+0" $8pp!8|+P!@#X!#8#`g $`,T!p0<!PL#`L'pX#p!*ph,.n P  lXT2aP P  dl(,T#et\+0" $8pp!8`D%`!c+X!`( <`!$p  (84@##!B tlT $Dp48@|!+(a/`p!hi+P!5@jc#H!#a#$#!C*P+@%H &P @  tl $Dp,+"`p!(&()"#/df E $9 $+h/ @ $+p& @.%#pw1O$!p$+ |~ϡ¡+x.  ^ P"$# B0Ld$!E$+8' <>GD% $P $$+h`p!`$+#h#` % %#` g $`!`  )-< -< *$ $V  8' # + 8'&0 $  L $P $$%`%ho  $ $ $ $!`!+| pq!pэ+0r@+ k@΍#,#ß$@ !`!n+,\+U#0## '$ ! $ #E 7_ >@!"!0L+A8`$(#AP#(#(/$%/<` $ ^ !"$+ b,.%$ $[''%G _ %% _ % %W % %_ %%W %%G x %% _ % %G %%G %% W %%G % %G % G %% G $_ %_ %G x _ %G += % '`XT%A$*0$ f( $8p!8 %*H# 4L#PC#P W $Pj#@!H*( )@*^ _ k1k9 `J1J9@ *J9)@<) (FG19(9%*\ h$JS `XT $L%4\ dJS `XT $L%4G@%*'2'!$ !$a$+H #8#@ % $#8?$8'!8' )-< -< #H$ $V  *' #+d`H*'&(d $  4`XT $%8%@9G82%l)%+X "` $< B$p l/L%8,x|%' pPP&H!@2xL`h|d $4T, $* & p!(*@%% d#n!S+ !+ $r!u+##$ș#!+" *V %%%HD80<@XP&  $4D`T,Hh $x|Pd80 $@<XLm;d.&&#3!$+`%`!` .&&#3!$+`df +` ^ < A,y D$@e$#(/ 0X!($+8$j' <>4D`T,Hh $x|Pd80 $@%X$.E&&#3!#y$+"7  n+,r+A&##$<!#A+`"#`!#` g $`!`&   4D`T,Hh $x|Pd80 $@<X$p`q1r'3!`+###$!+B   &`$ r %1+`6!`$$n+`#`#` g $`,#!`+$+# (# '$ ! *\%%%&  84`T,Hh $x|Pd0 $@<X$nr# 0!f! $+`"w+`Cq#`## ×$r@!!+?c +\ $ #"#8#@G$H! 7_ 0@+bD r+ A>$(#0a#A#8?$'X!' ^ rt!A!0<+A$`#A@# # '$ X! $+("'. LCX `} @dP+0% %(%0<D84L"$ p <B$ P$"8$%(%04D!$#!0!#cB$ dhlH'!$B$%*@'c$(+Hg $+H 8@<0,L" $p  @8<,0$H !H#$#T+a@$+ (L! $p  T(G$8!8c$%dhlH'%%G += % 'X"\` d} 8 HX"PDhl p}  D$#(/0c$#070P!(H$JK!F!$%0%`%hPtHxD|T'tx|T'%@HPD,0@<4(L+p*0+p(!%+pX" $p  <L@HPD04(,%p!pȭɭA$#@G1!($+p #%+pX" $p  <L@HPD04(,%p!pȭO%ϭH%+p+ h% c$#pw1JK!N!$%p+( %+@0XC $p  PD04"$!HI% !'+`8 < !$p  8PDPHD!  X!PH D} tx|T'+= % '("(d&)@,b,$&$@.b.$&@0b0$&@2b2$&D@3b3$&D@4b4$&DB8 @($ V % '+= % '$  !$$   '+= % ' "$C$  % 0!$0!$$ V  '+= % '"d&@b$& D% !c _ % '+= % '  "d&D@"d&D ! c&#%"!,''+= % 'T"\  %\% ,$%% \*0EN,4($0$(DpX!%$<'!$7W!$B$dŎ'<'L'!$7W!$B$ 0(+8408T"4 $p  0%(%08$8!8'/B$'$"+*9@8-'$8@8@)- %@d ,)TX\L%@4%@='$$ `d?0<:!%!8+H; ! d$$0!0+8/! dƐ'$%h+ $`d+"`t! #x'$%h+ $ m |'G %G %G G %G $*0!0Ɛ 8 +0!0$+$Ǡ+$ m |'%G %O += % '41 "#$ # 4d,(a b$ # ,( @4@ P , (8<B$ $"$;hX'Xd`!(\+8e(D@ <`!$p  D(@@<h!   <`@dh\`\%#+A@txl'`x x  &@ # ` &%$,% *6%(2<F+,-./012l'"#+'%()k '''%0$Hq!H*R$$!I&("#%%"#t$d,x!* @E,f,$(% Btx" @tAxap!$ +'@$  Dp!$'B'!@+ ! @@%( l'"#+'%(*k '"!k '%0$|Hq!HIR$$!*|&@(-m '+= %j ' "'C'" !/ '+= % '/<!0 $< B$$!$$~   !$$~   !$$~   !$$~   !$$~   !$$~   d!$ $4'$g $XD'"8B@!8 ai!8 ag!8 an!8 ao!8 ar!8 ae!8 $XD'<Ǎ!$%$, c$</<c$@<'L$#%\D$X`d-!$$~   !$$~   %0$@+8-<)-<)''%%_ ##(/$(E .<B#!e`  @`x%8%6($%H%@hiR %@HN j\ %HiT %@HjZ %HiV k%HikZ %Hik\ %Hik^ %@H%Hi$@+P@-<)-<)''%%_ += % '@4  "D @ <=> |A ($,  04@D@ 04HLPTX8'HLPTX8'+= % '  !  $!   $'/<` !$ $'+= % 'D&  !H  4568< @|A ( $,LPTX\0'8L<P@TX\0'+= % '@DH8<456 |A ( $,PTX\`0'+= % '4" @D  #>`y@#c0c,c09`z`C4%%@'T'!$ !$@D|HLPTV` !A* a@ *(e(yy$z| B ( $,<8\!@x @t'L$ \8<t'X4!$$~   !$$~   !$$~   !$$~   @X @D@!"@% D\"` @*%D@!$ ( @\"` @0%%q\"` @,%%14@TX"X @'\C`4 ` LMNP' zY (!A4c$@!$%%,* AdH'8<TX"X @'\C`8 ` LMNP' zY 8B$<!#0* A "p $#+#%a !p#!" $"p@"$!"@!$ !#(!"dH'+= % '< !$ $B%" "p+#%# !p $#b#a!A $Ap@"$!$$~   !$$~   $""4$m 4"#d$%+0D( $<`B$p  (($,!<*!$$  $4A(A/  )8 $+H  $<`B$p  0P $\$$!Ht $* )8^ $+H  $<`B$p  0P $\$$!Hn $*t $ )8 $+H  $<`B$p  0P $\$$!Hr $*t $")8 \)8 $+H  $<`B$p  ,0P $\$$!H!t $g$+H  $<`B$p  ,0P $\$$!Hx $* H)p $#Hi+%_ _ !H+)%H +% $+h#h%$#H#x $X<%%!X+D<L <`!$p  D<LD<L!  L<D ,$k  $0P $\$t $@+X"`#"#HO $I!b#( `l`$*($4D$8+8HH $<`B$p  40%8%0l$$!@\ $ 4*Pe@$+P@ $<`B$p  40l$4\ $$!Pu $K P*p $#PL%g g !PLJ%P L% $+p?#p%$#P#x $`<%!`+D<L <`!$p  D<LD<L!  L<D 4$k  $c$+P@ $<`B$p  40l$4\ $$!PU $K P*p $#PL%g g !PLJ%P L% $+p#p%$#P#x $`<%!`+D<L <`!$p  D<LD<L!  L<D 4$k  $0@+0#8#@G$@P!@(t $%(% %0%% $\$l$@+0{#0#8?$8GP!8%Y%!"+0j#@#(/$(%D!8&!(L8+P'@H<H <`B$p  <DP%P%HPD<!F  $\$t $@LD<Pl$+a@ $<`!$p  "$!"$EptxT'!$*H& !H') *-@"*9@'*9@\*9@)- %_ %%_ %%_ % % _ % % _ %% _ % % _ %%_ += % ',$m ,"#$ 0483 $,/!$$~   `8##07$0&#(AL! %%`k k 4+A%`8#a# '$ #AL!08% + `mM8% + `lD`A\'_ _ _ _ += % 'h7/ h!#x$|%T < t' 'D'!$7W!$B$ahH"$/"W<0c$   "W<0c$   `D#a# '$ #Ah!D48 0nj% + $$($\0,`r.B8@$#B0$<#X!Fd*0c#<`!$!B$@X  @XC/"lW<0c$ |  "pW<0c$ x  B$hl<8LPLu <@>B$pt<}!$$h' $} Hd<c$ H"/B$x|B$txLHX\Xu <>B$|<}!$$t' $} p<c$ p"/B$B$pt$ X\Xu <>B$x|<}!$$p' $} Tl<c$ T"/8B 8$4d 40+ bx4x $< B$p  %% 4x,0E$(!(8 ! @8CD-<k$nj$4d 40+ bx4x $< B$p  %% 4x,0E$(!(8 ! [@8CD-<k$njZ~ 8 $%A`,c$0+(xx $< B$p  8 $%(% f$0!0$Ǭ''!$ !$A'$X $Xq-%!Xm&p$ $%''!$ !$A'$@ $@ q$!@H &XC`$@''!$ !$A'$@ $@ q$!@H &XC`$@~ 8 $%`,c$0+(xx $< B$p  8 $%(% f$0!0$Ȭ$''!$ !$A'$@ $@ q$!@H &XC`$@~ 8 $%`,c$0+(xx $< B$p  8 $%(% f$0!0$Ȭ$F''!$ !$A'$@ $@ q$!@H &XC`$@~ 8 $%$`,c$0+(xx $< B$p  8 $%(% f$0!0$Ǭ&c8`,c$0+(xx $< B$p  8 $%(% f$0!0$Ǭ$$''!$ !$A'$@ $@ q$!@H &XC`$@~ 8 $%`,c$0+(xx $< B$p  8 $%(% f$0!0$Ȭ$$pp%!pύ& %3} %0ƍ< ,!$48C+ `40+ bx4x $< B$p  %% 4x,0E$(!(8 ! 8 + `b #$-`<$m <"#c$$$%+0C. $<`!$p </!$$~   %%($$ !(@$)!!!$$!E%%% 0 '+= % '`"!X\T L$@$% %(%%%f @LAHd<nj@Ȍ  D< 8dHh 8!(@$)$B$!e@D! Dp+#%b Bp $## ! $Dp@D$'&!D@B$!b!"+= % 'D"@$!,H<C@B8<@  ,%$% %(!8P<T@X\`4'%0' 8p%@ @q $#8'#@(!8 $8q@$O N !8'@$9$c$!(`    ,$(0  0$$(%$ PTX\`4'+= % '.!(@$)$B$!e@D! Dp+#%b Bp $## ! $Dp@D$'&!D@B$!b!"+= % 'D"@$!,H<C@B8<@  ,%$% %($8P<T@X\`4'%0'G H q+@#@%8 8p $#8#@ !8 $8q@$O N !8'@$9$c$!(`    ,$(0  0$$(%$ PTX\`4'+= % '.<B(&A .<B&A 0 Cp+#%" !p $#A#C!A $Ap@"$!A@!$ 8!"@$',0 4< !$$~   !(@$)$B$!e@D! Dp+#%b Bp $# #!D $Dp@D$'&!D@B$!b!"+= % 'D"@$!,H<C@B8<@  ,%$% %(+8P<T@X\`4'%0'G@H@P?%8G&HH&8 @p+8#8%8' 8p $#@(#8'!8 $8q@$O N !8'@$9$c$!(`    ,$0?@@@H7%0?&0&8'$(  0$$ (PTX\`4'+= % '.<B(&A .<B&A" 0@@ %#&&" "p+#%# !p $#b#a!A $Ap@"$!"@!$ 8!"@$',0 4< !$$~   !(@$)$B$!e@D! Dp+#%b Bp $## ! $Dp@D$'&!D@B$!b!"+= % 'D"@$!,H<C@B8<@  ,%$% %(!8P<T@X\`4'%0' 8p%@ @q $#8'#@(!8 $8q@$O N !8'@$9$c$!(`    ,$(0  0$$(%$ PTX\`4'+= % '.<B(&A .< B&A % !p0 Bp $#b#a!" $Ap@"$!A@!$ 8!"@$',0 4<>!$$~   !$$~   !$$~   !$$~   !$$~   !$$~   !$$~   !(@$)$B$!e@D! Dp+#%b Bp $## ! $Dp@D$'&!D@B$!b!"+= % 'D"@$!,H<C@B8<@  ,%$% %($8P<T@X\`4'%0'( Hp+8#8%8 8p $#8#@ !8 $8q@$O N !8'@$9$c$!(`    ,$(0  0$$(%$ PTX\`4'+= % '.<B(&A .<B&A 4 "p+#0%a !p $#a#b!A $Ap@"$!A@!$ 8!"@$',0 4< !$$~   !(@$)$B$!e@D! Dp+#%b Bp $# #!D $Dp@D$'&!D@B$!b!"+= % 'D"@$!,H<C@B8<@  ,%$% %(+8P<T@X\`4'%0'(@H@P?%8G&HH&8 @p+8#8%8 8p $#8'#@(!8 $8q@$O N !8'@$9$c$!(`    ,$0@@@H7%0?&0&8'$(  0$$ (PTX\`4'+= % '.<B(&A .<B&A" 4@0@ %b&&A "p+#%# !p $#b#a!A $Ap@"$!"@!$ 8!"@$',0 4< !$$~   !(@$)$B$!e@D! Dp+#%b Bp $## ! $Dp@D$'&!D@B$!b!"+= % 'D"@$!,H<C@B8<@  ,%$% %($8P<T@X\`4'%0'( Hp+8#8%8 8p $#8#@ !8 $8q@$O N !8'@$9$c$!(`    ,$(0  0$$(%$ PTX\`4'+= % '.<B(&A .< B&A 4 "p+#0%a !p $#a#b!A $Ap@"$!A@!$ 8!"@$',0 4<>!$$~   !$$~   !$$~   !$$~   !$$~   !$$~   !$$~   Ǡ0$,$% %(%%%& ,0H<&@'H(  B$+ " $<`B$p  PTX\`4'+= % 'h!0"8h@!8Y \!( $%X"#%b#%b!%"%$6 dde$f+8!(8 $< !$p d/Ǡ0$% %((%%*0AC0P@<,#D ` L8H4P@< tx .<BL&" .<B&"!  B$+ " $<`B$p  T'H8 4< !$$~   Ǡ0$,$% %(%%%& ,0H<&@'H(  B$+ " $<`B$p  PTX\`4'+= % 'h!0"8h@!8Y \!( $%X"#%b#%b!%"%$6 dde$f+8!(8 $<`!$p d/!$$~   Ǡ0$% %((%%*0AC0P@<,#D ` L8H4P@< tx .<BL&" .< B&"!  B$+ " $<`B$p  T'H8 4<>!$$~   !$$~   Ǡ0$,$% %(%%%& ,0H<&@'H(  B$+ " $<`B$p  PTX\`4'+= % 'h!0"8h@!8Y \!( $%X"#%b#%b!%"%$6 dde$f+8!(8 $<`!$p d/Ǡ0$(%(% %%*0AU0XD@,#H ` T<8PXD@ | .<BT&" .<B&"4  4B$DL<8 D4+ bL<L $<`B$p  % %<\'P< 8!$$~   !$$~   !$$~    $ %%%  <`B$p  % %%$80,4  0LA,A/! @$!! X! 0$8!(* A.08,#< ` .<B&".@&'@#4$@$V  @% #+# `D'@x *y @x x  <!$$~   !0@$1!(! $!$0'99  0'7 |T"C Bc `.$+@ 87787 87%(h+@"p!a"B0P!+`C8`!C8f`!C8`!C8`!C8Q`#"%&+*c,$#%Al`' $+8k $+@8%@8%@%@ 8%@  8%(%@h+0"p!a"B0P!+`C8`!%#C8`!% C8`!% C8`!% C8`"#% C8`!%&h++B,$"%#l`'$$+8> 8 DXN  DX $h+8"p!a"B0! C8`C8`"! LH!N  LH   l`'8/h+8"&p!a"C0$c8` @T! \G @T V * l`'G -@!0"8@!8 T" @ !8 '.<!$.<c$!$7W!$B$a'T" @!8 '.@!0"8@!8) 0T!D  !8 '.< !$.<4c$!$7W!$B$a'0T!D !8 '.<!$.<c$!$7W!$B$a'!0!8 0T!D !8 '.<!$.<c$!$7W!$B$a'0T!D  !8 '.<@!$.@!0"8@!8 T" @ !8 '.@!0"8@!8 8T!L  !8 '.<@!$. '.!$$~   !$$~    D!0 "8 @"8!@@"!@!N   N .<B HLPT4' <@}!$ $" ! %$|#$(c$$"f֌Z8nj!8HȐ, !"$(#(<&0&,!c!`c!b!&$` !%"0 '!  $(D|T,\`dhl@'H\L`Pdhl@'$$/4<8 !HH @*@Ď X  $(D<4T,\`dhl@'(<&030! ! %!0E+8f048 <`!$p  084408!"  408\`dhl@''+" % pp' "`''!$ !$a  @/@ B @ \)0@d`!@+H <(4 <`!$p  <(4<(,!  0@(,<lptx|P'HL d(!( !+("3(4!08! * &#%+"$`<B$<|$"p0!A@'b+ "b!A"!4 <@'G G G G += % ' "'C'" "#Cc$+ b$!dc!+" `!$! 'G %G t += % ' "$'C'"< !@DH LPTX '+= % ' "$'C'"$" B!(, @048< '+= % ' "$'C'"<!@DH LPTX '+= % ' "$'C'"$"B!(, @048< '+= % ' "'C'"4!8<@ DH'+= % ' "'C'""B! $ @(,'+= % ' <EB$ m $"/@"#<!(d&+8E$ <`!$p  $<,$(!8  $4A(A/`0! a(!$ \y  <@B$-$  !$(04 #p*p$%px+ $ r!%OD# #x@q$px!pN+O/ '%giR ^%PjT\ %PKRN %HIJL>c$!$*("(@$+8#8#@G$(!($+H '%%G %%_ O _ %W += % '@X"@<`!$$  tDuEvFwGyC(%8&(Ŭ!$%((@$+0E#0E#8?$8!8$+H  '%%G %_ += % '.<,K$+">`.<(K/Hnj+@Y Œ !Ì LPT @Cw$Wc$`(4 ( 0@0X,\<`d8hD'@$$ (4 0,<8(X\`dhD'%%W += % '<70"$40#$,% $%0W%0Fw <" #B$$(%,&@D H @ <,#+ b3$%$$! LP $4d$w$ 0(, (0 %DTX\8'W += % '"! B @ '+= % '"!B @ '+= % '(dc','<'!$7W!$B$a  @D$'+= % '(dc','<'!$7W!$B$a  @D$'+= % '(dc ','<'!$7W!$B$a  @D$'+= % '!7  $'+= % '!74  $'+= % '!! %!$$' $2Y 8  $# # 'd!d @<@!$$a \0E@C-<H$B(d<$'4@B<?!$$' $2Y 4  $# # ' `d-<H$njc^< !$ <,B$"" #/`\T<@ ACD i <!$@+(TXT $< jB$p  X&$1!0$Ǭ ì/!$3$8' $2Y H L'H L'% % $$TXP'% ! " @H L' $$TXP'&@ '\'!$7W!$B$LPS" XTH L'H L'-m L''+" %j $$'ÎtĎŎƎǎlȎp%H%c$$jK`|C%A%'!$7W!$B$aCD c '''!$7W!$B$ `XTp$ƌ|@&$'!$7W!$B$h Hq< !$$ V / < !$$ V # HV'8)8PB$ -!$ $"$#H$$$ %e$&$'$(" % !$ $"$#H$$$ %e$&$'$(" " !$ $"$#H$#$ #e$#$#$$" #%8G!%E1!@+P"3@!PH>0!8+@"'!@ g'8(? ! # $  ' '!( g$(!+("G % G G %%G % G % G %% G % G %% G % G % G %% G % G % G % G % G % G % G % G % G %% G %% G %% G %% G %%G += % ', "'@@4< Q!$>'  $"/< Q!$H>'  $"/B$"<!$$ m $"/?0<%!8+H !H%'$0!0+@ m '%%G %%G !8ƐB$$$F>?0<%!8+H !H%'$0!0+@ m '%%G %%G !8ƐB$$$F>?0<%!8+H !H%'$0!0+@ m '%%G %%G !8ƐB$$$F>?0<%!8+H !H%'$0!0+@ m '%%G %%G !8ƐB$$$F>?0<%!8+H !H%'$0!0+@ m '%%G %%G !8ƐB$$$F>?0<%!8+H !H%'$0!0+@ m '%%G %%G += % '"b$b"b@ " b"b`"&@?0!8+P&@98 $<`B$p  89 <)% $+"` $<`B$p !<4!$ $   m '%G c$ d(! # #c8` #c8` $$$+= % '(".<A⎳< Qc$"' Y  "!,0$'( $ j ?0<%!8+H( !H%'$0!0+@ m Pa/%% `4#  -@0@f"  "!0b/<$<5M ?0<%!8+H) !H%'$0!0+@ m  a/?0<%!8+H) !H%'$0!0+@ m  a/% %(:%(<%(ì% ì$+"`%"%A%A $ '-<&-<& $ 'G G G G '+" % ||'" $ ?0<%!8+H. !H%'$0!0+@(' m XP '$d!0&*8% c&(   (,048 'G += % '$"((@(B$#B0 !b!$dc% m a/ P2# @(,PT"  Td$T% ( %80,$#(/0@!(&$P%%%@%HV%%%(%0X\`L'X\`L'+8d8+1`$# #(/$(P!(+0#<H $4A@@AB[E# !$t*A`xpt D<`B$  D%dPL8' | yJ# ( l$$&+,h'-<&-<&⎈h'-<0'-<4'⎈h'` $H$$l)H` TX\^T'dP L| H# ( ,h'$$(&`$H$,l#H`d PL| $;# 0 4h'0$4&`$H$,l#H`d PL| $;# 0 4h'<$@!`$H$,# H`d PL| $;# 0 4h'L+e dh'%W += % 'dl&""`P /?0<%!8+H! !H%'$0!0+@ m <@8DHL$'%%G %%G _ W += % '(, < <!$4*0 8+(b<+(A7 #a#$#0!a&%`   @DH$' < a$+ AL#(#Cc$$#(/$(%\!($+8#:%g4!<> C,o`C$$#(/ 0!(+8#c%#!$x|d'-<&-<&x|d'0x|d'x|d',x|d'-<&-<&x|d'$x|d'-<('-<,'x|d'%G $_ %G _ W %_ o %%G %%G '+" %  'u $C`,C`B% `-<'-< ''/#  P,F$$#8?0!8 $+P%6@:%(,+$$#P W J1!P +X'`GJR %8G,@$$#X _ k1!X +`*jkZ %Pj ,`$$#` g 1!` +h+lFDBhb %X@%` $!'-<'-< ''J%%FhlD $B@01+p*pJ t6# $'$H%BD@hl%0%8 $%( %h0!p!p1+`<*`<H t6# (  d$a$* %$+ An# C#0$$#07$0&!0$+@$]ĐƐ2% 0! c$$'*(  D,8h$f$B$#8? 0!8  h!  P+A`#aX# '$ %8`d#AT!$+ 8 8 8 f"  l `dTX j $('$0$+ 48o0# i   `dT X$(,04a 8 '-?0<%!8+H' !H%'$0!0+@ m \,a/`H$tx|d'ph +0dtx|d'-< '-<$'tx|d'%W G $_ <<`!$ D| += % 'Tw<6!wX$w<6+(w! ('8'!$ !$,04-< 8<'('8'!$7W!$B$a@<$ w<@@('%@  c$/% <6!(+ !dDH<?<6$w<@L'<'L'!$7W!$B$a !@($JV%H*+P2@!@ ($LT%H*+P&@!@ ($J6%0+H !@!$+0"!0Š%%(`H'd@f H H'&" H'HTP4! CL+0$@ <`!$p  @4@X<!`  <P@TXL0+H`H'&e`{H'HTP$L+8e $<`B$p  TL0+P$!\$eH`H'&f`JH'HTP$L+@f $<`B$p  TL0+\$P$!d$0^$+0.P`H`H'&e`H'HTP$L+8e $<`B$p  TL0+P$!dP@8H'd@f H H'&" H'HTP4! CL+0$@ <`!$p  @4@X<!`  <P@TXL0+8 , $0$+(b0+(D#D#(/$ <$! $0 $$+(b~+(Dx 4 B!d$ p&d'`DHu Bi00#H+@*00!@%%(+@IB$H00+@ %%(0!!"!$,'+= % 'x7" 0 $xd/ $ j x", / $ j x"(/ $ j %4'p'!$ !$$804 @,<$H d,8C$D$E$F$('|'!$ !$$,($4 %% %%(%% %%(%%(%%(%% !$%0% +8",!!%%%(`#D##$!g m a/,d,%& 90$0e& 42$2e& /4$4e& *<d<%& %d% V  ("(d,e V  8!8C<B V % '+= % '-M$ ! "d&@"d&D@"d&D@"d& D !c V % '+= % '-M$ = "d& 6 d %& 1$$$e& ,($(e& ',$,e& "0$0e& 4$4e& d% V  !C B V % '+= % '-M$ ! "d&@"d&D@"d&D@ " d& D !c V % '+= % '-M$  "d&D@"d&D@"d& D c! V % '+= % '-M$ ! "d&D@"d&D@"d&D@"d& D !c V % '+= % '-M$ $ "d&  d %& d% V  "c ! V % '+= % '-M$ T "d& M$e& H $ e& C$$$e& >&$&e& 9($(e& 40d0%& /4$4e& *<d<%& %d% V  ,",d0e V  8!8C<B V % '+= % '-M$ ! "d&@"d&D@"d&D@"d& D !c V % '+= % '-M$ !B&"!,''+= % '-M$  "d& D !c V % '+= % '-M$  "d&D@"d&D@"d& D c! V % '+= % '-M$  "d& D !c V % '+= % '-M$ ! "d&D@"d&D@"d&D@ " d& D !c V % '+= % '-M$  "d& D !c V % '+= % '"d&@b$& D !c V % '+= % '"d&@b$& D !c V % '"d& @b$&D@b!&A!8  "d& @b$&D@b!&"!,  += % '"d&@b$& D !c V % '+= % '"d&@b$& D !c V % '+= % ' "'C'" !{#  't += % ' "'C'"7#  '+= % ' "'C'"7<@B$ /`cd@$$h'!$7W!$B$<@ 'h''!$7W!$B$LPTXq" \`' ''%%G += % '4+%$<% w7% dw <<1!$,0,'4$+a  / ` $ ,  `X\d|4 |'$<$ $ @0 %(%0%8%@%H''''<'D%p%H0%P%% h*X`xtl%%  t+( $c$  lC D<>$H 3 l%%% %(%0 h$0$l@<`H*@g0h",#LD   vM% LdPe  $D(d.<`E.!$p  T48H%P%(TH<>!$$8#h# #(#(/$e!C 3 <@!$ ,"8$+ b/B$p  P84<>$D$e$#(/0!(% TH3 @<84dDX`\P'%%%@%H%P'+= % '(,0 48<$t$  @D$'+= % '(,0 48<t$  @D$''+" % @@'' "o@ $ @@BB$   `@0''+" % @@'|''!$ !$A$?$$ $ ' del''!$ !$<$l $p$t''!$ !$)!$1$$' $2Y @D0'< )!$1$ 2Y @D0'@D0',a$ b$@ ,"#8 <"   @$(8< $ <$ @($ $ ݋ %''!$ !$a<_!$ $$ 4le$@f$(h$'%!$7W!$B$a `@4"!<`!c$' ( ! '%0'H'!$7W!$B$|% @  $ ݋ %''!$ !$a<_!$ $$`\'|''!$7W!$B$a`\<$(w@@(7%f@0/%(<6!(<6+0 c$!dh% `?<6$`$7|'<!$$ V !8%%  ݋ %X'x'!$ !$a<_!$X $\$`  "  \8 @&@@B''!$ !$AB$ % '+= %j 'Ž ÎĎŎ48<  g $(,@DH0'+= %j ' " 'C'"d '+= %j ' "'C'""W$7B$@ '+= % '\` C8BL$`!@<~$ 8"/ $X@"#$<$$ H L `a-<]B$Dc@@b$&D9@b$&D4@b$& D/$e& * $ e& % $ e V  "de V  !C B V % '+= % '"d&D4@ " e&E/@"e&*@b%&E%@"e V  "d e V  "c! V % '+= % 'X'h'!$ !$ATB?@4j <'''!$7W!$B$a'<'L'!$7W!$B$a4;<c4#8Cp8!"| <' '0'!$7W!$B$aX'<'L'!$7W!$B$aP'P'+= % '4 "8@0Cnc8`Cuc8`Clc8 `Clc8`<@('<=!$ $ 048 <B$ + $"! $ @$^M  4+ ]B<6&w*@<@B$&"@  @@$ @C-< f$GQ% |'cq<>6&w@<`|B$&"@  @< @C-<@f$G%|'@b%&9@ b %&E4@b%&E/@"e&E*@ " e&%@"e V  "de V  !C B V % '+= % '"d&D"@ " e&@b%&E@"e V  !C B V % '+= % '"d&D4@ " e&E/@"e&*@b%&E%@"e V  "d e V  "c! V % '+= % '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@"e V 5 "d e V ( "de V  "d% V  $"$c(! V % '+= % '"d&v@ " d&q@b$&l@"d&g@ " d&b@("(d&]@0"0d&X@4b$4"$& O "de V B "d e V 5 "d% V ( "d % V  $"$d(% V  ,",c0! V % '+= % '"d&D/@ " e&E*@"e&%@"e V  "d e V  "c! V % '+= % '"d&4@b$& /$e& *$e& %$e V   " de V  "c! V % '+= % '"d&D@ " e&@"e V  "c ! V % '+= % '"d&Dj@ " e&Ee@"e&E`@"e&E[@ b %&EV@("(e&EQ@0"0e&L@"e V B "d e V 5 "de V ( "de V  $"$d(% V  ,",c0! V % '+= % '"d&DS@ " e&EN@"e&EI@"e&D@$"$e&?@"e V 5 "d e V ( "de V  "d% V   " c$! V % '+= % '"d&D@ " e&@"e V  "c ! V % '+= % '"d&DU@ " e&P@"e&K@b%&EF@b%&EA@$"$e&<@(b(%&E7@,b,%&E2@"e V ( "d e V  "de V   ! C$B V % '+= % '"d&D@ " e&@"e V  "c ! V % '+= % '"d&D@ " e&@"e V  "c ! V % '+= % '"d&DA@ " e&E<@"e&E7@"e&2@"e V ( "d e V  "d% V  "c! V % '+= % '"d&D/@ " e&E*@"e&%@"e V  "d e V  "c! V % '+= % '"d&De@ " e&E`@"e&E[@"e&EV@$"$e&Q@,",e&L@"e V B "d e V 5 "de V ( "de V   " d$% V  ("(c,! V % '+= % '"d&D4@ " e&E/@"e&*@b%&E%@"e V  "d e V  "c! V % '+= % '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@"e V 5 "d e V ( "de V  "d% V  $"$c(! V % '+= % '"d&DF@ " e&EA@"e&E<@"e&7@ b %&E2@"e V ( "d e V  "d% V  "c! V % '+= % '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@"e V 5 "d e V ( "de V  "d% V  $"$c(! V % '+= % '"d&DX@ " e&ES@b%&EN@"e&EI@ " e&ED@("(e&?@"e V 5 "d e V ( "de V  "d % V  $"$c(! V % '+= %j ' "('C'"(, 04X3&  8<@$'+= % '("z@& $ (DHLPT,' DHLPT,'%O %%_ x'+" % '  $%%%%%%8''!$7W!$B$a0k%% %( %%%%8 % @,$%`'%h%!$7W!$B$a%+X`!!` 't'!$ !$Ap  <~c$ C/"8@!8- a8 a8' 8@D H*& <B$LP4'8@D H& <@B$LP4'LP4'8@D H& <@B$LP4'$%_ W %%G += % '%%%% 4$%% %@0T*0%<4$8P! a/ $ j 80+(@(<@ $,.<hl ƌ -.0';'!$ !$A-0.1$2$3456789:;'0' $ Ė +,>+,)*<)*0@B60/0$# B02B!c$% .%(,%0Z0-%8G+Pi@+P"@$#P W $PJ!PFKJR %PKJ1!X* b%+`b+`I$#`g $H,!H&<+h2X*4T\8' W& @X#"!$@#T$D$\p8t2x*z4|<#X`!d`H+(dd $ 48:$ 1W  c$2$ L%0D%8J%8'F%0$0%8B%8D%8F%8$8 R %@HN \ %HiT %@H Z %HiV %@H$@ %H* R %HIT %H*V %HI$H$b %PL^ l %Xd %Pj %Xf %P$PC%Xb %Xd %Xf %X$Xdr %`n |%ht%`z%hv%`$%`j %`l %`n %`$ ,z%hv%h|%p%p~%h$h%0%hr%ht%hv%h$hM%8 z%hv %h|%p %p~%h$h%@ %h r%ht%hv%h$h%Hz%hv%p|%h%p~%h$h%P%hr%ht%hv%h$h%Xz%hv%p|%h%p~%h$%#%j %l %f %$C%&%d$d% bn%`jt~ % %2 %r    % %  %ș   ^%X\%X^%X|    $''+" % \\'!0#+#de2% .f<%(4% f:%(6% f%(f2%(f4%(f6%(f gB%0> hL%0&D%8 hJ%8'F%0 h%8 hB%8hD%8hF%8hiR %@ N j\ %@hT %HIjZ %HiV %@Hj%HIjR %H*jT %HIjV %HIjkb %PL^ ll %Xd %PLlj %Xf %Pl%Xllb %Xlld %Xllf %Xz%hv%p|%h%p~%h&x$x& &h%pz%p|%p~%p&x$x&(&p  %x %x% %P%x/&$!&0&x %0 %%%0&$"&8&%3%4%S%%q&($a&@&3%r%r%r%r&2$b&H3&S%u%v%%%&S$&PA&a%t%t%t%&s$&Xb&b%t%%f%`d%`f%`> %8< %8 >%8   | N %H<x L %H<t N %H p l h ^%X|d \%X|`^ %X\XTv%pPt%pLv%pHD@%<%8%40,%\(%\$% dstuevxyf d d l d dddhddgddd|djxdtdidpdldhdmdd`dk d\dXdTdoP dL d n dH dDd@dq<d8dpd4d0d,da(a$arb aa|'+= % ',"#"%D$,%E$%d$*%&%$%$"%$$%$&%$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@ N *\ %@ T %H**Z %HiV %@H*%H**R %H**T %H*!%)0*+b %PL^ ,l %Xd %P,j %Xf %P,%X,b %X,d %X,f %X, -r %`n .|%ht%` .z%hv%` .%h .r%h.t%h.v%h./%p~0%x/%p0%x/%p0%x0%x0%x0%x01%2%q%P2%q%P2%Q2%Q2%Q)N %H1!J!c+PJ!P*$c%c'X@$c%q! !X+`!Xl! d+!k$X%('``$(%(e/!0!X+`!Xl!0+(!(e$X%8'`$8%8g?!@!X!+`!Xl!8+@!@ $X!%!'H$!%+#&!0!"+"!J'H@$H*O ! $+H!H#'P $C!0f+!e'P`$(E/!(+8!8'P$@ G#@&1!@+!"V%JT\%PKZf%Xblvz %x %0 %2   %%% %<%<%ș (   $'+= % ',"#"%D$,%e$%$*%&%$%$"%$$%$&%d$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@ N *\ %@ T %H**Z %H+V %@ *%HI*R %H**T %HI!%)0*+b %P^ ,l %Xd %P,j %Xf %P,%X,b %X,d %X,f %X, -r %`n .|%ht%` .z%hv%` .%h .r%h.t%h.v%h./%p~0%x/%p0%x/%p0%x0%x0%x0%x01%P2%q%P2%q%P2%Q2%Q2%Q)N %H1#PJ#k+J#"'`$q&c'`$b%q#X#`+ # #c+Xc# 'X$X&('($(%(e/#X#`+0#0#(e+Xe#0'X$X&8'8$8%8g?#X#`)+@ #@#8g+Xg#@ 'X $X+&!' $%a#&!0#A+HA#HI'@$"#b+b#' $ d'# +(#('0$07#0+8#8'@$@G#@&1#@(+(#!JV%H*T\%PKZf%Xblvz%x%%Q%%%8 %ș%ș%< (   $'+= % ''3'!$ !$A'8< L' <8 N' 8W' $  4''+" % '"#"%$,%$%$*%&%$%$"%$$%$&%$ %2% . &<%(4% &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%8'D%0(J%8'F%0(%8(B%8(D%8(F%8()R %@HN *\ %HiT %@H*Z %HiV %@H*%HI*R %HI*T %HI!%)*+b %P^ ,l %Xd %P,j %Xf %P,%X,b %X,d %X,f %X, -r %`n .|%ht%` .z%hv%` .%h .r%h.t%h.v%h./%p~0%x/%p0%x/%p0%x0%x0%x0%x01%P2%q%P2%q%P2%Q2%Q2%Q)N %H1 ]* x`| d ]* Xpt \ ]* Phl T ]*  xX!(|\!H+0!0&$H%8'@$8%8'?pP!@ tT!`K+H !H!8L+@!@($HK%PK'X$PK%H*O h!PAl!`c+A!!H*+P*!*$Pc%c'X $k%C!bH+C! ]* x|  ]* Xpt \ ]* Phl T ]*  !0!H+(!(%$H%8'@$8%8'?xX!@ |\!`K+H !H!8+@!@($HK%PK'X$PK%H*O pP!PKtT!p+XK!X!H*+P*!Pj$X%`'h@$`%X_ h!`l!p+!!Xl+`l!,$`%'h $%l!b+C!L! !h+8!8$h%@'`$@%@G!`!p+H!H.!@ +` !H$`%P'h $P%PW H!`!p-+X!X!PL+`L!Xl$`-%-'h`$-%!"+A!# ]* x|  ]* Xpt \ ]* Phl T ]*  !0!H+(!(%$H%8'@$8%8?xX!@ |\!`K+H !H!8+@!@($HK%PK'X$Pj%HIO pP!PKtT!p+XK!X!H*+P*!Pj$X%`'h@$`%X_ h!`,l!pm+!!Xl+`l!,$`m%m'h $%l!b+C!! !h+8!8$h %@ '`$@ %@G!`!p+H!H!@ +` !H,$`M%PM'h $PM%PW !`!p+X!X!PL+`L!Xl$`-%-'h`$%!"+A!# ]* x|  ]* Xpt \ ]* Phl T ]*  !0!H+(!(%$H%8'@$8%8?Xx!H \|!`K+@(!@!8+H!@ $HK%PK'X$Pj%HIO Pp!XKTt!p+Pj!P!H++X+!PK$X%`'h@$`%X_ h!`,l!pm+!!Xl+`l!,$`m%m'h $%l!b+C!! !h +8!8$h %@ '`$@ %@G!`!p+H!H!@ +` !H,$`M%PM'h $PM%PW !`!p-+X!X!PL+`L!Xl$`-%-'h`$%!"+A!#`d  $(,048<@DW' '`'+" % '("#"%D$,%$%$*%&%$%$"%$$%$&%$ %2% . &<%(4% &:%(6%  &%( &2%(&4%(&6%(&'B%0>(L%8'D%0(J%8'F%0 (%8(B%8(D%8(F%8()R %@ N *\ %HiT %@H*Z %HiV %@H*%HI*R %HI*T %HI!%) ]*    ]* ` d ]* Xx| \ ]* Ppt T  ]* Hh Ll  ]*  `!(d!H+0!0&$H%8'@$8%8'?X!@ \!`K+H !H!8+@!@($HK%PK'X$PK%H*O xP!PK|T!p+XK!X!H*+P*!Pj$X%`'h@$`%Xl_ Hp!hLt!+`!` !Xm+hm!`$h%p'x$p%ho h!p+hl!h!8'!x+!$x% '@ $ % '!I!@j+HI!@ ! +!H$@j%j'H@$#%!@k+!l'H`$H,O !H.+P.!PM'X@$X_ !h!x+`!`'x$x%pw!x!+(!(!p+x!('x$x%07!x!!+8!8!0+x!8'x$x%!x!B+ ! !/+x/! 'x$x%!x!c+@!@!O+xO!@'x$xo%!x)!J+H!H !o+xo!H'x $xO%PW !xk+X!PO+xO!X ]*   ]*   ]*   ]*  !(!H+0!0$H%8'@$8%8'?!H !`K+@(!@!8+H!@($HK%PK'X$PK%H*O !XK!p+Pj!P!H++X+!PK$X%`'h@$`%Xl_ !h!+`!` !Xm+hm!`$h%p'x$p%ho !x!+p!pN!h+x!p$x%'$0%x!0!q+!2!x+!$q%q' $q%!P! $+P! !b+b!D$  $(,048<@DW' '+= % '("#"%D$,%E$%d$*%&%D$%$"%$$%$&%d$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@ N *\ %@ T %H**Z %HiV %@ *%HI*R %H**T %H**V %HIW $#Xj $hLJ%pL J- p j-Xl X %P<6$H7!XM!`j+b!$`j%j'P@$j%! d+!'``$(/!0+(!('h$8?!8+@!@(O#H 'H )1<6$@#Hi+Xi#K$PJW #P+ #d$ l'# +0#( $07#0+8#8B ^%@h\ d%Xbn %`jt~ %0 %Q %S%%8%<.%(,%( .%()(+,"-./* 0 1 2 # 345$689 """"&" "%'""<$'+= % '&$ ]* L4P 8&$ ]* ,DH 0&$ ]* $<@ (&$ ]*  L,!(0P!H+0!0&$H%8'@$8%8'?$D!H (H!`K+@(!@!8+H!@ $Hj%Pj'X$PK%H*O <!PA@!`k+A!!H*+P*!*$Pc%c'X $k%C!b+C!d4!P|8!hl+ D! x$h%X'`$Xl%X_ !(!p+`!`!Xe,+(e!(t$`%0'h$0%07!8!p+`!`!0p+8!8l$` %@ 'h$@%@G!H!p+`,!`!@ h+H !Hd$`%'h $-%!"+"!b&$ ]*  |!#x!(+#!$(D%D' `$D%,!D+ Dt! '0$(/p!(+0l!0'@$8?h!8+@d!@('P$H*O #H &)1!H!+!!a V%CT \%PjZf %Xlblvz%x%0%2%%%|p%h%`%\XT |ph`\XT'<B$&" CB%% &A@% %(%%"8A,!0Ɛ!8d&0$%(*00B$+= % '<`!$ $  A,' A$$B$# B0!b #(` $& b   $ ݋ %8G:<6% *($0+8F&8+@#@G#@G$@!@(#0, '!8 $+P&@P'% %G %$G %%_ %%W $G % G %_ %W '+" % '"#$ %&'()@ *$+(,,-0.4/80<1%%%%P%Xhl`dX\PT\!4 &<1B4]* < D]<>4 &<15]* 0 4x|]<>4 &<15]* ( ,pt]<>4 &<15]*  %8%P |%8gx%Pt%8p%P#x#P +P #P%8G?#8+P#P %0!4!S+0!$S%S'$S%T—(!t,!+!!T(+T!$%'`$%§!5!v+!8!+!$v%v' $v%u!b$+C!y/6$xM<6$y/%0B%0D%0F%(%0g, J%8F T %8L %@  R %@ N %@H R %@ T %@ V %8'%@Hi,} Z %H+V d %P\ %Hib %PL^ %Pb %PLd %PLf %Hi%P k,]`j %Xmf t %`l %Xr %`n %X%`j %`l %`&% ,d,4$:%(6D%0<%(B%0>%0B%0D%0F%(%0g, J%8F T %@HL %8' R %@HN %@H R %@HT %@HV %8'%@Hi, Z %H+V d %P\ %Hib %P^ %Pb %Pd %Pf %Hi%P k,`j %Xmf t %`l %Xr %`n %X%`j %`l %`&% ''!$ !$T''!$7W!$B$D<%T'!0!E '$8!8)$H !H%!$!%  b %PL^  l %Xd %PL j %Xf %PL %X b %Xl d %Xl %c]* 4LP 8 ]* ,DH 0 ]* $<@ ( ]*  L,!@ P0!`K+H !H,$`K%PK'X $Pj%PW D$!XlH(!x+`l!`!PK+XK!Xl$`%h'p`$h%`g <!h@!x+!!`+h!$h%'p $%!b+C!d4!88!p+ ! $p%0'h$0%07 !8!h+@!@ !0+8!8$@%('H$(%%(/!8!@+H!@ !(+8!8$@%0'H$0&%07!8!@+H!@ !0+8!8$@%'($%!(!+!C!%+%!CD<%% %(%$+0b0+8F#8F#@f#@G$@!@ $+P'@}T'$|a' a,p XT*6%(4<%0:F%8BLVdefgahija,S `\*6%(4<%0:F%8BLVd e f g a hija,7 hd*6%(4<%0:F%8BLVdefgahij a, pl&%$,% *6%(2<Fbcdeafgh' $W $W $W $W % %G %_ W $W $W $W $W $W $W $W $W += % 'P8 '@'!$ !$`X%)H''!8#@e#@G$(!(R %@ N \ %HiT %@ Z %HiV %@H%HIR %H*T %H*.%(%!$%( ($+0b+0E'h' $LUA% '! ?g0 $#@H $0F J- 0 - H , % $% 0!0A@ $Ġ%U#(`#$!,Z%'!d%$0!0njƌB=5%0($@!@f2%0f%#(`@<*%% 48V$D!"! D0 pd'$ &C&&&'$i' D!$L#(`A_<}c4a C!V$ p# $,AI%$G %$G %_ W += % '0$,$%%7#@g#@G$@( L%8'D%0J%8'F%0$0%8B%8D%8F%8$8 R %@ N \ %@ T %H* Z %H+V %@H$@ %HI R %HIT %H*V %HI$Hb %P^ l %Xd %Pj %Xmf %P$PC%Xb %Xld %Xlf %X$Xr %`n |%`t%hz%hv%`$`%hr%ht%hv%h$h !%p~"%p%x#%x/%p$p$%x%%x&%x'%x$x()%P*%q%P+%3%P$,%Q-%Q.%2/%Q$01%T2%u%3%u%T$r4%S5%S6%r7%r$ ST%uU%v%U%%$a%0S%tT%tT%tT%$b%8gS T%u U%v% U%%$a%@ S%t T%tT%tT%$b%HiST%uU%v%U%%$a%PSS%tT%tT%tT%$b%XkST%uU%v%U%%$a%`lS%tT%tT%T%$b%hm S!T%"U%%#U%%$a%pn$S%t%T%&T%'T%$S%xo(S)T%*U%%+U%%$3%,S%t-T%.T%/T%$S%q0S1T%2U%%3U%%u$3%#4C%t5S%c6S%c7R%C$C%D&%$% D%S % %8 %<  | x N %H<t L %H<p N %H l h d ^ %X|` \ %X|\ ^ %X X T Pn%hLl%hHn%hD@<~%x8|%x4~%x0,(%<$%< %  |xtplhd`\ XTP L!H"#$D%@&<'(8)4*+,0-,.(/0$1 234567''+" % 't!0#+#lde2% .f<% 4%(f:%(6% f%(f2%(f4%(f6%(f gB%0> hL%0&D%8 hJ%8'F%0 h%8 hB%8hD%8hF%8hiR %@ N j\ %HiT %@HjZ %HiV %@Hj%HIjR %H*jT %H*jV %HIjkb %P^ ll %Xmd %Plj %Xf %Pl%Xlb %Xlld %Xllf %X l!mr %`n "n|%ht%`#nz%hv%`$n%h%nr%h&nt%h'nv%h(n)o%p~*p%p.%x+p%x/%p,p%x-p%x.p%x/p%x0p1q%2r%p%Q3r%q%4r%Q5r%Q6r%Q7r%QpST%uU%v%U%%&d$& &uU%U%U%U%&$&(&,U V% X%6% X%6%&$&0&$ X% X%X%X%&$&8D&(XY%\%%8Y%%#&h$!&@&yY%8Y%Y%Y%8&8$"&H9@& Y\%\%%Y%%#&j$!&PY&yY%8Y%Y%8Y%8&x$"&Xy<& Y!\%8"\%%8#Y%%#&l$!&`&y $Y%8%Y%8&Y%8'Y%8&ȸ$"&h8&(Y)\%8*\%%+Y%%#&n$!&p&y,Y%8-Y%.Y%/Y%8&$"&x4&0Y1\%82\%x%83Y%%y&p$!&&a4C%x5X%x6X%7X%&q$&"0&b%%8%șd`\%\X%\T%\PLH> %8D <%8@ >%8 < 8 4 N %H0 L %H<, N %H< ( $  ^ %X| \ %X| ^ %X   n%hl%hn%h~%x|%x~%x%<%<%%%% %%%%%% %%%|xtp%l%h%d`\%X%T%PLHld`\X T D P LHD@@<840,<($  !"#8$%& '()*+4,-./012304567psddq,dddd$d d d d( d ddddddd dddddddddddd d!d"d|#d$dx%dt&dp'd(vl)dh*d+t,dd-d`.d\/d0aX1aT2a3u4bP5aL6aH7ah''+" % ||'"#"%D$,%$%$*%&%$%$"%$$%$&%$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0&D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@HN *\ %@ T %H**Z %HiV %@H*%HI*R %HI*T %H**V %HI *!+b %PL^ ",l %PMd %Xl#,j %Xmf %P$,%X%,b %Xl&,d %Xl',f %X(,)-r %`n *.|%`t%h+.z%hv%`,.%h-.r%h..t%h/.v%h|0.1/%p~20%p%x30%x/%px40%x50%x60%x7!%/t%P%q%P%q%P%Q%Q%Q%Q % %% %% % %%%%%%%%%%%%%6%%6%%6%8%8%8%8 ! %9"t%p%!#%p%!$%p.%%p.&%p.'%p.()j%h*d%`%h-+%`%h-p,%`,-%`,.%`,/%`,l01b%`2l%h%`,3%h%`,4%h-5%h-6%h-7~%h!P!x#+P!x$#%#'$#%p! D!e+!! d+!p$e%(e'`$(%%(/!0!+!!(+0!0$%8'$8%8?!@! +!0!8+@!@$ %H '$H1%H O !PA!+A!!H*+P*!A$P%X'p $Xn%PKW p!Xnl|!+pn!p!PK+XK!Xn$p%'`$%pwx!t!+` !`!p+!` $%h'$h%h o !+!O'@$x! +x!xo'$#!(e+!f'`$07!+!2!0+8!8'$%@ 'h$@ %@(G!H +@(!@'h$!P*+A!+'h $Xm_ !Xn+hn!h'p$`g !p+!'$Q! D+!'@$x/!(+x!xh'$#!+!2!f+0f!0&d$%8'`$8%8'?!H+8'!8`'`$@G!P +@H!@\'`$!++X+!Xmbn%`l%h-%2%%%|x%<t%<p%șlXT~%xP|%xL~%xHD@ 6%0< 4%086 %040, >%8( <%8$> %8 F %@D %@ F%@    |xtphlXTPLdHD@ <!8"#`$4%0&,'(()$*+\, -./01234 567''+" % ||'"#"%D$,%E$%d$*%e&%$%$"%d$$%d$&%$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0&D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@HN *\ %@ T %H**Z %HiV %@H*%HI*R %HI*T %HI*V %HI *!+b %PL^ ",l %PMd %Xl#,j %Xmf %P$,%X%,b %Xl&,d %Xl',f %X(,)-r %`n *.|%`t%h+.z%hv%`,.%h-.r%h..t%h/.v%h|0.1/%p~20%x%p30%x%px40%x50%x60%x7!%/t%P%q%P%q%P%Q%Q%Q%Q % %% %% % %%%%%%%%%%%%%6%%6%%6%8%8%8%8 ! %9"t%p%!#%p%!$%p.%%p.&%p.'%p.()j%h*d%`%h-+%`%h-p,%`,-%`,.%`,/%`,l01b%`2l%h-%`3%h%`,4%h5%h6%h7~%h#xP#q+O#'`$0&q'`$b%p##+ # $#+# '$p&(e'($(%(/##+0#0&#(+#0'$&8'8$8%8?##8+@#@(#8+#@' $&H8'H $H(%H O #A#n+PA#P #H)+)#A'P`$P&X'X`$X+%PKW p#pn|l#+Xn#XK#P+p#Xn'p$p.&0'$ %pwx#` t#-+ #P#p+`#` ' $&h-'h$h%h o #+x#xO'@$O#b+b#' $ d'# +(#('0$07# +#2#0+8#8''$-&@ '@$@%@(G#@(+H(#H)' $!#A+PA#Pj'X`$XK_ #X+h#h'`$`g #p +#'x$x#xO+O#b'`$C#+ # h'($(/#+#2#(+0#0&d'$,&8'8$8%8'?#8+@#@(`'H $H O #H)+)#A\'P@$PAW #Pj+Xj#Xbn%`l%h-%2%%%8|x%șt%șp%<lXT&% P$% L&% HD@6%0<4%086%040, F%@( D%@$F %@   % %  %<    |xtphlXTPLdHD@ <!8"#`$4%0&,'(()$*+\, -./01234 567'+= % ''K'!$ !$A'PT }' TP ' PW'8$  L''+" % TT'CD*%e&E4% ,%E2% .%pE% E*% E,% E.% lE F:%(6 GD%0<%( GB%0>%(h G%0 G:%0G<%0G>%0dGHJ%8FIT %@HL %8'IR %@HN %8'`I%@(IJ %@ IL %@(IN %@(\IJZ %H+V Kd %P\ %HiKb %P^ %HiXK%PjKZ %PKK\ %PjK^ %PjT K!Lj %Xmf "Mt %`l %X#Mr %`n %XP$M%`%Mj %`&Ml %`'Mn %`L(M)Nz%hv*O%p|%h+O%p~%hH,O%p-Oz%p.O|%p/O~%pD0O1P%x2Q%P%x3Q%P%x/@4Q%05Q%06Q%07B%P<%3%%q%%q%r%S%r%r %u %% %% % %%%%%6%%6%%%%%%%%%%%ș%<%ș%ș ! %"%_%# %"%$%%%_&%'%()z%x*t%p%x+ %p.%x,%p-%p.%p/%p01j%h2d%`%h3 %`,%h4%`5%`6%`7%` \`dhlptx|$'X'!$ !$A\` ]*  hd ]*  `\ ]*  XT ]*  PL ]*  HD ]*  @< ]*  $(!0!P +8!8G$P %@ 'H$@ %@HG!H*!hl+P*!P!@ +H !HI$Pl%Xl'` $Xl%PKW !Xl!x+`l!`!PK+XK!X$`%h'p`$h%`g !h!+p!p.!`+h!h$p%x'$x%pw!x!2+!p!p+x!x$2%2'$2%‡!"!D+"!b!+!Q$D% D'@$ % $'!+ d! $}40,$  (8\'!bdcpl ]*  hd ]*  `\ ]*  XT ]*  PL ]*  HD ]*  @< ]*  8$'!(0!84!X*+@!@ $X*%HI'P$HI%HiO (!PK,!p+XK!Xn!H*+P*!Pj$X%`'h@$`%Xl_ !`$!+h!h!Xl+`l!`$h%p'x$p%ho !p!+x!x!h+p!p$x%0'$0%x!!S+!4!x+!0$S%r'$r%2!S !+S!v!2+2!r$%'@$%tŸ!!+!!t+t!4$%' $u%!!+H!H$%P' $P%PW !!+X!X !PU+U!Xu$%`'`$`%`g !!+h!h !`+!h$%p'$p%pw!!+x!x!p+!x$%'$%‡!!+!!+!5$V%V' $%—!!+!!U+U!u$6%6'`$%!b+C!d!"+A$!#%8 %0%H %@ %X %P %h%`%x%p%%%%(%% %(tx|$'t' ' ''+" % pp'" #$%&'@@O *@X %Hi_ $,@h %Xo (.,/|@@%h-%ST UVXY\O$N L,J (G4J0R0*x@ %Qt— 4*p@ %2— l*h!d!PT!a+T!T$3%3'@$a%!!+v!!3+3!$%'`$%§!$!+ȹ!!+!$%'Ƞ$%·!x!+!!+x!x$%@'$@%@G!`!n+H!H !@ +` !H,$`%X'p $Xn%X_ !8 !p +h!h!Xg+8g!8$h%`'p$`%`g t!h!0+p!p!`+h!h$p%'$%pwl!p+!*!X+P*!P*$%'@$X%2—!!y+8!!A+2!$y%y'@$y%Ÿ|!x!+!!t+!$%'`$%¯p!h!+!!+!$/%x/'$x%xd!!"+@!@(!x+!@$I%I'H$I%!k!H+Xk!H+!C+C!#$H% '8`$ % $'!(!8+H!8! +(!($8%0'H$0%07!0+8!8!H&!XG+`1!Xl$`G%8G'P`$8%8?!+8'!8G'P$PJW !`T+P!Pj'h@$hmo !p+!p!h+!p$%0'$0%07!x+0!0'$@G!+@H!@h'$p! d+!'`$(/!+H !Hi' $Xq_ !a+X+!X'`$8?!`+8!8G`'$PQW !+!2!PM+hM!h-\$%('p$(%(%/!p+(!(X'x$07!+0F!0T'x$@G!@+ !d"~ % | %x/ %2    % % %    %< %<| %șxtp > %8l < %8h > %8 d P Ln%hHl%hDn%h@<8.%(4,%(0.%(,($6%0 4%06%0 |`xtplh\dPL H!D"#X$@%<&8'(4)0*+T,,-(.$/0 1234567'+= % ' "T'C'"T 7#$'!$7W!$B$a'8$ C' X\P't '+" % xx' c$ * g0N#(aa#+#@L <`!$p  L% %\X#e! X\D@`('''!$7W!$B$8< %  8A$+" ` ! $`@$D%0:DNCDEFBGHI "#".% ,4%(2>%0:DNC D E F B GHI"#".% ,4%(2>%0:DNCDEFBGHI"#".% ,4%(2>%0:DNCDEFBGHI$" #".% ,4%(2>%0:DN C!D"E#F$B%G&H'I,"(#".% ,4%(2>%0:DN(C)D*E+F,B-G.H/I4"0!&%d$,% *6%(2<F0A1C2D3E4B5F6G7H+= % ' ,* b%% %% %%((%P%X!`J%_ *`C$+`DJ` !h +pAA!x!x!+h!h-!xo+X!Xm$h%p'`$p%h+pF'! c$_* b+ b !8!8+P!PH'X@$@ +Xf`48 '%%G %G % %G %% G % %G += % ' ,* b%% %% %%((%P%X!`J%_*`C%+`DK` !h +pAB!x#x#+h#h-#X+x#h'x$x&p'p$p%p+xF'! c$_* b+ b !8#P +@ #@'8$8+Xf`48 '%%G %G % %G %% G % %G += % '< 8 <%%% - 80!P*KL!`!h+0!0$h%8'X$8%8?!8+(!((!X ,!h+@h!@$h%0'`$0%07! +0'$KH!%%H*0E$(,0D! aP T]* <$+"`+0 8!A$#4'%%G G += % '0'd'!$ !$A0'$ (<@$$pt Δ' lW$ 0' $Փ' (,0'$ (<@$$ Δ' l$ 0' $Փ' h''+" % \\'h''!$ !$A0'd'!$ !$Ah'(%0%8@D $'' 'T7' P'X '!XlJ%h !hnm@%G %_ %_ += % ' '@'!$ !$A 'Ho' '' 'H7' D'h'+" % '0'd'!$ !$A''!$ !$Ah''!$ !$A' '!$ !$A' o' h'$o' 0'$ 'h' $Փ' (,'$ 0'(<@$$ $Փ' ##+ #d% 0'!0njȌ'H`$@ 'H@$8'! $PB%8Ǭ$ d% Ĭ!$$(0'' 0'7' 'h'+" % '0'd'!$ !$A''!$ !$Ah''!$ !$A' '!$ !$A' o' h'$o' 0'$ 'h' $Q' (,'$ 0'(<@$$ $Q' ##+ #d% 0'!0njȌ'H`$@ 'H@$8'! $PB%8Ǭ$ d% Ĭ!$$(0'' 0'7' 'd'+" % '0'd'!$ !$A''!$ !$Ah''!$ !$A''!$ !$A'$o' h'(o' '$ '$ Δ' 0''8$  0' D' $3h'!CDB'$ '$ Δ' 0'$ ' $$Փ' (,0'!#!D+#!" D' !$ `d$(040' D' ",@0'' 0' 7' '(0'!($8!8$G @'+" % 'D 78$ [D' $D' H 7 8 $ 8$ [D' $D'  * #(# a" +(#,  < !$p , %, < #d !A , < 8 4* a0# #( 4 $ +(a8 , 8  < B$p , , < #$ !b  4 , < 8 8 8  4 ''!$ !$L '$ Μ' \''!$ !$A d$( $\$'['!$ !$$<`$ 0 8C$\'% %'!$7W!$B$p$$'['!$7W!$B$a( !$0 j ( ' ( +"q`8 !()?!0&0C0 ,`, $0p*< T%!0$t'%!$7W!$B$!t'' 0 t'F' ( , 8  +0%84 !gG!8&8C8,($8q'!8'$'%!$7W!$B$Aca'' 0 '' ( 8  4 P @ '%$G %G % $G G l l += % ' 'D'!$ !$ALW<c$| <c$ $L8D$| <c$(,LpD$| <c$04LD$| <c$8<LB$| <c$@D<#B$$ ' $g PTH'+= % ''G'!$ !$APWC$H'(<`U$ ' P'T w' '(<`Uc$H ' H'T w' L'+= % '$78"$p#$$$%$ }' $ ~'  ~'  ~'  }' $ }'  ~'  ' $ ' $ ' $ ~' $ ~'  ~' '+= % '7p"$ }' d' '+= % 'dWhw8D$TpE$PF$\G$X8h$Hpi$L'G'!$ !$A' ~' XTd ' Td }' dXH ~' Th ~' 'L ~' \Td ' XTd }' dP' ' TP' }' PdT ~' d\ ~' TX ~' `'+= % 'P7#$o$$'!$7W!$B$aP8A$H!$7W!$B$H'G'!$7W!$B$aPpc$(<`U$ ' L'+= % ''G'!$ !$APW8C$pD$HT 8z' '(<`Uc$H ' H'T w' L'+= % '$7(W8#$8D$p%$pF$, w' , w' , w' '+= % '7Wp#$D$ ~' d' 'x'+" % '&   ' "$% '!$7W!$B$a '' $''!$ !$A$' ' ' $' $'' $"p!  ' !$*"`+= % '074W8C$(8$$p%$F$$G$($pI$  }' (4 ' $ ~' (<`VB$ ~'  }'   }' ,''+" % '''!$ !$a$$$K$$$''!$7W!$B$a''!$7W!$B$a(p%Cpp&A ' l''!$ !$A7l'8$ V "$#% !($0(' ,%`(<(!$/<` !$ ' '9$ Ȫ'  Ȫ' !'r$ ' `''!$ !$A`'!'r$ ' ''_'!$ !$A`'' ''9$ '  ''!$ !$A$ @@@?0!0ɐI %8' -# @!@0'$+@H$Ɛ670!8琀8%0- '%$G %%G %$G %%G %$G %%G %$G %%G %G += % '%%!0B9Ǡ !$B$&(F,w0!0ƌG$<5#0, 8!8I$#8*-@H !H#)J$#H K-`P !PCJK$#P l-X !XckL$#X -` !`M$#` -h !hN$#h -p!p΍#p+x$!x/$2@%0+!x&$+x!0xϠ&$:x %8+xs!0Ǡ&$9 I %8'+Hf !0Ǡ&$+8\!0B8 Ǡ&$B: I %8'+HN !0Ǡ&$+8D!09 Ǡ&$; @H %8'+H6 !0Ǡ &$9 I %8'+H) !0Ǡ &$+8!08 Ǡ &$: H%8'+H !0Ǡ &$+8S '%%G %%G %%G %%G %%G %%G %%G %%G %%G %%G %%G %%G %G %$G % $G % $G % $G % $G % $G %$G %$G += % '%%8!8 !$B$&(+0% &$!8a+@!0fȐB%80<5#8I, H!H$''$+H ƐB1!8g8)$%0+8%G$!Hi*R %0F0#0,@8!8&$+8G$)H !0fʐQ %HI)1#H ,@8!8'$+H Ɛ1!8g@8)$%0+8%G$!Hi*@R %0F0#0,@8!8&$+8'9!0fƐ1)$%0+8%qG$!Hi*S %0F0#0,c@8!8 &$+8XG$)BH !0ʐQ %HI)1#H ,H@8!8 '$+H= Ɛ1!8琀8 )$%0+8%/G$!H#*R %0F0#0,!@8!8 &$+8G$)H !0Ɛ@1%0#0,@  '%$G %%G %$G % %G %%G %$G %%G %$G % %G %%G %$G % %G %%G %$G %%G %$G % %G %%G %$G %%G %G += % '%%!0猂8Ǡ!$B$@&(FF,fw0!0+8$]!8ȌG$,R($ƌ28!8錀H %0&+HC !@F$,9($猂90!0ɌI %8'+H* !@G$, ($ƌ18!8錀I %0&+H !@&$+@ '%%G %%G %$G %%G %$G %%G %$G %G %$G += % '%%$%8%@!$ )( +H#k !H %P<%%)$+X!!0ʠ!b% F,),$0  &$ ,PXBg%P+P #P %PK $#Xj`HhgN%x J- ` j- h %P - x %PO!("+H '%%K %% J%K)`X!XKl-׀X !Xfl, $pM O- p%`,k<6&Xw`%@%8G@Xg%@( $% $G %G += % '#$!$ !$a $+"`!$+"` d!e2% "$+0"|."f<4%(% #$+0"o#f:6%(% $$+0"c$f%(%$+0"Z%f2%(&$+0"P&f4%('$+0"F'f6%(7% '!$ '(%$ 'B$G(!8a8G H, 808!8G,8!8$0#H <6$H7)9B8O% 'B($%$G %G %G %G %G %G %G %G G  % w7(!0!80 %O )1!@ <6!H#8 $B;$ɬW!(E(+= % 'R'  $/< Q' '+= % '<)!$$, %@$P,$ 1W AP$%%$+ bA$+ a#bc$# '$$P!E(c8p8u8.8 X4=$ 1W |@ + bD,D$#(/0A$P!(+8aL#bg$#@G$@(!08h8 Ðoc81`Ðnc8`+c8(`Ðoc8$`Ðfc8 `Ðfc8`C8`ac8`lc8 `lc8`.%0$+8"$$#8?0hiJ %@(iL %@(iN !g%8(8/<8/<$( 'G B$D($c$#(/0&!%8/<8/<$( '+= % '/B$C(`3'!d%(&s'% $(%0"$!,!$$#!8!, @'$B!8H!8'@J$!PH!P*J&8%8@ *$!PH!P*J@ K$!@h!@(&@ $%((@'$B!8H!8'@J$!@H!@(&8$%((+= % '/< ` '&'!$ !$a048<D%%.DH%c$d0,.% @'*7e0+!(%02!(*!( ' *$$DH.0,!$$0,,% 0 @@'0'!`B$C(`C,`048< H "$&q' %$G $%0,*!(F,0@0 '!0Ťw(0'!(&03!0f0B!0E$F8(048< H "$&q' ,D( '%(%$G |'+" % '''!$ !$A"$!$ !$A %!$$(wW"!(! %0#%(+'8'!H!PJ!8<4PX <5hh!Xmh!hM+P!PK$*(0'!@!0Ɍ!@ Ȭ$,+= % '%%!8!$B$`&(jF,0!0ƌG$<5#0, 8!8#88I$%0'-u8 !8#H I %0&+H#i !H&G$#0,] 668!8#8@8I$%0'-M8 !8#89I$%0'-?'$H !H%*#P Q %0F+P1@!8&G$#0,% 6B68!8#88I$%0'-'$H !H%)#H @I %0&+H  '%%G % $G %$G %%G % $G % $G %$G %G % $G %$G %$G += % '%%8!8!$B$`&(v+0%!0aǐ0<5#8I, H!H$'G$ɐN N )1#H ,@8!8'$+Hv I$Ɛ67!8gꐀP J1%00#0*-d@H !H$&F$N BN )1#H ,T@0!0ɬF$N O )1#H ,D@0!0ɬ&$+H9 I$>?!0fʐ@P J1%80#8*-'@H !H$'G$ɐN N )1#H ,@8!8G$Ɛ6B70#0,  '%$G %$G % $G %%G %$G %$G % $G %%G %$G %$G %G += % '%%!0 !$&( %0P&$+8,!`B$C0Pc,`A0+$` '%G $0,w:!8g0@!8G0+@ !8B$%%G %%G += % '#$!$ !$a%%!$%&(P&$+8c!0Ɛ%8H0+H P $+H'(  'B$C0Pc,`A0+$`!%c` '$ '%G !PJP !H* $*B$I0+P'@+H  I0+P$"@J$J1!H+XD`)!PJ+HI JJ0!Hi+XD` '% %G % %G % %G %%G += % '%%?0!@#A)$%8+@$p!@#? 1K *$%8'+HDc FG1!HC)H *$%@(+HDT !HC)J %@( <#P%#X&#`'#h(W <6$PW_ <6$Xwg <6$`o <6$h#(E#0f#8#@J,0@W%H+%8G%%!d`<e!$#(`#$@('!(dg,!d<%(e`P#$de,lptx%!$"( @'!(Cl'!E$E|,'' |%$`B$D( l'!(8%0 %'$%(%8 '('!$ !$$HpP !Bd*,@P!PGK<6$Xw KLb ^ %X<6$Xw+%X !bd+,f`JT X!Xgl1d %PjlR f %P<6$PWj<6$PW)%H !"d),F iN P!PGKk1Z %Hi IKL \ %Hi<6$H7$IJ <6$H7(%!$)( H '!H*)<6+X7`'!hn-X !Xi+%)9 '%d% $G d$G d$G d$G %d$G %d$G P !PDIGB$J(@P!PJdK-`% d$G %G %_ O _ O '+" % ll'D''!$ !$A"'C'!$ !$A''!$ !$A$$w"'&( $  B C'"'"$ Ȫ' !( 'D'$ $' %'B$C(`d(D'!(DF$!0Ɛ2%(F$!0Ɛ4%(<6$(<6+0f, 7!#ec$%$G '+" % hh'd''!$ !$A!$ $"$#$# "$#"K4"-$" $ " '+= % '.<F.<F' <$$(<@!$,048'+= % '0<@B$&" 4%1  D ! ( 8`D"$' 8`4!7,% $(%0"$!,!$$#!8!, @'$B!8H!8'@J$!PH!P*J&8%8@,*$!PH!P*J@,K$!@h!@(&@ $%((@'$B!8H!8'@J$!@H!@(&8$%((+= % '/< ` '&'!$ !$a048<D%%/DH%c$d0,.% @'*7e0$(p!(%0:!(*!( ' *$$DH.0,!$$0,,% 0 @@'0'!`B$C(`C,`048< H "$&' %$G $%0,*!(F,2@0 '!0Ťw(0'!(&0$0q!0f0J !0E$F8(048< H "$&' ,D( '$%(%$G |'+" % '''!$ !$A"$!$ !$A %!$$(wW"!(! %0#%(+'8'!H!PJ!8<4PX <5hh!Xmh!hM+P!PK$*(0'!@!0Ɍ!@ Ȭ$,+= % '%%!0 !$&( %07&$+8,!`B$C07c,`A0+$` '%G $0,w:!8g0@!8G0+@ !8B$%%G %%G += % '#$!$ !$a%%!$%&(7&$+8c!0Ɛ%8H0+H 7 $+H'(  'B$C07c,`A0+$`!%c` '$ '%G !PJP !H* $*B$I0+P'@+H  I0+P$"@J$J1!H+XD`)!PJ+HI JJ0!Hi+XD` '% %G % %G % %G %%G += % '%%?0!@A)$%8+@#-!@C%8<#H#PO <6$H7W <6$PW#0&#8GI, %H+%8G%%!d`<e!$#(`#$@('!(dg,!d<%(e`P#$de,lptx%!$"( @'!(Cl'!E$E|,'' |%$`B$D( l'!(8%0 %'$%(%8 '('!$ !$$HpP !Bd*,@P!PGK<6$Xw KLb ^ %X<6$Xw+%X !bd+,f`JT X!Xgl1d %PjlR f %P<6$PWj<6$PW)%H !"d),F iN P!PGKk1Z %Hi IKL \ %Hi<6$H7$IJ <6$H7(%!$)( H '!H*)<6+X7`'!hn-X !Xi+%)9 '%d% $G d$G d$G d$G %d$G %d$G P !PDIGB$J(@P!PJdK-`% d$G %G %_ O _ O '+" % ll'D''!$ !$A"'C'!$ !$A''!$ !$A$$w"'&( $  B C'"'"$ Ȫ' !( 'D'$ $' %'B$C(`d(D'!(DF$!0Ɛ2%(F$!0Ɛ4%(<6$(<6+0f, 7!#ec$%$G '+" % ||'d''!$ !$A"'c'!$ !$A''!$ !$A$$w"'&(@$  b c'"'B$ Ȫ' !( 'd'$ $' %'B$C(`d(d'!(0$+@<5#0i,% 7!afc$<5+((#, 7(!(%c$%$G %$G += % '%W!C !( ' !$"(@''+" % 'd''!$ !$A"'c'!$ !$A'l'!$ !$A$$xW"'& b@$  |b c'"'B$ Ȫ' 'd'$ ' td'$ ' p'<'+" % '"''!$ !$A'<'!$ !$A$|$Lw' $ Ȫ' '"'$ ' H"$"#*%&$4%f,% %2% .&% '2% (4% )6!$ !$A%e%$$%0(H!(8!8$I0#H <6$H7)9B8O!$%'B%0,@D'('"'$ ' @% , "'!80$+@%$G %B$C(`7!#% (!(e=<6$0@C!0#0<6!8?<6$8!0<6!0$,%B$C(`7!#% (!(e<6!8?<6$8!0<6!0$( % $( w7W*!0!8!(%@ H!P&!X'k!H%)!HiI% - += % '% W!C!$' "(@ '%c$d(7"! $%( $(0!0ƌ?<4#0G&0#0+0$  % $( w7W*!0!8!(%@H!P'!X%!H&),1%o 1!`<6!h#H, )%BK %Mi )  % $( W7w*!0!8!(%@H!P'!X%!H&),%a  $`q ׀:#@#@G$@H!8#H!@h%P%X  'h !hJ%k%L)+`I!` 1<5#ho-x !xm%f g 1#`-% $G % $G % % G %%_ += % ' ,($%%w:!8g#8#@#HO $HI!H -' !$B$ ,($'(+8'%%_ += % ' ,($%%w:!8g#8#@#HO $HI!H ' !$B$ ,($'(+8'%%_ %B$C(`7!#% (!(e=<6$0@C!0#0<6!8?<6$8!0<6!0$,%B$C(`7!#% (!(e<6!8?<6$8!0<6!0$( % $( w7W*!0!8!(%@ H!P&!X'k!H%)!HiI% - %c$d(7"! $%( $(0!0ƌ?<4#0G&0#0+0$  % $( w7W*!0!8!(%@H!P'!X%!H&),1%o 1!`<6!h#H, )%BK %Mi )  % $( W7w*!0!8!(%@H!P'!X%!H&),%a  $`q ׀:#@#@G$@H!8#H!@h%P%X  'h !hJ%k%L)+`I!` 1<5#ho-x !xm%f g 1#`-% $G % $G % % G %%_ += % '% W!C!$' "(@ '+= % '%%!$B$'(+8b8׀:#@#@G$@H!8#Hb!@%P%X  '!h J%k%L)l-` m%!`-h !hi %`+hI% % G % $G % $G %%_  % $( w7W*!0!8!(%@H!P&!X'k!H%)#Hi<6!H7I% - %c$d( W7"!(! %0 8!@!8@;$(+= % '% W!C!$' "(@ '%B$C(`7!#% (!(e=<6$0@C!0#0$,+= % '' '+= % ',' '+= % '7W&A ` $   !$ B$&A`$  '+= % '[' '+= % '< ~!$ 7&" ` $   C$ !$& #$  $ $'+= % '<~!$ [' $ $'+= % '< ~!$ 7&" ` $   C$ !$& #$  $ $(,'+= % '<~!$ [' $ $(,''+" % PP'B8 @''!$ !$A'& C$  '' '!$ $"$#$# "$#"K4"-$" $ " $ '+= % '.<F.<F( <8$$(+@A9#@a#@PG$@ '!@H%G%S !8 !8 !8 !8<&7<&7<&7<&7'' ''!$ !$A%  ''' !$g$% $ $*(@%X !Xhmo&P&`lj!$*(@PK%+`#`#h%%#pw$Xn!X$+xxpq%Pr%q%Pr%3s%qs%3s%3k^ %P%X+d- @!(23&Xk&P0+?K%+%%#Ç$Xp!X+{%qr%qs%%qs%Tt%t%Tt%Tk^ %q%XKd.Y@!&Q&Xk _K%+I%%#Ç$Xp!X+=%qr%qs%%qs%Tt%t%Tt%Tk^ %q%XKd.@!&Q&Xk J%+X `%%#X _ $PK!P+X`%LMz %`n O%h |%`O%h~P%h P%hP%hJV %`%Pdm--gbn%`ldl%`lb>%8gc:g<gcB$C(}`$+(#(#07$08 '!0d, @I!H! $+XE`%)ɠ k$b n%`̠d l%`̠bN %HɠŠJɠLɠ.Š+(`$#0#HO $Hi$!H(dl-tX !Xa+`Fkfk+@l$j v%h-l t%h-j^ %X+&Z+\+6&+0M@$#H#X _ $X$!Xhd-?` !`+hI6l`m$r ~ %pnt | %pnr f %`lib ld lN i+H  $###X_ $X$!Xhd, 8!8+`CW% %G %d$G % %_ % % G % d$G % %_ % %G % d$G % %_ % %G %d$G %%_ % d$G %G % %_ %d$G %G % %_ %d$G %G % %_ %d$G %G % %_ X !Xhmo&`l&PjB$J(@P!P*+X`#X#`#h o $hM!h$+xx%P%q%P%q%q%3%3n %P%hd- @!(23&P0&hm- M%+p%%#Ï$h!h+ %%3%%3%T%%%n %q%hd.@!&Q&hm @M%+op%%#Ï$h!h+b %%3%4%S%T%%T%Tn %q%hMd.@@!&Q&hm `J%+h0k%%#` g $PL!P+`#%LMz %`n O%h|%`O%h~P%h P%hP%hJV %`%Pdm-/% d$G %% G % %_ %d$G %%G % %_ %d$G %%G % %_ %d$G %% G % %_ _ O \'+" % '4,0(7"$ '@$ Ȫ' $$#@!0(Cc$C !(#&$@(M`' '!$ !$$ `'1@ $#@( $2"$5$+@b+@A #@a#@PG$@ `'!@H%9%E !8 !8D<&7DL<&7L`';' '_'!$ !$A%8<@$'`';' !$ 5$% $ $*(@%X !Xhmo&P&`lj!$*(@PK%+`#`#h%%#pw$Xn!X$+x@xpq%Pr%q%Pr%3s%qs%3s%3k^ %P%X+2- !(23&Xk&P0+?J%+X`%%#X _ $PK!P+X`%LMz %`n O%h |%`O%h~P%h P%hP%hJV %`%P2m-qǠJ^%HiɠL\%HiɠJ>%8'Ǡà:Ǡ<ǠàB$C(`@$+(N#(#07$0@8 '!02,@ I!H! $+XE6`%)ɠ k$b n%`̠d l%`̠bN %HɠŠJɠLɠ.Š+( $##07$0f$!02, 8!8+HC % %G %2$G % %_ % %G %2$G %%_ % 2$G %G % %_ %2$G %G % %_ X !Xhmo&`l&PjB$J(@P!P*+Xp`#X#`#h o $hM!h$+xb@x%P%%Q%3%q%3%3n %P%h-2-@ !(23&P0&hm- J%+h0k%%#` g $PL!P+`#%LMz %`n O%`|%hO%h~P%h P%hP%hJV %`%P2m-% 2$G %% G % %_ %2$G %% G % %_ _ O '+" % '"+@"#$ P( A'I'!$ !$A"&,2:F%8DL%@ JV%HIABCDEFGH%!$ ' 'B$ C,`A'! CD($#(I $#0#8?$G!C P( "@%!'@'!$ !$D8Cp`A!' $ ' "$!' $ Ȫ' "B$"%VCD+(dE P#0#8?$8G# b!(%%BT''!$ !$$ $($ ( %% $+Hdl PLT' Ȫ' T'!' $ ' "$!' $ Ȫ' "B$"L+ b?C&,2ABCDEFGH%!$ #,)`A'! #$($# ID$ $#(#07$&!# Ȫ' $JKJ'$ Ȫ'  $G %%_ %W %W % $G += % ' $*A`-<,-< ,% C<!$  $(A ApC$&(   (DJ,-./,-./+` $<`B$p  L8!%,-./eghi$C$>DJ()*+()*++`8 $<`!$p  L8$!(&()*+(E+0@ $<`B$p  L@f$!0&Š@e$+08 @$<`!$p  L8D8<!#,C$@$  8!$LlB<+ aD@D $<`!$p  %% %@%$!(PTX\`H'+= % '((,$b8'28#s8m8 ,$$ %j$<@%8+@!0ǠF$<B=A%8+@!0ǠF$+8!0<<ǠF$<>@@%8+@y!0ǠF$<=A%8+@i!0ǠF$<=A%8+@Y!0ǠF$+8O!0<B<ǠF$<B> @%8+@<!0Ǡ F$ <="@A%8+@,!0Ǡ F$+8 $'w@0'!0@(!(*$:@%8+@H!0ǠF$<=A%8+@8!0ǠF$<=A%8+@(!0ǠF$+8w@0 '!0@(!(*$:hL%8'D% hJ%8'F% UU%H+%8G%%!d`<f!$#(`#$'!0%Ɛ'!@'J%0&di, !dF<%0fhP#$df,lptx%!$"( @'!(Cl'!E$E|%% % ,'' |%$ %!$"(@'B$D( l'!(8%0%$%(%8 '*'!$ !$$HpP !Bd*,@P+%X !b!PGd+,`X)%H !"!Hgd+,u`KJ,)h!hO1 { %x1z V %PJ1Q J1T J1W Y %PjJ1R ^ %PjJ1S M %HI)11K )1N R %HI)1 I W%HI)1"L T%HI)1$IW %H*)1&J)1(M)1*%!$)( @H '!HI)%X  k-`'!hn-@X !Xi+%)9 '%\% $G d$G d$G d$G %d$G %d$G P !PDIGB$J(@P!PJdK-`% d$G %G %_ O _ O $'+" % '"#$''!$ !$Ah"i#'X'!$ !$A$$dw' $ Ȫ' '"'$ Ȫ' %%'$'$ ' `% %($'%(8@?c$%d($'!(f$!0Ɛ%8:%(670g$!890%0 -G,*70@8!8'E$G8%(0 ,,70@8!8'$8%0\'%$G %$G += % '7 $F=( %B$C(`@!#% '@(!(e%8N$8p> $8p#0$<? 0!0$$(+= % '7 "$ $ (F=( %B$C(`@!#% ;$C,"`A$(B$#B0 !b #(` $& b   a$$ ]:( '$_ @(!(e%8N$8p> $8p#0$<? 0!0$$(x'+" % ' $8'q#0$<? 0!0$$(d'+" % '' '!$ !$A''!$ !$A ' '!$ !$A'0 4 8  $>( 4 C,`'8 c$B$# '00 !  $E-( % @'!b!$ U*(  "(@ 7 '' ;( %@ '!CD%(N$(p. $(p# !$D"(@ '*( % @'!(d '!fg#(e!$#(`%@ '!de%0N$0p6 $0p#($47 0!($!$e#(`( $ %!$ $( + "*! a%( '@0 '!0Ƅ$#0LO &0&$4700 , 0 %0&$(0!0,%$G G $_ /@X'+" % `' ''!$ !$A''!$ !$A' '!$ !$A''!$ !$A''!$ !$A''!$ !$A 'HL P$;( % @ '!C!$ U*( "(@%!$"(@@ '!C% a'HL P$$;( 'HL P$$1( %$,W@'!d C$*!e ' ;( $!$"(@%!$"(@@'!C% % @'!C!$*( "(@%!$"( @@'! C'!E%0,7' !$ ' ;( %@'!CD%(N$(p. $(p# !$D"(@'*( @<%c$ d(% % @'! C'!FB!E!$"(@% @'! C'!FB!E!$"(@%!$"(@@'!C% U%@'!CD%(N$(p. $(p# $,/ 0! $!$D"(@'04 8 $=( 4A, '8!$B$#c00!d $\/( ('$_ @(!(%8N$8p> $8p#0$<? 0!0$$(@0'!00#(0Ť$(g+(a!(C( ,8!8 (,%$G %%G @8!@ !8!8$(@(!(%8N$8p> $8p#0$(@(!(%8N$8q> $8'q#0$(+= % '/< `<@DH'()*"#$%PX%%tX PT%)PT%c$d(4% L',7*!(@2!( 5( ,$$PT4(c$d(8% 07*!(@2!( 5( 0$$PT8(&+<@DH T'()*"#$%p3( PX&+%% +&%08 %( A$QL'$%%(&0,Nw2G0!0,C@<'!@ @:!0 ''!0"'!0 ''!0 "'!0F0G$8 &0'$8%%%8%<'"T 5( L'<'!@!$"(@%%x%$G %$G x'+" % ' %%$($$%0'w*!(@2!($%8'%@%!$7W!$B$2!0@J!&&$%!$7W!$B$''!$7W!$B$$%%(+= % '%$W@!C(, 04!881( !$"(@ 'l'+" % '''!$ !$A"$!$ !$A%B$%"(@W w@"!(! ' f+( %'@'!(d!af!(eB$C(`%B$C(`7@!#% @(!(e%8N$8p> $8p#0$(%B$C(`7@!#% @(!(e%8N$8p> $8p#0$<? 0!0$$(+= % '% W@!C!$*( "(@ '+= % '% W@!C!$U*( "(@ ' % $( w7W@*!0!8!(%@ @H!P&!X'k!H%)!HiI% ) t'+" % '%%'($@p+HY @J!H#Ph#P W $P +% '%`% !$7W!$B$a#!@%  '!PHL M I!$)( @H*-.@P)% '!PK--#@H  $pq!H++xJ)!x%T V %PP+ !x%+pB% G %G %G % $G % $G %%_ += % '%!$'($@p+HhP ׀@J#P#P W $P !H#h!@D%P  '@h!h-J%K)` $`jq+h1%!p +x)@x Α!h 2%p- ! %+p%n o 1!`a %`-%$G % G %$G % G % G %%_ += % '4$* d8$d8A$  d8@$ d85`$,$(0%8@ !##HH#PW $@ !@ \/( '$4,$(0%4(@'p+HH  '%_ ( '$ '< $ DȪ' 'l' $ ' ''!$ !$A$T$`'L'@$ Ȫ' 'H $ P' 4'( 8' '!$ !$A$ $ $ 8'h  $ p Ȫ' 8'l' $ ' h %% ! "'!0%Ɛ& !$%d $(b0B$X (c$# B$% L'!0%ǐ$8!@#$@%8Ǡ!$ %('4'!$ !$A$t$'L'@$ Ȫ' '\  $ d ' T ' $8p#0$<? 0!0$$(+= % '7 "$ $ (O( %B$C(`@!#% ;$C,"`A$(B$#B0 !b #(` $& b   a$$ ?L( '$_ @(!(e%8N$8p> $8p#0$<? 0!0$$(t'+" % ' $8'q#0$<? 0!0$$(d'+" % '''!$ !$A''!$ !$A''!$ !$A'04 8 $O( 4C,`'8c$B$# '00!  $E-( % @'!b!$U*( "(@ 7'' M( %@'!CD%(N$(p. $(p# !$D"(@'*( % @'!(d'!fg#(e!$#(`%@'!de%0N$0p6 $0p#($47 0!($!$e#(`($%!$ $( + "*! a%('@0'!0Ƅ$#0LO &0&$4700 , 0 %0&$(0!0,%$G G $_ /@X'+" % '' '!$ !$A''!$ !$A''!$ !$A ''!$ !$A''!$ !$A ' '!$ !$A'HL P$M( % @'!C!$ U*( "(@%!$"(@@'!C% a'HL P$$M(  'HL P$$1( %$,W@'!d C$*!e' M( $!$"(@%!$"(@@'!C% % @'!C!$*( "(@%!$"( @@'! C'!E%0,7' !$' M( %@'!CD%(N$(p. $(p# !$D"(@'*( @<%c$ d(% % @'! C '!FB!E!$"(@% @'! C '!FB!E!$"(@%!$"(@@'!C% U%@'!CD%(N$(p. $(p# $,/ 0! $!$D"(@'04 8 $O( 4A, '8!$B$#c00!d $\/( ('$_ @(!(%8N$8p> $8p#0$<? 0!0$$(@0 '!00#(0Ť$(g+(a!(C( ,8!8 (,%$G %%G @8!@ !8!8$(@(!(%8N$8p> $8p#0$(@(!(%8N$8q> $8'q#0$(+= % '/< `<@DH'()*"#$%PX%%tX PT%)PT%c$d(4% L',7*!(@2!( 5( ,$$PT4(c$d(8% 07*!(@2!( 5( 0$$PT8(&+<@DH T'()*"#$%p3( PX&+%% +&%08 %( A$QL'$%%(&0,Nw2G0!0,C@<'!@ @:!0 ''!0"'!0 ''!0 "'!0F0G$8 &0'$8%%%8%<'"T 5( L'<'!@!$"(@%%x%$G %$G x'+" % ' %$ $)'w@"! $'%0%!$7W!$B$*!%$%!$7W!$B$''!$7W!$B$$$(+= % '%$W@!C(, 04!881( !$"(@ 'l'+" % '''!$ !$A"$!$ !$A%B$%"(@W w@"!(! ' f+( %'@'!(d!af!(eB$C(`%B$C(`7@!#% @(!(e%8N$8p> $8p#0$(%B$C(`7@!#% @(!(e%8N$8p> $8p#0$<? 0!0$$(+= % '% W@!C!$*( "(@ '+= % '% W@!C!$U*( "(@ ' % $( w7W@*!0!8!(%@ @H!P&!X'k!H%)!HiI% ) t'+" % '%%'($@p+HY @J!H#Ph#P W $P +% '%`% !$7W!$B$a#!@%  '!PHL M I!$)( @H*-.@P)% '!PK--#@H  $pq!H++xJ)!x%T V %PP+ !x%+pB% G %G %G % $G % $G %%_ += % '%!$'($@p+HhP ׀@J#P#P W $P !H#h!@D%P  '@h!h-J%K)` $`jq+h1%!p +x)@x Α!h 2%p- ! %+p%n o 1!`a %`-%$G % G %$G % G % G %%_ += % '4$* d8$d8A$  d8@$ d85`$,$(0%8@ !##HH#PW $@ !@ \/( '$4,$(0%4(@'p+HH  '%_  $8p#0$<? 0!0$$(+= % '7 "$ $ (a( %B$C(`@!#% ;$C,"`A$(B$#B0 !b #(` $& b   a$$ #^( '$_ @(!(e%8N$8p> $8p#0$<? 0!0$$(x'+" % ' $8'q#0$<? 0!0$$(d'+" % '''!$ !$A''!$ !$A' '!$ !$A'0 4 8  $a( 4 C,`'8 @c$@B$# '00 !  $E-( % @'!b!$ U*(  "(@ 7'' _( %@'!CD%(N$(p. $(p# !$D"(@'*( % @'!(d'!fg#(e!$#(`%@'!de%0N$0p6 $0p#($47 0!($!$e#(`( $ %!$ $( + "*! a%( '@0'!0Ƅ$#0LO &0&$4700 , 0 %0&$(0!0,%$G G $_ /@X'+" % 翯'''!$ !$A''!$ !$A''!$ !$A''!$ !$A''!$ !$A''!$ !$A'HL P$u_( % @'!C!$ U*( "(@%!$"(@@'!C% b'HL P$$u_( 'HL P$$1( %$,W@'!d C$$0p!f' _( $!$"(@%!$"(@@'!C% % @'!C!$*( "(@%!$"( @@'! C'!E%0,7' !$' _( %@'!CD%(N$(p. $(p# !$D"(@'*( @<%c$ d(% % @'! C'!FB!E!$"(@% @'! C'!FB!E!$"(@%!$"(@@'!C% U%@'!CD%(N$(p. $(p# $,/ 0! $!$D"(@'04 8 $a( 4A, '8@!$@B$#c00!d $\/( ('$_ @(!(%8N$8p> $8p#0$<? 0!0$$(@0'!00#(0Ť$(g+(a!(C( ,8!8 (,%$G %%G @8!@ !8!8$(@(!(%8N$8p> $8p#0$(@(!(%8N$8q> $8'q#0$(+= % '/< `<@DH'()*"#$%PX%%vX PT%*PT%c$d(4% L',7$0p!0@:!0 5( ,$$PT4(c$d(8% 07$0p!0@:!0 5( 0$$PT8(&+<@DH T'()*"#$%p3( PX&+%% +&%08 %( B$RL'$%%(&0,Ow$0pH0!0 -C H<'!H*@B!0& ''!0"'!0 ''!0 "'!0F0H$8 &0($8%%%@%<'"T 5( L'<'!@!$"(@%%w%$G %$G x'+" % ' %%$($$%1'w$0p!0@:!0$%@'%H%!$7W!$B$8p!8@R !G'$%!$7W!$B$''!$7W!$B$$% %(+= % '%$W@!C(, 04!881( !$"(@ 'l'+" % '''!$ !$A"$!$ !$A%B$%"(@W w@"!(! ' f+( %'@'!(d!af!(eB$C(`%B$C(`7@!#% @(!(e%8N$8p> $8p#0$(%B$C(`7@!#% @(!(e%8N$8p> $8p#0$<? 0!0$$(+= % '% W@!C!$*( "(@ '+= % '% W@!C!$U*( "(@ ' % $( w7W@*!0!8!(%@ @H!P&!X'k!H%)!HiI% ) t'+" % '%%'($@p+HY @J!H#Ph#P W $P +% '%`% !$7W!$B$a#!@%  '!PHL M I!$)( @H*-.@P)% '!PK--#@H  $p-p!H++xJ)!x%T V %PP+ !x%+pB% G %G %G % $G % $G %%_ += % '%!$'($@p+HhP ׀@J#P#P W $P !H#h!@D%P  '@h!h-J%K)` $`Kq+h1%!p +x)@x Α!h 2%p- ! %+p%n o 1!`a %`-%$G % G %$G % G % G %%_ += % '4$* d8$d8A$  d8@$ d85`$,$(0%8@ !##HH#PW $@ !@ \/( '$4,$(0%4(@'p+HH  '%_ < Qc$T>'   $"/ #e# '$ !$* b%l& "  *(  <!$x |H'-<*-<*x|H'-<*-<*x|H'%%_ += % '`.<(K/ \c$`+(% $<`B$p  4$0p$!f/`( %H)-  %P+HI  %P+H* $+H 04* $?$?`Sx,l$(?lph<=`Sxl$(?#$?TSlO`$(?`d\<=TSl`$(%G %%G %%G %G %%G %G %%G += % '\`dx$\' j(  t'`] hlpDHL\'$h' j( F \'$D' j( ; |de$f+8 $<!$T>'  $"$<<!$T<'  $"$:<!$T:'  $"$8<!$T8'  $"/`! #$6<BJ ^ %H+\ d%Xb n%`% !@(&0!$*0% +0"!8#+@&(,0'%G G _ '+" % ``'"8@!8 3k Hap!%/ '$ ' ''!$7W!$B$% t$*@+@w@p! p*$'!$7W!$B$A$+X,d`%!i p#$'!$7W!$B$aĎ'''!$7W!$B$x'''!$7W!$B$ 1a'!$7W!$B$a/`$@(q!8/`< !$  $"`< !$ $"`< !$ $"t|abd : 0''/'!$7W!$B$a<`!$@$  0'%% 3P'@$ m p&"`x V 5 p@<#p) ( @<~c$ ("/`#Fd8%A8 %L8 %S8%E8&$a8 $l8 $s8$e8fc8`#ac8`#lc8 `#sc8 `#ec8`%%@ $  0$  0# +"= J K@%T't'!$ !$<$T$X$\@Bpt'T't'!$7W!$B$a<~c$ /+$$ B$  "CBpJ K@%t''!$ !$<$t$x$|@B't''!$7W!$B$a<~c$ /.<D4A/$,"/$<"/< !$$ z: .<><;!$$ z: 0''+" % 44'.<D.< D7 .<=ᎳB$ !$ < B$"/c$ $( "!|b/!$ Dp8:"@#$% <`#&  FJ K@%('H'!$ !$<$($,$0@BDHL'('H'!$7W!$B$a<~c$ x/J K@%D'd'!$ !$<$D$H$L@B`dp'D'd'!$7W!$B$a<~c$ l/J K@%4'T'!$ !$<$4$8$<@BPTX'4'T'!$7W!$B$a<~c$ /+= % '-<-<'$  '+= % '$(. "d& D7 d %& $%$f&(% .$e V $ ("$(C$*  D"$DC$ *  "c! V % '+= % '"d&@"e& % f&(% @!b V % '+= % '"d&@"e& % f&(% @!b V % '+= % '"d&D,@"e& % f&(%#@"e&@b%&EB8@"e V  !CB V % '+= % '"d&D,@"e& % f&(%#@"e&@b%&EB8@"e V  !CB V % '+= % '"d&DB81@"d&$e& %(@ b $&B8"@b$& D$e& $e V  !CB V % '+= % '"d&D@ " e&@"e V  "c ! V % '+= % '"d&@b%&EB8 @!b V % '+= % '"d&B88@b$&D3@ b $& D.$e V $ "d& Dd%& d% V  "c! V % '+= % '"d&@b$& D !c V % '+= % '"d&B8$@b$& D$e V   " d& D% c! _ % '+= % '"d&@"e V  "d& D%  c ! _ % '+= % 'ٻ) 'Hv_FRhxNEDPQGmwnrspuzcaygfBbtikeqdKClSLYXWAjZTVOKosmuX0X1X2lH<`4, 8 @Td\h(8`4!ȝ`!78Hd !"z'%`DzDIɊʊI4$p <.L17nxIdDoX3X4X5X6X70t04000q 0inAsIsrsXOpIPokfdlcch$,,,(,,\,0, ,,,-|---Л-atipv4v6orhilo%'&' v' M&N&N&O&`O&v'w'x'x'$y'Hy'y'Tz'{'hP&P&P&Q&d|'\}'O&FdT !csppcfnPCl1l2lrfpbptsidr1r2g0gpmprgwgrtrdwtwdkptittr3r4r5r6r7t1t2a1a2X Y Z [ [ |\ ^ H_ a a b hb c d d d pe 8f f 8g g h xi j l o PlRJtJf,@txIn DID7777fs R]S]|Z]8`(`ppdqeqqssrztzzzĜTxioppHp|pD7Rlkws^^P^d^^^'kaEEEElE0EFg @g (T?Fks\9:[:\:Tz:{:{:cwbwwrstrwhsscctbrtwescmllccfrcszrrcpfdo3R4R4RX5R5RX6Rh7R8R8Rh9R9R:R=R=R>R ?R?Rt@RARARBRCR$ERERFRGRPLRhMRORPRPQR$9S|9Srewex..P.CA`M\NO8PPQ^_`bdc dԬxL<`ԕh:;X<xН85?tA|CFFHHRxIOl233=P>LDiPjk\lmnXo d t0``pD` ld Te f df f dg 8h h AtvLDOr$$%GxGy4b#DpDq8D#iv,$  < @ 7roT  T LoHiToT (܃ $ X | pd110(R 4 Zh 3$3h33343x333D33X333$3o60u6tv6)?@*?To%dhdk?mwnlmrGGG G?@@`AApB CChDDx@BCDEGIXJ LLMO4P(RXSUVPXvwww$wЁww̌NNLTl0l3l4rrtr.5,15153504545875H85895rbmUԭV0YpY\0\\sPqvqvsv8tvlvhwwhwtox}|{({{{8JaKadLaMaNahpaĈacaXa4cL5c5c6cd9c9c:cCCHSdSdTdeeexeT`gg(gmgnn|nt0nbh1h2hlhdd`Gop;ÖŖxɢʢˢˢl̢(͢H΢hϢ(SؼS8SSt'T4SSd U\WkvrHrrĵrrhrrrrrp$tzL0L1DmixiftHLlh`qcrcuc4dNNvsdf YfxYfYfZfDZfдpksks1s2t0(؞6TH7TdtatbʝshthaTErrNewURIMsgAddRunptrextlocbuflenSumderRawExperrarroutfmtmsgpadwidargnetNetTo4pfddupsetgetLenMTUvalkeyAllAs4Is4Is6andnotxorsysSystypOldDirEnvPidpiddirrefendbssbadrawaddsubpcsretlowmaxgenminpoprunseqoffputobjgcwpostlsmOSsigcashaseofcaptagmidnewdefidxstrlognowexpKeyNumnegCapPadSeqSecCurMaxIovDevInoUidGidhdrOffRttTosAbsDaySubUTCabssecUsectxenvGetSetLogURLDelHasTCPUDPPSKBufhopcurencNowekmPutmactmpprfckx MapStrValPopkvsTLSpatresreqrwcrwssrvurlsrcaltallwmuJardstOutissrecjobcfgTTLCmdReplruPreEndpinTagbbbbitcmpdivmulremshlshrsqrAndBitCmpDivGCDLshModMulNegNotQuoRemRshXorInvIntdecctrR16R32PTRTXTrfdwfdDupIfnTfnTypFunArgIPPVarLOGcolCASDecIncCidCIDPsmPSMSIDRefPGNMinnumMacHdrVerRsvDstGSOnattunmtuSrcViaOOBecnECNAckacktapvecs64kdfkemdotsymCGITtlinteollexCpuECHUrittlISOVPCIP6IP4EmsOneNat PosCCCcccPosMapdocIifOifQosXdpVfsFdsFD0FD1TOSRSCGBPAgeOps CmdPNGbpsPTOFinrngpnsAnyanyMSIlnslfsOidpublsareg XOFhpkrhos1hs2ht0ht1pdt2NTTSqrQUICkeysLoadSwapNameisV6typ_flagtimewallnbufbufpsyncnextprevSizeIsCAURIscertHostCertnameecdhAlgoTypehashtext OnceusedReaderrsfreepeekFlagfmtCfmtQfmtSinitpluszeroprecScanAddrMaskTo16PortZoneFiledialconnIdlewaitwrMurdRxrdTxwrTxwrRxoncereadDoneTextfilepathsrcsLesssortPref ConndoneDialLocksizestatdatanodedeadrootseediterBitsAs16NextPrevaddrportmodeModeinfoInfofileSeekStatSyncseekOpen FileKillWaitkillstopwantmask*intheaplinkheadpad1pad2nfnsftabebssptabargspcsppclnflagFuncLinerefsdiffbasegoidgopccodeargpctxtlastbitpkindlistelemtinyfindloadgrowpackscavpushtailwhenlocktakenodenobjget1get2runqbyterankcurgoldpncgoparklinewakebitsrrunwrunuserrseqwseqselfonesfullleftnbitdepsskiptickbptrfillsemarecvitemdumpemitElemKind TypeGrowPathZeroDataAttrNanoUnixNsecUsecBaseCodePad1RdevPad2AtimMtimCtimPad4Pad5TimeCttyPgidHopszoneDateHourYeardatemononsecStopLongArgsRunEFindHelpRootWarncoreWithCoreFreeLastFeedfeedBackInitmoveListUserSendAuthOrigConnconnObfs CorehooksctsleafLeafRandrandSealaeadquicvershandstepscanMorewbufPushJoinBodywildhostFormcondwerrbufrbufwlogfflowbodyrerrtreeresptreqhbufhencPingzerrpipeKeysHeadPostsendTagsocspOCSPringloopHookpostIPv4IPv6holdPeekkickSignvalsdivWitoamakemodWnormsqrtutoaSqrtCopyformECDHHashSeedQinvSkiphighauthwrChrdChpipePermBoolCallRecvSeq2UintcallChaniregfregftyprcvrabidFromSortAAAAPackfdmudupsMtypMoffDumpIntsPtrsInt8IntPNArgVarP TreecopytmplmarkvarsINFOWARNopenpoolboolNodeRxIDTxIDDsapSsapdescDescVersPeerAtypbindFragUlenPlenCwndByteLeakIsIPFqdnEnumPullTailDropsentrcvdacksnumslostbodyfailIntnopadipadsealrateentsWirecidrtorcToDS SVCB NSECSetZUsedHintAlpnNsid InstInstexprproginstjobsconfHaltForkPlanVPC2MetaargvSctsseenDeclCmdsPipeTruetermTreeSpantcccrunensrcFlowfootnullintvmapvmustnilvMarkIfidVlanPkeyRoleIKeyOKeyLinkto64GotolessfromCompOursECT0ECT1ect0ect1AEADbackjsonoptsJSONhistrBufdictfreqlazyExprRuneSub0sign HashprivpubApubBkemAkemBhtabcellMapTwireenum BaseconvbetarenoCondbufobufecmovcnegEltsErrorFieldValuevalueelemsStoreCacheInteris224ResetWriteEqualCloneRootsPrimeCoefflocalCloseTokenWidthwritelimitcountatEOFssaveerrortokenfmtBsfmtBxfmtQcfmtSxminussharpspaceplusVladdrraddrCounttimercloseScopeLabeladdrsAddrsIndexFlagsmtimendotserrorfirst MutexRLockindexentryemptyUnmapv6u16IsDirChdirChmodChownchmodpreadstatesigMuclear*int8*uint*boolmagicminLCnfuncvaddrcutabpctabminpcmaxpcetextedatagcbsstypesdatap_Funcvalid_funcEntryunpinequalretpcstartstackbytepflushallocinUsestoreClearcachegListchecktracehchanresetsendxrecvxrecvqsendqsweptstampwbuf1wbuf2gFreewbBufvalPCnextplocksdyingincgoschedparamsigpcflagshash0extraunionmergearraytimersleepfdseqchunkreadyrightreusebytesdepthStackqueueeventAlignRoundtrunctablebuildHalenLevelStartOnoffUtimeStimeIxrssIdrssIsrssNswapNvcswNlinkPidFDStateTableHoursisDSTisstdisutcAfterClockIsDSTLocalMonthTitleShortPrintSetInUsagegetInDebugTraceIsSetSetFsapplyclockFatalInfofInfowNamedPanicWarnfWarnwloglnCheckSugarcloneBuildServemutexbReadArrayFrontIsAbsParseQueryMaxTxMaxRxudpSMTimesUnsetPortsAddTo EntrydirtyaftercoreslevelfuncscauseExtrauseByBytesSuiteinputnoncelabelgroupecdhekyberKDFIDKemIDkdfIDisRSASetIVRangeevictivLencurvehellosuiteInt64scanpValidFlushProtomultiserveavailIsAckCausevlogfdonecmatchhostsLimitshiftnodesproxyreqchreqMualtMuProxyaborton100tconnpingsconnsisDir TimerIssueEmptyNamesEmailemailAllownameszonesvultrUsersHTTPSMatchitemsPurgeRulesisTLSMutexClassclassnbitsexpNNexpWWIsIntroundCurve CurvechildOuterio/fshiterFloatIsNilSlicerunesNumInptrTostepsiregsfregsspillCNAMERetryrsemawsemaSysfdcsemaFstatFsyncPreadchansSize_TFlagKind_innerBoolPGetIPIPNetIPVarInt16Int32Int8PNFlagUint8UintPVarPFVisitfailfusageFuncsTRACEDEBUGERRORFATALoutMufieldMkdirfilesundefbufioSplitLowerUpperUnamerxAcktunFdrulesExistEncapRealmRegexAttrsGetIprcvMxlogIDOtherInt63Int31pktIDfragsblockoutertotalcode_idKeybracequotecommtownernextLparseToCDSOrderCoverSetDo RRSIGRcodeQtypeFudgeUinfoLeaseNdotsToSRVmpooldenseatEOTstack AliasGetDBStdinKdfIdKemIdm0invlimbsquietdedupNodesIdentnewIfnLead_byteisMaxnbytenruneLooseBoolsInIntUintsMapTomapTodebugwidthMergehumanStyleAliasmajorminorstylemarksaliasboolvnodevtimevuintvItemsprogsGuardFloodTrustMultiGroupSlaveOwnerDportNoAge IPNetTunIDSportDepthInputEnumsIsMapScaleBlackImagepacerECNCEFrameecncealarmIVLenBlockissetfloatfrontlinkswrPosrdPosfinalcodesRune0encapdhKEMprivAprivBlinesChildChainsetIdindirinstrGetFd RtMsgbyNumbyKeyApplywhichpbTypgoTypPixelalphaepochcubicoperr StateturboclampaddYXsubYXstalklanesDigitsignsUnwrapuniqueConfigzoneV6\ \l\\,\\@\ \\\HStringIssuerbyNameVerifyReasonDetailparamsDoubleParamsMethodTBSCSRdomaincipherNumber*[]intrecentbisect\(\\\B\\closed\\\errorsreadermaxWidacceptdoScannotEOFokVerbfmtSbxsharpVintbufFormat\\ \D\familyopAddrSourcesotypeEnablecancelServerAcceptListenunlinkPollFDTargetWeightnegatestatusactionsourcePrefixsearchrotatelookupuseTCPserverCanceldialIP DialerUnlockupdate\StrongparentexpandMaskedisZeroBitLenIs4In6addOnehalvessubOne\\$\\ReadAtpwriteSignalhandlerusageExitedexitedsignal\\*error*uint8*int16*int32*int64unsafeopaquenfilesptrbitgcdataetypesrodatagofuncfuncIDpcfilesignedgoexitinsertremovenoscanoffsetnpagesnelemsdivMulinListisFreelayoutrefillunpacksetAllrangeschunksallocNadjustsiftUpunlockverifyastateisChanperiodmodifytrace1qcounttickettryGetmcachepcachepalloctimerscycleslenPosvarintdivmodprocidvdsoSPvdsoPCnoCopy_panic_deferlabelscountsinHeapensurescalarfileIDactiveargLenparkedheadernotifybucketwriternextPCframesstringCommon\4\\ \\8\\\\\\\P\\\\X\ \0\p\\@\\\\\x\\ Assign\ \AfinderprefixoldnewFamilyGroupsHatypeZoneIdHeaderSetLenHostIDLingerIovlenMaxrssMinfltMajfltMsgsndMsgrcvNivcswFilterBlocksOffsetStatusChrootPtraceSetsidNocttyChangeCookie\n\l\`\\LayoutformatextendBeforeIsZeroMinuteSecondaddSeclocabssetLoccalledPreRunpflagslflagsiflagsHiddenParentPrintfSetErrSetOutgetErrgetOutpreRunconfigloggerGetIntgetEnvDPanicDebugfDebugwErrorfErrorwFatalfFatalwInfolnPanicfPanicwWarnlnschemeHyConnRemoteBufferLoggerIfName ServerRemoveEncodeSchemeOpaqueClientfilledclientClosednextIDNewUDP WriterCallerAddIntEqualsShouldFieldsspacedaddKeyErrorssecretageAddeventsaesKeykeyLenincSeqdidHRRrandomcookieAEADIDLengthaeadIDbufferDeletemacLen\ \@\Struct BufferquotedencodeendTopobjectopcodefieldsDecodeFramerstreamvaluesValuesQuotedDomainMaxAgeSecuremethodinReadremainHijackcurRequnsentframerinflowserveGgoAwayunreadreadFnskipWS ReadercondfnsawEOFmultismux121HandleonlyH1nwriteidleAtbrokenreusedaddTLSresultidleMuisHeadnum1xxfinish Closerlengthl\SetURLExistsHasTagTestCAAgreedagreedrevokeRevokesolver SolverissuerparsedwindowcursorWindowpermitSubmitworkerunFQDNnoncesAuthIDConnIDauthIDconnIDokCDialerResize\StreamisHTTPSecret\mcryptoPublicsharedvictimdeletemissesdoSlowandNotbitLenisPow2setBitstickyAndNotAppendCmpAbsDivModQuoRemSetBitUint64SetIntboring\PrimesNewGCMNewCTR\\\LookupmustBeCanIntCanSetSetCapSlice3CanSeqNumOutcommonstkOffappendaddArg\<Stride\SearchSerialExpireUnpack HeaderAnswerFinishdecrefincrefrwlockiovecsisFileFchdirFchmodFchownPwriteWritevSharedDoChandoCallGetenvAlign_GCDataBucketHasherMcountXcountFloatsInit64RefillReseed\,CountPIPMaskIPNetPIPVarPInt16PInt32PInt64PIntVarParsedUint16Uint32Uint8PactualformaloutputcommonDelimsOptionmuTmploptionerrorfColumnOutputWriterbyPathUnusedSquashResultdecodel CreateRenamestrictStrictConnIdBdaddrNodeidUserIDCstampTstamp\\?\LPasswdiphLenpshSetroutesmaxAgetcpNatudpNataccessNewDstRttVarAdvMSSRtoMinl(DecRefExtendIncRefIsFullRawCapIPAddrIsFqdnIsIPv4IsIPv6GetKeysampleUpdateFragIDTracerRetireDoneCbheightAscendInsertFramesremotesendMxpackertracertokenssenderOnLostlistenll StreamstreamsetterInt31nInt63nint31n\\\\seqNum\` \`'\\\dsbyte\tmpoffdigestReuseddynTabexcess Config ClientCertIDRrtypecolumncomBufrrtype*dns.AequalsKeyTag DNSKEYRegexpNodeIDLabelssigBufOpcodeQclass MsgHdrOrigIdCopyToIsTsigsetHdrMinttlregexpopHNumCapsparseinputsExpandScopesRebootAttachDetachGetSoa S3KeysBackupRegionSSHKeysuffixStderrStdoutAeadIdAesKeyRandomKeyLenBytesXSelectbytesX\\C\ \9\\!\\a\1\ InvertMult32NegateSquarereduceassigncmpGeqsetBigfromP2\x\enable\2backupignoreIsUintexpectnewDotnewEndnewNiluseVarSetPosisYesCisYesDhangulReaderruneAtasciiFflushFindentInTimeInUintInt64sHasKeyHaskeyNewKeyReloadSaveToreloadAsTimeAnchorInlineanchorstatesopenedparserterrorfloatvslicevActionInAddrprogFdProgIdTxRateTxQLenUmcastQueuesIFlagsOFlags IPVlanMiimonAdInfoL2missL3missVlanId\SetTOSSetDirSetEnvRangesByNameSyntaxByPathIsWeakOneofsIsListMapKeyBitmaprepeatminRttMinRTTminRTTTheirs\&SetAll OptionsetBPFcflagsSetTTLSetBPFrawOpt\~\nFrontgroupsIndenttoRead\\$MaxCapconcatfactornumCapexpiryExpiryptSizescSize\\\\O calcDHsizeDHLbrackRbrackLbraceRbracewrite0writeNwidthsIsLastNodeAtcreateArrayTSliceT RtAttrGetPidSocketsortedbyJSONbyText**boolisInitoneofsinitMuGoTypegoTypenumberBudgetsetIov\ \` \`\`\\\ srcPostokEndtokPos\\mixAdd\ \@\ \ \ writeX\\ (\ \ InvNTTMulHatPackT0PackT1DerivePackW1\delims\`\(\t TangleToMontConnectNewFunctopbits*func()*[8]intModeMapreflectVersionSubjectgetCerthaveSumAddCertDNSNameisValidhintErrkeySize*[6]int*[9]int*[4]intpendingpendBuf*fmt.ssnlIsEndadvanceconsumedoScanfgetBasegetRunehexBytescanIntscanOne*fmt.ppbadVerbdoPrintfmt0x64fmtBoolNetworktoLocalTimeout*net.IPWriteToconnectreadMsgsetAddrwriteTo TCPConn ContextControlrawConnCompareIsValidsrcAttr*net.MXsources*net.NSserverstimeoutsoffsettrustADprimarydialTCPdialUDPnetworkaddressTryLockRLockerRUnlock RWMutexisEntrykeyHashcompareAsSlicehasZonestring4string6modTimeModTimedirinfoReadDirReaddirWriteAtreaddirwrapErrSyscallSuccesssuccessReleasepidWaitrelease*[2]int*stringruntime*[]int8*uint16*uint32*uint64*[]uint*[]boolptrSizefuncofffiletabcovctrshasmaintypemaptextOffnameOffsrcFuncnpcdatastartPCstartSPisEmptytakeAllobjBasepushAllpopKzombiesraceCtxaddHeapblockeddequeueenqueuesortkeywaitersnextSeqinSweepbalancedisposeputFastpushcntdiscardrunnextpreemptdestroyseqlockentriesmorebufgsignalsigmaskisextraalllinklockedglibcallchacha8lockedmstartpcracectxwaitingcgoCtxtcoroargtophashgrowingbucketscomputeensuredgcStatspointerclosingstackIDmakeArgcontextcounterwrappedenabledstoppedreaderscallersChanDirGcSliceHasNameMapTypetypeOffstrconvstringsReplacepatternmappingsyscallIfindexPkttypeStoppedAddressNamelenInblockOublockBlksizeversionSetpgidSetcttyBackoffOptionsDst_lenSrc_lenMessageMinutesSecondsAddDateISOWeekWeekdayYearDaysetMonounixSecAliasesGroupIDExamplePreRunEPostRunContextExecutePrintlnSetArgsUseLineexecutepostRunkvstorealiasesAllKeysBindEnvDebugToGetBoolGetTimeGetUintrealKeyonFatalDPanicfDPanicwDebuglnDesugarErrorlnFatallnPaniclnEnabledstoragenewSinkcleanup*[1]intnewPairIsEmptyPopBacksetPathRawPathKeyFileChannelReceiveRootCAsSendBufpktConnreadBufUDPConnRandSrcPortStrbufPoolhopLoopDefinedAddBoolAddInt8AddTimeAddUintIntegerOnWriteAddCoreresetAtstartedsignalccancelcreadbufsessionhmacKeycreatedextractdecryptencryptnextMaccurveIDsendBufmarshalNetConnMarshalnewCertnSecretecdheOkamendedFloat64ptrSeenencoderelemEncelseEncscannedConsumeTrailerRequestExpiresCookiesGetBodyPatternmatchesRefererhasBytebyteBufabortedreqBodywrittendateBufclenBufHandlernewConnhandlerbaseCtxstreamsErrCodeSettingtrailerdidReadcontrol RequestwritechclosechisProxytlsHostheadPosidleLRUDialTLSgetConndialTLSbufPipereadErrClosingdialingPayload*http.IlatencyRewritebackendnet/urllockDirKeyTypeExpiredmanagedoptionsOnEventIssuersStoragelockKeyaccountdoIssueCleanUpPresentdecodeddnsZonednsNameoldCertexpireszonesMudomains ProblemstackMu AccounthttpReqReqAddr UDPConnrequesttcpConnudpConnDialer4Dialer6BindIP4BindIP6resolvelookup4lookup6EndPortonEvictRuleSetDefaultKickMapDecryptHeaderspopHeadpopTailprivategetSlowpinSlowtrySwapcheckerscratchndigitssetWordIsInt64ModSqrtSetBitsexpSlowFloat32nMinus2BitSizeMGFHashCountrysettingAddASN1UnwriteEncryptoutUsedtagSizesubkeyscipher1cipher2cipher3writersPkgPathCanAddrCanUintComplexConvertMapKeysPointerSetBoolSetUintSetZeroTryRecvTrySendCanSeq2gcSliceaddRcvr MapType PtrTyperegPtrsunicodeDNSDoneRefreshanswerssection SysFileRawReadReadMsgprepareInCountIsBlankMethodsKeySizeInSlicePackageChangedchangedAddFlagBoolVarGetInt8IPMaskPIPSliceInt8VarIntVarPStringPUint16PUint32PUint64PUintVaradd QParseFSmuFuncsloggersCommentTagNameChtimesgetDataTextVarsprintfDiscardpadCharConn_idQueueIDUser_idDev_idxResolveDstAddrDstPortBndAddrBndPortsrcAddrdstAddrsrcPortdstPortsentSeqgsoSizetcphLentunFileaddrMapportMapmaxSizeCloneTotunNametcpPorttunLoopifrNameifrDataMPLSDstCongctlbuffersAdvanceFreeLenOverCapReserveSetByteToOwnedTCPAddrUDPAddrLineNumInversematchIPDomainsGetTypeGetCodeGetCidrpresenttailPosGetBestEmplaceclearupackTimemessageputBackifIndexrcvTimehasDataiterateDescendreadPosgapTreeHasDatainitialappDataAddPingGetPingSetReadfinSentAddConnpayloadOnAckedpacketsuse0RTTonClosetlsConfcloseMxrunninginitErrsendErrdecoderreqDoneconnCtxdoWriterecvErrclearerdialErrclientsseedPosreadValShufflesuiteIDpermutetempDircontenttmpfileWasIdleGetConnGotConncomposecodeLenminSizesaveBufNoProxyStrings*dns.RRcommentcachedLSubtype*dns.DSparseDS*dns.KXVertPre*dns.LP*dns.MB*dns.MD*dns.MF*dns.MG*dns.MR*dns.MXService*dns.NSUDPSize*dns.PX*dns.RPOrigTtl*dns.RTMACSizeQdcountAncountNscountArcountIsEdns0SetAxfrSetIxfrSetTsig*dns.TAKeyCodePaddingAlgCodeServersonepasslongestmatchedvisitedFindAllLongestdoMatchexpiredAuthURLGetUserListDBsRestoreUpgradeBaseURLAccountBillingos/execskippedsysProcessEnvironenvironMinimumLookupASetVersHmacKeyCreatedleadingshiftInverbosebreakOKtreeSetIsFloatbackup2backup3commandnewBoolnewElsenewListnewTextnewWithoperandpopVarsrecoverSetTreeLeadCCCisInertbytesAtdoFlushsetDoneshadowsInInt64MustIntUint64sdoParsekeyListrawBodySetBodySectionlastPosPostfixMustGetMustSetgetBoolmissingLongTagContentproblemindentsanchorsterrorsstringvstructvemitterIn6AddrSetProgRxBytesTxBytesHairpinPromiscNetNsIDBitRateTxErrorRxErrorUdpCsum MacvlanQueueIdUpDelayPrimaryVxlanIdSrcAddrUDPCSumPortLowSetFlagIifNameOifNameIPProtoDataLenrawConnsizeMapMutableEndLineImportsValueOfCanSendsamplerackRateisGQUICConnLenPutBackLargestlastAckECNModeIteratehistoryptoModeAbandonrcvAEADUint64nIfIndexX__datagetWsetWRecvMsgSendMsgNextHopattrSeproffsetcopyLenhuffSymliteralskipNoprepeatskemBaseaddLinepaddingendCharlastIdxbuildergobTypeStructTencInitgetJSONgetTexthasJSONEditionfileRawgoTypesdepIdxskeyTypevalTypewiretagtagsizeSetLazycanLazy**int32**int64BoolPtrmutablemethodskeyConvvalConvkeyZerokeyKindRestartStartedsetDataBuffersrecvMsgsendMsgasBytesprevPos EncoderToByteswriteX2writeX4ExceedsPackB60UseHintNewEltPIsEqualTCPErrorUDPErrorfillAuthparseURIoverflowfillConn*[8]bool*[][]intgo.shape*[]uint8checkSumhashFuncisRSAPSSNotAfterKeyUsageDNSNamesPoliciesSubjectscontainshintCertnewPointLocationValiditypeekRuneReadRunereadByteargLimitscanBoolscanRunescanUint*fmt.fmtfmtFloattruncatefmtFlagserroringwrapErrsdoPrintffmtBytesprintArgGoStringsockaddrAddrPortaddrFuncreadFromshutdownwriteMsgReadFromIntervalContainsDeadlineAppendTo AddrPortaddrAttr*net.SRVPrioritycriteriaattemptsnoReloadnameListPreferGoLookupIPLookupMXLookupNSexchangelookupIPlookupMXlookupNSpreferGodeadlineresolverResolverdialUnixinitOnceTryRLockreadLineindirectchildrenkeyEqualvalEqualcloneSeqiterBOverlapsWithZone*os.File*os.filenonblockTruncateExitCodeSysUsageUserTimesysUsageuserTime*[]int16*[]int32*[]int64*uintptr*float32*float64*[]errorcuOffsetentryoffbaseaddrbytedatapcHeadernoptrbssecovctrsfuncNametextAddrfuncInfoentryOffFileLineFunctionrefStoresubtractlessThanslotsPtrstktopspsweepgenneedzeroelemsizespecialsheapBitsobjIndexflushGennextFreescavengepushBackpushKinitHeapsiftDownwakeTimesendLockmaybeAddneedsAdddataqsizelemtyperaceaddrisSelectwaitlinkwaittailmaySweepputBatchrunqheadrunqtailsudogbufstatsSeqwaitTimedisabledlastTimevarintAttargetpclockAddrmstartfnthrowingspinningfreeWaitncgocallwaitlockfreelinklibcallgdlogPerMcoroexittrackingwritebufsigcode0sigcode1guintptrdurationreleasedinStacksmSpanSysotherSysheapGoalIdleTimecpuStatsheapScansysStatscpuStatsconcreteassertedcapacitypositionfileLineFuncTypePointersUncommonuncommonpriorityReadByteprevRuneProtocolFlowinfoScope_idCoreDumpSignaledNsignals*[8]int8CgroupFDcacheEndUnixNanoflagNamePostRunEhelpFuncinReadercommandsAddGroupCalledAsCommandsExecuteCHasAliasHasFlagsHelpFuncPrintErrRunnableTraversefindNextproviderendpointEndpointProviderkeyDelimoverridedefaultsVisitAllGetInt32GetInt64InConfigaddStackDPaniclnSetLevelopenFileHyClientdispatchAuthFuncmainLoopNewErrorPopFrontPushBacklazyInit*url.URLHostnameJoinPathRedactedusernamepasswordPasswordUsernameOmitHostRawQueryFragmentgeoipMapCertFileSNIGuardFastOpenclientDoSendFuncwriteBufprevConnrecvLoopFullPathAddArrayAddInt16AddInt32AddInt64AddUint8emptyCtxisClienteventArrblockedcOverheadhaveVersrawInputlifetimeoriginalpskModesConfigID ListenerresponseInsecureecSignOkptrLevelgrow$scanNextarrayEncBufferednet/httpPusherIDDataSizeStreamIDlogReadsendWritelogWriteNewTimerHttpOnlySameSiteUnparsedsegmentsPostFormResponseFormFilepatIndexchunkingtrailerstlsStatecurStategetStatehijackedsetStateErrorLogServeTLSShutdownSettingsnewTimerreadMorestreamIDinGoAwaycondlogfbreakErrcloseErrisPushed WriterTodidCloseonHitEOFaddChildeachPairpatternsregisterMarkDeadsetErrorcacheKeycanceledisBrokenisReusedreadLoopproxyURLpopFrontidleConnaltProtodialConnConnPoolconnPoolabortErrlastIdleLastIdleexpected*[8]uintDirectorModifiedFilenameMetadataSmallestleafҵCapacitystopChandoneChanOnDemandManagersNamesKeyUnmanagethrottlePreCheckgetEmailisAgreedsetEmaillistenerrawBytescertHashGetOrderNewOrderOutboundDialFuncExitFuncconnLockinitConnQUICPortTCPPortsUDPPortsisDomainStatsMapHashFunclastReadlockSlowpushHeadheadTailoptionalexplicittimeTypemath/big*big.Int*big.natdivBasicdivLargemulAddWWmulRangesetBytessubMod2NBinomialIsUint64MulRangeSetBytesSetInt64validateValidateLocalityProvinceAddBytesAddValueSetError*io.pipeCanFloatMapIndexMapRangeNumFieldSetFloatassignTosetRunestypeSlowconstSumfunctionDNSStartrealTypeQuestionresourcerwunlock*poll.FDIsStreamRawWriteWriteMsgeofErrorreadLockpollablewaitReadPtrBytesOutCountEmbeddedOutSlice*sys.nihGetSlicetoStringflagTypeDefValueBoolVarPBytesHexCountVarDurationFloat32PFloat64PGetCountGetIPNetGetInt16GetUint8IPNetVarIPSlicePInt16VarInt32VarInt64VarInt8VarPIntSliceParseAllUint8VarUintVarPnext Qpeek Qterm QCRITICALFEEDBACKSetFlagsMkdirAllOpenFiledecodersencodersBoolFuncparseOnelastByteReadLineAddrTypeQueue_idtipcAddrInstanceAddrtypeIdentityPreferedNMethods*tun.TundeleteAtnewItemsupdateAtsetRoutesetRulestcpPort6SsthreshHoplimitInitCwndFeaturesInitRwndQuickACKReadPortGetValueGetEntry*v2geo.xsentTimePacketIDrefCountUsed0RTTVersionsrIterateNotEmptyfinishedKeyPhaseSetTokenSetTimerrcvQueuerttStatsunpackerpreSetupmessagesreadImplreadChanreadOncehandlerslogUsageinFlightinitMapssendConnstreamMxsettingscloseCtxgraceCtxuseCountDatagramlog/slogfinalizereadModeexpanderencodingboundarylastpartBoundaryNextPartReadFormnextPartreadFormFileNameFormNamecloseDotIsPseudoaddEntrycallEmitcheckEnduseProxytypeNameNameHashRdlength*dns.lex*dns.ANY*dns.APLNegation*dns.AVC*dns.CAA*dns.CDSGenerate*dns.DLV*dns.EID*dns.GIDLatitudeAltitude*dns.HIP*dns.KEY*dns.L32*dns.L64*dns.LOCHorizPre*dns.NID*dns.NXT*dns.OPT*dns.PTR*dns.SIG*dns.MsgOtherLenNameUsedSetEdns0SetRcodeSetReplypopEdns0Selector*dns.SOA*dns.SPF*dns.SRV*dns.TXT*dns.UID*dns.URI*dns.X25TemplateInfoCodeKeyLeaseServeDNSNameListAttemptsExchangegenerate**stringToRecordmatchcapnewBytesErrorURIsetValueTokenURLClientIDMassHaltCreateDBDeleteDBGetUsageListIPv4ListIPv6DatabaseSnapshotwatchCtxfirstErrConfigIdContentsToPublicPskModesAbsoluteMultiplyPow22523SubtractresetForPosition NodeTypeCopyListemitItemnextItemthisItemIsAssignCopyPipeElseListitemListnewBreaknewChainnewFieldnewRangepipelineTrailCCCIsNormaldoAppendmultiSegnextMaintmpBytescomments*ini.KeyisShadowFloat64sInUint64MustBoolMustTimeMustUintRangeIntSetValuekeysHashHasValueKeysHashsectionsSectionsMustFlaggetInt64nextExprShortTagend_markimplicitpossiblerequiredsequencenewlinesdocumenttag_datadoneInittextlessmappingvSegmentsprogNameheadroomRxErrorsTxErrorsAttachedLearningProxyArpSpoofchkRssQueryRawFlagsAllmultiProtinfoPMtuDiscFlowInfoMACAddrsNumPortsActorKeyMinLinksLacpRateAdSelectPortHighPeerNameLinkTypeValidLftUIDRangeCommentsUpstreamHopLimitupstreamargvc^PrefixessizeListmergeMapNewValueFullNameMessagesServicesIsPublicByNumberIsClosedIsPackedJSONNameMapValueTextNameNewFieldgetBytesgetIface*qr.CodehighGainAckCountOppositelogLevelfromPooltypeByteackFrameSendTimeackAlarmSendModegetIndexlossTimeptoCountkeyPhasesendAEADnonceBufrollKeysused0RTTSentTimeNewTokenmultiplysetGroupRecvMsgsSendMsgsdgramOptLogValueAddAttrsNumAttrsLogAttrslogAttrsemitFunc*spew.t0linkMask*[19]inthistSizecodebitscopyDistcopyDatamoreBitsbitCountCapNamesSimplifycapNamescalcSizecollapseparseInttmpClassnumRunesRetryMaxSeedSizebyteSizeChildrenminwidthtabwidthpadbytesIteratorparseKeyparseValencIndirdecIndirfieldnumfreeListsendZerosendTypeAddChildMeasuredNumFilesnumFilesNumEnumsnumEnumsInitJSONnameJSONnameTextallEnumsExtendee**uint32**uint64BytesPtrInt32PtrInt64PtrExporterinitDoneweakTypekeyFuncsvalFuncsraceReadrecvmmsgsendmmsgrecvMsgssendMsgsAssembleSkipTrue*bpf.TAX*bpf.TXA*xof.XOFSwitchDStokStartHCLTokengo/tokenWriteIntPackLe16UnpackT0UnpackT1MakeHintPackHintmixAddZ1ToAffinelastTypeDetangle ServeHTTP HTTPError *[8]uint8 *[8][]int net/netip **[]uint8 *[]func() BlockSize *[]net.IP *x509.OID toASN1OID RawIssuer Signature PublicKey NotBefore lazyCerts KeyUsages CreateCRL IsOnCurve Unmarshal Algorithm blockSize *[2]uint8 *[]string *[4]uint8 SkipSpace writeByte writeRune validSave nlIsSpace hexString Precision padString reordered panicking argNumber badArgNum doPrintln fmtString *[6]uint8 *net.Addr Temporary IsPrivate *net.conn LocalAddr closeRead CloseRead SetLinger noWriteTo *net.Conn *net.pipe localDone UnwrapErr IsTimeout ReadMsgIP WriteToIP KeepAlive AcceptTCP *chan int partition LookupSRV LookupTXT lookupSRV lookupTXT dualStack DualStack dialMPTCP doDialTCP *net.file appendTo4 appendTo6 pidSignal pidStatus pidfdWait os/signal *[]uint16 *[]uint32 *[]uint64 rangefunc StoreNoWB textStart NotInHeap pclntable noptrdata enoptrbss typelinks itablinks pkghashes inittasks gcbssmask startLine isInlined *[1]uint8 nfuncdata lessEqual recovered nextDefer nextFrame schedtick schedwhen sizeclass startAddr freeindex allocBits spanclass largeType scanAllocemptyK cleanHead deleteMin isSending reclaimed deferpool goidcache available caughtsig mallocing profilehz printlock traceback schedlink lockedExt lockedInt nextwaitm profStack libcallpc libcallsp cheaprand locksHeld syscallsp syscallpc syscallbp stackLock waitsince ancestors sleepWhen noverflow nevacuate committed largeFree inObjects stacksSys mCacheSys gcMiscSys TotalTime stackScan totalScan heapStats *[3]uint8 sleepStub setRecord *[8]int32 *[5]uint8 increment FreeBytes ArrayType NumMethod *[256]int tableSize toReplace WriteByte WriteRune copyCheck buildOnce Continued TrapCause *[2]int32 Multiaddr Interface *[14]int8 *[96]int8 *[3]int32 Pdeathsig Prefixlen ValueElem cacheZone GobDecode GobEncode UnixMicro UnixMilli stripMono initTimer ValidArgs usageFunc outWriter errWriter HasParent InOrStdin PrintErrf SetOutput UsageFunc ValueType envPrefix BindPFlag GetString GetUint16 GetUint32 GetUint64 searchMap locations addCaller *zap.ints *zap.Sink openSinks factories AuthRealm closeChan acceptErr checkIdle listeners ListenUDP handleTCP handleUDP negotiate udpServer zapLogger AutoRoute MoveAfter PushFront LoadGeoIP makeCache TLSConfig reconnect ReceiveCh CloseFunc Obfuscate readMutex connMutex addrIndex recvQueue AppendInt AddBinary AddObject AddString AddUint16 AddUint32 AddUint64 NewTicker cancelCtx AfterFunc *tls.Conn EarlyData createdAt nextEvent DidResume TLSUnique ClientCAs *tls.aead NonceSize didResume buffering bytesSent unmarshal sessionId keyShares earlyData Handshake sendAlert signature clientMD5 serverMD5 clientSum serverSum nonceMask nonceSize handshake rsaSignOk NextEvent Available ReadBytesempty$ nameBytes omitEmpty readIndex saveError scanWhile useNumber UseNumber readValue SetIndent indentBuf StreamDep Exclusive isControl *[9]uint8 dataFrame lastFrame errDetail headerBuf logWrites EndStream PadLength PromiseID ReadFrame WriteData WritePing connError CloseConn closeBody AddCookie BasicAuth FormValue ParseForm PathValue UserAgent cancelCtx statusBuf hijackedv ConnState trackConn ServeConn afterFunc serveConn idleTimer Truncated debugData DebugData Increment endStream newStream notePanic startPush setBuffer bodyBytes writeBody findChild matchPath queuePool RoundTrip addedGzip readLimit roundTrip writeLoop proxyAuth afterDial peekFront closeIdle AllowHTTP reqCancel abortOnce firstByte doRequest singleUse readerErr closeConn idleState setGoAway *http.Dir closeOnce transport Transport IssuerKey issuerKey getConfig KeySource certCache Challenge manageAll manageOne renewCert MaxEvents SetWindow primaryNs isExpired Resolvers getDomain getClient ListZones Directory *acme.EAB provision userAgent Directory retrieved authMutex HTTPSPort *[]dns.RR StartPort PrevEntry ExpiresAt evictList GetOldest PeekOrAdd onEvicted OnlineMap StreamMap getOnline Normalize readSlice writerSem readerSem localSize Broadcast *sync.Map BitLength FullBytes **big.Int ScanState *big.Word setUint64 FillBytes SetString SetUint64 lehmerGCD PublicKey publicKey *ecdsa.zr nistCurve CRTValues fixedSize AddUint24 AddUint48 *asn1.Tag IsRegular Anonymous CallSlice bytesSlow regAssign retOffset stackPtrs inRegPtrs framePool SliceType questions AResource Authority Ftruncate WaitWrite WriteOnce writeLock waitWrite *abi.Kind *abi.Type PtrToThis *abi.Name ValueSize *abi.ITab *[8]int64 Shorthand AddGoFlag BoolSlice BytesHexP CountVarP DurationP IPMaskVar IPNetVarP Int16VarP Int32VarP Int64VarP IntSliceP StringVar Uint16Var Uint32Var Uint64Var Uint8VarP UintSlice parseArgs SortFlags leftDelimerror QnewIf Qparse Q ParseGlob Templates associate setOption execFuncs logHandle outHandle SetPrefix StartLine isDiscard sendError MatchName decodeInt decodeMap decodePtr *afero.Fs RemoveAll *[1]error *[2]error ReadSlice PutUint16 PutUint32 PutUint64 Reserved1 Sa_family DeviceIdx TargetIdx SourceSAP bufsIndex numMerged itemsPool tunWriter gsoBuffer BatchRead BatchSize configure portIndex NewPacket batchLoop LinkIndex MultiPath *[3]error FullReset WriteZero familyMap portFirst WritePort NewBuffer newBuffer ProtoPort sizeCache GetDomain GetPrefix estimates timeDelta Serialize SessionID FragCount Decrement Allow0RTT generator maxHeight DeleteAll InsertAll PeekFront immediate sendQueue ctxCancel connState srcConnID pnManager ReadBatch batchConn ErrorCode errorRead completed cancelErr writeChan writeOnce localAddr mtuFinder openQueue maxStream GetStream tracingID sendRetry errorChan connQueue DialEarly connIDLen listening datagrams isConnect setupConn closeSend connCount ParseNext newClient math/rand remaining marshaled nextNonce baseNonce outputLen bufReader partsRead tmpshared DotReader skipSpace Coalesced Sensitive idToIndex maxStrLen matchHost ProxyFunc HTTPProxy httpProxy addUnique successesnonce+y Responses RevokedAtAdns:"a" *dns.AAAA ToCDNSKEY *dns.CERT *dns.GPOS Longitude HitLength *dns.SVCB *dns.ISDN Locator64 *dns.NSEC *dns.NULL *dns.RKEY Inception *dns.TSIG RRsetUsed SetNotify SetUpdate *dns.TKEY *dns.TLSA ToRFC3597 ExtraText LeaseLife *dns.Conn MatchRune numSubexp prefixEnd newReader newString hasPrefix FindIndex NumSubexp backtrack doExecute doOnePass WithExtra AuthStyle AttachVPC DetachVPC GetVNCUrl ListIPv4s ListIPv6s MassStart Reinstall ListPlans ListUsers GetDNSSec UpdateSoa AttachISO DetachISO ISOStatus ListNodes suffixOff *exec.Cmd WaitDelay goroutine ctxResult StdinPipe PrimaryNS LookupPTR LookupSOA KeyConfig ToPrivate SessionId KeyShares SqrtRatio ExpandFor fromP1xP1 seenLossy acceptRun ParseName peekCount IsComplex ifControl newAction newNumber stopParse Transform copySlice setString skipASCII QuickSpan transform flushCopy insertCGJ backwards quickSpan composing *ini.File DebugFunc AddShadow InFloat64 MustInt64 RangeTime ValidInts addShadow parseInts DeleteKey BlockMode getUint64 *toml.Key LocalDate LocalTime multiline omitempty encodeMap stashExpr OmitEmpty scan_mark pairs_end pairs_top input_pos canonical indention FieldsMap InlineMap RxPackets TxPackets RxDropped TxDropped Multicast FastLeave RootBlock LinkState MaxTxRate MinTxRate SlaveType Namespace EncapType OperState LinkAttrs EtherType RestartMs HelloTime FlowBased MiiStatus DownDelay PeerEqual ClearFlag ListFlags Timestamp IfInfomsg iovecList coveredBy sizeField mergeList ProtoType EndColumn getString rsc.io/qr ackPoints sampleRtt getMinRtt drainGain LossCount StreamNum LatestRTT UpdateRTT latestRTT ChoseALPN FrameType FinalSize AckRanges DelayTime GetLength ParsedLen parsedLen parseNext BytesLost hasNewAck isMissing ackQueued maxPeriod enableECN bytesRead applyMask ourParams allow0RTT willBlock WillBlock setIPMreq JoinGroup LogValuer WithAttrs WithGroup AddSource withAttrs withGroup *[316]int availRead readFlush writeCopy writeMark stepState dataBlock nextBlock freqcache bitCounts bitLength StartCond alternate checkSize newRegexp numRegexp TokenTypewriteRo BodyBytes drainBody DeriveKey authEncap coreDecap coreEncap *hpke.KEM dhKemBase *ast.Node *ast.File IsLiteral endEscape Highlight encodeInt popWriter AddRtAttr IfAddrmsg SetExtAck *nl.RtMsg Locations initDecls IsDefault **float32 **float64 AsIfaceOf AsValueOf StringPtr Uint32Ptr Uint64Ptr fieldDesc oneofDesc isPointer MessageOf GoValueOf IsValidGo IsValidPB PBValueOf DoNotCopy DataBytes sizeClass lastState raceWrite sockaddrs recvmmsgF sendmmsgF syscaller *bpf.Jump SkipFalse *bpf.RetA ShakeHash *x448.Key IsKeyword Multiline EmitASCII WriteBool WriteName WriteUint DecryptTo EncryptTo MulBy2toD UnpackB60 Decompose Transpose GetParams Disconnect TCPRequest UDPRequest Obfuscator *[8]string *[]*string *struct {} *[16]uint8 *[1]string keyModTime *[2]string *[32]uint8 *[][]uint8 *[8]uint32 *[64]uint8 *[28]uint8 RawSubject Extensions MaxPathLen OCSPServer rawSubject constraint systemPool ScalarMult ThisUpdate PrivateKey *[5]string Attributes NextUpdate *[20]uint8 *[66]uint8 *[4]uint64 *[8]uint64doSlow  *[18]uint8 *[14]uint8 UnreadRune *fmt.ssave floatToken scanNumber *fmt.State clearflags fmtBoolean fmtInteger fmtUnicode *func(int) widPresent *[68]uint8 goodArgNum catchPanic fmtComplex fmtPointer missingArg printValue isWildcard IsLoopback RemoteAddr *net.netFD closeWrite CloseWrite SetNoDelay *net.IPNet remoteDone noReadFrom IsNotFound ReadMsgUDP WriteToUDP ReadFromIP WriteMsgIP unlinkOnce AcceptUnix *net.scope Precedence *net.Error *net.Flags unknownOpt *[]*net.MX *[]*net.NS forResolve LookupAddr LookupHost LookupPort goLookupIP goLookupMX goLookupNS lookupAddr lookupHost lookupPort tryOneName dialSerial dialSingle *[12]uint8 *[8]uint16 **abi.TypeexpandB IsSingleIP string4In6 *[15]uint8 *[29]uint8 appendMode checkValid *os.Signal SystemTime systemTime *[3]uint32 *[]uintptr *complex64 *[]float32 *[]float64 pclnOffset modulename enoptrdata pluginpath gcdatamask *runtime.g *runtime.m *runtime.p insertBack allocCache gcmarkBits pinnerBits allocCount countAlloc nextSample tinyoffset tinyAllocs stackcache allocLarge releaseAll updateHeap *[2]uint64 mSyscallID tryGetFast workbufhdr checkempty sysmontick sudogcache mspancache gcStopTime recordLock cyclesLost stringData goSigStack preemptoff isExtraInC needextram cgoCallers winsyscall preemptGen waitreason gcscandone throwsplit raceignore parentGoid selectDone oldbuckets difference inWorkBufs largeAlloc numObjects totalFreed totalFrees mSpanInUse accumulate GCIdleTime atomicInfo *[10]uint8 *[2]uint32 _interface *[24]uint8 sysmonWake sleepRatio shouldStop gomaxprocs *[4]uint32 *chan bool *[48]uint8 readerWait rotateLeft *[5]uint32 frameStore *[3]string FieldAlign IfaceIndir StructType *[][]int32 *[65]uint8 UnreadByte *[108]int8 ExitStatus StopSignal Controllen *[14]int32 Credential Foreground Cloneflags Reordering *[19]uint8 LayoutElem *time.zone *time.Time cacheStart lookupName Nanosecond ZoneBounds initTicker subCommand SuggestFor ArgAliases Deprecated AddCommand DebugFlags HasExample LocalFlags ParseFlags PrintErrln ResetFlags SetContext HasChanged configName configFile configType BindPFlags GetFloat64 ReadConfig SetDefault callerSkip *zap.uints *zap.times *zap.int8s *zap.bools httpClient acceptChan deleteFunc ListenHTTP acceptLoop DisableUDP forwarding MoveBefore MoveToBack *url.Error RequestURI ForceQuery geositeMap ServerName ServerAddr QUICConfig UDPEnabled configFunc openStream writeMutex LoggerName AppendBool AppendInt8 AppendTime AppendUint AddFloat32 AddFloat64 AddUintptr thereafter reflectBuf reflectEnc crypto/tls OCSPStaple NextProtos ClientAuth MinVersion MaxVersion ticketKeys trafficKey *[13]uint8 scratchBuf nextCipher handshakes serverName retryCount activeCall pskBinders marshalMsg PublicName innerHello *tls.alert readRecord verifyData ciphertext HandleData sourceFunc escapeHTML ReadString FieldStack nameNonEsc parseState savedError canAddrEnc tokenError tokenState tokenStack invalidate writeDebug countError getReadBuf frameCache EndHeaders startWrite writeBytes writeFrame OpenStream CountError StatusCode ProtoMajor ProtoMinor RawExpires WriteProxy wantsClose *http.conn fullDuplex FlushError remoteAddr lastMethod finalFlush inShutdown activeConn onShutdown BaseConfig baseConfig checkNotOn bodyReadCh serveMsgCh writeSched goAwayCode readFrames rejectConn runHandler shutDownIn wroteFrame reqTrailer snapHeader sentHeader wroteBytes writeChunk ReadCloser *http.body earlyClose readLocked BodyCloser IsResponse ByteReadCh doBodyCopy unwrapBody addPattern multiChild emptyChild handleFunc HandleFunc readCloser continueCh callerGone writeErrCh markReused targetAddr beforeDial tryDeliver peerClosed readClosed resTrailer readerDone doNotReuse lastActive sendGoAway *http.File promisedID mimeHeader SetCookies connection copyBuffer BufferPool IsTerminal cacheIndex MustStaple ManageSync RevokeCert forceRenew obtainCert selectCert ListenHost acmeClient GetAccount getAccount newAccount acmeIssuer handleConn txtRecords GetRecords SetRecords getApiHost nameClient HTTPClient NewAccount LogTraffic ForceHTTPS DeviceName CancelRead getTraffic *hash.Hash *pem.Block unlockSlow *sync.Pool victimSize swapLocked *sync.Cond missLocked *sync.Once RightAlign *asn1.Flag IsCompound stringType isCompound modInverse montgomery ModInverse scaleDenom crypto/dsa Parameters privateKey polynomial SaltLength crypto/rsa saltLength Precompute *pkix.Name appendRDNs PostalCode CommonName ExtraNames HasExpired nonDefault flushChild crypto/aes crypto/des crypto/md5 *io.Writer *io.Reader *io.Closer IsExported CanComplex CanConvert Comparable SetComplex SetIterKey SetPointer UnsafeAddr Implements IsVariadic StructType assignIntN valueStart stackBytes outRegPtrs structType Additional AllAnswers MXResource NSResource SkipAnswer isBlocking RawControl ReadDirent readUnlock runtimeCtx *abi.TFlag IsEmbedded ReadVarint BucketSize *[0]uint64 fromString IsBoolFlag AddFlagSet BoolSliceP FlagUsages Float32Var Float64Var GetFloat32 GetIPSlice IPMaskVarP IPSliceVar Int32Slice Int64Slice MarkHidden StringVarP Uint16VarP Uint32VarP Uint64VarP UintSliceP shorthands rightDelimaction Qbackup Qerrorf Qexpect QnewDot QnewEnd QnewNil QuseVar Q ParseFiles missingKey parseFuncs DecodeHook ErrorUnset ZeroFields decodeBool decodeFunc decodeUint *hcl.Codec *ini.Codec Properties *flag.Flag AppendByte copyNeeded DecodedLen EncodedLen Target_idx *[63]uint8 IncludeUID ExcludeUID TableIndex ruleIndex6 gsoEnabled gsoToWrite BatchWrite nextIndex6 resetRules unsetRoute unsetRules *tun.Stack LastActive portAccess addrAccess LookupBack udpTimeout ReadPacket wintunLoop ILinkIndex *[1]uint32 WriteZeroN AddrString AddressLen PostReturn Descriptor comparator LastPacket RemoveUpTo extraAcked bytesAcked HeaderSize TokenStore WouldBlock SentPacket highestSeq HasAppData addAppData addInitial DestConnID streamsMap peerParams GetVersion closeLocal PacketConn supportsDF signalRead frameQueue sendStream runStopped RemoveConn MaxDataLen sendPacket streamType nextStream expiration destConnID retryQueue baseServer handlerMap closeQueue receiveErr Connection contentLen numWritten Connection HTTPStream ByteReader connection *[0]func() *rand.Rand ExpFloat64 initConfig nodeOffset *hmac.hmac crypto/rc4 *list.List *hkdf.hkdf CreatePart WriteField *[30]uint8 readHeader readString setMaxSize evictCount DecodeFull firstField beginChunk HTTPSProxy httpsProxy ipMatchers TBSRequest ProducedAt IssuerHash packHeader wrappedErr *dns.AFSDB DigestType *dns.CNAME *dns.CSYNC *dns.DHCID *dns.DNAME *dns.EUI48 *dns.EUI64 *dns.HINFO *dns.HTTPS SubAddress Preference *dns.MINFO *dns.NAPTR *dns.NINFO *dns.NSEC3 Iterations HashLength *dns.EDNS0 SetUDPSize SetVersion *dns.RRSIG Expiration PackBuffer RemoveName *dns.SSHFP *dns.UINFO *dns.Error TsigStatus TsigSecret prefixRune FindString ReplaceAll allMatches replaceAll StackTrace DeviceAuth AttachVPC2 DetachVPC2 MassReboot GetInvoice CreateUser DeleteUser UpdateUser CreateIPv4 DeleteIPv4 ListPublic GetCluster Kubernetes ReservedIP NewRequest SetBaseURLexited ExtraFiles StderrPipe StdoutPipe childStdin LookupAAAA ECHConfigs PskBinders nextProtos *[67]uint8 *[57]uint8 *[33]uint8 *[97]uint8 *[49]uint8 IsNegative MarkerOnly *[50]uint8 *parse.Pos continueOK parenDepth actionLine rangeDepth BranchNode Complex128 endControl newCommand newComment startParse unexpected *norm.Form SpanString appendRune assignRune initString setFlusher *norm.Iter InitString *hcl.field ReadCloser MustString MustUint64 RangeInt64 StrictInts TimeFormat ValidBools ValidTimes ValidUints parseBools parseUints KeyStrings ParentKeys mapToField mapToSlice NameMapper GetSection HasSection NewSection lineNumber FilterFunc GetComment MustGetInt SetComment getFloat64 EnterTable FromParser arrayIndex fromParser *yaml.Kind *yaml.Node token_mark start_mark items_data pairs_data buffer_pos raw_buffer flow_level references serialized best_width line_break whitespace open_ended FieldsList parseChild uniqueKeys aliasCount aliasDepth emitScalar marshalDoc Statistics AddrFamily Collisions AttachMode GSOMaxSize GSOMaxSegs GROMaxSize SrcPortMin MultiProto TimeQuanta NonPersist AgeingTime EncapLimit EncapFlags EncapSport EncapDport PartnerKey PartnerMac UseCarrier ResendIgmp LpInterval ReadOutput buildError inMiddleOf marshalMap cloneBytes ParentFile ByJSONName ByTextName IsMapEntry HasDefault GetUnknown SetUnknown WhichOneof NewElement InRecovery PacingRate debugPrint *bbr.Clock pacingRate pacingGain WithPrefix timeFormat logMessage LostPacket UpdatedMTU UpdatedKey DroppedKey AcksPacket PacketType parseFrame BytesAcked ecnMarking nextToSkip congestion ecnTracker sendWindow SetReadKey setReadKey createAEAD icmpFilter *[126]int8 getIPMreqn setIPMreqn genericOpt ICMPFilter LeaveGroup WriteBatch *slog.Attr *slog.Kind *slog.kind *spew.flag availWrite writeSlice makeReader *[17]int32 *[16]int32 hash/crc32 *syntax.Op calcHeight parseClass CheckRetry loggerInit clientInit *hpke.xKEM getSuiteID IsOperator *token.Pos writeLines Expression parseTable currentIdx checkArray checkTable safeString CommonType *gob.encOp encodeUint pushWriter sendTypeId countState *nl.RtAttr Calculated RangeFiles RangeEnums MakeString StringName CheckValid IsOpenEnum allocEnums checkDecls validation atomicOnce BytesSlice Float32Ptr Float64Ptr WeakFields newMessage fieldTypes rangeInfos getUnknown setUnknown nilMessage isRequired weakOffset checkField getPointer keyWiretag valWiretag CheckBytes *qtls.conn controllen setControl *bpf.ALUOpwriteXx scanDigits scanEscape scanString ErrorCount EndMessage WriteFloat marshalAny *k12.State *fp448.Elt ReduceLe2Q addGeneric nttGeneric subGeneric PackLeqEta UnpackHint IsIdentity CompressTo Decompress IsExtended HTTPRequest sync/atomic *[0]*string *chan error *[2]uintptr *[3]uintptr certificate certModTime poolDequeue *[][]string *func() int crypto/x509 *[]*url.URL *[]x509.OID MarshalText ExtKeyUsage IPAddresses addCertFunc CurrentTime buildChains Certificate crypto/ecdh scalarOrder GenerateKey TBSCertList *x509.pkcs8 *[]*big.Int *[]big.Word *[133]uint8 *fmt.buffer writeString errorString scanComplex scanPercent *func(bool) precPresent wrappedErrs WriteString unknownType *[1]uintptr *[4]uintptr *net.IPMask DefaultMask IsMulticast SetDeadline isConnected ctrlNetwork ReadMsgUnix SyscallConn WriteToUnix *net.IPAddr *chan<- int *<-chan int IsTemporary ReadFromUDP WriteMsgUDP readFromUDP *net.IPConn mptcpStatus *net.ipAttr *[]net.Addr *[]*net.SRV *net.result *net.byName lookupGroup LookupCNAME LookupNetIP goLookupPTR goLookupSRV goLookupTXT lookupCNAME *net.Dialer DialContext *[5]uintptr LoadOrStore HashTrieMap *netip.Addr bitsPlusOne withoutZone bitsSetFrom *[9]uintptr *os.dirInfo stdoutOrErr setDeadline *os.rawConn *os.timeout *[]*os.File *os.Process closeHandle *[16]uint64 *[512]uint8 *complex128 pctabOffset runtimehash funcnametab findfunctab textsectmap deferreturn stackguard0 stackguard1 *[6]uintptr syscalltick syscallwhen speciallock ensureSwept *func(uint)pushAllK minWhenHeap acquiretime releasetime bytesMarked flushedWork raceprocctx pinnerCache newSigstack createstack waitunlockf isMutexWait preemptStop trackingSeq setoverflow newoverflow noldbuckets oldoverflow *[68]uint64 totalAllocs mCacheInUse buckHashSys GCPauseTime GCTotalTime globalsScan publishInfo setEventErr *[0]uintptr slotsOffset errIntegral errOverflow *[112]uint8 *[32]uint64 startBucket checkBucket *[128]uint8 readerCount rotateRight *[1][]int32 *[800]uint8 badCharSkip *[256]uint8 ContainerID *[8][]uint8 NoSetGroups UidMappings GidMappings AmbientCaps UseCgroupFD Nanoseconds *time.Month MarshalJSON *time.Timer Annotations helpCommand CommandPath ErrOrStderr NamePadding OutOrStderr OutOrStdout SetHelpFunc UsageString ValueString configPaths AllSettings GetDuration GetIntSlice MergeConfig MustBindEnv WatchConfig WriteConfig writeConfig *zap.Option *zap.Logger development errorOutput WithOptions *zap.int16s *zap.int32s *zap.int64s WriteSyncer *zap.Config ReceiveLoop EventLogger ListenSOCKS GetOrCreate *tun.Server StructRoute InsertAfter MoveToFront insertValue *url.Values EscapedPath setFragment passwordSet RawFragment LoadGeoSite ConnFactory Established SendMessage Deobfuscate HopInterval currentConn TrimmedPath *func(int8) AppendArray AppendInt16 AppendInt32 AppendInt64 AppendUint8 AddDuration ErrorOutput EncodeEntry appendFloat jsonEncoder initialized cipherSuite *tls.Config CipherSuite ECHAccepted WrapSession writeKeyLog expandLabel handshakeFn echAccepted packetsSent hpkeContext echRejected serverShare closeNotify loadSession CryptBlocks serverHello clientHello *[1][]uint8 *json.field nameEscHTML byExactName valueQuoted InputOffset indentValue StreamEnded maxReadSize debugFramer stringToken HasPriority ErrorDetail WriteGoAway writeUint16 writeUint32 CloseStream activeConns MaxHandlers IdleTimeout WriteSubset writeSubset WriteHeader Partitioned lastSegment otherValues WithContext isH2Upgrade writeHeader wroteHeader handlerDone CloseNotify bodyAllowed readRequest ReadTimeout BaseContext ConnContext idleTimeout setConnFlow doneServing readFrameCh pushEnabled curHandlers canonHeader PseudoValue NumSettings httpResCode contentType closeStream onIdleTimer processData processPing readPreface resetStream resetQueued hasTrailers bodyRemains readTrailer addSegments findHandler registerErr canceledErr closeLocked reqCanceler h2transport dialConnFor PingTimeout pingTimeout bytesRemain sentHeaders pastHeaders readAborted abortStream *[][8]uint8 goAwayDebug reqHeaderMu closeIfIdle healthCheck ErrorString maxStreamID SortStrings Certificate getAllCerts ManageAsync generateCSR AltHTTPPort DNS01Solver usingTestCA loadAccount saveAccount DNSProvider getZoneInfo toSanitized getDNSZones *acme.stack PollTimeout *acme.Order httpPostJWS pollTimeout postAccount *acme.keyID InitialTime TraceStream RequestHook MasqHandler receiveLoop eventLogger masqHandlerreadMsgCwriteToC ResolveInfo HostMatcher evictedKeys evictedVals onEvictedCB CancelWrite initialTime *[621]uint8 *sync.Mutex *sync.eface rUnlockSlow *sync.entry dirtyLocked application *[8]float64 *ecdh.Curve addJacobian Precomputed AddASN1Enum AddASN1NULL MarshalASN1 Constructed *[60]uint32 *cipher.gcm *cipher.ctr *cipher.cbc *md5.digest *io.discard panicNotMap FieldByName OverflowInt SetMapIndex capNonSlice extendSlice lenNonSlice stackAssign IndirectKey crypto/sha1 LatinOffset ConnectDone authorities additionals OPTResource PTRResource SOAResource SRVResource TXTResource SetBlocking writeUnlock prepareRead FieldAlign_ *abi.Method DataChecked ReturnIsPtr *abi.FuncID LoadAcquire *pflag.Flag NoOptDefVal BytesBase64 BytesHexVar DurationVar Float32VarP Float64VarP GetBytesHex GetIPv4Mask IPSliceVarP Int32SliceP Int64SliceP IntSliceVar StringArray StringSlice StringToInt getFlagTypebackup2 Qbackup3 Qcommand QnewBool QnewElse QnewList QnewText QnewWith Qoperand QpopVars Qrecover Q *log.Logger ErrorUnused decodeArray decodeBasic decodeFloat decodeSlice *afero.File *afero.OsFs LoadOptions *[]*ini.Key *json.Codec *toml.Codec *yaml.Codec *flag.Value AppendFloat TrimNewline WithPadding Bdaddr_type NFCProtocol ServiceName *unix.Iovec *unix.RtMsg InfoContext WarnContext IDByPackage PackageByID StrictRoute itemsByFlow routeUpdate unsetRoute0 *tun.System *tun.TCPNat Destination staleReturn tcpListener *tun.WinTun processIPv4 processIPv6 WritePacket *buf.Buffer WriteRandom AddrPortLen ReadAddress matchDomain GetIntValue *v2geo.CIDR firstPacket FirstPacket HasMoreData ContainsAll ContainsAny writeOffset DropPackets streamQueue CurrentSize perspective frameParser closeRemote destroyImpl handleFrame sendPackets GetAckFrame cryptoSetup finalOffset signalWrite closeCalled resetTokens *quic.sconn gotGSOError writePacket nextVersion blockedSent maxTokenAge connHandler connContext ListenEarly closeServer MaxTokenAge createdConn isSingleUsehasDatax] hasMoreData sentRequest clearStream *http3.body getSettings requestDone closeCancel graceCancel addListener *[607]int64 NormFloat64 crypto/hmac *rc4.Cipher openGeneric sealGeneric crypto/rand *hpke.dhKEM *sha3.state *[25]uint64 *[168]uint8 SetBoundary currentPart NextRawPart disposition Multistream multistream PutIdleConn hasNetHooks *hpack.node searchTable shouldIndex evictOldest byNameValue EmitEnabled SetEmitFunc emitEnabled proxyForURLhttpReq+y RequestList *dns.zlexer isDuplicate GatewayType *dns.DNSKEY parseDNSKEY *dns.NIMLOC TypeCovered *dns.MsgHdr *dns.Header NameNotUsed RemoveRRset SetQuestion *dns.SMIMEA *dns.TALINK PSDNAddress *dns.ZONEMD fromRFC3597 SourceScope *dns.Client dialTimeout readTimeout DialTimeout *dns.klexer *libdns.SRV subexpNames prefixBytes minInputLen *regexp.job shouldVisit MatchReader MatchString SubexpIndex SubexpNames formatSlice expiryDelta RedirectURL AuthCodeURL TokenSource *govultr.OS GetUpgrades GetUserData ListVPCInfo ListHistory WriteAccess ListRegions GetNodePool GetVersions ListCluster Application Marketplace *exec.Errorsuccess SysProcAttr lookPathErr childStderr childStdout RespMailbox *doh.answer *bigmod.Nat ShouldPrint matchResult *parse.Node *parse.Tree *parse.Mode *parse.item emitComment elseControl expectOneOf hasFunction newContinue newPipeline newTemplate newVariable withControl *norm.input appendSlice charinfoNFC insertFlush returnSlice *gotenv.Env *[]ast.Node Insensitive MustFloat64 StrictBools StrictTimes StrictUints TimesFormat ValidInt64s parseInt64s ReflectFrom StrictMapTo reflectFrom dataSources sectionList ValueMapper NewSections GetComments MustGetBool MustGetUint SetComments *toml.entry handleTable handleValue stashedExpr MarshalYAML *yaml.Style HeadComment LineComment FootComment pairs_start tokens_head simple_keys best_indent events_head space_above foot_indent anchor_data scalar_data knownFields decodeCount RxCrcErrors ParentIndex MasterIndex NumTxQueues NumRxQueues SamplePoint PDPHashsize ActiveSlave ArpInterval ArpValidate FailOverMac PreferedLft *[2][]uint8 destinationenvironc^ marshalList StartColumn IsSynthetic Cardinality HasJSONName HasPresence IsExtension InterfaceOf InSlowStart setHighGain InitiatedBy SetLogLevel *utils.Rand MaxAckDelay SmoothedRTT smoothedRTT maxAckDelay *wire.Frame LowestAcked MaximumData StreamLimit outstanding numSentECT0 numSentECT1 DeleteBelow addToRanges IgnoreBelow ignoreBelow sentPackets ReceivedAck DeclareLost largestSent prevRcvAEAD nextRcvAEAD SetWriteKey handleEvent setWriteKey writeRecord DecodeToken setGroupReqrecvMsgWsendMsgW *[136]uint8 *[264]uint8 *slog.Level *slog.Value ReplaceAttr groupPrefix nOpenGroups writeLocked wrotePrefix *[][]uint32 Uint32Slice Uint64Slice finishBlock readHuffman appendGroup checkHeight checkLimits maybeConcat parseEscape parseRepeat wholeRegexp AccessToken *kem.Scheme Decapsulate Encapsulate LeadComment *token.Type handlePanic startEscape updateWidth AttachChild parseKeyval UpdateTable *gob.typeId externalEnc externalDec GobEncoderT EncodeValue encodeArray descsByName filesByPath NumMessages typesByName numMessages EnforceUTF8 eagerValues NumServices allMessages allServices lazyRawInit requiredBit messageInfo protoUnwrap denseFields coderFields sizePointer InvalidUTF8 *coding.Num betaLastMax ParseHeader Disassemble *bpf.JumpIf *bpf.ALUOpX *xof.k12d10writeX2xwriteX4x *sha3.State IsAbsorbing *x25519.Key *p384.Curve *p384.curve scanComment scanHeredoc lastCharLen lastLineLen EmitUnknown *[510]uint8 initialTodo Power2Round prepareNext outputASCII DeriveNoise ConnectError fillFastOpen *func() bool *[]struct {} *[11]uintptr *[16]uintptr *[8][]string EqualASN1OID SerialNumber SubjectKeyId *x509.sum224 systemVerify NewPublicKey CombinedMult *[][4]uint64 *[1]big.Word encoding/hex *[1024]uint8 *func(uint8) *func(int32) convertFloat *func(error) mustReadRune quotedString writePadding *fmt.Scanner *net.OpError *net.UDPAddr *net.TCPAddr *net.Buffers *func(int64) writeBuffers listenStream readMsgInet4 readMsgInet6 writeToInet4 writeToInet6 ReadFromUnix WriteMsgUnix *net.TCPConn MultipathTCP SetKeepAlive readDeadline lookupValues *net.UDPConn ListenPacket *net.rawConn HardwareAddr *net.nssConf *net.timeout serverOffset StrictErrors LookupIPAddr lookupIPAddr strictErrors dialParallellockSlow  *[1]net.Addr appendTo4In6 *[62]uintptr *os.fileStat Readdirnames spliceToFile RuntimeError *[]complex64 *[]*abi.ITab linktimehash *[]*abi.Type modulehashes takeFromBack *func() uint deferBitsPtr initHeapBits maybeRunChan unlockAndRun dequeueSudoG readyNextGen statusTraced heapScanWork deferpoolbuf goidcacheend gcAssistTime limiterEvent *[32]uintptr captureStack recordUnlock *runtime.mOS profileTimer isExtraInSig mLockProfile pcvalueCache locksHeldLen atomicstatus paniconfault inMarkAssist runnableTime sameSizeGrow nextOverflow gcCyclesDone GCAssistTime *[4096]uint8 *chan uint32 *map[int]int *[8192]uint8 replacements Unshareflags Microseconds Milliseconds *[]time.zone AppendFormat appendFormat *time.Ticker *cobra.Group UnknownFlags flagErrorBuf globNormFunc helpTemplate SilenceUsage HelpTemplate SetUsageFunc UsagePadding ValidateArgs VisitParents *viper.Viper AutomaticEnv GetStringMap ReadInConfig SetEnvPrefix UnmarshalKey mergeFlatMap searchInPath *zap.uint16s *zap.uint32s *zap.uint64s *zap.payload *[]io.Closer *[]time.Time buildEncoder buildOptions RegisterSink *http.Server httpListener FirewallMark Inet4Address Inet6Address *[]func(int) InsertBefore PushBackList DownloadFunc checkModTime closeCleanup *func(int16) AppendObject AppendString AppendUint16 AppendUint32 AppendUint64 AddComplex64 AddReflected LevelEnabler writeContext ocspResponse alpnProtocol SessionState *tls.CurveID CipherSuites OCSPResponse Certificates KeyLogWriter *[][32]uint8 cipherSuites deriveSecret finishedHash handshakeErr maxEarlyData ocspStapling RecordHeader sessionState certificates *tls.cbcMode *[]tls.alert readFinished sendFinished masterSecret rsaDecryptOk StoreSession *[1088]uint8 *[1184]uint8 *json.Number reflectValue byFoldedName literalStore errorContext indentPrefix getDataFrame maxWriteSize HeadersEnded WriteHeaders AdjustStream registerConn *http.Header Uncompressed *http.Cookie ProtoAtLeast comparePaths CookiesNamed SetBasicAuth SetPathValue isReplayable hitReadLimit setReadLimit calledHeader *<-chan bool hijackLocked WriteTimeout TLSNextProto nextProtoErr doKeepAlives shuttingDown wroteFrameCh maxFrameSize writingFrame hpackEncoder shutdownOnce PseudoFields checkPseudos LastStreamID noteBodyRead processFrame sendServeMsg setConnState writeHeaders wroteHeaders *http.mp4Sig earlyCloseFn *http.noBody doEarlyClose FlushHeaders extraHeaders readResponse wroteRequest targetScheme removeOldest idleConnWait connsPerHost MaxIdleConns queueForDial connPoolOnce RoundTripOpt initConnPool newTLSConfig pastTrailers copyTrailers writeRequest *[8][8]uint8 seenSettings nextStreamID addConnCalls RoundTripErr contentRange *[2048]uint8 *[]io.Reader *http.Client *[]sync.Pool Authenticate flushPending delayedFlush *[]io.Writer copyResponse ErrorHandler lockFilename DecisionFunc NeedsRenewal checkStorage TrustedRoots SetMaxEvents txtRecordsMu libdnsRecordID json:"id" createRecord doAPIRequest updateRecord deleteRecord upsertRecord addDNSRecord *acme.Client PollInterval GetDirectory pollInterval OverrideAddr OriginalAddr CloseWithErr handleClientreadFromCwriteMsgCTx json:"tx"OK json:"ok" ExpireBucket RemoveOldest *[63]uintptrRx json:"rx" *crypto.Hash encoding/pem *sync.Locker *sync.noCopy loadReadOnly defaultValue *big.divisor convertWords divRecursive crypto/ecdsa Organization Undocumented AddASN1Int64 BytesOrPanic *[256]uint32 XORKeyStream *cipher.AEAD productTable counterCrypt updateBlocks *io.WriterTo *io.ReaderAt *fs.FileInfo *fs.FileMode *fs.DirEntry CanInterface FieldByIndex MethodByName OverflowUint SetIterValue panicNotBool AssignableTo assignFloatN IndirectElem ReflexiveKey makeFuncCtxt *sha1.digest ConnectStart AAAAResource AllQuestions AnswerHeader SkipQuestion checkAdvance skipResource *atomic.Bool *poll.String ReadMsgInet4 ReadMsgInet6 WriteToInet4 WriteToInet6 prepareWrite waitCanceled internal/abi *abi.NameOff *abi.TypeOff *abi.ChanDir *abi.TextOff *abi.Imethod *abi.MapType *abi.PtrType *abi.RegArgs StoreRelease *pflag.Value AddGoFlagSet BoolSliceVar BytesBase64P BytesHexVarP DurationVarP Float32Slice Float64Slice GetBoolSlice GetUintSlice IntSliceVarP StringArrayP StringSliceP StringToIntP UintSliceVar parseLongArg sortedActual sortedFormal interspersed ErrorContextitemList QnewBreak QnewChain QnewField QnewRange Qpipeline Q AddParseTree **log.Logger logThreshold logListeners SetLogOutput encoding/csv *fsnotify.Op decodeString decodeStruct keyDelimiter KeyDelimiter defaultUsage *buffer.Pool lastRuneSize AppendDecode AppendEncode DecodeString SharedUmemFD tipcAddrtype Nfc_protocol Service_name *unix.RtAttr *tproxy.Conn AcceptTProxy DebugContext *tun.Options *tun.flowKey tcpGROAccess tcp4GROTable tcp6GROTable *tun.Handler checkTimeout inet4Address inet6Address tcpListener6 ExtendHeader ReadFullFrom ReadOnceFrom CheckBadAddr ReadAddrPort WriteAddress RearHeadroom NeedHeadroom GetBoolValue ProtoMessage ProtoReflect GetAttribute *v2geo.GeoIP windowLength GetThirdBest MaybeRelease handlePacket *quic.Config AddrVerified *quic.Stream AcceptStream SendDatagram capabilities *quic.sender DeleteStream ResetFor0RTT UpdateLimits UseResetMaps ConnectionID oneRTTStream addHandshake *quic.framer *quic.packer PacketNumber StreamFrames streamFrames AppendPacket srcConnIDLen creationTime handleFrames *quic.sealer appendPacket *quic.stream currentFrame streamSender mtuIncreased SetMaxStream shouldDelete deleteStream *quic.client runSendQueue createServer sendDatagram SetSendError parseTrailer responseBody ReadResponse acceptStream rcvdSettings *http3.Error ErrorMessage closeReceive altSvcHeader removeClient *rand.Source *blake2b.XOF *blake2b.xof *color.Color *rand.reader *hpke.Sender sharedSecret *[2400]uint8 dashBoundary ReadCodeLine ReadDotBytes ReadDotLines readCodeLine *gzip.Reader *gzip.Header decompressor WroteHeaders WroteRequest maxSizeLimit successRatio *ocsp.certID ResponseType *dns.CDNSKEY publicKeyRSA *dns.SVCBKey *dns.NSAPPTR *[]dns.EDNS0 RRsetNotUsed MatchingType *dns.RFC3597 tsigProvider *dns.Handler TsigProvider HandleRemove writeTimeout *[2]*big.Int *libdns.Zone MatchRunePos *[][][]uint8 ExpandString FindAllIndex FindSubmatch tryBacktrack ClientSecret refreshTokenOs json:"os" GetBandwidth ListVPC2Info ListInvoicesPG json:"pg" *govultr.SoaIP json:"ip" *govultr.Iso GetNeighbors *govultr.ISO ListClusters *govultr.SSL Availability *govultr.VPC BlockStorage DomainRecord FirewallRule LoadBalancer SetRateLimit SetUserAgentOS json:"os" ProcessStatesysUsageuserTime ProcessState childIOFiles goroutineErr *doh.ARecord *doh.DNSType rawPublicKey MasterSecret OmitEmptyPsk nextProtoNeg getPublicPtr NextProtoNeg OcspStapling getPublicObj *quic.Header SetGenerator ShouldEnable *bisect.cond *parse.lexer insideAction atRightDelim atTerminator blockControl breakControl nextNonSpace parseControl peekNonSpace rangeControl textOrAction *template.JS multiSegment *norm.qcInfo charinfoNFKC LastBoundary NextBoundary nextBoundary insertSingle insertUnsafe *[]token.Pos ShortCircuit AllowShadows *ini.Section nestedValues InTimeFormat MustDuration NestedValues RangeFloat64 StrictInt64s ValidUint64s parseUint64s *[8]*ini.Key isRawSection SaveToIndent FilterPrefix FilterRegexp MustGetInt64 WriteComment encodeStruct *toml.strict ExitKeyValue MissingField MissingTable arrayIndexes scalar_style head_comment line_comment foot_comment tail_comment token_number end_implicit problem_mark context_mark read_handler input_reader stem_comment root_context *yaml.parser fieldByIndex mergedFields *netlink.Via RxOverErrors RxFifoErrors TxFifoErrors RxCompressed TxCompressed ProxyArpWiFi PhysSwitchID *netlink.Can *netlink.GTP *netlink.Vrf *netlink.Vti AggregatorId ArpIpTargets NumPeerNotif TlbDynamicLb VtepDevIndex VlanProtocol *netlink.Ifb toRtAttrData *udpnat.conn *shell.ShellwatchCtxc^ IsMessageSet unmarshalMap AllowPartial MarshalState marshalField sizeSingular mergeMessage DoNotCompare ByDescriptor IsValidValue ProtoMethods panicMessage isAppLimited IsAppLimited MaxAckHeight OnAppLimited OnPacketLost OnPacketSent a0Candidates *bbr.bbrMode setDrainGain maxBandwidth highCwndGain pktInfoSlots ToHeaderBits *utils.Timer SetLossTimer LargestAcked MaxStreamNum ReasonPhrase *wire.Header ValidFor0RTT ReceivedTime declaredLost numAckedECT0 numAckedECT1 deletedBelow cleanupStart largestAcked ackedPackets getScaledPTO AddBytesRead AddBytesSent addBytesRead isLongHeader aeadOverhead nextSendAEAD rejected0RTT IsRetryToken *ipv4.rawOptrecvMsgsWsendMsgsW MulticastTTL TrafficClass *slog.Record *[]slog.Attr isEmptyGroup *slog.Source *slog.Logger *[512]uint32 tryWriteCopy huffmanBlock *flate.hcode *crc32.Table *syntax.Inst *syntax.Prog setAuthStyle RefreshToken EncodeValues RetryWaitMin RetryWaitMax PrepareRetrypatIndexRo *sign.Scheme *[4057]uint8 *[2009]uint8 *[1952]uint8 *[3407]uint8 *[4000]uint8 math/rand/v2 *ast.Comment IsIdentifier *token.Token PushAndChain parseNewline scanDateTime *gob.gobType encoding/gob *gob.mapType *gob.Encoder encodeSingle writeMessage IfaCacheinfo RegisterFile RegisterEnum CheckOverlap TypeResolver FileRegistry lazyInitOnce fileRegistry *impl.offset PointerSlice extensionMap isMessageSet oneofsByName mergePointer ExtendedType initToLegacy lazyInitSlow isNonPointer *impl.enumV1 *coding.Bits *coding.Mask *coding.Code *coding.Plan maxBurstSize lastSentTime getBandwidth IsEndOfRound hystartFound *socket.Conn *bpf.JumpIfX *bpf.NegateA *[1568]uint8 *[3168]uint8 *[1632]uint8 *[1920]uint8 *[3293]uint8 IsAtInfinity scanExponent scanFraction scanMantissa StartMessage WriteLiteral *gf256.Field coreAddition oddMultiples *[2560]uint8 *[1344]uint8 *[1312]uint8 *[2484]uint8 *[2528]uint8 *blake2s.XOF *blake2s.xof *common.Poly PackLeGamma1 UnpackLeqEta ExtendedEltP encoderState *[1280]uint8 *[2420]uint8 DeriveNoise2 DeriveNoise3 *func() error *func(string) fillTLSConfig *[8]struct {} crypto/sha256 MarshalBinary *[]*net.IPNet UnmarshalText Intermediates NewPrivateKey pointToAffine *func(func()) *fmt.readRune complexTokens convertString *func() int32 *func(uint64) *fmt.fmtFlags handleMethods *fmt.Stringer *net.UnixAddr *net.sockaddr IsUnspecified *net.UnixConn SetReadBuffer readFromInet4 readFromInet6 writeMsgInet4 writeMsgInet6 writeDeadline *net.pipeAddr *net.DNSError *net.Listener *net.fileAddr *[]net.IPAddr *[]net.ipAttr *[]netip.Addr singleRequest *chan []uint8 canonicalName *[]net.byName *net.Resolver *net.addrList goLookupCNAME fallbackDelay FallbackDelay internal/weak *netip.Prefix *func() int64 *os.LinkError copyFileRange *os.noWriteTo pidDeactivate *[]complex128 *interface {} *runtime.Func filetabOffset *[8]*abi.Type takeFromFront *runtime.coro decPinCounter getPinnerBits incPinCounter newPinnerBits nextFreeIndex pinnerBitSize *func(uint16) reportZombies setPinnerBits maybeRunAsync acquireStatus *[508]uintptr checknonempty *[512]uintptr scannedStacks *runtime.note *[65516]uint8 varintReserve cgoCallersUse waitTraceSkip signalPending hasCgoOnStack preemptShrink parkingOnChan nocgocallback trackingStamp gcAssistBytes *runtime.hmap *runtime.bmap incrnoverflow oldbucketmask *[]abi.Method missingMethod inputOverflow *func(uint32) *[16384]uint8 IncNonDefault headerWritten InterfaceType IsDirectIface *[256][]uint8 *strings.span *syscall.Conn *time.Weekday firstZoneUsed UnmarshalJSON *[1]time.zone commandgroups parentsPflags usageTemplate flagErrorFunc SilenceErrors ArgsLenAtDash ContainsGroup FlagErrorFunc HasLocalFlags RemoveCommand ResetCommands UsageTemplate secretKeyring SecretKeyring *viper.Logger allowEmptyEnv AddConfigPath AllowEmptyEnv BindFlagValue MergeInConfig RegisterAlias SetConfigFile SetConfigName SetConfigType WriteConfigAs getConfigFile getConfigType marshalWriter registerAlias resetEncoding *[]zap.Option sweetenFields *zap.errArray *zap.uintptrs *zap.float32s *zap.float64s handleConnect handleRequest socksListener BindInterface **net.UDPAddr NewConnection PushFrontList *url.Userinfo GeoIPFilename verifyAndFill connectedFunc *client.udpIO ListenUDPFunc *zapcore.Core CapitalString unmarshalText AppendFloat32 AppendFloat64 AppendUintptr AddByteString AddComplex128 OpenNamespace IncCheckReset UnmarshalYAML EncoderConfig appendComplex safeAddString FlushInterval AcceptableCAs UnwrapSession Renegotiation DecryptTicket EncryptTicket decryptTicket encryptTicket mutualVersion supportsCurve *tls.halfConn trafficSecret *tls.keyShare sessionTicket alpnProtocols pskIdentities originalBytes updateBinders MaxNameLength serverNameAck selectedGroup readFromUntil readHandshake *tls.listener LoadAndDelete *[8]tls.alert establishKeys cipherSuiteOk *tls.QUICConn encoding/json *json.encOpts readSlice$ *[]json.field *json.scanner popParseState convertNumber rescanLiteral *json.Decoder tokenValueEnd *json.Encoder SetEscapeHTML replyToWriter BlockFragment headerFragBuf WritePriority WriteRawFrame WriteSettings readMetaFrame HeaderEncoder *http.Handler *http.Request ContentLength *http.pattern *http.segment conflictsWith MultipartForm PostFormValue requiresHTTP1 handlerHeader contentLength closeNotifyCh finalTrailers finishRequest *[]*http.conn nextProtoOnce listenerGroup trackListener remoteAddrStr advMaxStreams shutdownTimer RegularFields HasDuplicates checkPriority processGoAway declBodyBytes onReadTimeout *http.htmlSig *http.textSig didEarlyClose bodyReadError GetClientConn *chan<- error writeLoopDone cancelRequest getCtxForDial *http.connLRU CancelRequest customDialTLS newclientconn connPoolOrDef NewClientConn newClientConn requestedGzip reqBodyClosed sentEndStream getConnCalled StreamsActive SetDoNotReuse closeForError encodeHeaders onIdleTimeout tooIdleLocked addConnLocked getClientConn *http.anyDirs reqDidTimeout needsContinue *http.Flusher *[32768]uint8 checkRedirect CheckRedirect SetXForwarded flushInterval copyToBackend AnyCommonName hostWhitelist CertSelection RenewCertSync AccountKeyPEM emailUsername lookUpAccount newACMEClient activeWorkers AppendRecords DeleteRecords getDNSRecords errorResponse *vultr.Client getDNSEntries *acme.Problem *acme.Account FinalizeOrder UpdateAccount doHTTPRequest *server.udpIO HookedReqAddr UntraceStream TrafficLogger Authenticator authenticated HijackAddress removeElement ContainsOrAdd RewriteDomain *bytes.readOp *bytes.Buffer *bytes.Reader *sync.rlocker *[]sync.eface *sync.RWMutex *asn1.encoder encoding/asn1 *big.Accuracy expNNWindowed ProbablyPrime publicKeyOnce *rsa.CRTValue SessionKeyLen ToRDNSequence StreetAddress pendingLenLen pendingIsASN1 AddASN1BigInt AddASN1Uint64 addASN1Signed addBase128Int crypto/cipher *cipher.Block deriveCounter *io.nopCloser *io.eofReader *io.onceError *fs.PathError *reflect.Type *reflect.Kind *reflect.flag InterfaceData OverflowFloat UnsafePointer ConvertibleTo stepsForValue NeedKeyUpdate crypto/sha512 Authoritative CNAMEResource SkipAuthority resHeaderType *atomic.Value *atomic.Int32 *atomic.Int64 internal/poll *poll.fdMutex *poll.SysFile ZeroReadIsEOF GetsockoptInt ReadFromInet4 ReadFromInet6 SetsockoptInt WriteMsgInet4 WriteMsgInet6 stringOffsets *abi.FuncType IntRegArgAddr *abi.FuncFlag *atomic.Uint8 *func() uint8 BoolSliceVarP DurationSlice Float32SliceP Float64SliceP GetInt32Slice GetInt64Slice Int32SliceVar Int64SliceVar PrintDefaults SetAnnotation StringToInt64 UintSliceVarP parseShortArg orderedActual orderedFormal argsLenAtDash errorHandling text/template ifControl Q newAction Q newNumber Q newString Q stopParse Q *[]parse.Node *csv.position *[65536]uint8 WrappedErrors *dotenv.Codec *[]*flag.Flag *flag.FlagSet ErrorHandling *atomic.nocmp *bufio.Writer *bufio.Reader decodeQuantum *unix.IPMreqn *[]unix.Iovec *socks5.Reply gsoReadAccess FrontHeadroom deleteElement inet4Prefixes inet6Prefixes broadcastAddr bindInterface frontHeadroom *tun.LinuxTUN processPacket familyByteMap WriteAddrPort *acl.HostInfo *acl.TextRule *acl.Protocol *v2geo.Domain unknownFields GetTypedValue GetSecondBest sendTimeState OpenUniStream SetRemoteAddr highestOffset GetCryptoData initialStream *[]wire.Frame activeStreams controlFrames pathResponses HandleMessage connIDManager tokenStoreKey mtuDiscoverer receivedRetry datagramQueue maxPacketSize Get0RTTSealer Get1RTTSealer getDestConnID EncryptHeader encryptPacket getLongHeader DecryptHeader *quic.rawConn *quic.oobConn receiveStream AddResetToken AddWithConnID packetInfoOOB *quic.streamI lastProbeTime lowestInQueue newStreamChan maxNumStreams handshakeChan handleNewConn validateToken zeroRTTQueues signalHasData *http3.stream parsedTrailer writeUnframed requestWriter *http3.Stream flushTrailers writeTrailers reqDoneClosed *http3.Server ServeListener ServeQUICConn serveListener *list.Element *hpke.hkdfKDF LabeledExpand *hpke.uint128 encryptionKey decryptionKey padAndPermute SectionReader net/textproto ReadLineBytes readLineSlice compress/gzip *[]hpack.node maxTableIndex *acmez.Solver *acmez.Waiter Authorization currentSolver *acmez.Client nextChallenge provision+y userAgent+y HashAlgorithm IssuerKeyHash *ocsp.request *dns.AMTRELAYTxt dns:"txt" *dns.IPSECKEY ExtendedRcode *dns.Question *dns.SVCBPort *dns.SVCBAlpn *dns.EDNS0_UL SourceNetmask *dns.ServeMux ReadMsgHeader *regexp.input regexp/syntax *regexp.queue *regexp.entry *[]regexp.job FindAllString LiteralPrefix *errors.stack *errors.Frame *oauth2.Token SetAuthHeader DeviceAuthURL *oauth2.Alias *govultr.Meta *[]govultr.OS *govultr.IPv4 *govultr.IPv6 ExpirySeconds GetRepository UpdateUserACL *govultr.Node CreateCluster DeleteCluster GetKubeConfig ListNodePools UpdateCluster *govultr.Plan ListBareMetal CreateFromURL *govultr.User *govultr.VPC2 FirewallGroup ObjectStorage StartupScript DoWithContext SetRetryLimit *<-chan error parentIOPipes *doh.DNSClass *doh.MXRecord *doh.NSRecord *doh.Resolver LookupService exchangeHTTPS rawExtensions SessionTicket *tls.KeyShare AlpnProtocols PskIdentities getPrivatePtr montgomeryMul *bisect.dedup *[]parse.item *parse.IfNode checkPipeline html/template *template.CSS *template.URL BoundaryAfter Decomposition FirstBoundary firstBoundary combineHangul insertOrdered compatibility *[8]token.Pos isBooleanType StrictUint64s ValidFloat64s parseFloat64s ChildSections NewBooleanKey DeleteSection NewRawSection WriteToIndent writeToBuffer ClearComments MustGetString MustGetUint64 *[]toml.entry EnterKeyValue *toml.decoder handleKeyPart unmarshalBool *yaml.keyList *[]*yaml.Node mapping_style problem_value comments_head tokens_parsed block_allowed write_handler output_buffer output_writer *yaml.decoder mappingStruct stringMapType *yaml.encoder *[]gob.typeId *netlink.Link RxFrameErrors PhaseSegment1 PhaseSegment2 SyncJumpWidth VlanFiltering *netlink.Bond ArpAllTargets AdUserPortKey AdActorSystem *netlink.Vlan *netlink.Veth PeerNamespace *netlink.Addr *netlink.Rule overlapsEndOf *netipx.IPSet ContainsRange OverlapsRange unmarshalList MarshalAppend Deterministic UseCachedSize ProtoInternal IsPlaceholder ReservedNames AppendMutable *bbr.ackPoint bytesInFlight chooseA0Point onAckEventEnd OnPacketAcked TimeUntilSend recoveryState endRecoveryAt slowerStartup drainToTarget updateAckRate *protocol.ECN *utils.Logger MeanDeviation SetInitialRTT meanDeviation ReceivedRetry DroppedPacket IsCryptoError RetirePriorTo ParseExtended skippedPacket numAckedECNCE failIfMangled packetHistory ReceivedBytes ResetForRetry SkippedPacket bytesReceived lastBlockedAt receiveWindow Get0RTTOpener Get1RTTOpener highestRcvdPN updateAllowed zeroRTTOpener zeroRTTSealer initialOpener initialSealer has1RTTSealer has1RTTOpener handleMessage NewRetryToken *ipv4.sockOpt getICMPFilter setICMPFilter SetICMPFilter *slog.Handler *[5]slog.Attr *slog.Leveler readDeltaBase *flate.Reader *flate.byFreq *syntax.Error *syntax.Flags leadingRegexp leadingString closeBodyRo LeveledLogger TLSIdentifier PublicKeySize SignatureSize DeriveKeyPair SharedKeySize extractExpand labeledExpand *hpke.kemBase *ast.ListType flushNoDefers terminateCell parseStdTable parseValArray checkKeyValue *gob.wireType *gob.encInstr *gob.gobError *gob.typeInfo *[]*gob.encOp *nl.IfInfomsg *nl.IfAddrmsg *[]sync.Mutex NumExtensions RangeMessages numExtensions GoPackagePath *strs.Builder *filedesc.Out unmarshalFull unmarshalSeed RawDescriptor allExtensions allocMessages allocServices *impl.pointer *func() *bool growBoolSlice unknownOffset GoReflectType OneofWrappers sizecacheType extensionType ExtensionType *impl.mapInfo *coding.Alpha *coding.Level AddCheckBytes *coding.Pixel *common.Pacer isCwndLimited currentMinRTT MarshalHeader *socket.iovec *bpf.JumpTest *bpf.Register *xof.blake2xs *xof.blake2xb EncapsulateTo DecapsulateTo isValidPubKey *ed448.scheme *descfmt.list invNttGeneric mulHatGeneric *internal.Mat *text.encType *text.Encoder *internal.Vec BarrettReduce *mlsbset.EltG *mlsbset.EltP DeriveUniform invNTTGeneric*func() string*cmd.tunLogger*cmd.udpLogger*cmd.tcpLoggerConnectRequest**fs.PathError*cmd.tunConfigfillQUICConfigfillServerAddrfillDisableUDPCompareAndSwap*[]*os.dirInfo*func(*string)*cmd.modeError*[]x509.sum224*[]quic.Stream*sha256.digest*x509.KeyUsageMaxPathLenZeroAuthorityKeyIdEmailAddresses*x509.CertPool*x509.lazyCertCheckSignatureVerifyHostnameScalarBaseMultRevocationTime*x509.validityTBSCertificateSignatureValue*[]fs.DirEntry*fmt.wrapError*fmt.ScanState*func([]uint8)scanBasePrefixtruncateString*fmt.Formatter*fmt.scanError*func() net.IPSetWriteBufferlistenDatagram*net.noWriteTo*net.AddrError*func(uintptr)*func() uint16*net.byRFC6724*net.InterfaceMulticastAddrs*net.nssSource*net.temporary**net.DNSError*net.dnsConfig*func() uint32*[8]net.byNamegetLookupGroupControlContext*net.sysDialerdoDialTCPProto unlockSlow *[1]net.IPAddrStringExpanded*netip.uint128*os.unixDirent*[]fs.FileInfo*os.noReadFrom*runtime.FramefuncnameOffset*[]abi.TypeOff*runtime._func*runtime.stack*runtime.gobuf*runtime.mspan*runtime.mutexlockRankStructmanualFreeListtypePointersOf*func() uint64*runtime.gList*runtime.sudog*runtime.hchan*runtime.timer*runtime.waitq*runtime.wbBufrunSafePointFntraceBufHeaderbecomeSpinningisWaitingForGCasyncSafePointcreateOverflowtinyAllocCountlargeFreeCountsmallFreeCountheapStatsDeltatotalAllocatedgcCyclesForcedScavengeBgTime*func(float64)*[][]*abi.Type*runtime.ErrorgoodSuffixSkip*syscall.Errno*syscall.Iovec*time.Duration*time.Location*cobra.CommandExecuteContextHasSubCommandsInheritedFlagsMarkFlagCustomNameAndAliasesSetHelpCommandSuggestionsForgetCompletionspersistentFlag*[]*pflag.FlaginiLoadOptionsenvKeyReplacertypeByDefValueonConfigChangeBindFlagValuesConfigFileUsedGetSizeInBytesGetStringSliceMergeConfigMapOnConfigChangeUnmarshalExactfindConfigFile*zap.durations*[1]zap.OptioninitHTTPClient*chan net.ConnListenAndServeCheckSupportedapplyToUDPConn*socks5.ServerUpdateIntervalshouldDownloadURL json:"url"GetCertificate*client.Client*client.ConfigMaxIdleTimeoutReceiveMessageobfsPacketConnreadBufferSize*zapcore.Entry*zapcore.Level*zapcore.Field*func(float32)AppendDurationopenNamespacestryAddRuneSelf*zapcore.Clock*[]color.Color*tls.quicState*tls.QUICEventverifiedChains*[]tls.CurveIDVerifiedChains*tls.ticketKeygetCertificatesetErrorLockedhandshakeMutexcloseNotifyErrclientFinishedserverFinishedclientProtocol*tls.echConfig*tls.echCipherpickTLSVersion*tls.certCache missLocked *[]*sync.entry*func(int) int*[]*json.fieldpushParseStatearrayInterfacevalueInterfacedebugFramerBufSetReuseFramesWriteRSTStreamunregisterConn*http.Response*http.SameSitebodyIsWritablecompareMethodsoutgoingLengthbackgroundRead*http.responsedidCloseNotifydeclareTrailer*[8]*http.connMaxHeaderBytescloseIdleConnsmaxHeaderBytesUpgradeRequestheaderWriteBufForeachSettingcurOpenStreamsprocessHeadersprocessSettingupgradeRequestBreakWithErrorCloseWithErrorcloseWithErroronWriteTimeoutsentContentLen*http.sniffSig*http.exactSigResponseToHEAD*http.ServeMux*http.muxEntry*http.wantConnconnsPerHostMuDialTLSContextReadBufferSizeremoveIdleConntryPutIdleConnOnlyCachedConndialClientConnrespHeaderRecvStreamsPendingencodeTrailersforceCloseConnforgetStreamIDhttp2Transport*http.Hijacker*http.canceler**http.RequestmodifyResponseModifyResponseRootCommonNamemaintainAssetsObtainCertSyncRenewCertAsyncAltTLSALPNPortNewAccountFunclastNextUpdateOverrideDomainTTL json:"ttl"toLibDNSRecordlistAllRecords*[]libdns.ZoneCSR json:"csr"LastActiveTimeLogOnlineState*server.ConfigUDPIdleTimeout*server.Server ResponseWriterdirectOutboundskipCNAMEChain*sniff.SniffergetDumpStreamslastActiveTime*crypto.SignertryLoadOrStore*sync.readOnly*asn1.RawValuesetFromScanner*dsa.PublicKeycrypto/ed25519doubleJacobian*rsa.PublicKey*[]crypto.Hash*godebug.valuenonDefaultOnceinContinuationAddASN1BooleanAddASN1UTCTime*aes.aesCipher*cipher.Stream*des.desCipher*io.ReadCloser*io.ReaderFrom*io.ReadWriter*io.ReadSeeker*io.ByteReader*io.ByteWriter*io.RuneReaderreadCloseError*io.PipeReader*io.PipeWriter*reflect.Value*reflect.hitermustBeExported*reflect.rtypeHashMightPanic*reflect.visit*sha512.digestAllAdditionalsAllAuthoritiesSkipAdditionalSkipAllAnswersresourceHeaderresHeaderValid*atomic.noCopy*atomic.Uint32*atomic.Uint64increfAndClose*poll.pollDescSetsockoptByte*go.shape.boolForgetUnshared*abi.ArrayType*[]abi.Imethod*abi.SliceType*sys.NotInHeap*godebugs.Info*pflag.ipValue*pflag.FlagSetBytesBase64VarDurationSlicePGetBytesBase64GetStringArrayGetStringToIntInt32SliceVarPInt64SliceVarPMarkDeprecatedStringArrayVarStringSliceVarStringToInt64PStringToIntVarStringToString*[]*parse.Tree endControl Q newCommand Q newComment Q startParse Q unexpected Q*flag.intValue*flag.boolFlag*[8]*flag.Flag*buffer.BufferwriteMultilineEncodeToString*unix.Sockaddr*unix._SocklenShared_umem_fd*unix.TIPCAddrDestinationSAP*logger.Logger*[]*buf.Buffer*tun.NativeTunExcludedRangesIncludePackageExcludePackageFileDescriptor*[]tun.flowKeylookupOrInsertupdateAgeOnGetLoadWithExpireprocessIPv4TCPprocessIPv4UDPprocessIPv6TCPprocessIPv6UDP*tun.ifreqData*buf.Allocator*[11]sync.PoolReadPacketFromWaitReadPacket*acl.ipMatcher*acl.GeoLoader*v2geo.GeoSiteEnumDescriptorGetCountryCode*[]*v2geo.CIDREntrySlotsUsedgetEntryWraper*utils.QStreamOpenStreamSync*quic.sendConnpopStreamFrameSequenceNumberhighestRetiredissueNewConnIDPopCryptoFrameHasInitialData*quic.unpackerIsAckElicitinglongHdrPacketsshortHdrPacketStartHandshakeorigDestConnIDretrySrcConnIDtokenGeneratorpacingDeadlineconnStateMutexNextConnectionearlyConnReadyhandleAckFrameonMTUIncreasedtriggerSending*quic.quicConncancelReadImplreadPosInFrameflowControllercancelWriteErrdataForWritingcompletedMutexhighestInQueuereceivedPacketpacketHandlers*quic.ListenernonQUICPacketsdecodeTrailersheaderCompletetrailerWritten*http3.ErrCodeStreamHijackerSetQUICHeadersremoveListener*rand.Source64container/listLabeledExtractexporterSecretmime/multipartCreateFormFilenlDashBoundaryReadMIMEHeaderGot100ContinueGot1xxResponse*[]*hpack.node*hpack.EncoderallowedMaxSize*hpack.DecoderSetEmitEnableddomainMatchers httpClient+yRawResponderID*ocsp.Response*dns.RR_Header*func() dns.RR*dns.APLPrefixReadPrivateKeypublicKeyECDSAData dns:"any"*func(...bool)ValidityPeriodisCompressible*dns.SVCBLocal*[]dns.SVCBKey*dns.EDNS0_ESU*dns.EDNS0_EDE*dns.EDNS0_N3U*dns.EDNS0_DHU*dns.EDNS0_DAU*dns.EDNS0_LLQ*dns.wireSliceTsigTimersOnlytsigRequestMAC*[]dns.HandlerSingleInflight*libdns.Record*regexp.RegexpmaxBitStateLenprefixComplete*regexp.thread*regexp.inputscanCheckPrefixReplaceAllFunc*oauth2.ConfigauthStyleCache*govultr.LinksRAM json:"ram"Tag json:"tag"URN json:"urn"SSL json:"ssl"CPU json:"cpu"Max json:"max"StartMigrationKVM json:"kvm"*[]govultr.ISOCreateNodePoolDeleteNodePoolUpdateNodePoolRegenerateKeys*[]govultr.VPCISO json:"iso"VPC json:"vpc" systemTimecreatedByStackCombinedOutput*doh.PTRRecord*doh.SOARecord*doh.SRVRecord*doh.TXTRecord*tls.ECHConfigParsePublicKeySetCipherSuite*tls.TicketKey*[]sign.SchemegeneratorTable*field.ElementcarryPropagate*bigmod.choice*bisect.Writer*[]bisect.cond*[3]parse.item*parse.DotNode*parse.endNode*parse.NilNode*template.HTMLBoundaryBeforeIsNormalString*norm.formInfo*norm.iterFunc*ini.DebugFuncAddNestedValueMustTimeFormatStrictFloat64saddNestedValuetransformValueparseFieldNamesectionIndexesSectionStringsSectionsByNameWriteSeparatorMustGetFloat64handleKeyValueunmarshalArrayunmarshalFloatskipUntilTable*yaml.IsZeroersequence_styletag_directivesstart_implicitproblem_offsetraw_buffer_poslast_anchor_id*[8]*yaml.NodegeneralMapType*[8]gob.typeId*netlink.EncapRxLengthErrorsRxMissedErrorsTxWindowErrorsClockFrequency*netlink.IPoIB*netlink.Xfrmi*netlink.IptunUdpZeroCsum6TxUdpZeroCsum6RxXmitHashPolicyAdActorSysPrio*netlink.VxlanUDP6ZeroCSumTxUDP6ZeroCSumRx*netlink.Dummy*netlink.Route*netlink.Scope*udpnat.packet childStdinc^go4.org/netipxAppendPrefixesentirelyBeforeContainsPrefixOverlapsPrefixUnmarshalStateDiscardUnknownRecursionLimitmarshalMessagesizeMessageSet FileDescriptorReservedRangesTypeDescriptor*bbr.BandwidthtotalBytesSenttotalBytesLostTotalBytesLostTotalBytesSentmax_ack_heightlastSentPacket*bbr.bbrSenderroundTripCountnumStartupRttslastCycleStartexitProbeRttAtrecoveryWindowtoGQUICVersionSetMaxAckDelayhasMeasurement*logging.FrameBufferedPacketUpdatedMetricsDataLenPresent*wire.AckFrame*wire.AckRangeencodeAckRangeValidForUpdateInitialMaxDatanumSentTestingnumLostTestingReceivedPacketshouldQueueACKinitialPacketsappDataPacketsnumOutstandingIsNewlyBlockedSendWindowSizesendWindowSizeepochStartTimetokenProtector*ipv4.ICMPType*ipv4.groupReqsetSourceGroupgetMulticastIfsetMulticastIf*ipv4.dgramOptpayloadHandlernewHandleState*slog.groupptr*slog.timeTime*qpack.Decoder*qpack.Encodercompress/flate*[]flate.hcode*[]crc32.Table*syntax.ranges*syntax.InstOp*[]syntax.Inst*syntax.Regexp*syntax.parserparseClassCharparsePerlFlags*query.EncoderRequestLogHook wantsCloseRoStandardClient*pki.TLSSchemePrivateKeySize*kem.PublicKeyCiphertextSizelabeledExtract*hpke.shortKEM*ast.ObjectKeytext/tabwriter*unstable.Kind*unstable.Node*unstable.rootNextExpressionparseSimpleKeyscanIntOrFloat*danger.TypeID*tracker.entry*gob.arrayType*gob.sliceType*gob.fieldType*gob.encBufferTextMarshalerT*gob.encHelper*gob.encEnginesendActualType*[]gob.gobType*[8]*gob.encOpSetSendTimeoutFindFileByPathFindEnumByName*[]token.TokenAppendFullName*filedesc.File*filedesc.Enum*filedesc.Base*impl.exporter*func() **bool*func() *int32*func() *int64growInt32SlicegrowInt64SliceunknownPtrKindneedsInitCheckfieldsByNumbermakeFieldTypesmakeStructInfosizeExtensionsinitFromLegacy*impl.EnumInfo*coding.StringnumConnectionsrttSampleCount*socket.ipConn*socket.msghdrboundRecvmmsgFboundSendmmsgF*socket.Option*bpf.Extension*xof.shakeBodyrecentPositionscanIdentifiermarshalUnknownexceedsGeneric*internal.VecLUnpackLeGamma1*[]common.Poly*internal.VecKcomputeT0andT1*mlsbset.Group*mlsbset.Power*func(net.Addr)*cmd.httpLogger*cmd.httpConfigfillConnFactoryfillEventLoggerfillMasqHandlerfillRequestHook*[0]*os.dirInfo*func() *string*chan os.Signal*chan struct {}*[8]x509.sum224*[8]quic.Stream*[]func() error*map[string]int*[]netip.PrefixUnmarshalBinaryExtraExtensionsgetSANExtension*func() []uint8hasSANExtensioncrypto/ellipticnormalizeScalarpointFromAffine*x509.authKeyId*[128][4]uint64internal/bisect*func() []error*fmt.wrapErrors*func(int) bool*fmt.GoStringerIsGlobalUnicastmatchAddrFamilySetReadDeadline*<-chan []uint8*chan<- []uint8*net.noReadFrom*net.ParseError*net.PacketConnwriteToAddrPortSetMultipathTCPKeepAliveConfig*func(int, int)*net.dialResult*map[int]stringresolveAddrListtestHookDialTCP rUnlockSlow getLineFromDatabitsClearedFrom*netip.AddrPort*func() uintptrsetReadDeadline*os.processModepidfdSendSignal*signal.handler*unsafe.Pointer*[]interface {}*runtime._defer*[8]abi.TypeOff*runtime.pinner*runtime._panic*runtime.sigset*runtime.mcache*runtime.gcBitsmarkBitsForBaseprepareForSweep*runtime.timersminWhenModifiedsetStatusTracedstatusWasTraced*runtime.gcWork*runtime.lfnodeinPtrScalarBitslargeAllocCountsmallAllocCountGCDedicatedTimedeferBitsOffsetsleepController*[8][]*abi.Type*runtime.FramesExportedMethods*strings.Reader*syscall.RtAttr*syscall.Signal*syscall._Gid_t*syscall.Rlimit*syscall.IPMreq*syscall.Linger*syscall.Rusage*syscall.Stat_t*func() float64*time.zoneTrans*chan time.TimelookupFirstZone*[]*cobra.GroupversionTemplatecommandCalledAsExecuteContextCMarkFlagDirnamePersistentFlags*func([]string)SetHelpTemplateVersionTemplateargsMinusFirstXfindSuggestionsinitCompleteCmd*[8]*pflag.FlagremoteProvidersencoderRegistrydecoderRegistrySafeWriteConfiggetRemoteConfigunmarshalReadergo.uber.org/zap*zap.optionFuncMarshalLogArray*zap.complex64s*zap.stacktraceidleCleanupLoop*proxymux.OpErracceptErrorFunc*go.shape.int64*tun.singLogger*tun.tunHandlerEscapedFragment*[]*v2geo.GeoIPGeoSiteFilenameDownloadErrFuncInitializeCacheKeepAlivePeriodBandwidthConfig*client.tcpConnPseudoLocalAddr*client.udpConnwriteBufferSizeAppendComplex64AppendReflected*[]zapcore.CoreencodeReflectedresetReflectBuftryAddRuneError*zapcore.ioCore*[8]color.ColorpropagateCancel*tls.activeCertextMasterSecretwaitingForDraintransportParamsSupportedCurvesSupportedPointsSupportedProtosResumptionStatecloseNotifySentupdateRequested*[]tls.keySharesupportedCurvessupportedPointsticketSupported*tls.echContextencapsulatedKeyinnerTranscriptConnectionStateclientHandshakehandleKeyUpdatemakeClientHelloreadClientHelloreadRecordOrCCSretryReadRecordsendAlertLockedserverHandshakeechRetryConfigsRetryConfigList*tls.cthWrapperConstantTimeSumpreMasterSecret*tls.AlertError*tls.cacheEntry dirtyLocked doFullHandshakepickCipherSuite*[8]*sync.entry*[4]tls.CurveID*[5]tls.CurveID*json.MarshalerAvailableBuffer*json.jsonError*[8]*json.field*[]reflect.TypeaddErrorContextobjectInterfaceReadMetaHeadersWriteDataPaddedcheckFrameOrder*http.keyValuessortedKeyValues*[]*http.Cookie*[]http.segmentMultipartReaderexpectsContinuemultipartReader*http.ConnStatehandleReadErrorwriteContinueMucloseAfterReplyrequestTooLargeunackedSettingsneedsFrameFlushcanonicalHeaderonSettingsTimeronShutdownTimerprocessPriorityprocessSettingsscheduleHandlerstartFrameWritewriteFrameAsync*http.http2pipecloseDoneLockedcloseNotifierMucloseNotifierCh*http.maskedSig ReadWriteCloser*http.socksAddrmatchingMethodsmatchOrRedirect*http.TransportwaitForContinuedialsInProgressTLSClientConfigMaxConnsPerHostIdleConnTimeoutWriteBufferSizedecConnsPerHostReadIdleTimeoutidleConnTimeoutget1xxTraceFuncwantSettingsAckstreamsReservedpendingRequestsStreamsReservedaddStreamLockedidleStateLockedaddConnIfNeeded*http.httpRange*http.CookieJar**http.Response*func(*url.URL)getErrorHandlercopyFromBackendDisableStaplingObtainCertAsyncreusePrivateKeyExternalAccountPreferredChains*[]acmez.Solver*[2]tls.CurveID*gandi.Provider*vultr.ProviderremoveDNSRecordupdateDNSRecord*acme.Directory*acme.ChallengeIdentifierValue*server.UDPConn readFromUDPCaddrExToRequest*[]*doh.ARecordfromStreamStats*sync.poolLocal*sync.poolChainunexpungeLocked*sync.WaitGroup*asn1.BitString*[]asn1.encoder*big.byteReaderexpNNMontgomery*func(int) uint*dsa.Parameters*ecdh.PublicKey*elliptic.Curve*rsa.PSSOptions*rsa.PrivateKey*[]rsa.CRTValue*[8]crypto.Hash*pkix.ExtensionContextSpecificNewCBCEncrypterNewCBCDecrypter*cipher.ctrAble*cipher.gcmAblegenerateSubkeys*io.multiWriter*io.multiReader*io.WriteCloser*io.ByteScanner*io.RuneScannerwriteCloseError*fs.ReadDirFile*reflect.MethodFieldByIndexErrFieldByNameFuncOverflowComplexstringNonStringexportedMethods*reflect.abiSeq*sort.Interface*nettrace.TraceAuthorityHeaderUnknownResourceresHeaderOffsetresHeaderLength*atomic.align64*atomic.Uintptr*abi.StructType*pflag.intValue*pflag.boolFlagBytesBase64VarPFloat32SliceVarFloat64SliceVarGetFloat32SliceGetFloat64SliceSetInterspersedShorthandLookupStringArrayVarPStringSliceVarPStringToIntVarPStringToStringPaddedGoFlagSets*[8]*parse.Tree elseControl Q expectOneOf Q hasFunction Q newContinue Q newPipeline Q newTemplate Q newVariable Q withControl QExecuteTemplate*[]**log.LoggerstdoutThresholdGetLogThresholdSetLogThreshold*csv.ParseError*fsnotify.EventLstatIfPossibleRegisterDecoderRegisterEncoder*[]*ini.Section*flag.textValue*flag.uintValue*flag.boolValue*flag.funcValue*func() float32writeSinglelineencoding/base64*base64.encoderencoding/binary*unix.SockFprog*unix.IfInfomsg*unix.IfAddrmsg*socks5.RequestWriteVectorised*tun.tcpGROItem*[8]tun.flowKey*tun.TCPSessionStoreWithExpireNewPacketDirectinterfaceFinderprocessIPv4ICMPprocessIPv6ICMPReadAtLeastFromNewPacketBuffer*acl.allMatcherGetResourceHashGetInverseMatch*[]bbr.ackPointSetWindowLengthtotalBytesAckedAcceptUniStreamReceiveDatagramEnableDatagrams*quic.newConnIDaddConnectionIDConnectionIDLenhandshakeStreamGetAppDataFrameGetInitialFramegetControlFrameAddActiveStreamencryptionLevelPacketNumberLenEncryptionLevelShouldSendProbeconnIDGeneratorreceivedPacketssentFirstPacketmaybeResetTimeronHasStreamDatascheduleSendingsendProbePacketPopPacketNumber*quic.batchConn*quic.basicConncancelWriteImplfinishedWriting*quic.sendQueueGetByResetToken*quic.mtuFinder*[]quic.streamIunblockOpenSyncGetOrOpenStreamsendRetryPacket*quic.TransportSetReceiveError*http3.SettingsenableDatagramssendRequestBodyExtendedConnect*rand.rngSource*frag.Defragger*blake2b.digest*sha3.ShakeHash*multipart.partCreateFormField*multipart.Part*multipart.Form*multipart.FileisFinalBoundarypopulateHeadersWait100ContinuetableSizeUpdate*idna.runeErrorgetAuthzObjects httpPostJWS+y pollTimeout+y postAccount+ysolveChallengesTBSResponseData*[]ocsp.request*func() dns.lex*dns.ParseErrorAAAA dns:"aaaa"setPublicKeyRSAPublicKeyLength*dns.NSEC3PARAM*dns.OPENPGPKEY*[]dns.Question*func([]dns.RR)Rdata dns:"hex"*dns.EDNS0_NSID*[8]dns.Handler*[8]dns.SVCBKeyExchangeContextMatchEmptyWidth*regexp.machine*[]regexp.entryFindAllSubmatchFindReaderIndexFindStringIndex*[]errors.FrameACL json:"acls"*govultr.Client*govultr.Backup*govultr.VNCUrl*[]govultr.IPv4*[]govultr.IPv6DetachMigration*govultr.DomainListReverseIPv6*govultr.ISOReq*[]govultr.NodeGetFirewallRule*govultr.S3Keys*[]govultr.Plan*govultr.Region*govultr.SSHKey*[]govultr.User*govultr.VPCReq*[]govultr.VPC2BareMetalServer*govultr.ipBase*govultr.lbBase*govultr.osBase*exec.ExitError*exec.ctxResultawaitGoroutines*doh.AAAARecordECHRetryConfigsSetMasterSecret*[]tls.KeyShareTicketSupported*[8]sign.SchemeSrcConnectionIDBytesCompressedbytesCompressed*bigmod.ModulusExpShortVarTime*bisect.Matcher*parse.NodeType*parse.ListNode*parse.itemType*parse.PipeNode*parse.BoolNode*parse.elseNodesimplifyComplex*parse.TextNode*parse.WithNodeclearActionLinecontinueControlparseDefinitiontemplateControlcombinesForwardQuickSpanStringdecomposeHangul*[]reflect.Kind*func(ast.Node)gopkg.in/ini.v1*ini.dataSource*ini.sourceFile*ini.sourceDataInsensitiveKeysisAutoIncrementRangeTimeFormat*ini.NameMapperMustGetDuration*toml.LocalDate*toml.LocalTimeEnterArrayTablehandleKeyValueshandleTablePartunmarshalString*yaml.TypeError*yaml.MarshalerindicatedString*yaml.fieldInfo*yaml.yamlErrorquoted_implicittoken_availablemapping_contextcallUnmarshaler*netlink.bpfObjSetXmitHeadroomTxAbortedErrorsTxCarrierErrors*netlink.VfInfoTimeSegment1MinTimeSegment1MaxTimeSegment2MinTimeSegment2Max*netlink.Tuntap*netlink.Bridge*netlink.Sittun*netlink.Ip6tnl*netlink.Gretun*netlink.Gretap*netlink.Geneve*netlink.IPVtap*netlink.IPVlanPrimaryReselectAllSlavesActivePacketsPerSlave*netlink.DeviceSuppressIfgroupreadWaitOptions*udpnat.Handler childStderrc^ childStdoutc^*netipx.IPRangeoverlapsStartOfunmarshalScalarmarshalSingularsizeMessageSlowLeadingCommentsSourceLocationsExtensionRangesRequiredNumbersContainingOneofLessRecentPointMostRecentPointTotalBytesAckedlastAckedPacketrecentAckPointsHasPacingBudgetmaybeAppLimitedsetHighCwndGainminRttTimestampmaxDatagramSize*brutal.pktInfocanPrintAckRate*utils.LogLevel*utils.RTTStatsUpdatedPTOCountECNStateUpdated*logging.Tracer*wire.PingFrameparseLongHeaderMaxUniStreamNumisTestingPacketGetAlarmTimeoutAppendAckRangeslargestObservedgenerateNewSkiplostPacketsInfocongestionMutexnumProbesToSendpacketsInFlightGetWindowUpdategetWindowUpdatehasWindowUpdatehighestReceived ConnectionStateheaderDecrypterheaderEncrypterSetLargestAckedhandshakeOpenerhandshakeSealerheaderProtector*rand.PCGSourcesetAttachFilterSetMulticastTTL*slog.LogValuer*slog.stringptr*flate.Resetterencoding/base32*syntax.EmptyOpparseNamedClassparseRightParenswapVerticalBarlookupAuthStyle*internal.Token*query.zeroableResponseLogHookresponseHandler isH2UpgradeRo*sign.PublicKeySupportsContext*kem.PrivateKeyGenerateKeyPair*kem.AuthSchemeAuthDecapsulateAuthEncapsulate*hybrid.cScheme*hybrid.xScheme*hpke.dhKemBase*hpke.hybridKEM*[]*ast.Comment*ast.ObjectList*ast.ObjectItem*ast.ObjectType*tabwriter.cell*unstable.RangeparseArrayTableparseExpressionparseWhitespaceCheckExpressioncheckArrayTablesetExplicitFlag*gob.CommonType*gob.structType*[]gob.encInstrencodeInterfacenewEncoderState*gob.GobDecoder*gob.GobEncoder*[8]gob.gobType*protowire.TypeRangeExtensionsRegisterMessage*[8]token.Token*order.mapEntry*filedesc.NamesIsFieldPresenceIsUTF8ValidatedIsJSONCompliantEditionFeatures*filedesc.Field*filedesc.Oneof*filedesc.EnumsunmarshalCountsallocExtensionsresolveMessagesresolveServicesFindEnumByIndex*impl.fieldInfoappendLazyBytes*[]impl.pointer*func() *[]bool*func() **int32*func() **int64*func() *uint32*func() *uint64growUint32SlicegrowUint64Slice*impl.oneofInfosizecacheOffsetextensionOffsetgetUnknownBytessizePointerSlow*impl.ConverterLoadMessageInfo*impl.messageV1*impl.unwrapperXXX_MessageName*coding.Version*[]coding.PixelackedBytesCountendPacketNumberhybridSlowStartnumAckedPackets*socket.Message*socket.mmsghdr*[]socket.iovec*socket.tcpConn*socket.udpConn*func() xof.XOF*ed448.SchemeID prepareNext6 rsc.io/qr/gf256*ed25519.scheme*blake2s.digestpackLe16Generic*[]internal.Vec*mlsbset.Params*cmd.configError*func(time.Time)Code json:"code"Type json:"type"*[8]func() error*[]zapcore.Level*go.shape.string*[]zapcore.Field*[1]netip.Prefix*[1]interface {}*[2]interface {}*[3]interface {}*[4]interface {}*[8]interface {}unmarshalOIDTextExcludedIPRanges*[]x509.lazyCert*[]asn1.RawValue*x509.privateKey*[]*bisect.dedup*map[string]boolValue asn1:"set"*map[uint64]boolinternal/godebug*func() net.Addr*func(int) errorSetWriteDeadlinereadFromAddrPortwriteMsgAddrPort*net.TCPListener*net.mptcpStatusSetUnlinkOnClose*net.rawListener*func() *poll.FD*[]net.nssSourcestandardCriteria*func(bool) bool*chan net.resultinternetAddrList*go.shape.*uint8compareAndDeleteCompareAndDelete*func() [4]uint8setWriteDeadline*os.SyscallError*os.ProcessState*signal.stopping*runtime.functab*runtime.offAddr*runtime.specialfreeIndexForScanisUserArenaChunkdivideByElemSizemarkBitsForIndexrefillAllocCache*[]atomic.Uint32*runtime.workbufgcMarkWorkerModescannedStackSize*runtime.libcallactiveStackChans*[]*runtime.bmap*runtime.funcinlcontrollerFailed*[]runtime.Frame*func() abi.Kind*go.shape.uint32*strings.Builder*syscall.Cmsghdr*syscall.Timeval*syscall.IPMreqn*syscall.RawConn*time.ParseErrorHiddenDefaultCmdPersistentPreRunTraverseChildrenGenZshCompletionMarkFlagFilenameMarkFlagRequired*func(...string)*func(io.Writer)SetFlagErrorFunc*func(io.Reader)SetUsageTemplategenZshCompletion*[]reflect.Value*[6]interface {}*viper.FlagValue*func() []stringReadRemoteConfig*viper.jwwLogger*zap.invalidPairMarshalLogObject*zap.AtomicLevel*zap.stringArray*zap.complex128s*[]time.Duration*http.cachedConn*[]*http.Request*tun.EventLogger*url.EscapeErrorResolveReference*utils.GeoLoader*[8]*v2geo.GeoIPdownloadAndCheckPseudoRemoteAddr*obfs.Obfuscator*func(complex64)AppendByteStringAppendComplex128*zapcore.sampler*zapcore.counter*zapcore.EncoderAppendTimeLayout*zapcore.nopCore*context.Context*context.todoCtx*context.stopCtx*[]tls.QUICEventpeerCertificates*tls.CertificateSignatureSchemesPeerCertificates*[]tls.ticketKeyVerifyConnectionSessionTicketKeyCurvePreferences*func() []uint16curvePreferencesexplicitNonceLenchangeCipherSpecsetTrafficSecretresumptionSecret*tls.pskIdentity*[]tls.echCiphersupportedVersionselectedIdentityHandshakeContext*func() net.ConnhandshakeContextquicStoreSession*tls.finishedMsgcertificateTypes*[]*list.Element loadReadOnly *tls.CipherSuite*tls.cipherSuite*[]*interface {}*map[uint16]bool*[1]tls.keyShare*[2]tls.keyShare*json.RawMessage*[8]reflect.TypeliteralInterface*json.mapEncoder*json.ptrEncoder*http.http2Frame*http.http2Flagshttp2FrameHeaderlastHeaderStreamdebugReadLoggerfWritePushPromiseWriteSettingsAckMaxReadFrameSizeTransferEncodingisProtocolSwitch*[]*net.Listener*http.connReaderabortPendingReadwants10KeepAlivecanWriteContinueEnableFullDuplexsetupHTTP2_ServeSawClientPrefacemarkNewGoroutinemaxReadFrameSizewantWriteFrameChsawClientPrefacesawFirstSettingsclientMaxStreamscurClientStreamscurPushedStreamsmaxPushPromiseIDneedToSendGoAwaywriteHeaderBlocksendWindowUpdategotTrailerHeader*http.bodyLockedregisterOnHitEOF*http.byteReader*http.readResultprobeRequestBody*[]*http.pattern*[]http.muxEntrymutateHeaderFuncconnsPerHostWaitRegisterProtocolqueueForIdleConnWriteByteTimeoutmaxFrameReadSizeawaitFlowControlwriteRequestBodycloseForLostPingwriteStreamResetlastChunkOrAlloc*http.FileSystem*http.writerOnly*http.gzipReader*http.fakeLocker*http.closeIdler*http.contextKey*[5]interface {}*certmagic.CacheGetConfigForCertcacheCertificatequeueRenewalTaskdeleteSiteAssetsgetChallengeInfoloadCertResourcesaveCertResourceaskUserAgreementloadAccountByKey*[]libdns.Record*[8]acmez.SolverPropagationDelayName json:"name"Plan json:"plan"Page json:"page"Fqdn json:"fqdn"Data json:"data"fromLibDNSRecord*acme.Subproblem*acme.IdentifierGetAuthorizationNewAuthorizationsetHookedReqAddr*server.OutboundhandleTCPRequest writeBuffersCAddr json:"addr"Auth json:"auth"dialAndNegotiatedualStackDialTCPinitEvictBuffers*sniff.teeReader*go.shape.uint64*utils.PortRange*utils.PortUniontryGrowByReslice*pem.lineBreaker*sync.dequeueNiltryExpungeLocked*sync.notifyList*asn1.setEncoder*asn1.oidEncoder*asn1.Enumerated*asn1.RawContent*[2]asn1.encoderdivRecursiveSteptrailingZeroBitsTrailingZeroBits*func(int) uint8*ecdh.PrivateKey*ecdsa.PublicKey*ed25519.Options*rsa.OAEPOptionscrypto/x509/pkix*godebug.setting*godebug.SettingAddASN1BitStringcallContinuation*func() asn1.Tag*io.StringWriter*reflect.ChanDir*reflect.MapItermustBeAssignable*reflect.abiStep*reflect.abiDesc*reflect.mapType*reflect.ptrType*[]reflect.visit*unicode.Range16*unicode.Range32internal/fmtsort*dnsmessage.TypeRecursionDesiredCheckingDisabledAdditionalHeaderSkipAllQuestions*poll.splicePipesplicePipeFields*[]syscall.IovecSetsockoptIPMreqSetsockoptLinger*unique.cloneSeqinternal/testlog*abi.StructField*func([32]uint8)*func([4]uint64)*pflag.uintValue*pflag.int8Value*pflag.boolValue*[]*flag.FlagSetDurationSliceVarFloat32SliceVarPFloat64SliceVarPGetDurationSliceGetNormalizeFuncGetStringToInt64SetNormalizeFuncStringToInt64Var*template.common blockControl Q breakControl Q nextNonSpace Q parseControl Q peekNonSpace Q rangeControl Q textOrAction QDefinedTemplates*template.option*[7]**log.LoggercreateLogWritersWeaklyTypedInputdecodeMapFromMap*flag.int64ValuecollectFragments*base64.Encoding*unix.SockaddrVM*unix.SockaddrL2Service_name_len*unix.SockFilter*socks5.Datagram*tproxy.ListenerDefaultInterfaceRegisterCallbackIncludeInterfaceExcludeInterfaceInterfaceMonitor*tun.tcpGROTable*[]netlink.Route*[]*netlink.RuleloopCheckTimeoutNewContextPacket*tun.StackRunnerFastOpenNoCookie*map[uint8]uint8*acl.hostMatcher*acl.cidrMatcher*[]*v2geo.Domain*v2geo.GeoIPList*quic.packetInfo*quic.connection*quic.TokenStore*quic.Connection*quic.SendStreamhandshakeTimeoutmaxRetryTokenAgecloseForShutdownupdateSendWindowactiveSrcConnIDsHasHandshakeDataUnpackLongHeaderGetSessionTicket*quic.closeErrorsendingScheduled*[]logging.FramehandleCloseErrorhandlePacketImplGetInitialSealerPeekPacketNumberunpackLongHeaderdequeueNextFrameisNewlyCompletedcurrentFrameDonecancelledLocally*quic.sendStreamcheckIfCompleted*quic.queueEntryRemoveResetTokenwroteFirstPacketlastProbeWasLostnextPacketNumber*quic.streamsMap*[8]quic.streamIUpdateSendWindownextStreamToOpenqueueMaxStreamID*quic.connRunner*[]wire.AckRange*quic.baseServerhandle0RTTPacketacceptEarlyConnsreceivedSettingsReceivedSettingsreceiveDatagramshasContentLengthsmallResponseBufsniffContentType*http3.FrameTypeconnHandlingDone*http3.dataFrame*http3.Transport*func(int) []intExtractAndExpandEncapsulationKeydashBoundaryDash*textproto.ErrorTLSHandshakeDoneWroteHeaderField*[256]hpack.node*idna.labelErrorcurrentChallenge pollInterval+yChallengeSolvers*ocsp.ParseError*ocsp.tbsRequestRevocationReasonRawResponderNameResponderKeyHash*[1]ocsp.request*[]dns.APLPrefixDigest dns:"hex"*func() *dns.CDSPrivateKeyStringpublicKeyED25519ZSData dns:"txt"Option dns:"opt"SetExtendedRcode*func() *dns.Msg*func() *dns.OPT*dns.SVCBDoHPath*dns.EDNS0_LOCAL*[]func() dns.RRExchangeWithConn*[1]dns.Question*regexp.lazyFlag*func(int32) int*regexp.bitStateReplaceAllStringErrorDescription*oauth2.Endpoint*govultr.AccountNext json:"next"Prev json:"prev"Size json:"size"Tags json:"tags"Disk json:"disk"Arch json:"arch"*govultr.VPCInfo*govultr.InvoiceDate json:"date"*govultr.HistoryListInvoiceItemsCost json:"cost"Used json:"used"Root json:"root"DeleteRepositoryListRepositoriesUpdateRepositoryHost json:"host"Port json:"port"User json:"user"Mode json:"mode"Time json:"time"StartMaintenance*govultr.ClusterListAppVariables*govultr.NetworkCity json:"city"*govultr.UserReq*govultr.VPC2ReqMeta json:"meta"IPv4 json:"ipv4"*govultr.isoBaseISOs json:"isos"**govultr.lbBase*govultr.lbsBase*govultr.soaBase*govultr.vncBaseVPCs json:"vpcs"*govultr.vpcBasewriterDescriptor*func(*exec.Cmd)*doh.CNAMERecord*[]*doh.MXRecord*[]*doh.NSRecord*[]tls.ECHConfigSetSessionTicket*tls.PskIdentityDestConnectionIDheaderProtection*parse.BreakNode*parse.ChainNode*parse.FieldNode*parse.RangeNode*norm.PropertiescombinesBackwardhasDecompositionPropertiesStringinsertDecomposed*norm.streamSafe*norm.lookupFunc*ini.LoadOptionsAllowBooleanKeysReaderBufferSizeValidTimesFormatValueWithShadowsparseTimesFormat*ini.ValueMapperSectionWithIndex*properties.itemDisableExpansion*func() toml.Key*[]danger.TypeIDhandleArrayTableunmarshalIntegergopkg.in/yaml.v3sequence_contextkey_line_comment*yaml.structInfo*netlink.LinkXdp*netlink.BareUDPBitRatePreScalerSyncJumpWidthMax*netlink.Macvlan*netlink.MacvtapLinkFailureCountPermHardwareAddrPeerHardwareAddr*format.Stringer*netipx.multiErrRemoveFreePrefixunmarshalMessageCheckInitializedappendFeatureSetTrailingCommentsDefaultEnumValueIsValidInterface*[2]bbr.ackPointOnPacketNeuteredenterStartupModebytesLostInRoundcongestionWindowrateBasedStartupSetLogTimeFormatClosedConnectionLossTimerExpiredHasMissingRangestoExtendedHeaderackDelayExponentAckDelayExponentMaxBidiStreamNumPreferredAddressHandleNewlyAckedhandshakePacketslowest1RTTPacketQueueProbePacketFirstOutstandingackedPacketsInfoepochStartOffset*handshake.EventGetInitialOpener*handshake.token*handshake.Token*ipv4.ICMPFilter*ipv4.icmpFilter*[]ipv4.ICMPType*[]*ipv4.sockOpt*ipv4.genericOpt*ipv4.PacketConnFile json:"file"Line json:"line"*flate.byLiteral*base32.EncodingparseVerticalBar isReplayableRo*sign.PrivateKey*hpke.xKEMPubKey*ast.LiteralType*parser.PosError*[]unstable.Node*unstable.ParserparseBasicStringparseInlineTable*tracker.keyKind*[]tracker.entrycheckInlineTableUpdateArrayTable*[]gob.fieldTypeBinaryMarshalerTencodeGobEncoderfreeEncoderState*gob.emptyStruct*[]*gob.typeInfo*[8]reflect.Kind*[]gob.encHelper*nl.IfaCacheInfo*nl.SocketHandleFindMessageByURLIsProto3Optional*[]filedesc.Enum*filedesc.EnumL2*filedesc.BaseL0*filedesc.EnumL1IsLegacyRequired*filedesc.FieldsunmarshalOptions*filedesc.Oneofs*filedesc.Method*filedesc.FileL1*filedesc.FileL2*impl.weakFields*func() *[]uint8*func() *float32*func() *float64*func() *[]int32*func() *[]int64*func() **string*func() **uint32*func() **uint64growFloat32SlicegrowFloat64SliceProtoMessageInfodenseCoderFieldscoderMessageInfo*impl.structInfoappendExtensionscheckInitializedisInitExtensionsmakeCoderMethodsmakeReflectFuncsunmarshalPointer*impl.mapReflectStoreMessageInforsc.io/qr/coding*func(uint, int)*coding.EncodingbudgetAtLastSent*socket.mmsgTmps*socket.mmsghdrs*bpf.Instruction*bpf.RetConstant*bpf.LoadScratch*sha3.storageBuf*kyber512.scheme*kyber768.scheme*mode3.PublicKey*ed448.PublicKey*scanner.ScannerallowInvalidUTF8mulBy2toDGenericnormalizeGeneric*[]internal.VecL*mode2.PublicKey*mlsbset.Encoder*cmd.serverLogger*cmd.socks5Logger*cmd.clientConfig*cmd.socks5Config*cmd.serverConfigfillAuthenticatorfillTrafficLogger*func() time.Time*chan<- os.Signal*map[string][]int*[8]zapcore.Level*[1]zapcore.Field*[2]zapcore.Field*[3]zapcore.Field*[4]zapcore.Field*[5]zapcore.Field*[]*cobra.Command*func() hash.Hash*x509.Certificate*[]pkix.Extension*x509.ExtKeyUsageRawTBSCertificatePermittedIPRangesPolicyIdentifiers*func() [][]uint8CheckCRLSignature*x509.certificate*x509.pubKeyEqualValues asn1:"set"*[0]*bisect.dedup*[]*godebug.value*[1]asn1.RawValue*func(error) bool*fmt.stringReader*func(int32) bool*func(string) int*func(bool) error*<-chan struct {}*net.pipeDeadline*net.ListenConfig*net.UnixListener*net.timeoutError*net.HardwareAddr*net.nssCriterion*[]map[string]intgoLookupHostOrder*func(int) string*netip.addrDetail*func() [16]uint8*[]unsafe.Pointer*runtime.funcInfo*runtime.pcHeader*runtime.textsect*runtime.initTask*runtime.guintptr*runtime.puintptr*runtime.muintptrallocBitsForIndexrefreshPinnerBitsuserArenaNextFree*[]*runtime.mspan*[]*runtime.sudogupdateMinWhenHeap*[3]atomic.Uint32maxStackScanDelta*runtime.traceBuf*runtime.dlogPerMprofileTimerValid*runtime.lockRankgoroutineProfiled*runtime.mapextra*runtime.cpuStatsScavengeTotalTimefloat64HistOrInit*runtime.stringer*runtime.pollDesctargetCPUFraction*func(int64) bool*[2]runtime.Frame*func() *abi.Type*strconv.NumError*strings.replacer*strings.trieNode*strings.Replacer*syscall.Sockaddr*syscall._Socklen*syscall.NlMsghdr*syscall.Timespec*syscall.IPv6Mreq*[]time.zoneTrans*<-chan time.TimeDisableDefaultCmdDisableNoDescFlagValidArgsFunctionPersistentPreRunEPersistentPostRunCompletionOptionscommandsAreSortedcommandsMaxUseLenDisableAutoGenTag*func() io.WriterGenBashCompletionGenFishCompletionHasAvailableFlagsHasInheritedFlags*func() io.ReaderNonInheritedFlagsgenBashCompletion*[8]reflect.ValueconfigPermissionsAddRemoteProviderSafeWriteConfigAsSetEnvKeyReplacerWatchRemoteConfiggetKeyValueConfigwatchRemoteConfig*zap.errArrayElem*zap.invalidPairs*zap.sinkRegistry*http.EventLogger*tproxy.TCPTProxy*tproxy.UDPTProxyInet4RouteAddressInet6RouteAddress*func() func(int)*[]*v2geo.GeoSite*client.HyUDPConn*client.TLSConfig*client.udpIOImpl*[]*http.response*udphop.udpPacket*func(complex128)*zapcore.counterssafeAddByteString*zapcore.errArray*context.valueCtx*context.canceler*context.timerCtx*context.emptyCtx*context.stringer*tls.SessionStateactiveCertHandles*[8]tls.QUICEventSupportedVersionsHandshakeCompletetestingOnlyDidHRRNameToCertificatesessionTicketKeyssupportedVersionsnextTrafficSecretprepareCipherSpec*tls.keyUpdateMsg*tls.echExtensioncompressionMethodquicResumeSessionquicSetReadSecretquicWaitForSignalsendSessionTicketwriteRecordLocked*tls.finishedHash*[8]*list.Element*tls.xorNonceAEAD*tls.keyAgreement*[0]*interface {}*[]*sync.readOnlyreadSessionTicketsaveSessionTicketdoResumeHandshakeSendSessionTicketsessionTicketSent*[1]tls.ticketKey*json.SyntaxError*json.Unmarshaler*json.encoderFunc*json.encodeState*json.decodeStatetokenValueAllowed*http.http2stream*http.http2Server*http.http2FramerAllowIllegalReadsMaxHeaderListSizedebugWriteLoggerfWriteContinuationWriteWindowUpdatemaxHeaderListSizestaysWithinBufferNewWriteScheduler*[]http.keyValues*[8]*net.Listener*http.chunkWritercloseWriteAndWaitReadHeaderTimeoutdisableKeepAlivesListenAndServeTLSreadHeaderTimeout*http.http2inflow*http.PushOptionsmaxClientStreamIDunstartedHandlerswritingFrameAsynchttp2HeadersFramenewResponseWriterstopShutdownTimer*http.errorReader*http.HandlerFunc*http.routingNode*http.serveMux121*[8]http.muxEntry*http.statusError*http.persistConn*chan<- struct {}mapRoundTripError*http.connOrError*[]*http.wantConn*[8]*http.Request*http.h2TransportDisableKeepAlivesForceAttemptHTTP2abortStreamLocked*[]chan struct {}initialWindowSizeCanTakeNewRequestReserveNewRequest*http.fileHandler*http.http2sorter*iter.Seq[string]*http.closeWriter*http.rwUnwrapper*[]http.ConnState*[][]*http.CookiemakeHeadersCopier*[]http.httpRangenet/http/httputil*certmagic.Issuer*certmagic.ConfigwhitelistContainsSelectCertificateOCSPCheckIntervalremoveCertificateupdateOCSPStaplesDefaultServerNameClientCredentialsCertObtainTimeoutstorageKeyUserRegmaxConcurrentJobs*[1]libdns.Record*[6]zapcore.Field*[7]zapcore.Field*[8]zapcore.Field*duckdns.ProviderValue json:"data"*godaddy.Provider*[]govultr.DomainResourcejson:"-"Locationjson:"-"*acme.CertificateChainPEMjson:"-"InitiateChallengePollAuthorizationRevokeCertificate*[]acme.Challenge*server.udpIOImpl*server.TLSConfig*outbounds.AddrEx PluggableOutbound*errors.AuthError*errors.DialError*crypto.PublicKey*crypto.Decrypter*sync.copyChecker*sync.poolDequeuepoolLocalInternaltryCompareAndSwap*asn1.SyntaxError*asn1.byteEncodermodSqrt3Mod4PrimemodSqrt5Mod8Prime*ecdh.x25519Curve*ecdsa.PrivateKey*pkix.RDNSequenceaddLengthPrefixed*aes.KeySizeError*cipher.BlockMode*des.KeySizeErrorwriteToWithBuffer*io.LimitedReader*io.SectionReader*reflect.cacheKeystackCallArgsSize*[8]reflect.visit*[1]reflect.Value*reflectlite.Type*fmtsort.KeyValue*sort.StringSliceinternal/nettrace*dnsmessage.Class*dnsmessage.RCodeSetsockoptIPMreqn*func(int) *uint8*abi.UncommonTypeinternal/godebugs*pflag.uint8Value*map[string]int64*pflag.ipNetValue*pflag.int64Value*pflag.int32Value*pflag.int16Value*pflag.countValue*pflag.goBoolFlag*func(*flag.Flag)DurationSliceVarPFlagUsagesWrappedGetStringToStringStringToInt64VarPStringToStringVarnormalizeFlagNamenormalizeNameFunc*template.FuncMap checkPipeline QSymlinkIfPossible*encoding.Decoder*encoding.Encoder*flag.stringValue*flag.uint64Value*bufio.ReadWriter*binary.ByteOrder*binary.bigEndian*unix.SockaddrXDP*func() [12]uint8*unix.SockaddrCAN*unix.SockaddrNFCSetServiceNameLen*unix.RawSockaddrIDBySharedPackageSharedPackageByIDBuildAndroidRulesAndroidVPNEnabled*[]tun.tcpGROIteminterfaceCallbacktxChecksumOffloadTXChecksumOffload*[]netip.AddrPortmaybeDeleteOldest*[1]*netlink.Rule*func(int, uint8)WriterReplaceable*acl.geoipMatcher*map[int32]string*map[string]int32*utils.AtomicTime*quic.ClientTokenSupportsDatagramsOpenUniStreamSyncInitialPacketSizehandleStreamFrame*quic.sendStreamI*func(wire.Frame)handshakeCompletequeueControlFramereplaceWithClosedReplaceWithClosed*quic.frameSorterdeleteConsecutiveHandleCryptoFrameinitialCryptoDataAppDataAckHandlerGetHandshakeFrameInitialAckHandlercontrolFrameMutexQueueControlFrameUnpackShortHeaderPackAckOnlyPacketsentPacketHandlerversionNegotiatedkeepAlivePingSentkeepAliveIntervalhandleCryptoFramehandleRetryPackethandleUnpackErrornewFlowControllernextKeepAliveTimeonStreamCompletedsupportsDatagrams*quic.frameSourcecomposeNextPacketinitialPaddingLenshortHdrConnIDLenunpackShortHeader*quic.streamError*[]socket.Message*quic.StreamErrorqueuedStopSendingcancelledRemotelygetDataForWritingpopNewStreamFrame*quic.multiplexer*quic.closePacket**os.SyscallErrorhandleInitialImplinvalidTokenQueueReadNonQUICPacketStatelessResetKeyTokenGeneratorKey*[1]logging.Frame*http3.connection*http3.StreamTypeSendRequestHeaderopenRequestStream*http3.ConnectionwasStreamHijacked*http3.gzipReaderOpenRequestStream*http3.ClientConnUniStreamHijackerdecreaseConnCount*http3.contextKey*hmac.marshalable*rc4.KeySizeError*func(*list.List)*multipart.Writer*multipart.ReaderdispositionParams*textproto.ReaderReadContinuedLineTLSHandshakeStart*[256]*hpack.nodeparseFieldIndexedparseFieldLiteralnet/http/internal*httpproxy.Config*httpproxy.config*acmez.authzStateObtainCertificate doHTTPRequest+ypollAuthorization*ocsp.revokedInfo*ocsp.ocspRequestValue dns:"octet"setPublicKeyECDSA*dns.SVCBKeyValueValue dns:"pairs" Locator32dns:"a"Locator dns:"hex"*func() dns.EDNS0AuthenticatedDataCompressjson:"-"*func() *dns.TSIG*dns.TsigProvider*dns.SVCBIPv6Hint*dns.SVCBIPv4Hint*dns.identityHash*dns.EDNS0_EXPIRE*dns.EDNS0_COOKIE*dns.EDNS0_SUBNET*dns.ClientConfig*map[string]uint8*[8]func() dns.RR*map[uint8]string*[]*regexp.threadFindSubmatchIndexReplaceAllLiteral*errors.withStack*func(url.Values)*oauth2.Transport*oauth2.AuthStyleDeviceAccessToken*[]govultr.BackupOsID json:"os_id"*govultr.Upgrades*govultr.UserData*govultr.VPC2Info*govultr.DatabaseGetConnectionPoolListServiceAlertsRestoreFromBackup*govultr.InstanceCreateReverseIPv4CreateReverseIPv6DeleteReverseIPv6GetBackupScheduleSetBackupSchedule*govultr.NodePool*govultr.VersionsGetForwardingRuleListFirewallRules*[]govultr.Region*govultr.Snapshot*[]govultr.SSHKey*govultr.VPC2NodeContainerRegistryvultrErrorHandler*govultr.ipv4Base*govultr.isosBase**govultr.lbsBase*govultr.userBaseVNCUrl json:"vnc"*govultr.vpc2Base*govultr.vpcsBase*[]*doh.PTRRecord*[]*doh.SOARecord*[]*doh.SRVRecord*[]*doh.TXTRecordMaximumNameLengthSetVerifiedChains*quic.cryptoFrame*nistec.p521Table*nistec.P521Point*nistec.p224Table*nistec.P224Point*nistec.p256Table*nistec.P256Point*nistec.p384Table*nistec.P384Point*func() parse.Pos*parse.lexOptions*parse.ActionNode*parse.BranchNode*parse.NumberNode*parse.StringNodeparseTemplateName*[]parse.itemType*template.element*map[uint32]int32*[]*ast.ObjectKeyAllowNestedValues*[]ini.dataSourceStrictTimesFormat*[][]*ini.Section*properties.lexerFilterStripPrefixGetParsedDuration*toml.DecodeError*[8]danger.TypeIDtypeMismatchErrorunmarshalDateTime*yaml.Unmarshaler*yaml.yaml_mark_tversion_directive*yaml.yaml_node_t*[]yaml.fieldInfo*netlink.BpfEncap*[]netlink.bpfObjTxHeartbeatErrors*netlink.Protinfo*[]netlink.VfInfoMulticastSnooping*netlink.VrfSlave*netlink.BondModeSuppressPrefixlen*[]netipx.IPRange*[]protowire.Type NoUnkeyedLiteralsunmarshalSingularmarshalMessageSet*protoreflect.MapIsStreamingClientIsStreamingServerappendEnumOptionsappendFileOptionsContainingMessagesampleMaxInflightOnCongestionEventmaxTrackedPacketsbandwidthEstimatebandwidthForPacermaybeUpdateMinRttisAtFullBandwidthexitingQuiescence*bbr.DefaultClock*[]brutal.pktInfo*protocol.Version*logging.ECNStateStartedConnectionNegotiatedVersionUpdatedKeyFromTLSLossTimerCanceled*wire.CryptoFrame*wire.StreamFramevalidateAckRangesMaximumStreamData*wire.FrameParserMaxUDPPayloadSize*ackhandler.FramelastTestingPacketdetectLostPacketsreceiveWindowSizefirstPacketNumberprevRcvAEADExpiryFirstPacketNumbersetAEADParametersstartKeyDropTimerzeroRTTParametersencodedRemoteAddr*[8]ipv4.ICMPTypesetGroupSourceReq*[8]*ipv4.sockOptMulticastLoopbackSetControlMessage*func() slog.KindpreformattedAttrswriteIndexedField*syntax.ErrorCode*[]*syntax.Regexp*syntax.charGroupparseUnicodeClass requiresHTTP1Ro*hpke.xKEMPrivKey*fiat.P224Element*fiat.P256Element*fiat.P384Element*fiat.P521Element*func() token.Pos*ast.CommentGroup*tabwriter.Writer*[]tabwriter.cell*unstable.builder*func(gob.typeId)*gob.userTypeInfo*gob.encoderState*[]*gob.encEngine*[8]*gob.typeInfo*[8]gob.encHelper*nl.NetlinkSocketSetReceiveTimeout*errors.wrapError*protowire.Number*pragma.DoNotCopyNumFilesByPackageFindMessageByNameRegisterExtension*[]order.mapEntry*filedesc.fileRaw*filedesc.Builder*filedesc.Message*[]filedesc.Field*filedesc.FieldL1*[]filedesc.Oneof*filedesc.OneofL1*[]*filedesc.Enum*filedesc.Service*filedesc.Methods*filedesc.Edition*filedesc.pathKeyresolveExtensions*filetype.depIdxs*impl.MessageInfo*func() **[]uint8*func() **float32*func() **float64*func() *[]string*func() *[]uint32*func() *[]uint64numRequiredFields*impl.listReflectatomicMessageInfo*[][]coding.Pixel*congestion.Clock*congestion.CubicSetNumConnectionstimeToOriginPointBandwidthEstimatemaybeIncreaseCwndStartReceiveRound*congestion.paceradjustedBandwidth*socket.syscaller*bpf.LoadAbsolute*bpf.LoadConstant*bpf.LoadIndirect*bpf.LoadMemShift*bpf.StoreScratch*kyber1024.scheme*mode3.PrivateKey*ed448.PrivateKey*ed25519.SchemeID*func() k12.State*func(*[32]uint8)reduceLe2QGeneric*goldilocks.Point*mode2.PrivateKeyCompressMessageToDecompressMessage*map[string]stringfillOutboundConfigfillUDPIdleTimeoutError json:"error"*func(*os.dirInfo)**certmagic.ConfigSignatureAlgorithmPublicKeyAlgorithmUnknownExtKeyUsageExcludedDNSDomainsExcludedURIDomainsAppendCertsFromPEMCheckSignatureFromhasNameConstraints*x509.ecPrivateKeyDpasn1:"optional"Dqasn1:"optional"*[0]*godebug.value*[1]unsafe.Pointer*func(string) bool*func() (int, int)*func() net.IPMask*func(net.IP) boolIsLinkLocalUnicastSetKeepAliveConfigSetKeepAlivePeriod*net.notFoundError*net.canceledError*net.onlyValuesCtxReadMsgUDPAddrPortWriteToUDPAddrPort*func() netip.Addr*net.buffersWriter*[][]net.nssSource*[8]map[string]int*func(int) []uint8*func(int64) errorblockUntilWaitable*[]*signal.handlerCompareAndSwapNoWB*[]runtime.functab*runtime.ptabEntry*runtime.bitvector*runtime.addrRangeremoveGreaterEqual*runtime.mSpanList*runtime.gclinkptr*runtime.spanClassuserArenaChunkFreetypePointersOfTypewriteHeapBitsSmall*runtime.pageCache*[]*runtime._defer*runtime.timerWhen*func(int64) int64*runtime.notInHeap*runtime.throwType*runtime.traceTimeScavengeAssistTime*func(uint32) bool*runtime.timeTimer*runtime.untracedGcontrollerCooldown*[8]unsafe.Pointer*runtime._typePair*func(int32) int32*func(uint8) error*func() time.Month*map[string]uint64*[1]time.zoneTransPersistentPostRunEhelpCommandGroupIDFParseErrWhitelistcommandsMaxNameLenDisableFlagParsingDisableSuggestionsCommandPathPaddingHasHelpSubCommandsHasPersistentFlagsInitDefaultHelpCmdIsAvailableCommandSetVersionTemplateValidateFlagGroupscheckCommandGroups*[]map[string]bool*func(*pflag.Flag)*[]viper.FlagValue*func(string) uintGetStringMapStringflattenAndMergeMapmergeWithEnvPrefixproviderPathExists*func(*zap.Logger)*zap.SugaredLogger*zap.nopCloserSink*zap.errorResponseLevel json:"level"newFileSinkFromURL*redirect.sockAddrupdateConnDeadline*func() url.Values*[8]*v2geo.GeoSiteInsecureSkipVerify*client.QUICConfig*client.clientImpl*[]*client.udpConn*[0]*http.response*udphop.UDPHopAddr*func(string, int)*zapcore.FieldType*[]zapcore.counter*context.cancelCtx*tls.QUICEventKind*[]*tls.activeCert*[]tls.CertificateNegotiatedProtocoltestingOnlyCurveIDGetConfigForClientClientSessionCache*func([][32]uint8)ticketKeyFromBytes*func(error) error*[]tls.pskIdentitycompressionMethodsquicSetWriteSecretreadHandshakeBytessignatureAlgorithm*tls.atLeastReader*[0]*sync.readOnly*func(uint16) boolprocessServerHellocheckForResumptionprocessClientHello*json.errorContext*json.floatEncoder*json.structFields*json.sliceEncoder*json.arrayEncoderAllowIllegalWrites*http.http2ErrCode*http.http2SettingmaxHeaderStringLenContextWithTimeout*http.headerSorter*http.relationshipParseMultipartFormRegisterOnShutdown*chan interface {}*http.http2outflowhttp2PriorityParamprocessResetStreamscheduleFrameWritesendWindowUpdate32*http.incomparablematchMethodAndPath*http.routingIndex*[][]*http.pattern*http.RoundTripper*http.writeRequest*func(http.Header)shouldRetryRequestcleanFrontCanceledDisableCompressionProxyConnectHeadertlsNextProtoWasNilhasCustomTLSDialerputOrCloseIdleConncontextWithTimeoutdialTLSWithContextdisableCompressioncloseReqBodyLocked*[8]chan struct {}getStartDialLocked*http.dirEntryDirs*http.fileInfoDirs*http.timeoutErrorallocatePromisedID*http.stringWriter*[8]http.ConnState*[]http.http2Flags*[8][]*http.Cookie*[]go.shape.string*certmagic.Storage*certmagic.KeyInfo*certmagic.KeyType*certmagic.ManagerResponderOverridesRenewCheckIntervalreplaceCertificateRenewalWindowRatioDNS01TXTRecordNameHTTP01ResourcePath issuerKeyjson:"-"promptUserForEmailstorageKeyCAPrefixstorageSafeUserKeychallengeTokensKey*certmagic.RevokerPropagationTimeout*cloudflare.cfZonePrice json:"price"Count json:"count"*gandi.gandiRecord*gandi.gandiDomain*gandi.gandiStatus*gandi.gandiErrorsCause json:"cause"*[]acme.SubproblemValue json:"value"*[]acme.IdentifierAccountKeyRolloverprovisionDirectory*func(quic.Stream)*server.h3sHandler*server.QUICConfigMaxIncomingStreams*server.serverImpl*func([]uint8) int*func(uint64) boolListenAndServeHTTP*outbounds.UDPConnPushFrontExpirable*[]*doh.AAAARecordState json:"state"*[]utils.PortRange*crypto.PrivateKey*crypto.SignerOpts*sync.poolChainElt*asn1.bytesEncoder*asn1.int64Encoder*asn1.multiEncoder*asn1.tagAndLengthprobablyPrimeLucas*func() []big.Word*func() ecdh.Curve*ed25519.PublicKeyaffineFromJacobianOrganizationalUnitAddASN1OctetString*cipher.cbcDecAble*cipher.cbcEncAble*reflect.StructTagmustBeExportedSlow*func() complex128*func() [2]uintptr*reflect.bitVector*reflect.fieldScan*reflect.layoutKey*[]reflect.abiStep*reflect.sliceType*[]abi.StructField*[]unicode.Range16*[]unicode.Range32*reflectlite.rtype*nettrace.TraceKey*map[string]uint16RecursionAvailable*dnsmessage.header*dnsmessage.ParserSkipAllAdditionalsSkipAllAuthoritiesSetsockoptIPv6Mreq*singleflight.call*testlog.Interface*abi.InterfaceType*[0]unsafe.Pointer*chacha8rand.State*pflag.uint64Value*pflag.uint32Value*pflag.uint16Value*pflag.stringValue*pflag.ipMaskValuedefaultIsZeroValueStringToStringVarP*template.Template*func() parse.Node*template.variableGetStdoutThresholdSetStdoutThresholddecodeMapFromSliceReadlinkIfPossible*flag.float64Valuego.uber.org/atomic*unix.SockaddrUnix*unix.SockaddrTIPC*unix.SockaddrIUCV*unix.IfaCacheinfoOverrideAndroidVPNUnregisterCallbackIncludeAndroidUser_TXChecksumOffload*[8]netip.AddrPort*[]*tun.TCPSessionLoadOrStoreWithAgeinet4ServerAddressinet6ServerAddress*map[int]struct {}*func(*buf.Buffer)*metadata.Metadata*acl.geositeDomain*acl.domainMatcher*v2geo.GeoSiteList*v2geo.Domain_Type*quic.packetBufferactiveConnectionIDshouldUpdateConnIDupdateConnectionIDremoveConnectionIDretireConnectionID*quic.cryptoStreamAppendStreamFramesRemoveActiveStreamPackMTUProbePacketChangeConnectionIDDiscardInitialKeysconnFlowControllerearlyConnReadyChandroppedInitialKeyshandshakeConfirmedhandleMaxDataFramelogCoalescedPacketsendPacketsWithGSO*quic.packetPackerGetHandshakeSealer*quic.streamSendercurrentFrameIsLastqueuedBlockedFrameenqueueClosePacketnextStreamToAcceptoutgoingUniStreamsincomingUniStreams*quic.zeroRTTQueuenextZeroRTTCleanupsendStatelessResetConnectionIDLengthpopStreamFramex]*http3.datagrammer*map[uint64]uint64WriteRequestHeader*http3.requestBodyadditionalSettings*http3.errorSetter**quic.StreamErrorAdditionalSettings*http3.goAwayFrame*http3.frameParser*rand.lockedSource*func() *list.ListupcomingHeaderKeysnet/http/httptrace*hpack.HeaderFieldSetMaxStringLength*httpproxy.matcher*httpproxy.ipMatch*[1]pkix.Extension*ocsp.responseData*ocsp.responseASN1*func(dns.RR) boolPrefixes dns:"apl"Endpoint dns:"hex"Target dns:"octet"*dns.SVCBECHConfig*dns.SVCBMandatory*dns.EDNS0_PADDING*map[uint16]string*regexp.inputBytesFindAllStringIndexFindStringSubmatch*errors.StackTraceEmail json:"email"Total json:"total"Links json:"links"Label json:"label"*govultr.Bandwidth*[]govultr.VPCInfo*[]govultr.HistoryUnits json:"units"*[]govultr.InvoiceBytes json:"bytes"Image json:"image"Plans json:"plans"MySQL json:"mysql"Redis json:"redis"AddReadOnlyReplicaGetMigrationStatusPromoteReadReplica*govultr.DomainReqNotes json:"notes"*govultr.ReverseIP*govultr.NeighborsDefaultReverseIPv4*govultr.PublicISONodes json:"nodes"**govultr.Versions*[]govultr.Cluster*[]govultr.Network*govultr.OSService*govultr.SSHKeyReqonRequestCompletedOnRequestCompletedBlock json:"block"Usage json:"usage"*govultr.plansBase*govultr.usersBaseUsers json:"users"*govultr.vpcs2Base*exec.wrappedError*tls.HPKEKeyConfigServerCertificates*[]tls.PskIdentityGroup json:"group"CompressionMethodscachedPrivateHello*bisect.parseError*parse.CommandNode*parse.CommentNode*[8]parse.itemType*template.HTMLAttr*[]norm.Properties*[1]*ast.ObjectKey*[]*ast.ObjectItemIgnoreContinuationKeyValueDelimitersStringsWithShadows*[8][]*ini.SectionscanEscapeSequencescanUnicodeLiteral*toml.valueOptions*toml.errorContexthandleKeyValueParttryTextUnmarshalerunmarshalLocalDateunmarshalLocalTime*yaml.yaml_event_t*yaml.yaml_style_t*yaml.yaml_token_ttag_directives_endsimple_key_allowedsimple_keys_by_tok*yaml.yaml_break_tflow_plain_allowedsimple_key_context*[8]yaml.fieldInfoInlineUnmarshalers*netlink.MPLSEncap*netlink.SEG6Encap*[4]netlink.bpfObj*netlink.LinkAttrs*netlink.LinkSlavePropagationSegment*netlink.IPoIBMode*netlink.BondSlave*netlink.Wireguard*[1]netipx.IPRange*[8]protowire.TypemarshalMessageSlow*protoreflect.Name*protoreflect.Kind*protoreflect.ListappendFieldOptionsappendOneofOptionsHasOptionalKeyword*protoreflect.Enum*bbr.sendTimeStatemaxAckHeightFiltersampleMaxBandwidthsampleIsAppLimitedTotalBytesNeuteredtotalBytesNeuteredconnectionStateMapMaybeExitSlowStartSetMaxDatagramSizecycleCurrentOffsetdetectOvershooting*[5]brutal.pktInfo*quicvarint.Reader*protocol.StreamID*protocol.KeyPhase*logging.TimerTypeAcknowledgedPacketMaybeSplitOffFrame*wire.MaxDataFrameIsApplicationErrormarshalVarintParam*ackhandler.packetfirstTestingPacketfirstCapablePacketGetHighestAckRangeLowestPacketNumbergetPTOTimeAndSpacebaseFlowControllerDecodePacketNumberGetHandshakeOpener*[]handshake.EventinvalidPacketLimitinvalidPacketCountValidateRemoteAddr*rand.LockedSource*ipv4.ControlFlagsMulticastInterface*func() slog.Level*func() slog.Value*slog.timeLocation*qpack.HeaderField*flate.dictDecoder*flate.literalNode*[1]*syntax.Regexp*[8]*syntax.Regexp*syntax.printFlagsoutgoingLengthRoSetResponseHandler*func() kem.Scheme*hybrid.xPublicKey*hybrid.cPublicKey*tabwriter.osError*unstable.IteratorparseLiteralString*func() gob.typeIdsendTypeDescriptor*[0]*gob.encEngine*struct { r1 int }*struct { r2 int }*struct { r3 int }*struct { r4 int }*struct { r5 int }*struct { r6 int }*struct { r7 int }*order.FieldRanger*order.EntryRangerIsDelimitedEncoded*[]*filedesc.Field*[]*filedesc.Oneof*[8]*filedesc.Enum*filedesc.Messages*[]filedesc.Method*filedesc.MethodL1optionsUnmarshaler*filedesc.ServicesFindMessageByIndex*impl.mergeOptionsAppendPointerSlice*func() *[][]uint8*func() *[]float32*func() *[]float64*[]*impl.fieldInfo*[]*impl.oneofInfo*impl.extensionMaporderedCoderFieldsreflectMessageInfounmarshalExtension*impl.resolverOnly*impl.mapConverter*impl.messageState*impl.mapEntryType*impl.legacyMerger*impl.MessageStateslowStartThreshold*bpf.ALUOpConstant*bpf.LoadExtension*prototext.encoder*text.encoderStatefillBandwidthConfig*func() *os.dirInfo*chan cmd.modeError*[]certmagic.Issuer*x509.HostnameError*func() crypto.Hash*[]x509.ExtKeyUsage*func(string) errorPermittedDNSDomainsPermittedURIDomains*x509.VerifyOptions*func([]uint8) bool*x509.InvalidReasonUnmarshalCompressed*x509.publicKeyInfo*x509.pssParameters*[][]pkix.Extension*errors.errorString*func() (int, bool)ReadFromUDPAddrPortWriteMsgUDPAddrPort*net.temporaryError*func(uintptr) bool*func() poll.String*[]net.nssCriterion*[8][]net.nssSource*func() sync.Lockerinternal/concurrent*[]netip.addrDetail*func() fs.FileMode*[]chan<- os.Signal*[8]*signal.handler*func(error) string*runtime.moduledata*[]runtime.textsect*runtime.modulehash*func(interface {})*[13]unsafe.Pointer*runtime.cgoCallersinitOpenCodedDefers*runtime.sysmontick*[]runtime.guintptr*runtime.workbufhdr*runtime.winlibcall*runtime.waitReason*runtime.statDepSet*runtime.metricKind*runtime.plainError*runtime.traceFrame*map.bucket[int]int*runtime.metricData*func() abi.ChanDir*syscall.WaitStatus*syscall.Credential*time.fileSizeErrorappendFormatRFC3339appendStrictRFC3339DisableDescriptionsGenBashCompletionV2InitDefaultHelpFlagupdateParentsPflags*[8]map[string]bool*[8]viper.FlagValueautomaticEnvApplied*func(string) int64*func(string) []intwatchKeyValueConfig*[]encoding.Decoder*[]encoding.Encoder*func() *zap.Logger*zap.SamplingConfignewFileSinkFromPath**redirect.sockAddrFdControlUnixSocket*socks5.EventLoggerNewPacketConnection*func() []func(int)*utils.SNIGuardFunc*client.ConnFactory*[8]*client.udpConn*func(string, bool)*func(string, int8)*func(string, uint)*zapcore.optionFuncaddElementSeparator*func(float64, int)closeOpenNamespaces*zapcore.errorGroup*[]context.canceler*context.CancelFuncenableSessionEvents*[]*tls.CertificateSupportsCertificate*tls.ClientAuthType*func() *tls.ConfigmaxSupportedVersionisHandshakeCompletesecureRenegotiation*tls.clientHelloMsgobfuscatedTicketAge*[]tls.echExtension*tls.serverHelloMsg*tls.transcriptHashhandleRenegotiationquicWriteCryptoData*tls.certificateMsg*tls.permanentError*[]*tls.CipherSuite*[1]tls.pskIdentity*json.unquotedValue*json.structEncoderHeaderBlockFragmentSetMaxReadFrameSize*func() http.Header*func(*http.Cookie)startBackgroundReadrequestBodyLimitHit*func() <-chan boolsetupHTTP2_ServeTLStlsHandshakeTimeoutqueuedControlFramescanonHeaderKeysSizeinFrameScheduleLoopnewWriterAndRequest*func(uint32) errorprocessWindowUpdatehasNonemptyTrailers*http.bodyEOFSignalmatchingMethodsPath*[8][]*http.patternredirectToPathSlash*http.MaxBytesError*http.wantConnQueue*http.connectMethodTLSHandshakeTimeoutMaxIdleConnsPerHostmaxIdleConnsPerHostcleanupWriteRequestcountReadFrameErrorisDoNotReuseAndIdlebytesFromFirstChunk*http.http2dialCallhttp2clientConnPool*http.ProtocolError*http.serverHandler*http.baseContexter*[8]http.http2Flags*http.CloseNotifier*[8]go.shape.stringdefaultErrorHandlergetAllMatchingCertsoptionalMaintenance*[]acme.CertificateHandleHTTPChallengepromptUserAgreement CertificateResource*certmagic.lockMeta*certmagic.namedJobgetDNSPresentMemory*godaddy.PostRecord*acme.Authorization*acme.DirectoryMeta*acme.accountObjectKeyID json:"key_id"GetCertificateChain PrivateKeyjson:"-"fillChallengeFields*server.StreamStats*server.StreamState*server.RequestHook*server.EventLoggerProxyStreamHijackerwriteToAddrPortC*masq.MasqTCPServerListenAndServeHTTPS*[1]utils.PortRange*errors.ConfigError*errors.ClosedError*asn1.taggedEncoder*asn1.stringEncoderexpNNMontgomeryEven*func(*big.Int) int*ed25519.PrivateKey*elliptic.p256CurveFillFromRDNSequence*cryptobyte.BuilderAddASN1Int64WithTag*io.ReadWriteCloser*func(float64) bool*reflect.structType*reflect.layoutType*reflect.ValueError*unicode.RangeTable*[]fmtsort.KeyValue*[]dnsmessage.Class*[]dnsmessage.RCode*dnsmessage.section*poll.errNetClosingSetsockoptInet4Addr*singleflight.Group*func() []*abi.Type*func(int32) uint32*pflag.ipSliceValue*pflag.float64Value*pflag.float32ValueShorthandDeprecatedparseSingleShortArg*template.ExecError*func() *parse.Treetext/template/parseclearActionLine QcontinueControl QparseDefinition QtemplateControl Q*mapstructure.Error*mapstructure.fielddecodeMapFromStructdecodeStructFromMap*flag.durationValue*flag.boolFuncValue*flag.ErrorHandling*func([]uint8, int)*unix.SockaddrInet4*unix.SockaddrInet6*unix.RawSockaddrVM*unix.RawSockaddrL2*unix.SockaddrPPPoE*tun.PackageManager*[][]tun.tcpGROItem*[8]*tun.TCPSessionWriteIsThreadUnsafe*chan udpnat.packet*func() *buf.Buffer*metadata.Socksaddr*func() *net.IPAddr*network.PacketConn*acl.geositeMatcher*func(bbr.ackPoint)*quic.packetHandler*[]protocol.Version*quic.ReceiveStream*quic.streamManagerGetOrOpenSendStream*quic.connIDManagerStatelessResetTokenChangeInitialConnIDSetMaxActiveConnIDs*func(uint64) errorhandshakeCryptoDataHandshakeAckHandler*[]quic.sendStreamI*[]ackhandler.FrameAppendControlFramesHandle0RTTRejectionPackCoalescedPacketPackConnectionClose*quic.mtuDiscovererSetLargest1RTTAcked*quic.datagramQueueHandleDatagramFramehandshakeDestConnIDcryptoStreamManagerretransmissionQueuecryptoStreamHandlerreceivedFirstPacketdropEncryptionLevelhandleDatagramFramehandleNewTokenFramelogLongHeaderPacketnextIdleTimeoutTimeresetPacingDeadlinesendConnectionCloseappendPacketPayloadpackConnectionClose*quic.streamOpenErr*quic.receiveStreamqueuedMaxStreamDatacloseForShutdownErrcancellationFlaggedsendStreamCompleted*quic.indexableConnstatelessResetMutexoutgoingBidiStreamsincomingBidiStreamsgetOrOpenSendStream*quic.deadlineError*chan quic.quicConninitialPacketNumberverifySourceAddress*quic.EarlyListenerhandleNonQUICPacketVerifySourceAddressstatelessResetQueuehasNonEmptyTrailers*http3.listenerInfo*http3.headersFrameunknownFrameHandler*rand.runtimeSource*func() blake2b.XOFFormDataContentType*hpack.incomparableMaxDynamicTableSize*hpack.dynamicTable*httpproxy.allMatch*acmez.retryableErrremainingChallenges*ocsp.ResponseError*ocsp.basicResponse*ocsp.responseBytes*dns.compressionMap GatewayAddrdns:"-"setPublicKeyED25519Digest dns:"base64"*[]dns.SVCBKeyValue*func() dns.SVCBKeySetRcodeFormatError*func(dns.RR) error*dns.ResponseWriter*regexp.onePassProg*regexp.onePassInst*regexp.inputString*regexp.inputReader*errors.withMessage*errors.fundamentalgolang.org/x/oauth2*oauth2.TokenSourceAppID json:"app_id"*[]govultr.VPC2Info MegaBytes json:"mb" GigaBytes json:"gb" TeraBytes json:"tb"*[]govultr.DatabaseVPCID json:"vpc_id"*govultr.DatabaseDBMaxGB json:"max_gb"MaxMB json:"max_mb"ListAdvancedOptionsListConnectionPoolsStartVersionUpgradeIsoID json:"iso_id"*[]govultr.Instance*govultr.RestoreReqListPrivateNetworks*govultr.ISOService*govultr.ClusterReq*[]govultr.NodePool*govultr.KubeConfigListForwardingRules*govultr.NetworkReq NetworkID json:"id"*govultr.ReservedIP*[]govultr.Snapshot*govultr.VPCService*[]govultr.VPC2Node*govultr.backupBase*govultr.dnsSecBase*govultr.domainBase*govultr.lbRuleBase*govultr.regionBase*govultr.s3KeysBase*govultr.sshKeyBase**govultr.usersBase**govultr.Bandwidth*func(func() error)*[]*doh.CNAMERecord*map[string][]uint8ApplicationSettingsSecureRenegotiationgetCachedPrivatePtrTransportParameters*[]quic.cryptoFrame*quic.ProtectionKey*[]nistec.p521Table*[]nistec.p224Table*[]nistec.p256Table*[]nistec.p384Table*[]fiat.P224Element*func() *bigmod.NatSetOverflowingBytesmontgomeryReduction*edwards25519.Point*unsafeheader.Slice*parse.VariableNode*parse.ContinueNode*parse.TemplateNode*[]template.element*norm.reorderBuffernLeadingNonStarters*[1]*ast.ObjectItem*printer.ByPositionInsensitiveSectionsIgnoreInlineCommentUnparseableSections*properties.stateFn*[]toml.DecodeError*toml.LocalDateTime*[]map[string][]inthandleKeyValueInner*yaml.yaml_parser_t*[]yaml.yaml_mark_t*[]yaml.yaml_node_ttag_directives_datastream_end_producedblock_plain_allowed*[]*yaml.structInfo*exceptions.HandlerBitRatePreScalerMinBitRatePreScalerMaxBitRatePreScalerInc*netlink.TuntapMode*netlink.TuntapFlag*[]net.HardwareAddr*netlink.IPVlanMode*netlink.IPVlanFlag*netlink.BondAdInfo*[]netlink.BondMode*[]*nl.SocketHandleawaitGoroutinesc^FindExtensionByNameunmarshalMessageSet*proto.mergeOptions*protoreflect.ValueappendMethodOptionsappendRepeatedFieldappendSingularField*protoreflect.Names*[]protowire.Number*bbr.roundTripCountlastPacketSendStatemaxAckHeightTrackerGetCongestionWindowOnCongestionEventExSetRTTStatsProvidercalculatePacingRateupdateRecoveryStatecurrentRoundTripEndmaxCongestionWindowminCongestionWindowprobeRttRoundPassed*protocol.StreamNum*protocol.ByteCount*utils.ByteInterval*func(*wire.Header)*logging.PacketType*wire.NewTokenFrame*wire.DatagramFrame*map[uint64][]uint8*func(utils.Logger)SetAckDelayExponentisAllowedAtEncLevelhighestPacketNumbergetLossTimeAndSpaceallowWindowIncreasereceivedFinalOffsethandleSessionTicket*func(bool) []uint8*func() []slog.Attr*func(...slog.Attr)*func() slog.Record*slog.commonHandler*flate.decompressor*[]syntax.charGroupremoveLeadingRegexpremoveLeadingString*internal.AuthStyle*internal.tokenJSONexpectsContinueRomultipartReaderRo*sign.SignatureOpts*func() sign.Scheme*hybrid.xPrivateKey*hybrid.cPrivateKey*func(*[4057]uint8)*func(*[2009]uint8)*func() token.Token*[][]tabwriter.cell*unstable.reference*tracker.KeyTracker*gob.gobEncoderType*errors.prefixErrorRangeFilesByPackageextensionsByMessage*order.messageField*filedesc.Extension*filedesc.EnumValue*[]filedesc.Message*filedesc.MessageL2*[8]*filedesc.Field*[8]*filedesc.Oneof*filedesc.MessageL1*[]filedesc.Service*filedesc.ServiceL2*[]*filedesc.Method*filedesc.ServiceL1*[]filedesc.pathKey*filedesc.enumRange*[]filedesc.EditionunmarshalNeedsValue*func(impl.pointer)*[8]*impl.fieldInfo*[8]*impl.oneofInfooneofWrappersByTypemakeKnownFieldsFuncmutableUnknownBytes*impl.ExtensionInfo ExtensionDescriptor*impl.listConverter*impl.enumConverter*impl.boolConverterShouldExitSlowStart*bpf.RawInstruction*kyber512.PublicKey*kyber768.PublicKey*func(*[4000]uint8)*func(*[1952]uint8)*func(*[2560]uint8)*func(*[1344]uint8)*func() blake2s.XOF*func(*common.Poly)*internal.PublicKey*func(mlsbset.EltG)*map[string]float64*func(*[2528]uint8)*func(*[1312]uint8)*func(string, error)*cmd.udpTProxyLogger*cmd.tcpTProxyLogger*cmd.clientConfigTLSCAmapstructure:"ca"Upmapstructure:"up"*cmd.tcpTProxyConfig*cmd.udpTProxyConfig*cmd.serverConfigTLS*cmd.serverConfigACL*func(string) string*[1]certmagic.Issuer*[]*x509.Certificate*func([]uint8) error*func(x509.OID) boolfindPotentialParentscheckNameConstraintsIsCAasn1:"optional"*x509.tbsCertificateQinvasn1:"optional"*x509.pkcs1PublicKey*x509.rfc2821Mailbox*func(*bisect.dedup)*[1][]pkix.Extension*[1]x509.ExtKeyUsage*func(string, int32)*func(reflect.Value)IsLinkLocalMulticast*net.KeepAliveConfig*net.addrPortUDPAddr*func(int, int) bool*net.hostLookupOrderstandardStatusAction*chan net.dialResult*map[string][]string*func(net.Addr) boolgoLookupIPCNAMEOrder*[8]netip.addrDetail*func() netip.Prefix*func() interface {}*[8]chan<- os.Signal*runtime.errorString*[]runtime.ptabEntry*[]*runtime.initTask*runtime.boundsError*[136]*runtime.mspanheapBitsSmallForAddr*[32]*runtime._defer*[]runtime.timerWhen*[128]*runtime.sudog*[128]*runtime.mspan*runtime.pTraceStategcFractionalMarkTime*runtime.mTraceState*[]*runtime.traceBufneedPerThreadSyscallwaitTraceBlockReason*runtime.gTraceState*func(*runtime.coro)*runtime.metricValue*func(string) func()printControllerReset*[]runtime._typePair*func(uint64) uint64*func() []abi.Method*func() *abi.MapType*[]*strings.trieNode*syscall.SysProcAttr*func(time.Time) int*func() time.Weekday*func(time.Duration)*cobra.flagCompErrorGenZshCompletionFilegenZshCompletionFilehasNameOrAliasPrefixmergePersistentFlags*func(string) uint64SetConfigPermissions*[8]encoding.Decoder*[8]encoding.Encoder*func() zapcore.Core*func(zapcore.Level)*zap.errSinkNotFound*proxymux.muxManagercanonicalizeAddrPort*tun.interfaceFinderInterfaceIndexByNameInterfaceNameByIndexUrgent json:"urgent"*obfs.obfsPacketConn*zapcore.WriteSyncer*zapcore.EntryCaller*func(string, int16)*func(string, int64)*func(string, uint8)*zapcore.jsonEncoder*zapcore.TimeEncoder*zapcore.NameEncoder*zapcore.systemClock*[8]context.canceler*context.afterFuncer*tls.SignatureScheme*[8]*tls.Certificate*tls.ClientHelloInfo*tls.ConnectionStateExportKeyingMaterialGetClientCertificateSetSessionTicketKeysexportKeyingMaterialextendedMasterSecretencryptedClientHelloSymmetricCipherSuite*func() (int, error)getClientCertificatenewRecordHeaderErrorreadChangeCipherSpecwriteHandshakeRecord*tls.helloRequestMsg*tls.rsaKeyAgreement*tls.prefixNonceAEAD*tls.binaryMarshaler*func(*interface {})crypto/internal/hpkeserverResumedSession*json.MarshalerErrortryGrowByReslice$*http.http2FrameType*http.http2DataFrame*[]http.http2Setting*http.http2SettingIDstartWriteDataPaddedMaxConcurrentStreams*http.ResponseWriterwantsHttp10KeepAlivesetInfiniteReadLimitdisableWriteContinueSetKeepAlivesEnabledcloseListenersLockedinitialReadLimitSizemaxConcurrentStreams*[]*http.http2stream*[]hpack.HeaderField*http.http2PingFrame*http.http2writeData*func(*http.Request)writeDataFromHandlerunreadDataSizeLocked*http.transferWriter*[]*http.routingNode*http.maxBytesReader*http.http2Transport*[]*http.persistConn*http.requestAndChannumExpectedResponsescloseConnIfStillIdlecleanFrontNotWaitingCloseIdleConnectionsremoveIdleConnLockedreqBodyContentLengthcloseIdleConnections*http.countingWriter*http.http2timeTimer*http.http2connError*http.http2httpError*[]http.http2ErrCode*[]http.RoundTripper*httputil.BufferPool*[]certmagic.Manager*certmagic.ChallengehandshakeMaintenanceDisableHTTPChallengeHTTPChallengeHandlerselectPreferredChainstorageKeyUserPrefix*[]*certmagic.Config*[]certmagic.KeyInfo*[]certmagic.StoragesaveDNSPresentMemory*[]cloudflare.cfZoneStatus json:"status"Paused json:"paused"*cloudflare.Provider*[]gandi.gandiRecord*[]gandi.gandiDomain*[]gandi.gandiErrorsLocation json:"body"Object json:"object"Errors json:"errors"*namedotcom.Provider*func() *http.ClientOrders json:"orders"OldKey json:"oldKey"Sigjson:"signature"Reason json:"reason"*func(uint32, error)readFromAddrPortCwriteMsgAddrPortC*outbounds.aclEngineStream json:"stream"*errors.ConnectErrormodSqrtTonelliShanks*cipher.cbcDecrypter*cipher.cbcEncrypter*cipher.StreamReader*des.tripleDESCipher*func() reflect.Type*reflect.StructField*func() reflect.KindmustBeAssignableSlow*reflect.abiStepKind*reflect.methodValueinternal/reflectlite*[8]dnsmessage.Class*[8]dnsmessage.RCode*func(uint32) uint32*singleflight.Result*func(int) *abi.Type*abi.IntArgRegBitmapruntime/internal/sysinternal/chacha8rand*pflag.intSliceValue*pflag.durationValue*pflag.bytesHexValue*pflag.ErrorHandling*func(*flag.FlagSet)ParseErrorsWhitelist*template.writeError*[]template.variableIgnoreUntaggedFieldsgo.uber.org/multierr*multierr.multiError*binary.littleEndian*unix.SockaddrL2TPIP*unix.SockaddrRFCOMM*unix.RawSockaddrXDP*unix.TIPCSocketAddr*unix.RawSockaddrCAN*unix.RawSockaddrNFC*unix.RawSockaddrAnyBuildAutoRouteRangesDefaultInterfaceName*[8][]tun.tcpGROItem*func() *udpnat.conn*func(uintptr) error*func() *net.TCPAddr*func() *net.UDPAddr*metadata.SerializerInitializeReadWaiter*[]acl.geositeDomain*func() bbr.ackPoint*protocol.UDPMessage*quic.receivedPacketSetCongestionControlHandshakeIdleTimeout*func() *quic.Config*quic.receiveStreamIactiveSequenceNumberSetHandshakeCompleteGenerateConnectionIDGetPostHandshakeData*[]*wire.CryptoFrame*[]protocol.StreamID*[8]quic.sendStreamI*quic.unpackedPacketIsPathMTUProbePacketMaybePackProbePacketPackApplicationCloseundecryptablePacketsidleTimeoutStartTimelogShortHeaderPacket*quic.sealingManager*quic.ackFrameSourcemaybeGetCryptoPacket*quic.packetUnpacker OOBCapablePacketConncanBufferStreamFrame*[]*wire.StreamFramenumOutstandingFramesstatelessResetHasherqueueStreamIDBlocked*quic.rejectedPackethasNegotiatedVersioncleanupZeroRTTQueuescloseForShutdownx]updateSendWindowx]*[1]ackhandler.Frame*http3.requestWriter*http3.requestStream*func() http3.Stream*http3.RequestStream*http3.streamClearergenerateAltSvcHeadersetupListenerForConn*http3.settingsFrame*[1]protocol.Version*[]qpack.HeaderField*func(*list.Element)*mlkem768.nttElement*textproto.dotReader*[]map[string]stringGotFirstResponseByte*hpack.DecodingError*hpack.pairNameValueparseHeaderFieldReprchunkHeaderAvailable*httpproxy.cidrMatch*[]httpproxy.matcher*[]*acmez.authzState*ocsp.ResponseStatus*ocsp.singleResponsegithub.com/miekg/dns*func() *dns.CDNSKEY*func(uint8) *dns.DSAddress dns:"uint48"getTimeoutForRequestFindAllSubmatchIndex*func([]uint8) []intReplaceAllStringFunc*govultr.ListOptions*govultr.ApplicationVendor json:"vendor"Region json:"region"Family json:"family"Amount json:"amount"*govultr.InvoiceItemPublic json:"public"*govultr.PGExtensionMemory json:"memory"Period json:"period"CreateConnectionPoolDeleteConnectionPoolGetBackupInformationUpdateConnectionPoolSubnet json:"subnet"Action json:"action"Source json:"source"*[]govultr.ReverseIPAttachPrivateNetworkDetachPrivateNetwork*[]govultr.PublicISO*govultr.NodePoolReqLabels json:"labels"**govultr.KubeConfig*govultr.HealthCheck*govultr.GenericInfoCreateForwardingRuleDeleteForwardingRuleDeploy json:"deploy"*govultr.PlanService*govultr.SnapshotReqScript json:"script"*govultr.UserService*govultr.VPC2Service*govultr.RequestBody*govultr.accountBaseBackup json:"backup"*govultr.backupsBaseBlocks json:"blocks" DatabaseDB json:"db"Domain json:"domain"*govultr.domainsBase*govultr.invoiceBase*govultr.lbRulesBase*govultr.networkBase**govultr.regionBase*govultr.sshKeysBase*govultr.upgradeBase*govultr.vpcInfoBasecachedLookExtensions*chan exec.ctxResult*[]*nistec.P521Point*[]*nistec.P224Point*[]*nistec.P256Point*[]*nistec.P384PointmaybeSubtractModulus*unsafeheader.String*concurrent.hashFunc*[8]template.elementnTrailingNonStartersNextBoundaryInString*[32]norm.Properties*[]*ast.CommentGroup*ini.ErrEmptyKeyName*map[string]*ini.Key*properties.Encoding*properties.itemType*[8]map[string][]inthandleArrayTableParthandleRootExpressionunmarshalInlineTable*yaml.yaml_comment_t*[]yaml.yaml_token_ttag_directives_start*yaml.yaml_emitter_t*[]yaml.yaml_event_t*map[*yaml.Node]bool*[8]*yaml.structInfo*yaml.resolveMapItem*netlink.Destination*netlink.MacvlanModeAdActorOperPortState*netlink.GenericLink*netlink.NextHopFlag*netlink.NexthopInfo*[8]netlink.BondMode*[]netlink.IPoIBMode*[8]*nl.SocketHandle*common.WithUpstreamwriterDescriptorc^prefixFrom128AndBits*[]protoreflect.KindunmarshalMessageSlow*protoreflect.MapKey*protoreflect.SyntaxappendMessageOptionsappendServiceOptionsappendSourceCodeInfo*[2]protowire.Number*[8]protowire.Number*bbr.extraAckedEvent*bbr.recentAckPointsEndOfAppLimitedPhaseonPacketAcknowledgedendOfAppLimitedPhaseupdateGainCyclePhasenumLossEventsInRoundcongestionWindowGainbandwidthAtLastRoundisAppLimitedRecovery*brutal.BrutalSender*protocol.PacketType*protocol.StreamType*utils.defaultLogger*logging.ShortHeaderSentLongHeaderPacket*logging.CryptoFrame*logging.StreamFrame*qerr.TransportError*wire.ExtendedHeaderreadPreferredAddressMaxDatagramFrameSize*func() protocol.ECN*ackhandler.ecnState*ackhandler.intervalhasNewMissingPackets*ackhandler.SendModepeerAddressValidatedgetCongestionControlgetPacketNumberSpacemaxReceiveWindowSize*handshake.EventKindnextRcvTrafficSecretgetNextTrafficSecretRetrySrcConnectionID*ipv4.ControlMessage*func(ipv4.ICMPType)*ipv4.groupSourceReqSetMulticastLoopback*ipv4.payloadHandler*ipv6.ControlMessage*slog.HandlerOptions*slog.defaultHandler*func() slog.Handler*qpack.decodingError*objx.MSIConvertablemime/quotedprintable*flate.InternalError*[]flate.literalNode*crc32.slicing8Table*[]syntax.printFlags*[8]syntax.charGroupparsePerlClassEscape*internal.ContextKey*eddilithium3.scheme*hpke.shortKEMPubKey*tracker.SeenTracker*map[gob.typeId]bool*pragma.DoNotCompare*protoregistry.FilesFindDescriptorByName*protoregistry.Types*filedesc.Extensions*filedesc.stringName*filedesc.EnumValues*[]protoreflect.Name*filedesc.EnumRangesunmarshalSeedOptions*[]*filedesc.Message*[8]*filedesc.Method*func() filedesc.Out*[]*filedesc.Service*[8]filedesc.pathKey*filedesc.fieldRange*[8]filedesc.Edition*impl.ExtensionField*impl.marshalOptions*impl.validationInfo*impl.validationType*func() impl.pointer*impl.coderFieldInfoinitOneofFieldCodersmarshalAppendPointer EnumValueDescriptors*impl.legacyEnumType*impl.int32Converter*impl.int64Converter*impl.bytesConverter*impl.errInvalidUTF8OnApplicationLimitedlastSentPacketNumbergolang.org/x/net/bpf*kyber1024.PublicKey*kyber512.PrivateKey*kyber768.PrivateKey*ed448.SignerOptions*eddilithium2.scheme*internal.PrivateKey*func() mlsbset.EltP*func() mlsbset.EltGbarrettReduceGeneric*func(string, string)*cmd.clientConfigObfs*cmd.clientConfigQUIC*cmd.serverConfigObfs*cmd.serverConfigACME*cmd.serverConfigQUIC*cmd.serverConfigAuth*utils.Atomic[string]EABKIDjson:"eab_kid"*[]*sync.poolChainElt*map[x509.sum224]bool*map[string]struct {}*cmd.clientModeRunnerBasicConstraintsValidIssuingCertificateURLCRLDistributionPoints*x509.potentialParentAddCertWithConstraintprivateKeyToPublicKey*x509.pkcs1PrivateKey*x509.pkcs10Attribute*func() *bisect.dedup*func(*godebug.value)*[1]*x509.Certificate*hex.InvalidByteError*func() (bool, error)*func() time.Duration*func(int, int) error*netip.parseAddrError*func(netip.Addr) int*func(*os.file) error*[]runtime.modulehash*runtime.ancestorInfo*runtime.gsignalStackallocCountBeforeCacheupdateMinWhenModified*runtime.limiterEventgcMarkWorkerStartTime*runtime.mLockProfile*[2]*runtime.traceBuf*runtime.pcvalueCache*runtime.heldLockInfo*runtime.metricReaderaccumulateGCPauseTime*func(unsafe.Pointer)*runtime.piController*[8]runtime._typePair*[]runtime.metricData*func() *abi.FuncType*strings.stringWriter*strings.stringFinder*strings.byteReplacer*syscall.SockaddrUnix*syscall.SysProcIDMap*func(time.Time) bool*func() (string, int)*cobra.PositionalArgsDisableFlagsInUseLine*func(*cobra.Command)GenBashCompletionFileGenFishCompletionFile*func([]string) errorSetHelpCommandGroupIDValidateRequiredFlags*[]*template.Template*viper.StringReplacer*func(fsnotify.Event)*func(string) float64SetTypeByDefaultValue*func() zapcore.Level*forwarding.TCPTunnel*forwarding.UDPTunnel*proxymux.subListener*proxymux.muxListener*redirect.TCPRedirect*list.List[func(int)]*url.InvalidHostError*utils.UpdateResponseVerifyPeerCertificate*client.HandshakeInfo*func(*http.response)*zapcore.CheckedEntry*zapcore.ArrayEncoder*func(string, uint16)*func(string, uint32)*func(string, uint64)*zapcore.LevelEncoder*zapcore.LevelEnabler*zapcore.errArrayElem*context.afterFuncCtxautoSessionTicketKeys*tls.cipherSuiteTLS13clientFinishedIsFirstmarshalWithoutBinders*tls.handshakeMessageclientSessionCacheKeyconnectionStateLockedquicHandshakeCompletequicRejectedEarlyDatahasSignatureAlgorithm*tls.constantTimeHash*func() *interface {}*func(*sync.readOnly)*map[tls.alert]string*func() *hpke.hkdfKDF*func() tls.QUICEvent*[12]*tls.CipherSuite*[13]*tls.CipherSuite*map[reflect.Type]intdisallowUnknownFields*json.condAddrEncoderDisallowUnknownFieldstokenPrepareForDecode*http.http2serverConn*func(uint32) []uint8*http.http2frameCachestartGracefulShutdownsendExpectationFailedshouldReuseConnection*[8]*http.http2streamneedToSendSettingsAckpeerMaxHeaderListSizewriteFrameFromHandler*http.http2pipeBuffercloseWithErrorAndCodeprocessTrailerHeaders*chan http.readResult*[8]*http.routingNode*http.routingIndexKeyshouldRedirectRLocked*http.redirectHandler*http.http2writeQueue*http.http2ClientConnmaxHeaderResponseSize*[]http.wantConnQueue*[8]*http.persistConnResponseHeaderTimeoutExpectContinueTimeoutGetProxyConnectHeaderalternateRoundTripperuseRegisteredProtocolexpectContinueTimeoutabortRequestBodyWriteencodeAndWriteHeadersframeScratchBufferLenresponseHeaderTimeout*http.http2dataBuffer*http.http2gzipReader*http.cancelTimerBody*http.initALPNRequest*http.socksAuthMethod*[8]http.http2ErrCode*[8]http.RoundTripper*[5]http.http2SettinghandleUpgradeResponse*certmagic.ACMEIssuer*certmagic.OCSPConfigDNS01KeyAuthorization*certmagic.acmeClientstorageKeyUsersPrefix*certmagic.ErrNoRetrychallengeTokensPrefix*certmagic.httpSolver*certmagic.solverInfo*certmagic.PreChecker*certmagic.ocspUpdate*[8]*certmagic.Config*[8]certmagic.KeyInfo*[8]certmagic.Storage*certmagic.jobManager*[]certmagic.namedJob*[]*cloudflare.cfZone*[8]gandi.gandiDomain*[]godaddy.PostRecord*func() libdns.RecordMACKeyjson:"mac_key"*acme.cachedDirectory*server.TrafficLogger*func(uint32, string)*server.AuthenticatorIgnoreClientBandwidth*func([]uint8) string*auth.httpAuthRequest*outbounds.cachedConn*outbounds.dialResult*errors.ProtocolError*crypto.DecrypterOpts*boring.PublicKeyECDH*asn1.StructuralError*asn1.fieldParameters*func(int64) *big.Int*elliptic.unmarshaler*elliptic.CurveParams*pkix.CertificateList*io.nopCloserWriterTo*func() reflect.Value*reflect.makeFuncImpl*reflect.makeFuncCtxt*func(int) (int, int)*dnsmessage.AResource*[]dnsmessage.section*func() go.shape.boolinternal/singleflight*[]*singleflight.callCompareAndSwapRelease*atomic.UnsafePointer*pflag.uintSliceValue*pflag.boolSliceValue*pflag.NormalizedName*func(*pflag.FlagSet)parseTemplateName Q*[1]template.variable*mapstructure.Decoder*javaproperties.Codec*func([]uint8) uint16*func([]uint8) uint32*func([]uint8) uint64golang.org/x/sys/unix*unix.SockaddrNetlink*unix.RawSockaddrUnix*unix.SockaddrL2TPIP6*unix.TIPCServiceName*unix.RawSockaddrTIPC*unix.RawSockaddrIUCV*unix.SockaddrNFCLLCP*ranges.Range[uint32]DefaultInterfaceIndex*func(netip.AddrPort)*buf.defaultAllocator*network.PacketWriter*acl.CompilationError*func() []*v2geo.CIDR*func() *bbr.ackPoint*func() bbr.Bandwidth*quic.ClientHelloInfo*quic.ConnectionStateMaxIncomingUniStreamsHandleMaxStreamsFrame*quic.connIDGenerator*[]protocol.ByteCount*[]utils.ByteInterval*[8]protocol.StreamID*quic.coalescedPacketSetHandshakeConfirmed*chan quic.closeError*quic.connectionTimerreceivedPacketHandlerhandshakeCompleteChanhandleHandshakeEventshandleMaxStreamsFramesendPacketsWithoutGSOmaybeGetAppDataPacket*quic.headerDecryptor*[]protocol.StreamNum*[]*quic.packetBufferhandleStreamFrameImpl*quic.uniStreamSenderonStreamCompletedImpl*chan quic.queueEntry*quic.connMultiplexer*[]quic.indexableConn*quic.closedLocalConn*[]quic.packetHandler*quic.errServerClosedmaybeSendBlockedFramemaxIncomingUniStreams*quic.EarlyConnection**qerr.TransportError*[]*quic.zeroRTTQueuemaybeSendInvalidTokensendConnectionRefusedConnectionIDGeneratorreadingNonQUICPacketshandleStreamFramex]*[]*http3.datagrammerEnableExtendedConnectbytesRemainingInFrameviolatedContentLength*http3.responseWriter*http3.hijackableBody*[]http3.listenerInfo*func() *list.Element*rand.hideAgainReader*sha3.spongeDirection*multipart.partReader*multipart.FileHeader*multipart.writerOnly*textproto.MIMEHeader*[8]map[string]string*[1]httpproxy.matcher*acmez.challengeTypeslistOfferedChallengesenabledChallengeTypesgolang.org/x/net/idna TypeBitMap dns:"nsec"Mbdns:"cdomain-name"Mddns:"cdomain-name"Mfdns:"cdomain-name"Mgdns:"cdomain-name"Mrdns:"cdomain-name"Mxdns:"cdomain-name"Nsdns:"cdomain-name"Ptrdns:"domain-name"Txtdns:"domain-name" Certificate dns:"hex" FingerPrint dns:"hex"*func(*dns.Msg) error*[]regexp.onePassInstFindAllStringSubmatchgithub.com/pkg/errors*oauth2.RetrieveErrorMainIPjson:"main_ip"SizeGBjson:"size_gb"*govultr.BlockStorage*govultr.DatabaseUser*[]govultr.DatabaseDB*govultr.DatabasePlanListAvailableVersionsUpdateAdvancedOptions*govultr.DomainRecordIPTypejson:"ip_type"*govultr.FirewallRule*govultr.ReinstallReq*govultr.LoadBalancer*[]govultr.ReservedIPSSHKeyjson:"ssh_key"*govultr.databaseBase*govultr.instanceBase*govultr.invoicesBase*govultr.lbFWRuleBase**govultr.lbRulesBase*govultr.networksBase*govultr.snapshotBase*govultr.userDataBase*govultr.vpc2InfoBase*exec.goroutineStatusSetServerCertificates*func() tls.ticketKey*func() tls.TicketKeyLabeljson:"identity"*map[uint]sign.Scheme*[56]nistec.p224Table*[64]nistec.p256Table*[96]nistec.p384Table*[96]fiat.P224ElementcarryPropagateGeneric*func() bigmod.choiceinternal/unsafeheader*concurrent.equalFunc*[]*parse.CommandNode*parse.IdentifierNodeskipContinuationBytesFirstBoundaryInString*[8]*ast.CommentGroup*ini.sourceReadCloserChildSectionDelimiter*chan properties.itemMustGetParsedDuration*yaml.yaml_encoding_t*yaml.yaml_document_tstream_start_producedsingle_quoted_allowed*netlink.BondLacpRate*netlink.BondAdSelect*netlink.VlanProtocol*netlink.RuleUIDRange*[8]netlink.IPoIBMode*[]netlink.TuntapMode*netipx.stacktraceErrFindExtensionByNumber*[8]protoreflect.Kind*proto.MarshalOptions*protoreflect.MessageappendDescriptorProtoExtensionRangeOptionsSetFilterWindowLengthaggregationEpochBytes*bbr.bandwidthSamplerRemoveObsoletePacketsoverestimateAvoidance*bbr.bbrRecoveryStatehasNoAppLimitedSamplelastAckPrintTimestamp*protocol.Perspective*protocol.KeyPhaseBit*func(utils.LogLevel)SentShortHeaderPacket*qerr.StreamErrorCodenumEncodableAckRanges*wire.MaxStreamsFrame*congestion.ByteCount*[]*ackhandler.packet*func() wire.AckRangereceivedPacketTrackerHasOutstandingPacketshasOutstandingPacketssetLossDetectionTimer*ackhandler.ccAdapterUpdateHighestReceivedmaybeAdjustWindowSizenumRcvdWithCurrentKeynumSentWithCurrentKeynextSendTrafficSecrethandshakeCompleteTimegolang.org/x/exp/randgolang.org/x/net/ipv4*[]bpf.RawInstructiongetMulticastInterfacesetMulticastInterfaceSetMulticastInterfacegolang.org/x/net/ipv6*func(slog.Attr) bool*qpack.indexAndValues*flate.huffmanDecoder*flate.huffmanEncoderassignEncodingAndSize*[8]syntax.printFlags*[]internal.AuthStyle*retryablehttp.Client*retryablehttp.Logger*func() kem.PublicKeyEncapsulationSeedSize*hpke.shortKEMPrivKey*hpke.hybridKEMPubKey*func(token.Pos) bool*unstable.ParserError*func(*gob.encEngine)*protoiface.MessageV1checkGenProtoConflict*[]order.messageField*[]filedesc.Extension*filedesc.ExtensionL2*[]filedesc.EnumValue*filedesc.EnumValueL1*[8]protoreflect.Name*filedesc.OneofFields*filedesc.FieldRanges*[8]*filedesc.Message*[8]*filedesc.Service*filedesc.FileImportsresolveEnumDependency*filedesc.ExtensionL1*impl.valueCoderFuncs*impl.unmarshalOutputoneofWrappersByNumbermakeUnknownFieldsFunc*impl.aberrantMessage*impl.uint32Converter*impl.uint64Converter*impl.stringConverter*impl.legacyMarshaler*congestion.BandwidthOnConnectionMigrationmaybeTraceStateChange*kyber1024.PrivateKeyNormalizeAssumingLe2Q*func(*internal.VecK)*goldilocks.groupMLSB*func([]uint8, uint8)*cmd.tcpRedirectLogger*func(net.Addr, error)URLmapstructure:"url"UDPmapstructure:"udp"SNImapstructure:"sni"*cmd.tcpRedirectConfigMTUmapstructure:"mtu"TLSmapstructure:"tls"TUNmapstructure:"tun"Keymapstructure:"key"Dirmapstructure:"dir"DNSmapstructure:"dns"TCPmapstructure:"tcp"*cmd.serverConfigSniffACLmapstructure:"acl"Successjson:"success"*func(*string) *string*[0]*sync.poolChainElt*[]*server.StreamStats*map.bucket[string]int*[][]*x509.Certificate*func([]uint8) []uint8ExcludedEmailAddresses*func() *x509.CertPool*x509.SystemRootsError*x509.basicConstraints*func() *godebug.value*func() (uint8, error)*func() netip.AddrPort*func(time.Time) error*func(string) []string*map.bucket[int]string*[]net.hostLookupOrder*map[string]net.byName*func() (string, bool)*func(dnsmessage.Type)*func(netip.Addr) bool*go.shape.interface {}*os.fileWithoutWriteTo*func(os.Signal) errorhandleTransientAcquirehandleTransientRelease*func(*runtime._defer)*runtime.PanicNilError*runtime.mSpanStateBox*func(uintptr) uintptrisUnusedUserArenaChunkspecialFindSplicePointwriteUserArenaHeapBits*runtime.stackfreelist*[256]runtime.guintptr*func() unsafe.Pointer*runtime.statAggregate*[]*runtime.moduledata*[8]runtime.metricData*func() *abi.ArrayType*syscall.SockaddrInet4*syscall.SockaddrInet6*func() syscall.Signal*func() (int64, int64)*func() *time.Location*func() (uint64, bool)github.com/spf13/cobraBashCompletionFunction*func(...*cobra.Group)*func() *pflag.FlagSet*func(io.Writer) errorGenZshCompletionNoDesc*func() []*cobra.GroupHasAvailableLocalFlagsInitDefaultVersionFlag*func() *cobra.Command*func(...interface {})*func(context.Context)*[8]*template.Templategithub.com/spf13/viper*func(io.Reader) errorHookjson:"-" yaml:"-"*forwarding.atomicTimegetAndClearAcceptError*tproxy.TCPEventLogger*tproxy.UDPEventLoggerMaxStreamReceiveWindow*client.udpConnFactory*[]protocol.UDPMessage*func() *http.response*zapcore.writerWrapper*zapcore.ObjectEncoder*func(string, []uint8)*func(string, float32)*func(string, float64)*func(string, uintptr)*[4096]zapcore.counter*zapcore.SamplerOption*zapcore.EncoderConfig*zapcore.CallerEncoder*context.backgroundCtx*[]tls.SignatureSchemeSessionTicketsDisabledBuildNameToCertificate*tls.RecordHeaderErrorhandleNewSessionTicketmaxPayloadSizeForWriteprocessCertsFromClientquicReadHandshakeBytescertificateAuthoritiesdiscardHandshakeBuffer*tls.ECHRejectionErrorUnverifiedCertificates*tls.endOfEarlyDataMsg*tls.ecdheKeyAgreement*func() *sync.readOnly*func(*tls.activeCert)SetTransportParameters*func() (int64, error)*map[reflect.Type]bool*http.http2chunkWriter*http.http2writeFramer*http.http2FrameHeader*func() []*http.CookiecomparePathsAndMethodsclosedRequestBodyEarlymaxQueuedControlFrames*http.http2bodyReadMsg*http.http2streamState*http.http2GoAwayFrame*http.http2StreamErrorprocessFrameFromReader*http.http2closeWaiter*http.readTrackingBody*http.bufioFlushWriter*http.connectMethodKey*http.transportRequest*http.responseAndErrorreadLoopPeekFailLocked*[][]*http.persistConn*chan http.connOrError*[8]http.wantConnQueueOnProxyConnectResponseMaxResponseHeaderBytesprepareTransportCancelstartDialConnForLockedpeerMaxHeaderTableSizedecrStreamReservations*http.http2missingBody*http.http2GoAwayError*[]*http.http2dialCall*http.http2addConnCall*http.http2requestBody*http.http2writeGoAway*http.http2frameParser*http.requestTooLarger*[]http.http2FrameType*[]http.http2SettingID*httputil.ProxyRequest*httputil.ReverseProxy*certmagic.FileStorage*certmagic.Certificate PrivateKeyPEMjson:"-"getCertDuringHandshakegetNameFromClientHelloloadManagedCertificatemostRecentAccountEmailstorageKeyIssuerPrefix*[]certmagic.Challenge*certmagic.DNS01SolverdeleteDNSPresentMemoryIDjson:"id,omitempty"Accountjson:"account"*[8]*cloudflare.cfZone*cloudflare.cfResponseMessagejson:"message"*[1]godaddy.PostRecord*namedotcom.nameClient*namedotcom.nameDotCom*acme.keyChangeRequestPayloadjson:"payload"*server.udpEventLogger*server.defaultUDPConn*auth.httpAuthResponse*outbounds.ResolveInfo*outbounds.dohResolverStreamsjson:"streams"crypto/internal/boring*boring.PrivateKeyECDH*asn1.bitStringEncoder*asn1.ObjectIdentifier*func(uint64) *big.Int*rsa.PrecomputedValues*godebug.runtimeStderr*cryptobyte.BuildErrorAddASN1GeneralizedTimeAddUint8LengthPrefixed*func(complex128) bool*[]reflect.StructField*[]*reflect.structType*[]*unicode.RangeTable*[8]dnsmessage.section*func(bool, bool) bool*poll.splicePipeFields*[8]*singleflight.callgithub.com/spf13/pflag*pflag.int64SliceValue*pflag.int32SliceValue*map[uint8]*pflag.Flag*[]*parse.VariableNode*mapstructure.Metadatagithub.com/spf13/afero*map[string]*flag.Flag*func() *buffer.Buffergo.uber.org/zap/buffer*func([]uint8, uint16)*func([]uint8, uint32)*func([]uint8, uint64)*unix.RawSockaddrInet4*unix.RawSockaddrInet6*unix.RawSockaddrPPPoX*unix.TIPCServiceRange*unix.SockaddrCANJ1939*acl.geositeDomainType*func() []*v2geo.GeoIPnumberOfPresentEntriesNumberOfPresentEntrieslastAckedPacketAckTime*quic.connCapabilitieshandleResetStreamFramehandleStopSendingFrameGetOrOpenReceiveStreampacketsSinceLastChangepacketsPerConnectionIDaddStatelessResetTokenSetStatelessResetTokengetStatelessResetToken*quic.frameSorterEntry*[8]protocol.ByteCount*quic.longHeaderPacket*[]quic.receivedPacket*[]*wire.DatagramFramemaxPayloadSizeEstimatelastPacketReceivedTimehandleLongHeaderPacketmaybeSendAckOnlyPacketnumNonAckElicitingAcksappendLongHeaderPacketlongHeaderPacketLengthunpackLongHeaderPacket*[8]*quic.packetBuffermaybeGetRetransmissionqueuedResetStreamFramereceiveStreamCompleted*[8]quic.indexableConn*quic.closedRemoteConnGetStatelessResetToken*quic.packetHandlerMap*[8]quic.packetHandler*[3]protocol.ByteCount*quic.headerParseError*[8]protocol.StreamNummaxIncomingBidiStreamsgetOrOpenReceiveStream*chan quic.closePacket*[8]*quic.zeroRTTQueueconnectionRefusedQueue*[1]protocol.StreamNum*[2]protocol.StreamNum*[8]*http3.datagrammerremainingContentLengthmaxResponseHeaderBytes*http3.cancelingReader*[8]http3.listenerInfo*mlkem768.fieldElement*[]mlkem768.nttElement*func() sha3.ShakeHashReadContinuedLineBytesreadContinuedLineSlice*httptrace.ClientTrace*httptrace.GotConnInfo*httptrace.DNSDoneInfo*[]hpack.pairNameValueSetMaxDynamicTableSize*httpproxy.domainMatchgithub.com/mholt/acmezprovisionDirectory+y*[]ocsp.singleResponse*func() *dns.RR_Header PublicKey dns:"base64"Fqdndns:"domain-name"Ptrdns:"cdomain-name"Mboxdns:"domain-name" Signature dns:"base64"Hostdns:"domain-name"*func(string) *dns.Msg*dns.SVCBNoDefaultAlpn*map[uint8]crypto.Hash*func() *regexp.Regexp*regexp.onePassMachine*oauth2.AuthCodeOption*oauth2.tokenRefresherBalancejson:"balance"*[]govultr.Application*govultr.BackupService*govultr.AttachVPC2ReqOSjson:"os,omitempty"IPjson:"ip,omitempty"*[]govultr.InvoiceItemProductjson:"product"Allowedjson:"allowed"Countryjson:"country"Airportjson:"airport"Billingjson:"billing"Storagejson:"storage"Premiumjson:"premium"*[]govultr.PGExtension*govultr.DatabaseUsage*govultr.DBListOptionsPGjson:"pg,omitempty"*govultr.DatabaseAlertListMaintenanceUpdates*govultr.DomainService*govultr.FirewallGroupReversejson:"reverse"*[]govultr.NodePoolReqVersionjson:"version"DeleteNodePoolInstance*govultr.ObjectStorage*govultr.BareMetalPlan*govultr.RegionServiceOptionsjson:"options"*govultr.ReservedIPReq*govultr.SSHKeyService*govultr.StartupScriptBackupsjson:"backups"*govultr.bareMetalBaseRegionsjson:"regions" DatabaseDBs json:"dbs"*govultr.databasesBaseDomainsjson:"domains"*govultr.instancesBase*govultr.isoStatusBase*govultr.lbFWRulesBaseNetworkjson:"network"*govultr.snapshotsBase*govultr.vpc2NodesBase*<-chan exec.ctxResult*chan<- exec.ctxResult*tls.ECHConfigContentsInsecureSkipTimeVerify*tls.PubClientHelloMsg*[132]nistec.p521Tablecrypto/internal/nisteccrypto/internal/bigmod*func() parse.NodeTypeAllowNonUniqueSectionsDeleteSectionWithIndex*properties.Properties*func(string, int) int**unstable.ParserError*map[reflect.Value]int*func() *unstable.NodeunmarshalLocalDateTime*[]yaml.yaml_comment_t*yaml.yaml_node_type_t*yaml.yaml_node_item_t*yaml.yaml_node_pair_t*map[interface {}]bool*map[string]*yaml.Node*[]yaml.resolveMapItem*exceptions.multiError*exceptions.causeError*exceptions.MultiError*netlink.LinkOperStateAdPartnerOperPortState*netlink.RouteProtocol*netlink.RulePortRange*[8]netlink.TuntapMode*func() []netip.Prefix*interface { Reset() }marshalMessageSetField*protoreflect.FullNameappendEnumValueOptions*protoreflect.EnumType*[]impl.ExtensionFieldhasNonAppLimitedSampleupdateRoundTripCounterlastSampleIsAppLimited*quicvarint.byteReader*protocol.PacketNumber*protocol.ConnectionIDUpdatedCongestionStateDroppedEncryptionLevel*logging.DatagramFrame*qerr.IdleTimeoutError*qerr.ApplicationError*wire.ResetStreamFrame*wire.DataBlockedFrame*wire.StopSendingFrame*wire.PreferredAddressDisableActiveMigration*ackhandler.ecnHandler*ackhandler.ecnTrackerIsPotentiallyDuplicate*[]ackhandler.interval*func() *wire.AckFrameOnLossDetectionTimeoutSentAckElicitingPacketisAmplificationLimited*handshake.CryptoSetup*handshake.cryptoSetup*handshake.cipherSuite*map[int]*ipv4.sockOpt*func(slog.Value) bool*func() slog.LogValuer*func() syntax.EmptyOp*func() *syntax.Regexp*[8]internal.AuthStyle ErrorCode json:"error"*retryablehttp.Backoff*retryablehttp.Request*pki.CertificateScheme*func() kem.AuthScheme*hpke.hybridKEMPrivKey*func(*ast.ObjectItem)*func() *gob.encEngine*nl.NetlinkRequestData*pragma.DoNotImplementNumExtensionsByMessage*filedesc.defaultValue*[]*filedesc.EnumValue*[][2]protowire.Number*filedesc.FieldNumbers*[]*filedesc.Extension*filetype.fileRegistry*impl.unmarshalOptions*func() []impl.pointer*impl.atomicNilMessage*impl.coderMessageInfo*impl.messageConverter*impl.listPtrConverter*impl.float32Converter*impl.float64Converter*socket.ControlMessage*socket.mmsghdrsPacker*ed25519.SignerOptions*goldilocks.twistPoint*func(net.Addr, string)*cmd.tcpForwardingEntry*cmd.udpForwardingEntry*atomic.Pointer[string]*[8]*server.StreamStatsRawSubjectPublicKeyInfoPermittedEmailAddresses*x509.distributionPoint*map.bucket[string]bool*[1][]*x509.Certificate*map.bucket[uint64]bool*func(fmt.State, int32)*func(*net.netFD) error*[8]net.hostLookupOrder*func() (string, error)*netip.parsePrefixError*os.fileWithoutReadFromhandlePersistentReleaseinternal/runtime/atomic*func() *runtime._defer*runtime.lockRankStructtypePointersOfUncheckedtraceSchedResourceState*runtime.traceBufHeader*[]runtime.heldLockInfo*[]runtime.ancestorInfo*runtime.heapStatsDelta*runtime.scavengerState*map[uint32][]*abi.Type*func() *abi.StructType*func(*strings.Builder)*syscall.NetlinkMessage*[]syscall.SysProcIDMap*func() (int, int, int)*func() context.ContextGenBashCompletionFileV2GenPowerShellCompletionGlobalNormalizationFuncHasAvailableSubCommandsLocalNonPersistentFlagsgenPowerShellCompletion*[]pflag.NormalizedNameAddSecureRemoteProviderGetStringMapStringSliceisPathShadowedInAutoEnvisPathShadowedInDeepMapisPathShadowedInFlatMap*viper.ConfigParseError*func(*zapcore.sampler)*sockopts.SocketOptions HasUpdate json:"update"getCertificateWithCacheDisablePathMTUDiscovery*client.BandwidthConfig*obfs.obfsPacketConnUDP*chan *udphop.udpPacketgo.uber.org/zap/zapcore*zapcore.CheckWriteHook*zapcore.ArrayMarshaler*func(...zapcore.Field)*func() zapcore.Encoder*zapcore.consoleEncoderaddSeparatorIfNecessary*zapcore.leveledEnabler*tls.ClientSessionCache*tls.ClientSessionStatequicTransportParametersselectedIdentityPresentverifyServerCertificatewriteChangeCipherRecord*tls.serverHelloDoneMsg*func([]uint8, []uint8)*func(tls.CurveID) bool*map.bucket[uint16]bool*[]func() *hpke.hkdfKDF*[1]tls.SignatureScheme*[3]tls.SignatureScheme*[4]tls.SignatureScheme*[7]tls.SignatureScheme*json.reflectWithString*map[string]*json.field*http.http2writeContext*http.http2HeadersFrame*http.http2incomparablenoteBodyReadFromHandlerwrite100ContinueHeadersshouldSendContentLength*[]http.routingIndexKey*chan http.writeRequest*[8][]*http.persistConn*func() *http.TransportconnectMethodForRequesthttp2transportTestHooks*http.http2RoundTripOpt*http.http2clientStreamcanTakeNewRequestLocked*[8]*http.http2dialCall*http.http2UnknownFrame*func() (uint32, error)*http.http2writePingAck*http.onceCloseListener*http.persistConnWriter*http.http2noBodyReader*[8]http.http2FrameType*[8]http.http2SettingID*[]http.socksAuthMethod*certmagic.KeyGenerator*certmagic.CacheOptions*certmagic.ConfigGetterAllMatchingCertificatesmakeCertificateWithOCSPCertificatePEMjson:"-"CacheManagedCertificategetCertificateFromCachegetTLSALPNChallengeCertmanagedCertNeedsRenewalrenewDynamicCertificatestorageHasCertResourcesDisableTLSALPNChallenge*[8]certmagic.Challenge*[]certmagic.ocspUpdate*cloudflare.cfDNSRecordPerPagejson:"per_page"github.com/libdns/gandigithub.com/libdns/vultr*[]govultr.DomainRecordDeactivateAuthorization*[]acme.cachedDirectory*server.BandwidthConfig*server.udpSessionEntry*server.defaultOutbound*auth.HTTPAuthenticator*outbounds.httpOutbound*outbounds.resolveError*outbounds.udpConnState*outbounds.lookupResultReqAddrjson:"req_addr"*func() utils.PortUnion*sync.poolLocalInternal*func([]uint8) *big.Int*func() *ecdh.PublicKeyAddASN1ObjectIdentifierAddUint16LengthPrefixedAddUint24LengthPrefixedAddUint32LengthPrefixed*cipher.gcmFieldElement*func() reflect.ChanDir*func(int) reflect.Type*func() []reflect.Value*func(*reflect.MapIter)*[8]*reflect.structType*map[reflect.visit]bool*[8]*unicode.RangeTable*reflectlite.ValueError*dnsmessage.nestedError*func(*poll.splicePipe)*pflag.stringToIntValue*pflag.stringSliceValue*pflag.stringArrayValue*pflag.flagValueWrapper*pflag.bytesBase64ValueMarkShorthandDeprecated*map[string]*parse.Tree*encoding.encodingError*func(func(*flag.Flag))*func(int) (int, error)*unix.SockaddrLinklayer*unix.RawSockaddrL2TPIP*unix.RawSockaddrRFCOMMDialOriginalDestination*[]ranges.Range[uint32]*[]*netlink.NexthopInfo*func(int, int) []uint8*map.bucket[uint8]uint8*acl.InvalidSyntaxError*v2geo.Domain_Attribute*func() []*v2geo.DomainlastAckedPacketSentTimecloseWithTransportErrorAddFromPreferredAddressinitialClientDestConnID*quic.shortHeaderPacketIsOnlyShortHeaderPacket*func() handshake.EventhandleHandshakeCompletehandleShortHeaderPacketonHasStreamControlFrameappendShortHeaderPacketshortHeaderPacketLengthunpackShortHeaderPacket*func(quic.closePacket)deleteRetiredConnsAfter*quic.connTracingCtxKey**quic.headerParseError**qerr.ApplicationError*quic.StatelessResetKeyversionNegotiationQueuemaybeSendStatelessReset*func() *http3.Settings*[]*protocol.UDPMessage*[1]protocol.UDPMessage*mlkem768.encryptionKey*[3]mlkem768.nttElement*[9]mlkem768.nttElement*mlkem768.decryptionKey*encoding.TextMarshalerisBoundaryDelimiterLineparseContentDisposition*httptrace.DNSStartInfo*func(string, []string)*[8]hpack.pairNameValue*hpack.headerFieldTable*internal.chunkedWriter*internal.chunkedReader*acmez.challengeHistorylistRemainingChallengesfillChallengeFields+yrememberFailedChallengepresentForNextChallengeNamedns:"cdomain-name"*func() (dns.lex, bool) TimeSigned dns:"uint48"Mboxdns:"cdomain-name"*dns.tsigSecretProvider*map[string]dns.Handler*map[dns.SVCBKey]string*map[string]dns.SVCBKeyExchangeWithConnContext*func(int) (int32, int)FindReaderSubmatchIndexFindStringSubmatchIndexReplaceAllLiteralString*govultr.AccountServiceTagurl:"tag,omitempty"ImageIDjson:"image_id"*govultr.BillingServiceEndDatejson:"end_date"MountIDjson:"mount_id"*[]govultr.BlockStorageBaseURLjson:"base_url"StartUpjson:"start_up"CreateDockerCredentialsPlanRAMjson:"plan_ram"*govultr.DatabaseBackup*[]govultr.DatabasePlan*govultr.MaxConnections*[]govultr.DatabaseUser*[]govultr.FirewallRule*govultr.BackupSchedule*govultr.PrivateNetworkRecycleNodePoolInstance*govultr.StickySessions*govultr.ForwardingRule*govultr.LBFirewallRule*[]govultr.LoadBalancer*govultr.NetworkService*govultr.SnapshotURLReqIPBlockjson:"ip_block"*govultr.bareMetalsBase*govultr.databaseDBBase**govultr.lbFWRulesBase*govultr.publicIsosBase*govultr.reservedIPBaseSSHKeysjson:"ssh_keys"*govultr.vkeClusterBase*exec.prefixSuffixSaverPeerApplicationSettingsQuicTransportParameters*func() *parse.ListNode*func() *parse.PipeNodeSkipUnrecognizableLinesPreserveSurroundedQuote*[]unstable.ParserError*func(*yaml.Node) error*yaml.yaml_event_type_t*yaml.yaml_error_type_t*yaml.yaml_token_type_t*yaml.yaml_simple_key_t*yaml.yaml_alias_data_t*[8]yaml.resolveMapItemcallObsoleteUnmarshaler*netlink.SEG6LocalEncap*netlink.LinkStatistics*netlink.BondSlaveState*netlink.vxlanPortRange*[]netlink.BondAdSelect*[]netlink.BondLacpRate*[]netlink.VlanProtocol*proto.UnmarshalOptionsLeadingDetachedComments*protoreflect.RawFields*[8]impl.ExtensionFieldNumAckAggregationEpochsnumAckAggregationEpochsOnRetransmissionTimeoutcalculateRecoveryWindowenterProbeBandwidthModemaybeExitStartupOrDraininitialCongestionWindowSentTransportParameters*wire.PathResponseFrameMarshalForSessionTicketInitialMaxStreamDataUniRetrySourceConnectionIDActiveConnectionIDLimit*ackhandler.StreamFrameincludedInBytesInFlightlargestObservedRcvdTimeGetLossDetectionTimeoutlowestNotConfirmedAckedremoveFromBytesInFlightstartNewAutoTuningEpochEnsureMinimumWindowSizeshouldQueueWindowUpdate*handshake.xorNonceAEADfirstRcvdWithCurrentKeyfirstSentWithCurrentKeyshouldInitiateKeyUpdategetDataForSessionTicketJoinSourceSpecificGroup*[]qpack.indexAndValuesparseIndexedHeaderFieldparseLiteralHeaderFieldreadRequiredInsertCount*quotedprintable.Reader*map[*syntax.Regexp]int*internal.RetrieveError*map[string]sign.Scheme*eddilithium3.PublicKey*func() *ast.ObjectList*map[*gob.typeInfo]bool*map[string]token.Token*[8]*filedesc.EnumValue*[8]*filedesc.Extension*[]*impl.coderFieldInfo*impl.pointerCoderFuncs*[8]reflect.StructFieldcheckInitializedPointermakeExtensionFieldsFunc*impl.legacyEnumWrapper*impl.legacyUnmarshaler*func(coding.Level) intlastMaxCongestionWindow*congestion.cubicSenderlargestSentPacketNumber*func() bpf.Instruction*eddilithium2.PublicKey*func(*[32]uint8, bool)*cmd.adaptiveConnFactoryModemapstructure:"mode"Addrmapstructure:"addr"Namemapstructure:"name"Typemapstructure:"type"HTTPmapstructure:"http"*func() netip.addrDetailDownmapstructure:"down"IPv4mapstructure:"ipv4"IPv6mapstructure:"ipv6"Authmapstructure:"auth"Obfsmapstructure:"obfs"QUICmapstructure:"quic"Lazymapstructure:"lazy"Certmapstructure:"cert"*cmd.serverConfigACMETLS*cmd.serverConfigACMEDNSFilemapstructure:"file"ACMEmapstructure:"acme"*utils.Atomic[time.Time]*map.bucket[string][]int*map[string]func() error*[]zapcore.EncoderConfig*func() ([]uint8, error)*x509.SignatureAlgorithm*x509.PublicKeyAlgorithm*[]asn1.ObjectIdentifier*func(*x509.Certificate)Idasn1:"optional,tag:0"*x509.certificateRequest*x509.CertificateRequestRawTBSCertificateRequest*func(interface {}) bool*func(string, bool) bool*net.UnknownNetworkError*func(net.IPMask) net.IP*func() <-chan struct {}*func(netip.Prefix) bool*func(string) netip.Addr*func(netip.Addr) string*func(fs.FileMode) error*func(*os.Process) error*runtime.boundsErrorCodesetUserArenaChunkToFault*[]runtime.stackfreelist*func(int64, int64) bool*runtime.persistentAlloc*runtime.pcvalueCacheEnt*map[string]interface {}*strings.genericReplacer*syscall.SockaddrNetlink*syscall.RawSockaddrUnix*cobra.CompletionOptionscompletionCommandGroupID*func(...*cobra.Command)*func() []*cobra.CommandInitDefaultCompletionCmd*[8]pflag.NormalizedName*forwarding.sessionEntry*[]*proxymux.muxListener*redirect.TCPEventLoggerInet4RouteExcludeAddressInet6RouteExcludeAddress*list.Element[func(int)]*func(*url.URL) *url.URL*map[string]*v2geo.GeoIP*udphop.udpHopPacketConn*udphop.InvalidPortError*zapcore.ObjectMarshaler*func(string, complex64)*func(string, time.Time)*[][4096]zapcore.counter*zapcore.DurationEncoder*func(time.Time, string)*context.CancelCauseFunc*tls.QUICEncryptionLevelPreferServerCipherSuites*tls.keySharePrivateKeys*tls.certificateMsgTLS13hashForClientCertificate*tls.newSessionTicketMsgprocessClientKeyExchangeprocessServerKeyExchange*func([]uint8) hash.Hash*func(tls.keyShare) bool*[8]func() *hpke.hkdfKDF*json.UnmarshalTypeError*func() (float64, error)*http.http2PriorityParam*[]*http.http2serverConn*func() <-chan time.TimeMaxUploadBufferPerStream*http.http2ServeConnOptsonceSetNextProtoDefaults*http.http2goroutineLock*http.http2PriorityFrame*http.http2SettingsFrame*http.unsupportedTEError*[8]http.routingIndexKey*[]*http.http2writeQueue*[]http.connectMethodKey*[]*http.http2ClientConn*http.http2writeSettingsIsHTTP2NoCachedConnError*http.erringRoundTripper*http.http2serverMessage*[]*multipart.FileHeader*func(func(string) bool)*[]http.http2frameParser*http.ResponseController*[2]http.socksAuthMethod*func(hpack.HeaderField)*[]certmagic.CertificateRenewManagedCertificatesunsyncedCacheCertificatereloadManagedCertificatenewACMEClientWithAccountstorageKeyUserPrivateKey*certmagic.tlsALPNSolver*certmagic.solverWrapper*certmagic.soaCacheEntry*[]*certmagic.solverInfo*[8]certmagic.ocspUpdate*map[string]acmez.SolverTTLjson:"ttl,omitempty"Currencyjson:"currency"*cloudflare.cfResultInfoNewNoncejson:"newNonce"NewOrderjson:"newOrder"Finalizejson:"finalize"*[8]acme.cachedDirectory*func(bool, string) bool**server.udpSessionEntry*outbounds.socks5UDPConn*outbounds.OutboundEntry*func() crypto.PublicKeyprobablyPrimeMillerRabin*func(*big.Int) *big.Int*map[crypto.Hash][]uint8Criticalasn1:"optional"*func(*pkix.RDNSequence)*func() pkix.RDNSequence*pkix.TBSCertificateList*pkix.RevokedCertificate*func(reflect.Type) bool*iter.Seq[reflect.Value]*func(int) reflect.Value*func() *reflect.MapIter*func() reflectlite.Type*dnsmessage.AAAAResource*func(int32, int32) bool*map.bucket[string]int64*pflag.float64SliceValue*pflag.float32SliceValue*func(func(*pflag.Flag))*template.missingValType*func(int, string) error*func(string) *flag.Flag*func() *base64.Encoding*unix.RawSockaddrNetlink*unix.RawSockaddrL2TPIP6*unix.RawSockaddrNFCLLCP*socks5.NegotiationReply*control.InterfaceFinder*network.ReadWaitOptions*func(acl.HostInfo) bool*func() ([]uint8, []int)*func() []*v2geo.GeoSite*map.bucket[int32]string*map.bucket[string]int32*func(int) *bbr.ackPoint*[]protocol.ConnectionID*[]quic.frameSorterEntry*func(protocol.StreamID)streamsWithControlFrames*func() protocol.VersionapplyTransportParameterscheckTransportParametershandleHandshakeConfirmedhandleHandshakeDoneFramehandleMaxStreamDataFramehandlePathChallengeFrame*http3.QUICEarlyListener*func() http3.Connection*func(http.Header) error*func(qpack.HeaderField)crypto/internal/mlkem768*[]mlkem768.fieldElement*textproto.ProtocolError*hpack.InvalidIndexErrorcountAvailableChallengesinitiateCurrentChallengegolang.org/x/crypto/ocsp Certificate dns:"base64"Targetdns:"domain-name"*func() dns.SVCBKeyValueRmaildns:"cdomain-name"Emaildns:"cdomain-name"Map822dns:"domain-name"*func(*dns.Msg) *dns.Msg*dns.EDNS0_TCP_KEEPALIVE*map.bucket[string]uint8*map.bucket[uint8]stringgithub.com/libdns/libdns*func([]uint8) [][]uint8*oauth2.reuseTokenSource*[]oauth2.AuthCodeOptionPasswordCredentialsToken*govultr.BareMetalCreateTagjson:"tag,omitempty"*govultr.BareMetalServerFeaturesjson:"features"*govultr.BareMetalUpdateUserNamejson:"username"Passwordjson:"password"Metadatajson:"metadata"Businessjson:"business"*govultr.DatabaseServiceDatabasejson:"database"Usernamejson:"username"*govultr.DatabaseUserACL*govultr.DatabaseForkReq*govultr.DatabaseBackupsJitjson:"jit,omitempty"*govultr.AvailableOption*[]govultr.DatabaseAlert*govultr.DomainRecordReq*[]govultr.FirewallGroup*govultr.FirewallRuleReqProtocoljson:"protocol"*govultr.InstanceServiceHostnamejson:"hostname"Dowjson:"dow,omitempty"Domjson:"dom,omitempty"FileNamejson:"filename"Endpointjson:"endpoint"Versionsjson:"versions"*govultr.LoadBalancerReqSSLjson:"ssl,omitempty"VPCjson:"vpc,omitempty"Requiredjson:"required"Locationjson:"location"*[]govultr.ObjectStorage*[]govultr.BareMetalPlan*govultr.SnapshotService*[]govultr.StartupScript*govultr.applicationBasePlansjson:"plans_metal"*govultr.databaseDBsBase*govultr.databaseMessage DatabaseUser json:"user"Instancejson:"instance"Networksjson:"networks"Clustersjson:"clusters"*govultr.reservedIPsBaseSnapshotjson:"snapshot"Upgradesjson:"upgrades"**govultr.vkeClusterBase*govultr.vkeClustersBase*govultr.vkeNodePoolBasemontgomeryRepresentation*map.bucket[uint32]int32github.com/hashicorp/hclSpaceBeforeInlineCommentKeyValueDelimiterOnWrite*func(string, uint) uint*toml.StrictMissingError*[]yaml.yaml_node_item_t*[]yaml.yaml_node_pair_t*netlink.MPLSDestination*netlink.BondArpValidate*netlink.BondFailOverMac*[8]netlink.BondAdSelect*[8]netlink.BondLacpRate*[8]netlink.VlanProtocol*[]nl.NetlinkRequestData*udpnat.DirectBackWriterunmarshalMessageSetField*protoreflect.EnumNumber*protoreflect.Descriptor*protoreflect.FileImport*protoreflect.SourcePath*protoreflect.EnumRanges*func() protowire.Number*func() protoreflect.Map*bbr.maxAckHeightTrackerResetMaxAckHeightTrackermaybeEnterOrExitProbeRttprobeRttCongestionWindow*logging.CongestionState*func(protocol.KeyPhase)*logging.ECNStateTriggerReceivedLongHeaderPacket*qerr.TransportErrorCode*wire.MaxStreamDataFrame*wire.PathChallengeFrame*wire.HandshakeDoneFrame*congestion.PacketNumber*ackhandler.FrameHandler*func(bool) protocol.ECN*[]protocol.PacketNumberIncrementHighestReceived*handshake.updatableAEADOriginalDestConnectionIDLeaveSourceSpecificGroupFunctionjson:"function"github.com/quic-go/qpack*qpack.invalidIndexError*[8]qpack.indexAndValuesgithub.com/stretchr/objx*flate.CorruptInputError*internal.AuthStyleCache*internal.expirationTimewantsHttp10KeepAliveRo*retryablehttp.LenReaderUnmarshalBinaryPublicKeygolang.org/x/crypto/hkdf*eddilithium3.PrivateKeygolang.org/x/crypto/sha3*[]protoreflect.FullNameRangeExtensionsByMessageresolveMessageDependency*impl.reflectMessageInfo*func(impl.pointer) bool*impl.extensionFieldInfo*impl.lazyExtensionValue*func() *impl.weakFields*[8]*impl.coderFieldInfo*func(*impl.MessageInfo)*congestion.DefaultClockCongestionWindowAfterAcklargestAckedPacketNumberlargestSentAtLastCutback*qtls.clientSessionCachelog/slog/internal/buffer*func(token.Pos, string)*eddilithium2.PrivateKey*func(net.Addr, net.Addr)*[]cmd.tcpForwardingEntry*[]cmd.udpForwardingEntry*cmd.serverConfigACMEHTTP*map.bucket[string]string*cmd.serverConfigAuthHTTP*cmd.serverConfigResolverfillIgnoreClientBandwidth*func(server.StreamState)*[8]zapcore.EncoderConfig*map[string]zapcore.LevelMaxConstraintComparisions*func() *nistec.P256Point*func() *nistec.P384Point*func() *nistec.P521Point*func() *nistec.P224Point*x509.authorityInfoAccessMGFasn1:"explicit,tag:1"*[]x509.distributionPointIsInterfaceLocalMulticast*func() (*os.File, error)*func() (time.Time, bool)*func() (net.Conn, error)*func(netip.AddrPort) int*func() *netip.addrDetail*[]*runtime.PanicNilError*[4]runtime.stackfreelist*runtime.gcMarkWorkerMode*runtime.traceBlockReason*[10]runtime.heldLockInfo*runtime.gcStatsAggregate*map[int32]unsafe.Pointer*map[unsafe.Pointer]int32*func() *abi.UncommonType*func(int32) (int, error)*syscall.RawSockaddrInet4*syscall.RawSockaddrInet6*syscall.NetlinkRouteAttr*func(time.Duration) bool*map.bucket[string]uint64*cobra.ShellCompDirective*cobra.FParseErrWhitelistcommandsMaxCommandPathLenAllChildCommandsHaveGroup*func(string) *pflag.Flag*func(string, bool) errorMarkFlagsRequiredTogetherMarkPersistentFlagDirname*func(string, int) string*map[string]reflect.ValuesearchMapWithPathPrefixes*func(string) *zap.Logger*func(zapcore.Level) bool*func(net.Listener) error*proxymux.connWithOneByte*[8]*proxymux.muxListener*func(...string) *url.URL LatestVersion json:"lver"*client.udpSessionManager*zapcore.multiWriteSyncer*func(interface {}) error*func(string, complex128)*func(zapcore.Field) bool*zapcore.CheckWriteAction*zapcore.SamplingDecision*zapcore.ReflectedEncoder*zapcore.MapObjectEncoder*map[zapcore.Level]string*func(bool, error, error)*context.withoutCancelCtx*func(func()) func() bool*tls.RenegotiationSupportunmarshalHandshakeMessage*tls.certificateVerifyMsg*tls.certificateStatusMsg*tls.serverKeyExchangeMsg*tls.clientKeyExchangeMsggenerateClientKeyExchangegenerateServerKeyExchange*tls.clientHandshakeState*tls.serverHandshakeState*[]json.reflectWithString*http.http2WriteScheduler*func() *http.http2Framer*[8]*http.http2serverConnMaxDecoderHeaderTableSizeMaxEncoderHeaderTableSize*func() (*url.URL, error)*map[*http.conn]struct {}initialConnRecvWindowSizemaxDecoderHeaderTableSizemaxEncoderHeaderTableSize*http.http2bufferedWriter*http.http2responseWriter*http.http2RSTStreamFramenewWriterAndRequestNoBodypromoteUndeclaredTrailers*http.readWriteCloserBody*http.finishAsyncByteRead*map[string]http.muxEntry*[8]*http.http2writeQueue*http.http2writeQueuePool*http.http2ClientConnPool*chan http.requestAndChan*[8]http.connectMethodKey*http.http2clientConnPool*[8]*http.http2ClientConn*[]*http.http2addConnCall*http.nothingWrittenError*[8]http.http2frameParser*certmagic.OnDemandConfig*[8]certmagic.CertificategetCertFromAnyCertManagerloadCertResourceAnyIssuermoveCompromisedPrivateKeyobtainOnDemandCertificate*[8]*certmagic.solverInfo*[]cloudflare.cfDNSRecordLegacyIDjson:"legacy_id"github.com/libdns/duckdnsgithub.com/libdns/godaddy*namedotcom.errorResponse*acme.loggableSubproblemsSetExternalAccountBinding*server.udpSessionManager*outbounds.socks5Outbound*outbounds.directOutbound*outbounds.noAddressError*outbounds.systemResolver*outbounds.udpConnAdapter*func() protocol.StreamID*pkix.AlgorithmIdentifier*[]cipher.gcmFieldElement*func(int) reflect.Method*func(reflect.Value) bool*func(int, string) *uint8*map.bucket[string]uint16*chan singleflight.Result*pflag.stringToInt64Value*pflag.durationSliceValue*func() ([]string, error)*encoding.DecoderRegistry*encoding.EncoderRegistry*base64.CorruptInputError*map.bucket[int]struct {}*network.VectorisedWriter*func() v2geo.Domain_Type*func(bbr.roundTripCount)*func(protocol.ByteCount)activeStatelessResetTokenremoveStatelessResetToken*[8]protocol.ConnectionID*quic.cryptoStreamManager*[8]quic.frameSorterEntry*quic.retransmissionQueue*[]ackhandler.StreamFrame*[]*quic.longHeaderPacket*quic.cryptoStreamHandler*chan quic.receivedPackethandleTransportParameterssendPackedCoalescedPacket*quic.packetNumberManagermaybeGetShortHeaderPacket*func(quic.indexableConn)*quic.mtuFinderAckHandler*func(protocol.StreamNum)*quic.ConnectionTracingID*chan quic.rejectedPacketdisableVersionNegotiationmaybeHandleStatelessReset*func(quic.packetHandler)*map.bucket[uint64]uint64*http3.countingByteReader*http3.singleRoundTripper*func(quic.ReceiveStream)*encoding.BinaryMarshaler*encoding.TextUnmarshaler*acmez.failedChallengeMapenqueueUnfailedChallengesObtainCertificateUsingCSR*[8]asn1.ObjectIdentifierTargetdns:"cdomain-name"Mapx400dns:"domain-name"*func() (*dns.Msg, error)*map[uint16]func() dns.RR*map.bucket[uint16]string*func(io.RuneReader) bool*func() errors.StackTraceUserCodejson:"user_code"CPUCountjson:"cpu_count"UnitTypejson:"unit_type"SiteCodejson:"site_code"RootUserjson:"root_user"PublicIPjson:"public_ip"PlanDiskjson:"plan_disk"*govultr.DatabaseCPUUsage*govultr.SupportedEngines*govultr.FirewallGroupReq*[]govultr.PrivateNetworkMinNodesjson:"min_nodes"MaxNodesjson:"max_nodes"*govultr.ClusterReqUpdate*[]govultr.ForwardingRule*[]govultr.LBFirewallRuleV4Subnetjson:"v4_subnet"CPUModeljson:"cpu_model"*govultr.PlanAvailability*govultr.StartupScriptReqACLjson:"acls,omitempty"*govultr.OSServiceHandler*govultr.blockStorageBase*govultr.databaseUserBase*govultr.domainRecordBase*govultr.firewallRuleBase*govultr.invoiceItemsBase*govultr.reverseIPv6sBaseUserDatajson:"user_data"**govultr.vkeClustersBase**govultr.vkeNodePoolBaseNodePooljson:"node_pool"*govultr.vkeNodePoolsBasePQSignatureSchemesEnabled*func(bisect.Writer) bool*struct { Node ast.Node }*ini.ErrDelimiterNotFoundUnescapeValueDoubleQuotes*func() map[string]string*yaml.obsoleteUnmarshaler*yaml.yaml_scalar_style_t*yaml.yaml_parser_state_t*yaml.yaml_read_handler_t*[]yaml.yaml_simple_key_t*[]yaml.yaml_alias_data_t*exceptions.HasInnerError*func(netlink.Encap) bool*netlink.LinkStatistics32*netlink.LinkStatistics64*func(netlink.Route) bool*map[int]*nl.SocketHandle*protoreflect.Cardinality*func() protoreflect.Name*func(protoreflect.Value)*protoreflect.FileImportsappendEnumDescriptorProtoappendFileDescriptorProtoappendUninterpretedOption*protoreflect.FieldRanges*func() protoreflect.Kind*protoreflect.MessageType*func() protoreflect.List*[]protoreflect.RawFieldsaggregationEpochStartTimecalculateCongestionWindowgetTargetCongestionWindow*protocol.EncryptionLevel*protocol.PacketNumberLen*func(bool) time.Duration*logging.ConnectionTracer*logging.PacketDropReason*logging.PacketLossReasonReceivedShortHeaderPacket*qerr.StatelessResetError*wire.StreamsBlockedFrame*wire.TransportParametersInitialSourceConnectionID*func(*ackhandler.packet)SentNonAckElicitingPacketcheckFlowControlViolation*func([]uint8, bool) bool*handshake.TokenGenerator*handshake.tokenProtector*func(ipv4.ICMPType) bool*map[ipv4.ICMPType]string*base32.CorruptInputError*map[*syntax.Regexp]int64ErrorURIjson:"error_uri"*retryablehttp.CheckRetry*retryablehttp.ReaderFunc*retryablehttp.hookLoggerUnmarshalBinaryPrivateKey*func(kem.PublicKey) bool*func() *fiat.P224Element*func() *fiat.P256Element*func() *fiat.P384Element*func() *fiat.P521Element*func() unstable.IteratorparseIntOrFloatOrDateTimeparseMultilineBasicString*errors.SizeMismatchError*pragma.NoUnkeyedLiterals*[8]protoreflect.FullName*filedesc.EditionFeatures*filedesc.SourceLocations*map[filedesc.pathKey]int*filedesc.PlaceholderFile*filedesc.PlaceholderEnum*filedesc.resolverByIndex*filetype.resolverByIndex*func(int32, int32) int32*func() *impl.MessageInfo*impl.aberrantMessageType*func() protoreflect.Enum*impl.messageIfaceWrapper*func(coding.Version) int*prototext.MarshalOptions*cmd.masqHandlerLogWrapper*cmd.clientConfigTransport*cmd.clientConfigBandwidthRealmmapstructure:"realm"Routemapstructure:"route"Emailmapstructure:"email"*cmd.serverConfigBandwidthHTTPSmapstructure:"https"GeoIPmapstructure:"geoip"Proxymapstructure:"proxy"Sniffmapstructure:"sniff"*func() server.StreamState*func(string, string) bool*func(time.Time) time.Time*[]pkix.RevokedCertificate*func(*x509.CertPool) bool NextUpdateasn1:"optional" RawAttributes asn1:"tag:0"Hashasn1:"explicit,tag:0"*func(string) (int, error)*func(string) net.sockaddr*func(time.Duration) error*net.tcpConnWithoutWriteTo*func(func(uintptr)) error*map[string]map[string]int*func(netip.AddrPort) bool*map[abi.TypeOff]*abi.Type*[0]*runtime.PanicNilError*[]runtime.pcvalueCacheEnt*runtime.sysStatsAggregate*runtime.cpuStatsAggregate*runtime.sliceInterfacePtr*func(uint64, uint64) bool*func() *abi.InterfaceType*strings.appendSliceWriter*syscall.SockaddrLinklayerGidMappingsEnableSetgroups*cobra.commandSorterByNameSuggestionsMinimumDistanceGenZshCompletionFileNoDescHasAvailableInheritedFlagsMarkFlagsMutuallyExclusiveMarkPersistentFlagFilenameMarkPersistentFlagRequiredRegisterFlagCompletionFuncSetGlobalNormalizationFunc*func(string) interface {}WatchRemoteConfigOnChannel*func() *zap.SugaredLogger*forwarding.TCPEventLogger*forwarding.UDPEventLogger*sockopts.UnsupportedError*func(int) (string, error)*map[string]*v2geo.GeoSiteInitialStreamReceiveWindowMaxConnectionReceiveWindow*chan *protocol.UDPMessage*obfs.SalamanderObfuscator*zapcore.lockedWriteSyncer*zapcore.sliceArrayEncoder*zapcore.appendTimeEncoderNegotiatedProtocolIsMutualhandlePostHandshakeMessagequicGetTransportParametersquicSetTransportParameters*tls.certificateRequestMsg*json.UnsupportedTypeError*func(reflect.Value) error*func(*http.Request) error*http.http2readFrameResult*http.http2writeResHeaderscloseAllStreamsOnConnClose*func([]uint8, int) string*http.globalOptionsHandler*http.expectContinueReader*[]context.CancelCauseFuncStrictMaxConcurrentStreams*[]*http.http2clientStream*http.http2ClientConnState*http.http2ConnectionError*[][]*http.http2ClientConn*[8]*http.http2addConnCall*http.http2handlerPanicRST*http.http2goAwayFlowError*http.checkConnErrorWriter*http.http2stickyErrWriter*http.requestBodyReadError*map[http.ConnState]string*[][]*multipart.FileHeader*map[string][]*http.Cookie*httputil.maxLatencyWriter*certmagic.ChainPreferenceSANsjson:"sans,omitempty"*certmagic.renewQueueEntry*map[string]chan struct {}*certmagic.ACMEDNSProviderSizejson:"size,omitempty"Namejson:"name,omitempty"Portjson:"port,omitempty"Typejson:"type,omitempty"Datajson:"data,omitempty"Metajson:"meta,omitempty" Frequencyjson:"frequency"Hostjson:"host,omitempty"Fqdnjson:"fqdn,omitempty"Userjson:"user,omitempty" KeyChangejson:"keyChange" Protectedjson:"protected"*server.udpEventLoggerImpl*[]*server.udpSessionEntry*auth.CommandAuthenticatoraltSvcHijackResponseWriter*chan outbounds.dialResult*func([]big.Word) *big.Int Parametersasn1:"optional" Extensionsasn1:"optional"*func([]int) reflect.Value*func(uint32, uint32) bool*func(int, int, int) error*pflag.stringToStringValue*func(string, string) *int*[]map[string]interface {}*template.missingKeyAction*jwalterweatherman.Notepad*func() flag.ErrorHandling*unix.RawSockaddrLinklayer*socks5.NegotiationRequest*func([]*buf.Buffer) error*map[netip.AddrPort]uint16*func(*buf.Buffer) []uint8*func() metadata.Socksaddr*[]*v2geo.Domain_Attribute*func() *v2geo.Domain_Type*func(quic.receivedPacket)github.com/apernet/quic-go*func() protocol.ByteCount*[]*wire.PathResponseFramequeuedTooManyControlFramesAddStreamWithControlFramesQueuedTooManyControlFrames*func(*wire.DatagramFrame)appendOneShortHeaderPackethandleConnectionCloseFramehandleNewConnectionIDFramerestoreTransportParameters*quic.OOBCapablePacketConnhandleResetStreamFrameImpl*quic.packetHandlerManager*quic.sendStreamAckHandler*map[uint64]chan struct {}**qerr.StatelessResetErrorhandleResetStreamFramex]handleStopSendingFramex]*[1]*quic.longHeaderPackethandleBidirectionalStreams*http3.stateTrackingStream*func(int, func(int, int))*mlkem768.DecapsulationKeyGoodasn1:"tag:0,optional"Hostnamedns:"domain-name"MACdns:"size-hex:MACSize"NextNamedns:"domain-name"Keydns:"size-hex:KeySize"*func(int) regexp.lazyFlag*func(*regexp.Regexp) bool*func(string, int) [][]intFindAllStringSubmatchIndex*func(io.RuneReader) []int*oauth2.DeviceAuthResponsePlanjson:"plan,omitempty"V6MainIPjson:"v6_main_ip" Bandwidthjson:"bandwidth"*[]govultr.BareMetalServerLivejson:"live,omitempty"*govultr.ContainerRegistry Continentjson:"continent"*govultr.DatabaseCreateReqModejson:"mode,omitempty"Datejson:"date,omitempty"Timejson:"time,omitempty"*govultr.DatabaseMigration*govultr.DatabaseDiskUsage*[]govultr.AvailableOption Availablejson:"available"*govultr.DBPlanListOptions Locationsjson:"locations" Timestampjson:"timestamp"*govultr.DatabaseUpdateReq*govultr.InstanceCreateReqHourjson:"hour,omitempty" Neighborsjson:"neighbors"*govultr.BackupScheduleReq*govultr.InstanceUpdateReq*govultr.KubernetesService*govultr.NodePoolReqUpdate*govultr.ClusterUpgradeReqDeleteClusterWithResourcesPathjson:"path,omitempty"RuleIDjson:"id,omitempty"IPV4json:"ipv4,omitempty"IPV6json:"ipv6,omitempty"*govultr.ReservedIPService*govultr.ISOServiceHandler*govultr.KubernetesHandler*govultr.VPCServiceHandler*govultr.availableUpgrades*govultr.blockStoragesBase Migrationjson:"migration"*govultr.databasePlansBase DatabasePlans json:"plans"*govultr.databaseUsageBase*govultr.databaseUsersBase DatabaseUsers json:"users" Databasesjson:"databases"*govultr.domainRecordsBase*govultr.firewallGroupBase*govultr.firewallRulesBase Instancesjson:"instances"*govultr.objectStorageBase Snapshotsjson:"snapshots"*govultr.startupScriptBase**govultr.vkeNodePoolsBase*chan exec.goroutineStatus*map.bucket[string][]uint8*func([]*x509.Certificate)InsecureServerNameToVerify*edwards25519.incomparable*map[string]parse.itemTypegithub.com/subosito/gotenvAllowPythonMultilineValuesAllowDuplicateShadowValues*map[string][]*ini.Section*func(string, int64) int64handleArrayTableCollection*yaml.yaml_emitter_state_t*yaml.yaml_mapping_style_t*yaml.yaml_tag_directive_t*yaml.yaml_write_handler_t*map[string]yaml.fieldInfo*func() *netlink.LinkAttrs*netlink.BondArpAllTargets*netlink.LinkNotFoundError*func(netlink.NextHopFlag)*[]netlink.BondArpValidate*[]netlink.BondFailOverMacNeedAdditionalReadDeadline*func(netipx.IPRange) bool**errors.SizeMismatchError*func(protoreflect.MapKey)*func() protoreflect.Value*protoreflect.ProtoMessageappendFieldDescriptorProtoappendOneofDescriptorProto*func() protoreflect.Names*[]protoreflect.EnumNumber*protoreflect.FieldNumbers*[8]protoreflect.RawFields*bbr.congestionEventSampleshouldExitStartupDueToLossroundsWithoutBandwidthGain*func() protocol.StreamNum*func(string) utils.Logger*qerr.ApplicationErrorCode*wire.NewConnectionIDFrame*wire.ConnectionCloseFrame*wire.transportParameterID*map.bucket[uint64][]uint8UnmarshalFromSessionTicket*congestion.LostPacketInfo*func(bool) *wire.AckFrame*func() *ackhandler.packetlastAckElicitingPacketTime*handshake.headerProtector*handshake.ConnectionStatehandleDataFromSessionStatemarshalDataForSessionStateExcludeSourceSpecificGroupIncludeSourceSpecificGroup*func(string) slog.Handler*func(string) *slog.Logger*func(*flate.decompressor)*func(*syntax.Regexp) bool*func() (io.Reader, error)*func(kem.PrivateKey) bool*protoregistry.typesByName*map[protoreflect.Name]int*impl.placeholderExtension*impl.legacyMessageWrapperlastTargetCongestionWindowlastCutbackExitedSlowstartinitialMaxCongestionWindow*map.bucket[string]float64*func([]uint8, uint8, int)**sockopts.UnsupportedError*cmd.serverConfigMasquerade*atomic.Pointer[os.dirInfo]*cmd.clientModeRunnerResult*func(string, func() error)*map.bucket[string][]string*func([]uint8) (int, error)UnhandledCriticalExtensionsPermittedDNSDomainsCritical*x509.UnknownAuthorityError*x509.tbsCertificateRequest*x509.distributionPointName*[]x509.authorityInfoAccess*func() (int32, int, error)*net.tcpConnWithoutReadFrom*func() ([]net.Addr, error)*map[string][]net.nssSource*func(*net.MX, *net.MX) int*<-chan singleflight.Result*[8]runtime.pcvalueCacheEnt*runtime.errorAddressString*runtime.gcBgMarkWorkerNode*runtime.heapStatsAggregate*runtime.stringInterfacePtr*runtime.uint16InterfacePtr*runtime.uint32InterfacePtr*runtime.uint64InterfacePtr*runtime.TypeAssertionError*strings.byteStringReplacer*syscall.RawSockaddrNetlink*func(string, int, int) int*func(*cobra.Command) errorGenPowerShellCompletionFileHasAvailablePersistentFlags*func(string, string) error*func(int, ...string) errorSetCompletionCommandGroupID*func(func(*cobra.Command))genPowerShellCompletionFile*map[string]map[string]bool*map[string]viper.FlagValue*func(string) time.DurationsearchSliceWithPathPrefixes*[]*forwarding.sessionEntry*func(net.PacketConn) error*map[uint32]*client.udpConn*func([]uint8, []uint8) intSignedCertificateTimestamps*tls.CertificateRequestInfoDynamicRecordSizingDisabled*func() tls.ConnectionState*tls.encryptedExtensionsMsg*json.UnsupportedValueError*json.InvalidUnmarshalError*map[interface {}]struct {}*func(http.http2Flags) bool*http.http2PushPromiseParam*func(bool, [8]uint8) error*func(uint32, uint32) errorinitialStreamRecvWindowSize*http.http2frameWriteResult*chan http.http2bodyReadMsg*http.http2unstartedHandlerinitialStreamSendWindowSize*http.http2MetaHeadersFrame*func() []hpack.HeaderField*http.http2startPushRequestpossiblyConflictingPatterns*func(string, http.Handler)*chan http.responseAndError*[8]context.CancelCauseFunc*[8]*http.http2clientStream*http.http2PushPromiseFrame*[8][]*http.http2ClientConn*http.http2writePushPromise*http.http2writeSettingsAck*http.http2flushFrameWriter*func(http.Header) []string*http.http2connectionStater*func() http.ResponseWriter*map[http.http2Flags]string*[8][]*multipart.FileHeader*http.socksUsernamePassword*go.shape.[]go.shape.string*func(*http.Response) errorcheckIfCertShouldBeObtained*certmagic.dnsPresentMemory*certmagic.retryStateCtxKey*certmagic.updateQueueEntry*[]*certmagic.soaCacheEntry CreatedOnjson:"created_on"github.com/mholt/acmez/acme*[8]*server.udpSessionEntry*auth.PasswordAuthenticator*auth.UserPassAuthenticator*outbounds.speedtestHandler*outbounds.standardResolver*func(qerr.StreamErrorCode) InitialAtjson:"initial_at"*asn1.invalidUnmarshalError*func([]uint8, int) []uint8*rsa.PKCS1v15DecryptOptions*pkix.AttributeTypeAndValue*[16]cipher.gcmFieldElement*func(string) reflect.Value*reflect.structTypeUncommon*func(int) reflectlite.Type*poll.DeadlineExceededError*chan<- singleflight.Result*map[*abi.Type]interface {}*func(string) (uint, error)*func(string) (bool, error)*pflag.ParseErrorsWhitelist*func(*int, string, string)*func(string) (int8, error)*[2]map[string]interface {}*jwalterweatherman.Feedback*mapstructure.DecoderConfig*func(int) ([]uint8, error)github.com/apernet/sing-tun*func([][]uint8, int) error*map[uint16]*tun.TCPSession*tun.systemUDPPacketWriter6*tun.systemUDPPacketWriter4*list.List[go.shape.*uint8]*func() bbr.extraAckedEvent*quic.ConnectionIDGenerator*func() *utils.ByteInterval*func() *wire.DatagramFrameonHasStreamControlFrameImpl*quic.DatagramTooLargeError*quic.errCloseForRecreatinghandleUnidirectionalStreamscheckContentLengthViolation*[]*http3.QUICEarlyListenergolang.org/x/crypto/blake2b*encoding.BinaryUnmarshaler*httptrace.WroteRequestInfoSetMaxDynamicTableSizeLimitparseDynamicTableSizeUpdate GatewayHostdns:"ipsechost" Exchangerdns:"domain-name" Algorithmdns:"domain-name"*func() (libdns.SRV, error)*func([]uint8, int) [][]int*func(string, int) []string**oauth2.DeviceAuthResponse ExpiresInjson:"expires_in"github.com/vultr/govultr/v3*govultr.ApplicationServiceLabelurl:"label,omitempty" ShortNamejson:"short_name"OsIDjson:"os_id,omitempty" NetmaskV4json:"netmask_v4" GatewayV4json:"gateway_v4" V6Networkjson:"v6_network" IPAddressjson:"ip_address" StartDatejson:"start_date" UnitPricejson:"unit_price"*govultr.BlockStorageAttach*govultr.BlockStorageCreate BlockTypejson:"block_type"*govultr.BlockStorageDetach*govultr.BlockStorageUpdate DateCreatedjson:"added_at" PullCountjson:"pull_count" PlanVCPUsjson:"plan_vcpus" CurrentGBjson:"current_gb" CurrentMBjson:"current_mb"Nodesurl:"nodes,omitempty" VCPUCountjson:"vcpu_count"*govultr.DatabaseUserACLReq RuleCountjson:"rule_count" NetworkIDjson:"network_id" NodePoolsjson:"node_pools"*govultr.MarketplaceService DiskCountjson:"disk_count"*govultr.PlanServiceHandler*govultr.UserServiceHandler*govultr.VPC2ServiceHandler**govultr.availableUpgrades*govultr.backupScheduleBase BareMetaljson:"bare_metal"*govultr.bareMetalPlansBase*govultr.billingHistoryBase*govultr.databaseAlertsBase*govultr.firewallGroupsBase IsoStatusjson:"iso_status"*govultr.objectStoragesBase*govultr.startupScriptsBase**govultr.ContainerRegistry*func() []*x509.CertificateVarTimeDoubleScalarBaseMultUnescapeValueCommentSymbols*map.bucket[string]*ini.Key*yaml.yaml_sequence_style_t*[]yaml.yaml_parser_state_t*map.bucket[*yaml.Node]boolgithub.com/sagernet/netlink*netlink.BondSlaveMiiStatus*netlink.BondXmitHashPolicy*[8]netlink.BondArpValidate*[8]netlink.BondFailOverMac*func() protoreflect.SyntaxappendExtensionRangeOptionsappendMethodDescriptorProto*[2]protoreflect.EnumNumber*func(int) protowire.Number*protoreflect.ExtensionType*func() protoreflect.MapKeyEnableOverestimateAvoidance*func(congestion.ByteCount)checkIfFullBandwidthReached*func() protocol.StreamTypeReceivedTransportParametersRestoredTransportParameters*qerr.HandshakeTimeoutError*congestion.AckedPacketInfodetectAndRemoveAckedPacketshasOutstandingCryptoPackets*handshake.LongHeaderOpener*handshake.LongHeaderSealer*handshake.longHeaderOpener*handshake.longHeaderSealer*ipv4.kernelSockaddrStorage*func(*net.Interface) error*func(func(slog.Attr) bool) TokenTypejson:"token_type"*retryablehttp.RoundTripper*retryablehttp.ErrorHandler*retryablehttp.PrepareRetrycrypto/internal/nistec/fiatparseMultilineLiteralString*func(*unstable.Node) error*map.bucket[gob.typeId]bool*[8]protoreflect.EnumNumberGenerateLegacyUnmarshalJSON*map[string]*filedesc.Field*[]filedesc.EditionFeatures*map[filedesc.pathKey][]int*impl.messageReflectWrapper*impl.placeholderEnumValues*func(protoiface.MessageV1)originPointCongestionWindow*congestion.HybridSlowStart*congestion.SendAlgorithmExgolang.org/x/crypto/blake2s*func(string, string, error)Directmapstructure:"direct"SOCKS5mapstructure:"socks5"Listenmapstructure:"listen"Remotemapstructure:"remote"Strictmapstructure:"strict"Servermapstructure:"server"Configmapstructure:"config"*cmd.serverConfigResolverTCP*cmd.serverConfigResolverUDP*cmd.serverConfigResolverTLSEnablemapstructure:"enable"Inlinemapstructure:"inline"Secretmapstructure:"secret"Stringmapstructure:"string"*func(*string, *string) bool*map.bucket[x509.sum224]bool*map.bucket[string]struct {}*func(string, time.Duration)*x509.InsecureAlgorithmErrorReasonasn1:"optional,tag:1"*func(crypto.PublicKey) bool*func(context.Context, bool)*go.shape.*internal/abi.Type*func() (fs.FileInfo, error)*func(int) ([]string, error)*func(uintptr) (string, int)*func(uintptr, uintptr) bool*runtime.savedOpenDeferState*func([]uint8, int, int) int*func(context.Context) error*func(io.Writer, bool) errorIsAdditionalHelpTopicCommand*func(string, string) string*viper.defaultRemoteProvider*func(string) (string, bool)watchKeyValueConfigOnChannel*map[string]encoding.Decoder*map[string]encoding.Encoder*func([]uint8, string) error*[8]*forwarding.sessionEntry*func(*list.List[func(int)])*utils.localCertificateCache*func() (quic.Stream, error)**quic.DatagramTooLargeError*func(zapcore.ObjectEncoder)SupportedSignatureAlgorithms*map[string]*tls.CertificatesupportedSignatureAlgorithmssecureRenegotiationSupported*map.bucket[tls.alert]string*func(uint8) (string, error)*map.bucket[reflect.Type]int*http.http2OpenStreamOptions*http.http2FrameWriteRequest*http.http2HeadersFrameParam*func(*http.http2serverConn)PermitProhibitedCipherSuitesMaxUploadBufferPerConnection*func(string) []*http.Cookie*map[*net.Listener]struct {}DisableGeneralOptionsHandlershouldConfigureHTTP2ForServe*func(int) http.http2Setting*http.http2WindowUpdateFramecopyTrailersToHandlerRequestshouldSendChunkedRequestBody*func(*http.http2ClientConn)*map[[8]uint8]chan struct {}awaitOpenSlotForStreamLockeddecrStreamReservationsLocked*http.http2writeWindowUpdate*http.http2pseudoHeaderError*http.http2ContinuationFrame*http.http2noCachedConnError*certmagic.IssuedCertificateCacheUnmanagedTLSCertificate*certmagic.distributedSolver*[8]*certmagic.soaCacheEntrygithub.com/libdns/cloudflareProtojson:"proto,omitempty"Flagsjson:"flags,omitempty"Usagejson:"usage,omitempty"github.com/libdns/namedotcom*namedotcom.nameDotComRecordTokenjson:"token,omitempty"Titlejson:"title,omitempty" NewAccountjson:"newAccount" RevokeCertjson:"revokeCert"Errorjson:"error,omitempty" Identifierjson:"identifier" Challengesjson:"challenges"*outbounds.PluggableOutbound*outbounds.aclRejectOutbound*chan outbounds.lookupResult Connectionjson:"connection"*func(int64, int64) *big.Int*func([]uint8) cipher.Stream*map[*reflect.structType]int*func(reflectlite.Type) bool*map[dnsmessage.Class]string*map[dnsmessage.RCode]string*func() (int, string, error)*func(*syscall.Stat_t) error*func(int, int) (int, error)*func(int, int, uint8) error*func(string) (int64, error)*func(string) (int32, error)*func(string) (int16, error)*func(string) ([]int, error)*func(string) (uint8, error)*jwalterweatherman.Thresholdgithub.com/fsnotify/fsnotify*func(string) (uint32, bool)*mapstructure.DecodeHookFunc*map[reflect.Value]struct {}github.com/txthinking/socks5github.com/apernet/go-tproxy*func(uint32) (string, bool)*tun.DefaultInterfaceMonitor*func() protoreflect.Message*func() *quic.receivedPacket*func() quic.ConnectionState*func(*wire.MaxStreamsFrame)*func(protocol.ConnectionID)*func() []utils.ByteIntervalmaybeGetAppDataPacketFor0RTT**quic.errCloseForRecreating*[8]*http3.QUICEarlyListener*func(quic.Connection) error*http3.roundTripperWithCount*multipart.stickyErrorReader*multipart.sectionReadCloser*func(httptrace.GotConnInfo)*func(httptrace.DNSDoneInfo)vendor/golang.org/x/net/idnaHitdns:"size-hex:HitLength" NextDomaindns:"domain-name" SignerNamedns:"domain-name"*func(uint16, bool) *dns.MsgpackBufferWithCompressionMapLabeljson:"label,omitempty"Plansjson:"plans,omitempty"*govultr.BlockStorageService*[]govultr.ContainerRegistry Enterprisejson:"enterprise"*govultr.FerretDBCredentials*govultr.DatabaseDBCreateReq*govultr.DatabaseCredentials Percentagejson:"percentage"*govultr.DatabaseMemoryUsageUnitsjson:"units,omitempty"*govultr.DatabaseConnectionsMySQLjson:"mysql,omitempty"Emailjson:"email,omitempty"*govultr.DomainRecordService*govultr.FireWallRuleServiceNotesjson:"notes,omitempty"*govultr.LoadBalancerServiceChainjson:"chain,omitempty"Nodesjson:"nodes,omitempty"*govultr.ReservedIPUpdateReq*govultr.VPC2AttachDetachReq*govultr.LoadBalancerHandler*govultr.containerRegistriesDatabaseAlerts json:"alerts"*govultr.databaseUpdatesBaseIPv4sjson:"ipv4s,omitempty"IPv6sjson:"ipv6s,omitempty"*govultr.privateNetworksBase*func([][]*x509.Certificate)SecureRenegotiationSupported*map.bucket[uint]sign.Schemecrypto/internal/edwards25519*map[string]template.element*[]func(string, string) bool*func(string, uint64) uint64*[]yaml.yaml_tag_directive_t*[]yaml.yaml_emitter_state_t*map[reflect.Type]gob.typeId*netlink.BondPrimaryReselect*[]netlink.BondArpAllTargets*map[netlink.BondMode]string*func() (netip.Prefix, bool)*protoreflect.EnumDescriptor*protoreflect.FileDescriptor*func(pragma.DoNotImplement)*protoreflect.SourceLocationappendServiceDescriptorProto*func(int) protoreflect.Name*func(protowire.Number) bool*[]protoreflect.ProtoMessage*func() congestion.ByteCount*[]congestion.LostPacketInfocongestionWindowGainConstantcwndToCalculateMinPacingRate*func() protocol.Perspective*func() protocol.KeyPhaseBitSentVersionNegotiationPacket*wire.StreamDataBlockedFrame*[]wire.transportParameterID*congestion.RTTStatsProvider*func(protocol.PacketNumber)queueFramesForRetransmission*handshake.ShortHeaderOpener*handshake.ShortHeaderSealer*handshake.TokenProtectorKeygolang.org/x/net/http2/hpack*map[string]syntax.charGroupgolang.org/x/oauth2/internal*internal.LazyAuthStyleCache*retryablehttp.LeveledLoggerEncapsulateDeterministically*func(*fiat.P224Element) int*func(*fiat.P256Element) int*func(*fiat.P384Element) int*func(*fiat.P521Element) int*map[reflect.Type]*gob.encOp*func(nl.NetlinkRequestData)*filedesc.PlaceholderMessage*[8]filedesc.EditionFeatures*func() proto.MarshalOptionsestimatedTCPcongestionWindow*func() congestion.BandwidthnormalizeAssumingLe2QGeneric*cmd.serverConfigOutboundHTTP*cmd.clientConfigTransportUDP*cmd.clientConfigQUICSockopts*cmd.serverConfigTrafficStats*func(*x509.Certificate) bool*x509.CertificateInvalidError*func() *elliptic.CurveParams*x509.pkcs1AdditionalRSAPrime*[]pkix.AttributeTypeAndValue*interface { Is(error) bool }*interface { Unwrap() error }*func() (*net.TCPConn, error)*func(*net.SRV, *net.SRV) int*map.bucket[string]net.byName*func(string) (string, error)*struct { F uintptr; X0 int }*[][8]runtime.pcvalueCacheEnt*func() (runtime.Frame, bool)*strings.singleStringReplacer*syscall.RawSockaddrLinklayer*syscall.SocketControlMessage*viper.UnsupportedConfigError*func(context.Context, error)*func() *list.List[func(int)]*interface { Timeout() bool }*utils.LocalCertificateLoader*func(*tls.Certificate) error*tls.newSessionTicketMsgTLS13*atomic.Pointer[interface {}]*tls.QUICSessionTicketOptions*map[interface {}]*sync.entry*func(uint8) ([]uint8, error)*map.bucket[reflect.Type]bool*func() http.http2FrameHeader*map[uint32]*http.http2stream*[]http.http2unstartedHandlerstartGracefulShutdownInternal*map[string]*http.routingNode*http.http2transportTestHooks*http.http2erringRoundTripper*map[http.http2ErrCode]string*[]map[http.http2Flags]string*map[http.http2SettingID]bool*map[string]http.RoundTripper*func(*httputil.ProxyRequest)*func(*certmagic.Config) bool*map[string]*certmagic.Config*[]certmagic.dnsPresentMemory*map[string]certmagic.KeyInfo*map[string]certmagic.Storage ModifiedOnjson:"modified_on"*map[string]cloudflare.cfZone TotalCountjson:"total_count"*map[string]gandi.gandiDomain DomainHrefjson:"domain_href"*func([]uint8, *string) error*outbounds.DirectOutboundMode*func(string) (net.IP, error)*func(crypto.PrivateKey) bool*func() (reflect.Value, bool)*func(int, int) reflect.Value*map[*reflect.structType]bool*[]chan<- singleflight.Result*func() (interface {}, error)*map.bucket[uint8]*pflag.Flag*func(string) ([]bool, error)*func(string) (uint16, error)*func(string) (uint32, error)*func(string) (uint64, error)*func(string) ([]uint, error)*func(...interface {}) string*func(string, int, int) error*map.bucket[string]*flag.Flag*func(int32) *base64.Encoding*func() (*tproxy.Conn, error)*func(uint16) *tun.TCPSession*func(io.Reader) (int, error)*func() protoreflect.EnumTypeisDomain_Attribute_TypedValueAllowConnectionWindowIncrease*func() quic.connCapabilities*func(*wire.StopSendingFrame)*func() protocol.ConnectionIDundecryptablePacketsToProcesshandleRetireConnectionIDFrame*quic.StreamLimitReachedError*func() (quic.streamI, error)*map[string]map[string]string*func(httptrace.DNSStartInfo)SetAllowedMaxDynamicTableSizeRevokedasn1:"tag:1,optional"Unknownasn1:"tag:2,optional" ThisUpdateasn1:"generalized" ProducedAtasn1:"generalized" Replacementdns:"domain-name"*func(*dns.Msg, int) *dns.Msg*map.bucket[uint8]crypto.Hash*func([]uint8, int) [][]uint8*func(string, int) [][]string DeviceCodejson:"device_code"Cursorurl:"cursor,omitempty"Regionurl:"region,omitempty" DeployNamejson:"deploy_name"VPCIDjson:"vpc_id,omitempty"AppIDjson:"app_id,omitempty" MacAddressjson:"mac_address" InstanceIDjson:"instance_id"*govultr.ContainerRegistryReq DataCenterjson:"data_center"*govultr.DockerCredentialsOpt VanityNamejson:"vanity_name" TrustedIPsjson:"trusted_ips"Engineurl:"engine,omitempty"*govultr.FirewallGroupService SubnetSizejson:"subnet_size"ISOIDjson:"iso_id,omitempty" InternalIPjson:"internal_ip" AutoScalerjson:"auto_scaler" KubeConfigjson:"kube_config"*govultr.ObjectStorageService S3Hostnamejson:"s3_hostname"*govultr.ObjectStorageCluster CPUThreadsjson:"cpu_threads"*govultr.ReservedIPConvertReq*govultr.StartupScriptService APIEnabledjson:"api_enabled" MACAddressjson:"mac_address" NodeStatusjson:"node_status"*govultr.BackupServiceHandler*govultr.DomainServiceHandler*govultr.RegionServiceHandler*govultr.SSHKeyServiceHandler BareMetalsjson:"bare_metals"**govultr.containerRegistries PublicIsosjson:"public_isos" ReservedIPjson:"reserved_ip" VKEClusterjson:"vke_cluster"*tls.HPKESymmetricCipherSuite*func() [][]*x509.Certificate*func(uintptr, []uint8) error*func(*properties.Properties)*map.bucket[reflect.Value]int*map.bucket[interface {}]bool*map.bucket[string]*yaml.Node*func(int, int, string) error*[8]netlink.BondArpAllTargets*[]netlink.BondXmitHashPolicy*map[netlink.IPoIBMode]string*map[string]netlink.IPoIBModesyscallVectorisedWriterFields*func(protoreflect.Name) bool*func() protoreflect.FullName*protoreflect.FieldDescriptor*protoreflect.EnumDescriptors*protoreflect.SourceLocationsappendSourceCodeInfo_Location*protoreflect.OneofDescriptor*func(protoreflect.RawFields)*func(int) protoreflect.Value*[8]protoreflect.ProtoMessage*[]congestion.AckedPacketInfoexpireAckAggregationInStartup*protocol.StatelessResetToken*qerr.VersionNegotiationError*func() protocol.PacketNumber*wire.RetireConnectionIDFramereadNumericTransportParameterInitialMaxStreamDataBidiLocal*congestion.CongestionControl*ackhandler.sentPacketTracker*ackhandler.SentPacketHandler*ackhandler.sentPacketHandler*ackhandler.packetNumberSpace*ackhandler.sentPacketHistory*handshake.aesHeaderProtector*map.bucket[int]*ipv4.sockOpt*func(*ipv4.ICMPFilter) error*retryablehttp.RequestLogHook*func() asn1.ObjectIdentifier*map[reflect.Type]gob.gobType*[]protoreflect.ExtensionType*[][2]protoreflect.EnumNumber*impl.extensionTypeDescriptor*func(net.Addr, string, error)*cmd.serverConfigOutboundEntryTimeoutmapstructure:"timeout"Addressmapstructure:"address"AltPortmapstructure:"altPort"Domainsmapstructure:"domains"Commandmapstructure:"command"*cmd.serverConfigResolverHTTPSGeoSitemapstructure:"geosite"Contentmapstructure:"content"Headersmapstructure:"headers" EABHMACKeyjson:"eab_hmac_key"*func(*os.dirInfo) *os.dirInfo*x509.ConstraintViolationError*func(*x509.Certificate) error*func(*big.Int, *big.Int) boolUniqueIdasn1:"optional,tag:1"FullNameasn1:"optional,tag:0"*func() (*net.UnixConn, error)marshalBinaryWithTrailingBytes*func(string) ([]uint8, error)*[2][8]runtime.pcvalueCacheEnt*runtime.goroutineProfileState*map[string]runtime.metricData*map.bucket[uint32][]*abi.Type*struct { F uintptr; X0 *int }*struct { F uintptr; X0 bool }*func(time.Duration) time.Time*func(int, int, int) time.Time*func([]uint8, string) []uint8*func() (int, time.Month, int)*func(time.Time) time.Duration*func() (time.Time, time.Time)*func(string, ...string) error*func(string, ...interface {})enforceFlagGroupsForCompletion*map[string]*template.Template*viper.ConfigFileNotFoundError*map[interface {}]interface {}*[]mapstructure.DecodeHookFuncInitialConnectionReceiveWindow*zapcore.PrimitiveArrayEncoder*map[zapcore.Level]color.Color*context.deadlineExceededErrorEncryptedClientHelloConfigList*func(*tls.SessionState) error*func(uint16) tls.keyAgreement*atomic.Pointer[sync.readOnly]*map.bucket[string]*json.field*http.http2responseWriterState*func(http.http2Setting) error*http.http2serverInternalState*func() (io.ReadCloser, error)*func() (string, string, bool)onceSetNextProtoDefaults_Serve*[]http.http2FrameWriteRequest*map[http.connectMethodKey]int*func(*http.http2clientStream)*http.tlsHandshakeTimeoutError*[8]map[http.http2Flags]string*func(*url.URL) []*http.Cookie*httputil.switchProtocolCopier*certmagic.CertificateSelector*certmagic.CertificateResourcedistributedHTTPChallengeSolver*certmagic.decodedCertResourceWeightjson:"weight,omitempty"Targetjson:"target,omitempty"Sourcejson:"source,omitempty"Lockedjson:"locked,omitempty" Permissionsjson:"permissions"Resultjson:"result,omitempty"Errorsjson:"errors,omitempty" Descriptionjson:"description"Answerjson:"answer,omitempty"Serverjson:"server,omitempty"*[]namedotcom.nameDotComRecordStatusjson:"status,omitempty"Detailjson:"detail,omitempty" Identifiersjson:"identifiers" Certificatejson:"certificate"*[]outbounds.PluggableOutbound*trafficlogger.dumpStreamEntry*func(*big.Int, uint) *big.Int*pkix.AttributeTypeAndValueSET*[1]pkix.AttributeTypeAndValue*func(int) reflect.StructField*map.bucket[reflect.visit]bool*map[dnsmessage.section]string*map[string]*singleflight.call*[1]chan<- singleflight.Result*func(string) (float64, error)*func(string) (float32, error)*func(string) ([]int32, error)*func(string) ([]int64, error)*map.bucket[string]*parse.Tree*jwalterweatherman.LogListener*[]jwalterweatherman.Threshold*func() ([]uint8, bool, error)*func([]uint8, uint16) []uint8*func([]uint8, uint32) []uint8*func([]uint8, uint64) []uint8*func() []ranges.Range[uint32]*ranges.Range[go.shape.uint32]*list.Element[go.shape.*uint8]*func(congestion.PacketNumber)*func(qerr.TransportErrorCode)*func(protocol.StreamID) error*func(*wire.StreamFrame) error*func(utils.ByteInterval) bool*func(*wire.CryptoFrame) error*quic.streamControlFrameGetterhandleUnpackedLongHeaderPackethandleVersionNegotiationPackettryQueueingUndecryptablePacketpopNewStreamFrameWithoutBuffer*map[string]quic.indexableConn**qerr.VersionNegotiationError*func(protocol.ByteCount) bool*func(io.Reader, uint64) error*http3.unknownFrameHandlerFuncgo.uber.org/zap/internal/color*func(hpack.HeaderField) error*func(func(hpack.HeaderField)) GatewayHostdns:"amtrelayhost"Saltdns:"size-hex:SaltLength"*func(string, uint16) *dns.Msg*func(*dns.KEY, []uint8) error PreviousNamedns:"domain-name"*map.bucket[string]dns.Handler*map.bucket[dns.SVCBKey]string*map.bucket[string]dns.SVCBKey*func(*regexp.Regexp, int) int*func() (*oauth2.Token, error)Expiryjson:"expiry,omitempty"*govultr.AccountServiceHandlerMainIPurl:"main_ip,omitempty"Regionjson:"region,omitempty" DateModifiedjson:"updated_at"*govultr.ContainerRegistryUser*govultr.ContainerRegistryRepo*govultr.ContainerRegistryPlanPublicjson:"public,omitempty"*govultr.DatabaseAddReplicaReqDBNamejson:"dbname,omitempty"*govultr.DatabaseUserCreateReqMethodjson:"method,omitempty" Credentialsjson:"credentials"*govultr.DatabaseListAlertsReq*govultr.DatabaseUserUpdateReqDomainjson:"domain,omitempty"MD5Sumjson:"md5sum,omitempty"Labelsjson:"labels,omitempty"Scriptjson:"script,omitempty"*govultr.BillingServiceHandler*govultr.NetworkServiceHandlerHistoryjson:"billing_history" Connectionsjson:"connections"*govultr.databaseMigrationBaseRecordjson:"record,omitempty"Invoicejson:"billing_invoice"*func(*bigmod.Modulus) []uint8*func(string, float64) float64handleArrayTableCollectionLast*yaml.yaml_version_directive_t*[]netlink.BondPrimaryReselect*[8]netlink.BondXmitHashPolicy*map[string]netlink.TuntapMode*bufio.SyscallVectorisedWriter*protoreflect.MethodDescriptorappendEnumValueDescriptorProto*func(int) [2]protowire.Number*protoreflect.FieldDescriptors*protoreflect.OneofDescriptors*func() protoreflect.RawFields*func(protoreflect.Value) bool*func(int, protoreflect.Value)*map[int32]impl.ExtensionFieldIsOverestimateAvoidanceEnabled*func(utils.ByteInterval) int8*func(logging.CongestionState)*func(protocol.KeyPhase, bool)InitialMaxStreamDataBidiRemotecheckSequentialPacketNumberUsepeerCompletedAddressValidation*func(qpack.HeaderField) error*map.bucket[*syntax.Regexp]int*map[string]internal.AuthStyle*retryablehttp.ResponseLogHook*map.bucket[string]sign.Schemegolang.org/x/crypto/cryptobyte*map.bucket[*gob.typeInfo]boolgithub.com/sagernet/netlink/nl*func(int, []uint8) *nl.RtAttr*[]protoreflect.FileDescriptor*[8]protoreflect.ExtensionType*map.bucket[string]token.Token*[]protoreflect.SourceLocation*filedesc.PlaceholderEnumValue*func() proto.UnmarshalOptions*func(net.Addr, string, uint64)*func(net.Addr, string, string)*cmd.serverConfigOutboundDirect*cmd.serverConfigOutboundSOCKS5*cmd.clientConfigObfsSalamander*func() (*client.Config, error)*cmd.serverConfigObfsSalamander*cmd.serverConfigMasqueradeFile*func() (*server.Config, error)*[]*utils.localCertificateCache*map.bucket[string]func() error CRLIssuerasn1:"optional,tag:2"*[]x509.pkcs1AdditionalRSAPrime*[][]pkix.AttributeTypeAndValue*func([]uint8, []uint8) []uint8*interface { Unwrap() []error }*func(io.Writer) (int64, error)*func(io.Reader) (int64, error)*func(func(uintptr) bool) error*map[net.hostLookupOrder]string*atomic.Pointer[runtime._defer]*runtime.metricFloat64Histogram*func(uintptr) (uintptr, int64)*map.bucket[string]interface {}*func(uintptr, uintptr) []uint8*func(*time.Location) time.Time*func([]uint8) ([]uint8, error)*func(*cobra.Command, []string)*func() (*cobra.Command, error)GenPowerShellCompletionWithDesc*[]*viper.defaultRemoteProvider*func() map[string]interface {}searchIndexableWithPathPrefixes*[2]mapstructure.DecodeHookFunc*func(string, ...zapcore.Field)Leveljson:"level" yaml:"level"*func() (net.PacketConn, error)*func(*list.Element[func(int)])*func(string) (*url.URL, error)*interface { Temporary() bool }*map.bucket[string]*v2geo.GeoIP*func(string) (net.Conn, error)*client.reconnectableClientImpl*map[context.canceler]struct {}*tls.certificateRequestMsgTLS13*func(*json.scanner, uint8) int*func(net.Conn, http.ConnState)*chan http.http2readFrameResultprocessSettingInitialWindowSize*http.http2noDialH2RoundTripper*http.http2noDialClientConnPool*map[string]*http.http2dialCall*http.http2headerFieldNameError*map[http.http2FrameType]string*map[http.http2SettingID]string*func(*url.URL, []*http.Cookie)*func() (*http.Response, error)*struct { F uintptr; X0 error }*certmagic.StandardKeyGeneratormakeCertificateFromDiskWithOCSPmanagedCertInStorageExpiresSoon*[][]certmagic.dnsPresentMemory*map[string]certmagic.Challenge*map.bucket[string]acmez.SolverKeyTagjson:"key_tag,omitempty"ZoneIDjson:"zone_id,omitempty" ActivatedOnjson:"activated_on" PlanPendingjson:"plan_pending" NameServersjson:"name_servers"*namedotcom.listRecordsResponse*outbounds.errHTTPRequestFailed*[8]outbounds.PluggableOutbound*func() (float64, big.Accuracy)*map.bucket[crypto.Hash][]uint8*func([]uint8) cipher.BlockMode*func(string) ([]string, error)*func() iter.Seq[reflect.Value]*map[string]*unicode.RangeTable*func(int, int, [4]uint8) error*func(string) ([]net.IP, error)*func(string, int, string) *int*[8]jwalterweatherman.Threshold*func(netip.Addr) (string, int)*func() protoreflect.EnumNumber*func() congestion.PacketNumbertotalBytesSentAtLastAckedPacket*func(string) *quic.ClientToken*func(protocol.EncryptionLevel)*func() ackhandler.FrameHandlerhandleUnpackedShortHeaderPacketregisterPackedShortHeaderPacket*func([]uint8, *uint8, []uint8)*func(quic.indexableConn) error*[]protocol.StatelessResetToken*func(protocol.StreamNum) errorenqueueVersionNegotiationPacket*[]*http3.roundTripperWithCountvendor/golang.org/x/crypto/hkdfvendor/golang.org/x/crypto/sha3*func() (multipart.File, error)*func(int) (int, string, error)*map[hpack.pairNameValue]uint64*internal.FlushAfterChunkWriter*func(crypto.PrivateKey) string*func([]uint8, *dns.TSIG) error*func([]uint8, int) [][][]uint8 AccessTokenjson:"access_token" DateCreatedjson:"date_created"*govultr.BareMetalServerServiceSizeGBjson:"size_gb,omitempty"*govultr.ContainerRegistryPlans*govultr.DatabaseConnectionPool MonthlyCostjson:"monthly_cost" MessageTypejson:"message_type"DNSSecjson:"dns_sec,omitempty" PowerStatusjson:"power_status" DateUpdatedjson:"date_updated"IPTypejson:"ip_type,omitempty"*govultr.MarketplaceAppVariable*[]govultr.ObjectStorageClusterSSHKeyjson:"ssh_key,omitempty"APIKeyjson:"api_key,omitempty"*govultr.DatabaseServiceHandler*govultr.InstanceServiceHandler*govultr.SnapshotServiceHandler*govultr.containerRegistryReposInvoicejson:"billing_invoices" ReservedIPsjson:"reserved_ips"DNSSoajson:"dns_soa,omitempty" VKEClustersjson:"vke_clusters"**govultr.ContainerRegistryRepo*func() (io.WriteCloser, error)*[]tls.HPKESymmetricCipherSuite*func(*norm.reorderBuffer) boolgithub.com/pelletier/go-toml/v2*map[string]yaml.resolveMapItem*func(netlink.Destination) bool*func(netlink.NexthopInfo) bool*[8]netlink.BondPrimaryReselectgithub.com/sagernet/sing/common*func(protoreflect.MapKey) bool*protoreflect.MessageDescriptor*func() protoreflect.Descriptor*protoreflect.ServiceDescriptor*protoreflect.MethodDescriptors*func() protoreflect.EnumRangeslastSentPacketNumberBeforeEpoch*func(protocol.ByteCount, bool)OriginalDestinationConnectionID*flowcontrol.baseFlowController*func(protocol.ByteCount) error*func() (*net.Interface, error)*func([]slog.Attr) slog.Handlergithub.com/davecgh/go-spew/spew*func(io.Reader, []uint8) errorgithub.com/cloudflare/circl/pkigithub.com/cloudflare/circl/kem*map[reflect.Kind]gob.encHelper*map[reflect.Type]*gob.typeInfo*[]protoreflect.FieldDescriptor*map[protowire.Number]struct {}*func(protoreflect.Value) error*func(impl.offset) impl.pointerCongestionWindowAfterPacketLossgithub.com/cloudflare/circl/xof*goldilocks.preTwistPointAffine*func(*[32]uint8, uint8, uint8) *func(net.Addr, net.Addr, error)BindIPv4mapstructure:"bindIPv4"BindIPv6mapstructure:"bindIPv6"Usernamemapstructure:"username"Passwordmapstructure:"password"Insecuremapstructure:"insecure"Sockoptsmapstructure:"sockopts"FastOpenmapstructure:"fastOpen"SNIGuardmapstructure:"sniGuard"UserPassmapstructure:"userpass"TCPPortsmapstructure:"tcpPorts"UDPPortsmapstructure:"udpPorts" *[]cmd.serverConfigOutboundEntry *cmd.serverConfigMasqueradeProxyResolvermapstructure:"resolver" *func(time.Time, time.Time) bool *[0]*utils.localCertificateCache *chan cmd.clientModeRunnerResult *map.bucket[string]zapcore.Level *struct { F uintptr; X0 string } *func([]*x509.Certificate) error *x509.UnhandledCriticalExtension SaltLengthasn1:"explicit,tag:2" *[]pkix.AttributeTypeAndValueSET *struct { F uintptr; X0 *error } *func() (syscall.RawConn, error) *func(net.KeepAliveConfig) error *func(interface {}) interface {} *func(int) (netip.Prefix, error) *func(int64, int) (int64, error) *runtime.traceSchedResourceState *map.bucket[int32]unsafe.Pointer *map[runtime._typePair]struct {} *map.bucket[unsafe.Pointer]int32 *map.bucket[string]reflect.Value *func(string) *zap.SugaredLogger *func(...zap.Option) *zap.Logger *func(zapcore.Core) zapcore.Core *struct { F uintptr; X0 uint32 } *func() *list.Element[func(int)] *func() ([]uint8, string, error) *map.bucket[zapcore.Level]string *func(tls.ConnectionState) error *func([]uint8, []uint8) tls.aead supportedSignatureAlgorithmsCert *map[uint16]func() *hpke.hkdfKDF *func() http.http2WriteScheduler *func() (http.http2Frame, error) *map.bucket[*http.conn]struct {} *chan http.http2frameWriteResult *map.bucket[string]http.muxEntry *func(string, http.RoundTripper) *http.http2transportResponseBody *func(string) (http.File, error) *http.http2headerFieldValueError *http.http2headersOrContinuation *struct { io.Reader; io.Closer } github.com/caddyserver/certmagic CacheUnmanagedCertificatePEMFile storageHasCertResourcesAnyIssuer *func(http.Handler) http.HandlerCreatedjson:"created,omitempty"Updatedjson:"updated,omitempty" *[]certmagic.decodedCertResource *certmagic.RingBufferRateLimiter *[8][]certmagic.dnsPresentMemory *map[string]certmagic.ocspUpdateServicejson:"service,omitempty"Contentjson:"content,omitempty"Proxiedjson:"proxied,omitempty"Messagejson:"message,omitempty"Detailsjson:"details,omitempty"Tokenjson:"api_token,omitempty"Recordsjson:"records,omitempty"Websitejson:"website,omitempty"Expiresjson:"expires,omitempty"Contactjson:"contact,omitempty" *map[string]acme.cachedDirectory *masq.altSvcHijackResponseWriter *outbounds.directOutboundUDPConn *trafficlogger.trafficStatsEntry *[]trafficlogger.dumpStreamEntry *func() (*ecdh.PublicKey, error) *func([]int) reflect.StructField *struct { F uintptr; X0 []int8 } *nettrace.LookupIPAltResolverKey *func([]uint8, int) (int, error) *func(*[][]uint8) (int64, error) *func(*pflag.Flag, string) error *func(string) ([]float32, error) *func(string) ([]float64, error) *func(string) (net.IPNet, error) *func(*int, string, int, string) *[]jwalterweatherman.LogListener *mapstructure.DecodeHookFuncKind *mapstructure.DecodeHookFuncType *func(string, fs.FileMode) error *socks5.UserPassNegotiationReply *func() ([]uint8, func(), error) *v2geo.Domain_Attribute_IntValue *func(string, *quic.ClientToken) *func() (quic.SendStream, error) *func(*wire.TransportParameters) *func([]utils.ByteInterval) bool *[]quic.streamControlFrameGetter *func() protocol.EncryptionLevel *func(*wire.DatagramFrame) error popNewOrRetransmittedStreamFrame *func(net.Addr, quic.packetInfo) *[8]protocol.StatelessResetToken *func(*wire.StreamsBlockedFrame) *chan quic.errCloseForRecreating DisableVersionNegotiationPackets github.com/apernet/quic-go/http3 *[8]*http3.roundTripperWithCount *func(string) (io.Writer, error) *func() (*multipart.Part, error) *httptrace.clientEventContextKey *map.bucket[uint16]func() dns.RR *func(string) (*dns.Conn, error)PerPageurl:"per_page,omitempty"Netmaskjson:"netmask,omitempty"Gatewayjson:"gateway,omitempty"Reversejson:"reverse,omitempty"Networkjson:"network,omitempty" *govultr.ContainerRegistryRegion Subscriptionjson:"subscription" *[]govultr.ContainerRegistryRepo *govultr.DatabaseAdvancedOptionsVersionjson:"version,omitempty"Backupsjson:"backups,omitempty"Enabledjson:"enabled,omitempty"SSLInfojson:"has_ssl,omitempty" S3AccessKeyjson:"s3_access_key" S3SecretKeyjson:"s3_secret_key" Applicationsjson:"applications" **govultr.containerRegistryRepos Repositoriesjson:"repositories" **govultr.ContainerRegistryPlans SupportedSignatureAlgorithmsCert *func(*bigmod.Nat) bigmod.choice *map[token.Pos]*ast.CommentGroup github.com/magiconair/properties *map[netlink.BondAdSelect]string *map[netlink.BondLacpRate]string *map[netlink.VlanProtocol]string *map.bucket[int]*nl.SocketHandle *map[string]netlink.BondAdSelect *map[string]netlink.BondLacpRate *map[string]netlink.VlanProtocol google.golang.org/protobuf/proto *func() protoreflect.Cardinality *func() protoreflect.FileImports *protoreflect.MessageDescriptors *protoreflect.ServiceDescriptors *func() protoreflect.FieldRanges *func() protoreflect.MessageType *func(int) protoreflect.EnumType *bbr.connectionStateOnSentPacket AckAggregationBandwidthThreshold ackAggregationBandwidthThreshold totalBytesAckedAfterLastAckEvent *func(congestion.ByteCount) bool ReceivedVersionNegotiationPacket GetLowestPacketNotConfirmedAcked *handshake.chachaHeaderProtector *handshake.quicVersionContextKey *func(net.Addr) ([]uint8, error) *map.bucket[ipv4.ICMPType]string golang.org/x/net/internal/socket *func(slog.Attr, slog.Attr) bool *map[string]qpack.indexAndValues *map.bucket[*syntax.Regexp]int64 *func() *internal.AuthStyleCache *func(string, *url.Values) error github.com/cloudflare/circl/sign AuthEncapsulateDeterministically github.com/cloudflare/circl/hpke github.com/hashicorp/hcl/hcl/ast *func(...string) *ast.ObjectList *func(protoreflect.FullName) int *[][]protoreflect.FileDescriptor *protoregistry.packageDescriptor *[8]protoreflect.FieldDescriptor *map.bucket[filedesc.pathKey]int *func(reflect.Type) interface {} *func([]uint8, []uint8, []uint8) *func(*kyber512.PrivateKey) bool *func(*kyber768.PrivateKey) bool!*cmd.serverConfigMasqueradeString!*map[string]zapcore.EncoderConfig!*struct { F uintptr; X0 *uint32 }!*func(asn1.ObjectIdentifier) boolVersionasn1:"optional,default:0"!*struct { F uintptr; X0 []uint8 }!*func(fmt.ScanState, int32) error!*map.bucket[string]map[string]int!*func(int) ([]fs.DirEntry, error)!*func(int) ([]fs.FileInfo, error)!*func() (*os.ProcessState, error)!*map.bucket[abi.TypeOff]*abi.Type!MarkZshCompPositionalArgumentFile!*func(func(*cobra.Command) error)!*func(zapcore.ArrayEncoder) error!*func(*url.URL) (zap.Sink, error)!*map[string]*proxymux.muxListener!*map.bucket[string]*v2geo.GeoSite!*func() (client.HyUDPConn, error)!*func(string, interface {}) error!*func(time.Duration) *time.Ticker!initLegacySessionTicketKeyRLocked!*tls.CertificateVerificationError!*func(interface {}, interface {})!*func(json.field, json.field) int!*func(...http.http2Setting) error!*http.http2synctestGroupInterface!*chan http.http2FrameWriteRequest!*map[uint32]*http.http2writeQueue!*func() http.http2ClientConnState!*interface { FlushError() error }!*map.bucket[http.ConnState]string!*map.bucket[string][]*http.Cookie!*map[string]certmagic.Certificate!CacheUnmanagedCertificatePEMBytes!*map[string]*certmagic.solverInfo!*map.bucket[string]chan struct {} IsSubscribedjson:"is_subscribed" CanSubscribejson:"can_subscribe"!*outbounds.errSOCKS5RequestFailed!*trafficlogger.TrafficStatsServer!*func() (*ecdh.PrivateKey, error)!*func(reflect.Type) reflect.Value!*struct { F uintptr; X0 []int16 }!*struct { F uintptr; X0 []int32 }!*struct { F uintptr; X0 []int64 }!*func(string, bool, string) *bool!*func(string) (net.IPMask, error)!*func(string, int8, string) *int8!*func(string, uint, string) *uint!*func(reflect.Value) (int, error)!github.com/mitchellh/mapstructure!*mapstructure.DecodeHookFuncValue!*func(string) (afero.File, error)!*func(*flag.Flag, *flag.Flag) int!*func(string, flag.ErrorHandling)!*func(flag.Value, string, string)!*func(bool) (*net.TCPConn, error)!*map[tun.flowKey][]tun.tcpGROItem!setSearchDomainForSystemdResolved!*map.bucket[netip.AddrPort]uint16!*func(netip.Prefix) netlink.Route!*[]*list.Element[go.shape.*uint8]!*func() []*v2geo.Domain_Attribute!*v2geo.Domain_Attribute_BoolValue!*map[uint64]protocol.ConnectionID!*[8]quic.streamControlFrameGetter!*func() handshake.ConnectionState!*map.bucket[uint64]chan struct {}!*func() (quic.sendStreamI, error)!maybeSendVersionNegotiationPacket!*func(interface {}) *list.Element!*func(*list.Element) interface {}!*func(tls.ConnectionState, error)!*func(httptrace.WroteRequestInfo)RevocationTimeasn1:"generalized" OtherDatadns:"size-hex:OtherLen"!*func(interface {}) *oauth2.TokenImageIDjson:"image_id,omitempty"!*govultr.ContainerRegistryService!*govultr.ContainerRegistryStorage MonthlyPricejson:"monthly_price" PlanReplicasjson:"plan_replicas" LatestBackupjson:"latest_backup"!*[]govultr.DatabaseConnectionPool!*govultr.DatabaseBackupRestoreReq DateModifiedjson:"date_modified" ServerStatusjson:"server_status" NodeQuantityjson:"node_quantity"!*[]govultr.MarketplaceAppVariableGPUTypejson:"gpu_type,omitempty" PrefixLengthjson:"prefix_length"!*govultr.ReservedIPServiceHandler!*govultr.containerRegistryRegions FirewallRulejson:"firewall_rule" InvoiceItemsjson:"invoice_items" LoadBalancerjson:"load_balancer" ReverseIPv6sjson:"reverse_ipv6s"!*struct { in string; out string }!*map.bucket[string]parse.itemType!*map.bucket[string][]*ini.Section!*map.bucket[string]yaml.fieldInfo!*bufio.NetVectorisedWriterWrapper!*func() protoreflect.ProtoMessage!appendFieldOptions_EditionDefault!appendFieldOptions_FeatureSupport!*protoreflect.EnumValueDescriptor!*func() protoreflect.FieldNumbers!enableAckAggregationDuringStartup!*func(protocol.PacketNumber) bool!*ackhandler.ReceivedPacketHandler!*ackhandler.receivedPacketHandler!*ackhandler.receivedPacketTracker!*ackhandler.receivedPacketHistory!*ackhandler.packetNumberGenerator!*flowcontrol.StreamFlowController!*flowcontrol.streamFlowController!*func(*socket.Message, int) error!*func() (*ipv4.ICMPFilter, error)!*func([]bpf.RawInstruction) error RefreshTokenjson:"refresh_token"!*func(map[gob.typeId]bool) string!*[8][]protoreflect.FileDescriptor!*func(protoreflect.EnumType) bool!*protoregistry.extensionsByNumber!*interface { EnforceUTF8() bool }!*map.bucket[protoreflect.Name]int!*[]protoreflect.MessageDescriptor!*func(*kyber1024.PrivateKey) bool!*func(*common.Poly, *common.Poly)!*func(mlsbset.EltG, mlsbset.EltP)N|6tFG~j k6tFG\܍H6tFGݸdQ6tFG54e6tFG@5nY6tFGݸwg6tFGN5U6tFGT ~6tFG6~6tFGn*6tFG$k ]ĵZ6tFG`B×U6tFGs޸Ggg6tFGO`6I6tFG]@6tFG` ^6tFGfk6tFG|k6/6tFGG@E6tFGW`k{6tFGח 7O6tFG$b6tFGk޸euv6tFG.6tFG `-^6tFG 7K76tFG~Z6tFG਼+<16tFGxO76tFGkwB6tFG,/@8ӑ6tFGG/`lMhK6tFGNj8 H6tFG9b3|6tFG^| 6tFG> _`6tFGl֧6tFGk`mm6tFG`9_)6tFGn99&|6tFGElk6tFG9Z-06tFG߸8Q6tFG3o߸ q6tFGnX :6tFGX ȱ6tFG`ȱA^6tFG@7RX}6tFGXъ6tFG+@~6tFG:Χ6tFG@ȱ=6tFGք^$6tFGU0:N 6tFG'@;|q6tFGOu6tFGnlg"<6tFGNY;5 6tFG A;Jg6tFG] `~6tFGo`ns]36tFGr6tFGp<6tFG*`fZ6tFGi6tFGG`FN6tFGl`<|6tFG摌6tFG9p6tFGb@6B6tFGl<9QY6tFG^ =ē?6tFG!A a6tFGYaP6tFGF 8g6tFGj@9oQD<6tFG* qsI6tFGYiB6tFG<B6tFG`65̻6tFG+0٬6tFGY@&v6tFG/'`6tFG4+ b6Z{6tFGJmb 26tFGŻ_6tFGąFW6tFG+ @H6tFGUš#6tFGެ`ɱ;9q6tFG@ ˣ6tFG 堶6tFGtJ@A16tFGBfdmZ>6tFG?$Oa6tFGZ蓆6tFGM6tFGJ)v6tFGASk;6tFGB;#6tFGF@16tFG@]6tFGÆɱE@6tFG}Bj#6tFG2v6tFGKɱ|c6tFG" ʱ 6tFG 2`ʱ #6tFG(2ʱ眈6tFGKʱ=8b6tFG02 ˱~36tFGK`˱+t.6tFG82˱x2I6tFGK˱g]X6tFG) ̱#xn6tFG"`̱6tFGg̱M Q6tFG̱rz6tFG ͱr@6tFGg`ͱ]Dm6tFGgͱ6tFG"ͱ=16tFG α;6tFG#-  6tFG@cy6tFG[C$E6tFG*W56tFG C{6tFG=Юz6tFGFC::6tFGB׶ 6tFGPC*6tFGrL66tFG`αi6tFGC& 6tFGn-r2^OQ6tFG[E=6tFG[\=6tFGgAb46tFG\16tFG.C h*:Y6tFG\E?r6tFGcextFGhqc6tFGg F6tFG6F 6tFG~\BTm6tFGG6tFG~1α,H6tFGXC`Hc6tFGH,6tFGrα;6tFG^.`n+VL6tFG1 ϱW56tFGpoM6tFG i(c76tFG`ϱ#6tFGg@;Xգ6tFGmC`s96tFG*H%-_6tFG1ix6tFGG6tFGSه76tFGA I26tFGϱ*WT6tFG=qg6tFG Ō6tFGItiq6tFGCϱ@+6tFG4R|-.6tFGwq бʺgw6tFG` T76tFGCj%z6tFGq`бm6tFGqбyYT6tFGqбa6tFG;_|6tFG<8ܮy6tFG 6tFG@J\6tFGDJΨ,6tFG]2pd6tFGd 3=o6tFG/K7/6tFG !w6tFG ѱ6tFG%rlqZ ^6tFG ;/6tFGLت]6tFGV2 m)Ns6tFGq2t6tFGv@M_6tFG`uN6tFG2NCy+6tFGM|6tFG`N\D6tFGUr6tFG`ѱ6tFGO=46tFGO*6tFG-fo6tFG@P6tFGQWH6tFG'``r6tFG8 6tFGpϿrQ6tFG?D n?5I6tFG?`Q6tFG/ 6tFG޲7.P6tFGZnϳ6tFG`I6tFGR46tFG2ࢵeR6tFG olhh6tFGi y *6tFG_ ;}6tFG1 -]6tFG` 6tFG@SA{O6tFG~)m<6tFG`O6tFGE-M46tFG,T3ܷt6tFGHT@4 o6tFG6;6tFG 6tFG4֛6tFGE;KJ6tFGO5}D6tFGg`5Pg6tFG7@< )6tFG}pAt6tFGÏd'V6tFG7F6tFGN`U?6tFG U4Wgi6tFGLF 6tFG qV6tFGPt6tFGUS6tFG@V>H6tFG25-T6tFG 66tFGrm6tFGr6{$6tFG3 &Z6tFG`?0՟6tFG MM6tFG`g6tFG` B6tFG`U9-np6tFGS كl6tFGѱy6tFGe5ѱw6tFG = 6tFG5 T76tFG!Ϲт6tFG~৾OD6tFG`a6tFGc@OeK6tFGa6c66tFG`U3-6tFG GϨ6tFG@7-6tFGW=>b6tFGy7\k6tFG߹ 6tFG3GyB6tFGzs`Ws6tFG!6tFGNaxs6tFG ұ_W#6tFGߌGU6tFG>aO6tFG8L6tFG"6`ұJ6tFGa .'&6tFGu 6tFG4`W 6tFGWJP96tFG= \6tFGb XG6tFGX-=6tFGbJcf6tFG͍E tw6tFGDH hp6tFG8{2!6tFG v^6tFGg`=!F46tFG2u 9!E6tFGi`Ztd$6tFGZ$v6tFGX [6tFGsv6tFGM6tFG[K"6tFGvE6tFG%R]%6tFG8`#6tFG5]sx̪6tFGv`]xo6tFGK"6tFG&]t6tFGyގ6tFGH`搘6tFGK7 h6tFG @Q 6tFG@:"6tFGX >W$6tFG996tFGI Bz6tFG4u{6Tr:6tFGcұjt6tFG 746tFGRұ6tFG+_36tFG\V^zw6tFGurH6tFGW@_H6tFGuwv786tFG`6tFGVv|`i6tFG``+HM6tFGdVu6tFG 6tFG y$6tFGa܎6tFGdb6tFGV Gb6tFGg9 <_6tFGwF_Rj6tFGG&z6tFGj H4=6tFG0Ͽ?6tFGi`EK<6tFGϩcHr6tFGவ'4@6tFGXW@xk6tFG6tFGֺJ6tFG: dA6tFG3<ȑ*6tFG4: L 6tFGeNС"6tFG(TAA6tFGK@"6tFGeA6tFG6tFG:`i7"6tFG .sa6tFGkjdp06tFGw %6tFG|(t6tFG`ӱ<06tFG a'6tFGM+6tFG ӱ`6tFGr@=66tFGK@f{6tFG&y=L6tFGJ"ǻK6tFG^"}T56tFGBs6tFGr"ӱ[LL6tFG>|56tFGf6tFGX%i56tFG" 6tFG`6tFGf{6tFG` ~6tFG`w@ 6tFG7 ~696tFGNu_6tFGv# #m6tFGx)h6tFGLgV#6tFGL*ih6tFGeg6tFGX@hj>ir6tFGx%6tFGx~'j6tFG4Y`> "{6tFG# {,?6tFG`$x?6tFG7 T~K6tFG# p6tFG#`E욲6tFG$F{6tFG$,{cE6tFGLha6tFGiF6tFGC-f6tFG`;`iG 6tFG jE]6tFG@Ƽ-6tFGM9+6tFGf MI6tFGajL6tFGg ?7J6tFGM <6tFGmbA@l6tFG$Ǽ }6tFGmK6tFG*+6tFGg?JT:6tFG/8 6tFGnC6tFG?-rP6tFG0 6tFGB%`o46tFG`Աi%6tFGԱ6tFGp6tFG@qdlw=6tFGq;b6tFGr \)6tFGwd6tFG`rNUK6tFGr<6tFGE6tFG%6tFGg@6tFG%!Mf6tFGXAgo6tFGH 8b6tFGnK{6tFG_<Աe6tFGz7_{6tFG1`A06tFGs876tFG u'Tb6tFGto6tFGg`udp6tFGv6tFG<A?6tFG/`ձry6tFGձ6tFGA@*j6tFGg`6tFGMJ6tFG&r6tFGձ6tFGi: M6tFG;36tFGgv]6tFGb6tFGCni6tFGŕ .|6tFG=<r6tFGo˼76tFG=]6tFGMz`WR6tFGjzxzE6tFGzZ6tFGv<`x:6tFGxcQ6tFG=ޣ@6tFG KI3LU6tFG>>6tFG ,6tFG.h y6tFG36tFGh@, !6tFG=y 6tFGA+c6tFGyRJ6tFGb`Dhv6tFG&u6tFG&B 6tFG^`36tFGoZ6tFGaD6tFG* i6tFG6(f6tFGhDؗJ6tFGhy6tFGa@q6tFG-!6tFGB2:6tFGhE\oo 6tFGEcwP6tFG=Oz 6tFGh@Fj6tFG;` 6tFGhlRT6tFGĖFl6tFGh m6tFGi"y6tFGՖG穋t6tFGI D6tFGeA?*6tFG@B8^6tFG>@T66tFGNvn6tFG| ֱ $6tFGh6tFGJ' |{6tFG^'|6tFG|OEH/-6tFGE ;a6tFG.FO\6tFG|FZ^6tFGiG?b6tFGG$6tFGH@:6tFGOHm6tFG `+w6tFG ~6tFG`~kM6tFG'o6tFG/ 6tFG eX6tFGO`ֱA&6tFGcV46tFGwL8{(6tFG@ D 6tFGֱh"6tFG(`A6tFG\}M⟷6tFG6tFG(Bv,6tFGֱ l6tFG ױ0)6tFG `ױ#6tFGױI6tFG߸ң6tFG%ױ=6tFG366tFGۍ6tFG? ر01ww6tFG`ر<6tFGݐ-tFG8u<tFGjh6tFGj`)`n6tFGy؜6tFGBܱ36tFG)CU4k6tFGP+:6tFG ~ܱN6tFG{ཱུF6tFGE6tFG@O)A(6tFG@uB6tFG(\ ݱ6tFG) d6tFG)`~6tFGN~Fp6tFG^Un K6tFG@# 6tFGws6tFGlS`6tFGnR6tFGK4p06tFGnµwG6tFG%`սF6tFGU6tFGSE;6tFG`6tFG7 {Y?6tFGn<]6tFGkVZ+6tFGX6tFGS ֽ6tFG̀N6tFG,U6tFGk i6tFG"}Kq6tFG 16tFG>#:X6tFG>o@L9N6tFG|mA6tFG`ɻ2`6tFGTF,]6tFG4?@vf6tFGn26tFG`F)S6tFG?L9 6tFG/6tFG,$JD|6tFG@{6tFG6`$?6tFG.p%X6tFGߝ$c6tFGD 6tFG^,{6tFGb-kW6tFGpOKdZ6tFG`M6S6tFGV %1<#6tFG^@-}Au6tFGs6tFGEj6tFG'@`Kf,6tFGxbF6tFGO6tFG/ )6tFG-( )6tFGz@o6tFGh6tFGt}Ի6tFG^r6tFG-%&ݺ6tFGEO7Q6tFG@ N?;6tFGֽ1Ba6tFGOC;6tFG΃%tk6tFG.N.q6tFGXĵ S 6tFG^6tFGONf6tFG^qg6tFG] G;6tFGT@O6tFG  #6tFGh')6tFGd6tFG[ǵ[%X6tFG3OV6tFG`*6tFGA%6tFGD~@&Z^6tFGt&6tFG5A'9@u6tFGG6tFGl26tFGo QS6tFG&6tFGȵc6tFG}c6tFGa~`ȵFeu6tFGXE6tFG PF66tFGքK6tFG/`'Kd6tFG6G`Pn`6tFGEG'\6tFGY(O6tFG/|st6tFGp6tFGg 46tFGEqT6tFGɵap6tFG6tFGG ɵ u6tFG/ȼ{*6tFG*Y`$N6tFG\`ʻ-L6tFGy^-͑6tFG Q6tFGZÜ6tFGP6tFGYʻ<%6tFG (6tFGG@еGq6tFGH4es6tFGYyn.6tFGH'6tFGH@Pl6tFG.t௷5M6tFG "6tFGw0l6tFG( 6tFGZ(g6tFGCg6tFGp:6tFG4I e"6tFG4Ie2L6tFG@)" 6tFGU>6tFG)k6tFG6nE6tFGL ߃16tFGt U6tFGCIA4t6tFG Q 6tFG`LY6tFGJ`g..6tFGಷWJ6tFG!J<6tFG!B2p%$6tFG61`ѵ@L6tFGf 6tFG0}6tFGCѵA6tFG ҵt6tFGaIࡻ16tFGpId6tFGV #6tFG6tFG!%q@6tFGbGU9"6tFG`Sb6tFG `fMv6tFGTaU6tFGR16tFG߀@13+6tFG %=y6tFGT96tFG6ҵq96tFGS,1m6tFG WN\6tFG* `6"6tFG +6tFG ࢻ>"6tFGg>NyZ6tFGjo6tFGUAm6tFGdF UDZ56tFG0 ҵ4(6tFG` ~6tFGa`V/;6tFGh ·6tFG@96tFG[q 2MŎ6tFGt6tFG@ӵT6tFGq6tFG#Pӵ06tFGu"Uq6tFG>൷L6tFGgg6tFG@6tFGi}6tFGb`Iv`y6tFG``3>l6tFGࣻ]n6tFGԵhO@:6tFG7[`Ե:6tFG~èW56tFG"D*6tFGȳ m6tFG"@hRr6tFG*+{6tFG"Iz6tFG/`O_6tFGb~Ã6tFGb>6tFGkX?$l6tFG6CԵ56tFG'|6tFG?|%6tFG u8$6tFG+#x0g6tFGyZ6tFGb S6tFG`UcC6tFGQCyF\6tFG\`u6tFG յ@&l6tFGo6tFG 16tFG@Y6tFG յ76tFGDc&&6tFG`y6tFGյ 6tFG; .!6tFG`˻P9M6tFG:2~^6tFGA6tFG ^6tFGwbW6tFG_#`et6tFG;hF6tFG0y6tFGlC@ֵe&6tFG,Q6tFG@HF6tFG#0?]6tFGi V'6tFG#s96tFG`cڍ6tFG\6tFGb2 76tFGi.6tFGv2ֵf]6tFG'6tFGV6tFG׵NqW6tFG[ื6tFGcݛ6tFGc7ۻ6tFG \8 %6tFGc`׵LM6tFGC `6tFG2 B<ח6tFGc6tFGWbJ 6tFG\ j6tFG'@6tFGI!6tFG E6tFGH\$׵%(6tFG:@$ صS6tFGCصQj6tFGdjDM[6tFG$dصc6tFG[/L6tFG\Tt6tFG@ٵ3#6tFG ऻMUH6tFG_Չ6tFG$ )6tFG}$'R6tFGr`k%6tFG(3I6tFG*EXd6tFG< 6tFGVl$6tFGr\nh6tFG)lKpKh6tFGS$F6tFGנ6tFG/@XgY6tFGܳ @6tFG3`*ɸ,Y6tFGʈQ@6tFGJm26tFGG.i6tFG_Qv6tFG_Dٵ[6tFG`C6tFGd˻hWg6tFG@=`6tFG\`ݍ6tFGॻҬ36tFGڵ M6tFG3% 6tFG؇zj6tFGXr$6tFGo6tFG1;6tFG3`OW6tFGɢm6tFG9^ =6tFGzD6f6tFGl L^6tFG GIH6tFGM`d6tFG3J@m\D:6tFG\E(6tFG Ϳ6tFG{mXR6tFG"`̻]_J_6tFGӝ`ڵn 6tFG_঻$z6tFGBJn 6tFG o6tFGՁ6tFGXv6tFG8*36tFGNf6tFGg%B(6tFGji6tFGKj6tFGeo6tFGD@H6tFGe@}6tFG7Q66tFG]&HU6tFG]q6tFGE`q6tFG8f6tFG҉`MN6tFGTfXJ6tFG+6tFGE rx6tFGpf e\6tFG6tFGgn(6tFG6tFG7E"6tFG @·u 6tFGe6tFG@K6tFG7QM26tFGOG6tFG·i-6tFG/@*` 6tFG!) 6tFG*÷26tFG/] g6tFG*`÷ʂ&6tFG+÷BT6tFGŅ' {6tFG56tFGO ķt6tFGf@ʂ6tFGPķrGx6tFG(ķj[6tFG@@ŷ}a66tFGz3ŷ@Y6tFGƷ\\-6tFG`Ʒ( 6tFGD]@+Ʒ16tFGU6tFG7& Ƿ|6tFGREÂz6tFGY]`"6tFGfi)f6tFGǷ6tFG 2s6tFGn]3`6tFG@Ƿ돆6tFGfhg6tFGE@ȷdbB6tFGV@l6tFGm6tFG}g6tFG3+ȷ6tFG7+` I6tFG&,ɷK6tFG&@,6tFGE,`ɷDZx6tFG k"6tFGDMX6tFGɷ3߅6tFG ʷX 6tFGR\6tFGlʷwj;6tFG3ʷ026tFGW@˷d6tFGb̷Zw6tFG`̷T[6tFG@P[p6tFG?e6tFGI$ =)6tFGJʣ6tFGM ,} 6tFGJ̷6tFGJ`d96tFGu>6tFGuc6tFGu|Iv6tFGu @7-6tFG]৻%6tFGv V6tFG3` 6tFG̵ ͷ:6tFG@Rµ6tFGߌj׸6tFG"6`MZm6tFGͷΙ6tFG2K@η6c6tFG4ηi6tFGϷK6tFGu$6tFGgH#?6tFG26tFGзRx6tFG@ѷ%m6tFG`p{v6tFGvh6tFGg@*nB6tFGv +ck6tFGL'6tFG'_*z6tFGѷO,6tFG2C?v6tFGֶ,^6tFGcm6tFGx&S6tFGr d.6tFGiR6tFGK`56tFGva6tFG47&6tFG 8[6tFGK`s6tFG{+%O6tFGҷK66tFG+R6tFGCY>6tFGNwG6tFG<96tFG y6tFGl6tFGՇs6tFG#`H;6tFG<%6tFG6tFGn5t6tFG5`ҷO%6tFGNx@,i=6tFG SՆ+6tFG,?B,6tFG`c%6tFG) - x6tFGqY6tFGF`-H36tFGŦ36tFGf\86tFG< aF6tFGhh^&Mn6tFGh6tFGF AZ6tFG`<6tFG6tFGҷÁm76tFGh ӷ[6tFG5ں-6tFGF Ǵi6tFGJ \@6tFG6W6tFG| y$ƻ6tFG6tFGb `56tFG`G1(6tFG|6tFGӷ8j6tFGӷ ˽I]U6tFG``c[6tFGhD6tFG^6.d6tFG`Y}Wv6tFGp86tFGӷe;6tFG8G-<`6tFGMNR=26tFG4l6tFG`Yl6tFG^ɿU"'6tFG7.$06tFG6 6tFGa`B956tFG, bl6tFGag6tFGa 6tFGa` 6tFGG7,6tFGn` ^6tFG+طՑ|6tFG܍@/ H6tFG/6\6tFGz`ط26tFGSK8,6tFG ٷdd6tFG(\6tFG7λxJ`6tFG  t⍂46tFGc 6tFG __6tFG* U6tFG`L"6tFGg`ؽ·96tFG(j0^6tFG(tuo6tFG BC6tFGDIV^6tFG+Hٷ}c6tFG7 J 6tFGY@K26tFG`0{};6tFGJ^U6tFG~׽i6tFG۷`. L6tFG˽B1E6tFGbK i6tFG)L2K6tFGEs26tFG}1@R6tFGHLLj6tFGT)ݎ6tFG M%w6tFG@]6tFGjMtz6tFGlT(6tFG _6tFGHٷ; %U6tFGo`SDZ6tFG*8@ڷH6tFGz>M76tFGOڷ6tFGv36tFG>8`uc6tFGb Nc6tFG 66tFGjv{ 6tFG"`t6tFGQ6tFG`016tFG9NG6tFG.9 TC6tFGFS6tFG @6tFGI`^T6tFGcr2'6tFGӸ@"Ø6tFGPUR6tFG[=6tFG{ Ě6tFG6tFG=d |ܻ6tFGI`Kg.6tFGI"}6tFG)'L6tFGj9 hl/6tFG `26tFG)IA6tFGIq6tFG୻9y6tFGD۷+9+6tFGZ 6tFG_ bq6tFGxkNR@6tFGW @5/6tFG0@U06tFGk`,06tFGn$6tFGi E6tFG*H.-6tFGqX6tFG l`޷!H6tFG ٽ(>6tFGe`z6tFGOk6tFG8޷qXT6tFG*U: 6tFG  ߷ v6tFGސ 6tFG iU6tFGV[6tFG߷zk6tFG`Vc,6tFG˹`dil6tFG {(6tFG`ϻRG6tFGh)@| d6tFGUU)Y_6tFGlVK6tFGmz6tFGȇX|6tFG)%6tFG`3t6tFGݢ`OOAG6tFG 6tFG`wQ6tFG 6tFGo6tFGO W&6tFG<if6tFG:` 6tFGRO`!F6tFGj0b6tFGjP)6tFGR 1ea,6tFGfu6tFG}Q6tFG{T86tFGXV6tFG x 6tFGք &6tFGrbe6tFǴ Q6tFG’1~'m6tFGRWkq6tFG;6tFG1vܛ6tFG %{^6tFG@4=6tFG`6tFG` t\6tFG>w'" R6tFGة6tFG S{6tFG;  26tFG5M6tFGe`4W6tFGrum6tFG`MǕ6tFG~@2h2t6tFG2x^26tFG&6tFG736tFG7.6tFGK`3k7r6tFG3"96tFG͈ 4<(96tFGC6tFGK@g拇6tFGO.N_6tFG P6tFGO,4D6tFG4D6tFG~@5kt6tFGJf=m 6tFGX ɋ6tFG%``٠f6tFG @6tFG=|D6tFGٽs 6tFGzPI6tFG6tFG Vn΀6tFGM 486tFG3VW6tFG I6tFG/N6tFG0L.6tFG80@(=46tFG`006tFGO5|M6tFG"Y*%}v6tFGWƹvE6tFG:< 96tFGh6tFG ,6tFG`4}'6tFGO&!i'6tFGr*6tFG?%h=6tFG 5<6tFG8T ɸ6tFG>`6tFGN` S 6tFG46BB6tFGE`6*6tFGOM6tFGGT 6tFGVTE[6tFGw`Y6tFGs6tFGg`ˀ6tFG M M6tFG6å6tFG| 6tFGw6tFGm 7=lp?6tFGHV73MrG6tFG7&[A6tFG1=6tFG`S*6tFGpgD6tFG>=@8;l6tFGR=856tFGKWܺ6tFGIൻ.6tFGT`-6tFG^6tFGy $'6tFG"C6tFG#c6tFGVMbBi6tFGUkM?6tFG͹G6tFGgc-`g6tFGhGɔ6tFG=഻1>6tFG-h`1]n6tFGWh`l~6tFG%`ͽʽ6tFGA26tFGnz6tFG7ҹug6tFG1රsQn6tFGMY[JD6tFG7 46tFG76tFG- νt6tFGH෻"6tFG_[;6tFG`2{6tFGxsS6tFGS-฻16tFGm- oć6tFG dV'6tFGC@k6tFG ;6tFG& A6tFGĕ Yy186tFGE\6tFGqkz6tFG'`9H6tFG9q 6tFGZ? :6tFG :K 6tFG: jq6tFG˱@;1#6tFGU`em9x6tFGn? ú)@6tFG v$ 6tFG eu6tFG$;M5e6tFG`%6tFGWfs6tFGZ 6tFG/0 6tFGd 8ug6tFG@[Z(P6tFG[ ;6tFGS<>}C6tFGrV` 6tFGZdR6tFGnr6tFGV ڲ.6tFGBS׏ 6tFG3S 6tFG`!46tFGf6tFG`л^T6tFGV\36tFGz{iW6tFG_)@T^6tFG&W hc6tFG?GT6tFGbW H6tFGqW`gT6tFG ɺ*'6tFG0@ PinSHA256mapstructure:"pinSHA256" FirewallMarkmapstructure:"fwmark" Transportmapstructure:"transport" Bandwidthmapstructure:"bandwidth" TCPTProxymapstructure:"tcpTProxy" UDPTProxymapstructure:"udpTProxy" SpeedTestmapstructure:"speedTest" Outboundsmapstructure:"outbounds""*atomic.Pointer[sync.poolChainElt]"*struct { F uintptr; X0 net.Conn }]+x6tFGn`]!@76tFGWE G.@5 oBG.ݸa6tFG-AlE6tFG6tFG@w ZlG}j%D6tFG4`U VG@O wGNX @  GƩ@/ ٯ\Ga3GH V^G~X@ |:GX <HG` .Gf@ rtS Gvd |G ~]G`a F;$G sq6tFG, CCUG@676tFGy=6tFG&1 W6tFGvEz6tFG@} RtG 7 x G=`ͿjI6tFGKI6tFGC6tFGd  GMG@ ~G ~ ,r0G%@>& 6tFG@ 4Gk ]G 6tFG **OG D".bG[}6tFG2"*func() (*x509.Certificate, error)"*func(*pkix.CertificateList) error RelativeNameasn1:"optional,tag:1""*func(*bisect.dedup) *bisect.dedup6tFG` =)}G = ŎaG 5u-Gd@`ȱ\V6tFG0` ŗsG0 Կ 8=LGؿ G-GS* G` pT'GXP> Ga& h6tFGs wg]Gs` X|G ӣGͶ @mG ]JGQ jG-x &0#HG ` śG8p: 5<(G0 %Gx mGձ Q%G6A``p6tFG/vh6tFGՅ жl Gc k {G~YA66tFG QD6tFG^"*func(*net.Buffers) (int64, error)"*map.bucket[string][]net.nssSource `sG+> ;G, nqG,@ ͡Gb/ GA` 0G qG bqD6tFGZ 8G, IiOG&@- }Go@, G *[G jGQ,A6tFG @f6tFG fvG 5 G 2G3#  {SG`7 |ԧGL0@ 1GA[ {G2BB eRrGp@.ҽ6tFGԏh6tFGGD[6tFG @06tFG`N6tFGȆWK6tFGS wq6tFG  AGp ` AkG 16tFGlྻ HRD6tFGe ˺26tFGn `z6tFG5 i HG `t16tFG˺'6tFGm 3G`iL6tFGL ࿻]6tFG)`TB'6tFGym6tFGfࡰF6tFG$ `"*func([]uint8, int64) (int, error)"*func(string) (fs.FileInfo, error) G[ xDG -.6tFGHFG6tFG%͖z6tFGर G\B 0G "*struct { runtime.gList; n int32 }"*struct { F uintptr; X0 chan int } ;-GK ʱ e@Gd`ʱ "D~Ggʱ ;Gʱ 8Gg ˱m&06tFGg ?G``˱T6tFG WmGg˱6tFGg cOG'`˱+*6tFG' swG/  ̱ fGL `̱6tFGL LGv̱ CG̱ bG- ͱ PpG``ͱc 6tFG k/%Gͱ6tFG 8n"*func(zapcore.ObjectEncoder) error q1G2 un6tFG׉ +@6tFG /vGq36tFG MڛG@@ t3}G LGh qx\G Gs ٸG%n zhGirX|6tFGEMEȶ6tFGX` 6tFG2@޽ G rM Gľ v\HG|"*map.bucket[uint32]*client.udpConn 5tGF 06tFG FGX"*atomic.Pointer[net/http.response] VG@Layoutjson:"layout" yaml:"layout" 6Gh  \GW g݅GҰ×'6tFG @ @hmG.a` 9pGG7"*func(*interface {}) *interface {}"*struct { F uintptr; R *tls.Conn } XOG@Y ":Gx .G  G@@ WG]Gd >Gna  zRG l G@ G`W 0@GW N }G X 0GHX kGO ö G%G3 pIPG Gw`8 G@ү  kG?,  pPGm ` g`GH^ Ź$G^b@"*map.bucket[interface {}]struct {}  h7G5K VjG~b` w!G07] >AG@TvD6tFG ]J`6tFG "*func(uint32, bool, []uint8) error"*func(http.http2FrameWriteRequest)"*func() (*multipart.Reader, error)"*struct { io.Reader; io.WriterTo }"*map[string]*http.http2addConnCall"*http.transportReadFromServerError"*map.bucket[http.http2Flags]string"*struct { F uintptr; X0 []string } OGuH ~EGu`? %QGU^ Sw3GB` 4GS zG  0G* PG7o Gv ޫGrw6tFGwî 9Gw`޼9\6tFGKh  IsrWG  BǑGw mbG ZbGa "CGB Į U3iGb 4G>@ V"Gy Gw^ #G`ǻ N-Gw Ʈ 0bYGC` ┿G UGW ;cG < GtGx9 aGG"` 2nG 4HG, Gc #+G' 'GpX`ʮ  vGs :Gy SIG `M iGӱHH6tFGCx` +6tFG t6tFGenwmb6tFG{ G6" !bGI uԽ+G9  "*func() (crypto.PrivateKey, error)  JhG$J CZGf$ j ,Gb 6tFG@` =G`l"*func(string, uint64, uint64) bool U/XGZ` w)6tFG`"github.com/hashicorp/golang-lru/v2 /G`ʻ+Cn6tFGe x}G`U1.6tFG* #GhN6tFG gG0 \G~?6tFGXWM6tFG,]G_6tFG`l )NG\\`6tFG%a6tFG +6tFG 4^_GY@߮V\6tFGu6tFGκ YG : `i6tFG)`»kJ&6tFG02&6tFG4@A6tFGCAS6tFG  Ύ%wGj% /^G@ LastActiveAtjson:"last_active_at" D}GK6tFGf _\7o6tFG  `6tFG{$ nU7G%r"*func(time.Duration, uint32, bool)  |G<sNRJ6tFGܕQ ,HG_A"*func(*big.Int, *big.Int) *big.Int u$ G< \Gh`Ȼ"*pkix.RelativeDistinguishedNameSET KG<y"*func(reflect.Value) reflect.Value"*func(int, int, int) reflect.Value"*map[unsafe.Pointer]unsafe.PointerMt 6tFG%*UGfC6tFGK + dGr'N G'N o5YG )MG  C+GG =5ԃG'G BG'H G/@ ӷ[GO~H~Q6tFG "*func([]interface {}, bool, error) "b`YGO H EJGOH G`ֱ6tFG G@P6tFG~j`+ i6tFG W1G` C.Gϩ@"*map.bucket[*abi.Type]interface {}"*func(int, uintptr) unsafe.Pointer (0Gj"*func(*bool, string, bool, string)"*func(string, string, string) *int"*func(string, pflag.ErrorHandling)"*func(*int8, string, int8, string)"*func(*uint, string, uint, string)"*func(pflag.Value, string, string)ԅ6tFG@/ pOvG}"*func(parse.Node) (string, string) WG ? vG \ _Gk H cNhGZA 9[Gd~`"github.com/spf13/jwalterweatherman&Q6tFG G~` .#: G қG?6tFGxA Tf?G Z l<GI 'W3GA>V6tFGB@ [GB"*socks5.UserPassNegotiationRequest"*map.bucket[uint16]*tun.TCPSession"*[8]*list.Element[go.shape.*uint8] ᤊGl@!*6tFGɫ`  G ` GwM #)G^m 'GR 9G)@) c_G;`ϴ {G RG*6tFG8* ` n?QtGi ` 1mHG1W66tFGQ1lj9V6tFG] D C5GRi D686tFG> s6tFGWn6tFG݇ Y?P6tFGk(ix 6tFG| /-6tFG^Ѻ wG ( Gy  ?0%6tFG`.E6tFG?@ w6tFG ` _V<G""*func(io.Reader, int) (int, error) ?ÑG2 5oMG$]{ 趪UG _jG~nYR6tFG8K rD6tFGA nl!6tFG` G%ڷ HG>X mWGCl @gGۮ` ^z6tFG -s6tFG1 y6tFGH@Ժr1?6tFG 6tFGRX E6tFG|. ,Gi/ UB%6tFGX]Ժ cmG3 c6tFG>`K6tFGH@ |>G @86tFGQ 6tFG,`"*func(protocol.PacketNumber) error"*quic.sendStreamResetStreamHandler ZGS@N G@w G  rG _6tFG  PsG"x߽U6tFG" #zGC@U M~G: j;GPM )GhT, qsG# r }G] sG}T ߷ $RG>޷ =(:G?ྲྀ ݿ G@Y +G q'G kGM  />GS LGd@ PG  0UG % G` s G[@c6tFG  lGV'qZ6tFG  aG(( 96tFG  K]G(m |6tFGH FeY6tFGaܶv6tFG8_`G6tFG7C6tFGݶWqU6tFG  G ::G@[ 6tFGt`tG,6tFGl `.Y 6tFG @/D6tFG,c386tFGQ Zw8G#``d6tFG9 T|GBEw6tFG \JVG& `.+6tFGൾ6tFG 2 ;/G)' 2]-6tFG׺ќ6tFG4 26tFG(tZ6tFG T-k6tFGw6@غ *G0ټ36tFG.@ aj9G ~ Gĵ ]9G`n!c6tFG< A G<@ +0]Gj"*chacha20poly1305.chacha20poly1305 'T2Gi  3G7 5~GGWrb6tFG= pGq@ɭ  ?GG G"*func(string, string, net.IP) bool %G.`' GD` myGW "`GT ɵ6tFG u"*func(*dns.DNSKEY, []dns.RR) error"*struct { R *big.Int; S *big.Int } ׎G࠷ GYQ 4G ~Gܠ lxG.s  yeGs (Ŧ6tFGH`u ' G` xu6tFG{@/ {WG' Gc E"Gu@ GrЭ &<GH OGExpiryjson:"expires_in,omitempty"Intervaljson:"interval,omitempty" kGW!(P)6tFGfɶ>6tFGh?@\Z6tFGC346tFG uHostnamejson:"hostname,omitempty""*govultr.ContainerRegistryMetadata MaxStorageMBjson:"max_storage_mb""*[]govultr.ContainerRegistryRegionVersionsjson:"versions,omitempty"Databasejson:"database,omitempty"Usernamejson:"username,omitempty"Passwordjson:"password,omitempty" RedisACLKeysjson:"redis_acl_keys""*govultr.DatabaseMigrationStartReq"*govultr.DatabaseVersionUpgradeReq MaxRuleCountjson:"max_rule_count"SSHKeysjson:"sshkey_id,omitempty" V4SubnetMaskjson:"v4_subnet_mask""*govultr.RequestCompletionCallback"*govultr.ApplicationServiceHandler"*govultr.MarketplaceServiceHandler"*govultr.DatabaseAvailableVersions"**govultr.containerRegistryRegions"*govultr.objectStorageClustersBase ywhG Y<G ` L'G$v pGRI pcGaB |rGࡻ kG SWGZ z;7GJ1 sRG^1`f q&GOT !6G1` t cGT Nz'G`V FXPGU Ь&G G@ |#G [ ձpGb & G{ࣻ zG߳`Ե liGC`U ۝bGE# T`Gu Gy# _PCG V "{G[ uhGC >G‡ Gu !G M;GW WFk^Gt ySG3\@zSڊ6tFGF4d6tFG2  G2 SqGCऻ TGD dG=(  Q+G* G2l RPG$@X fyG GnG ,&G% >=dGs` \G` ChG\X qG lCGM%l i~Gڢ@m = Gnum AGn T\G\ o˅6tFG@w6tFGP@6tFG,6tFG;I6tFG Cb@6tFG F6tFG8 C d6tFG  6tFG*V QQ6tFG]@L?6tFG&Ts%6tFGE4m6tFGEk6tFGf@W6tFG]խ06tFGbݭׅ6tFGɶ=vw6tFG9@ޭ#6tFG ݭ t~G] "9G[@ HGm ߒGj %PG} *(BG@ DdG"PreferSkipResumptionOnNilExtensionDatajson:"key_exchange,omitempty" reG WJkGo 1G]G໴ |Gna  AGb ͷ 5G %=G  8G` yAU1G4ͷ G@η lGη GϷ GNv`` |:kG@^@ѷ '̊GĿ ԖGj^@ m1 1GĊſ G^ ./Gڊ ǿ W`G^ G`ȿ |qG^ čG^` "crypto/internal/edwards25519/field"*func(*bigmod.Modulus) *bigmod.Nat )FGv JHGK`ͻ vuG@ K(G  +V4IG{_ DGY naG` БGEŹ DgFG4` cG ^}PG@b ^j,<Gk+ G sKhGY@ ݕ(G8`઻ 06tFG/ G!M =kGe C,Gb` a]dgGƹ"*map[reflect.Type]*yaml.structInfo G{M@ NG ӷ  A"G N}G|W wGG QЅG  )G` .*GG 3G' "0G'ӷ [G`` @]G bG`iE6tFG @" ~Gu q [_G a. >LGӷ oG>NP Ai#TG `շ pRG ɿ  'tGa = .GD K{G ` ]HGdi  ^LMGi "¤G]` "~Ga RQG NtG  C8G Gv oJGb )G  ȬrGY(`Y 4G3 `"*interface { IsMessageSet() bool } qE6tFGi tG`I R GF `󧱍6tFG.0"*protoreflect.ExtensionDescriptors"*func(int) protoreflect.FileImport"appendUninterpretedOption_NamePart"*func(protoreflect.FileDescriptor)"*func(protoreflect.EnumDescriptor)"*protoreflect.EnumValueDescriptors"*func() protoreflect.ExtensionType f[Gj xtGb  aGIҴ &m\G90 E6tFG~q G "SetMaxAckHeightTrackerWindowLength"limitMaxAckHeightTrackerBySendRate"*func(congestion.RTTStatsProvider) D/G &\@NGu`޷ Ŀ_G "*protocol.ArbitraryLenConnectionID"github.com/apernet/quic-go/logging 8GG` ̔!Gմ +yGg߷ kG*"*func() (bool, protocol.ByteCount)  G: d*WGW `G  2G1 fRG$|"writeLiteralFieldWithNameReference `PvG ^6tFGx MޘGqQ rK\GG OIuG n6tFGq@% KG JYI6tFGy >6tFG@y ɕ[G *G~ U@3lG.~  rG4 V0G^~ ,8G"` W}G0 QJGe =Gu` 1KG =G P=GeaV6tFG<γ׆6tFG<γ6tFG<ϳ C6tFG<@ϳs6tFG=ϳ'Y6tFG=ϳb:6tFG*=г D=[Gn! n*Gc (G)` {rGeTa aGT s"*func(protoreflect.EnumType) error"*protoregistry.extensionsByMessage %YG, `{G GV w~GT 0Gw7 ?;Gл aiG6@X`BM 6tFG6X "GXT+6tFGX"*map.bucket[string]*filedesc.Field"*func(*filedesc.FieldRanges) error"*map.bucket[filedesc.pathKey][]int wGb Gz =G ?QG a 1G̹ 3G@ Gz=` \x]G `G G= [GGd Gx  5*G; MG # GGgй tG= V{<GBh@ TPGhѹ gCG ̿ ,G˽ +BGlh G4ӹ %+?G ۘGh G҉b"*map[protowire.Number]interface {}"*map[reflect.Type]protowire.Number"*map[protowire.Number]reflect.Type"*[8]protoreflect.MessageDescriptorSM&6tFG8G@3X6tFG2TKO6tFGǧ3'6tFGFc0OF6tFGOc1 FILG`E$ȁ6tFG0AY6tFG@1 38G>n ;G>n I/G o vG\* f|GQ  G c X _Guuo6tFG)n_v6tFG')26tFG5)@pC6tFGQ) jG fG+@ ؁GG@ 3G iG G O4G+#*[]*trafficlogger.trafficStatsEntry#*func([]uint8) (*big.Int, *big.Int)RevokedCertificatesasn1:"optional"#*weak.Pointer[net/netip.addrDetail]#*func(*abi.Type, interface {}) bool#*func(fs.DirEntry, fs.DirEntry) int#*func(interface {}, uintptr, int64)#GenPowerShellCompletionFileWithDesc#*map.bucket[string]encoding.Decoder#*map.bucket[string]encoding.Encoder#*func(...zapcore.Field) *zap.Logger#*[]func(*url.URL) (zap.Sink, error)#*func(zapcore.ArrayMarshaler) error#*func([]zapcore.Field) zapcore.Core#*map.bucket[string]*tls.Certificate#EncryptedClientHelloRejectionVerify#*func([]uint8) (cipher.AEAD, error)#*struct { F uintptr; X0 *tls.Conn }#*func(http.http2writeContext) error#*func(string) (*http.Cookie, error)#*func(net.Listener) context.Context#*map.bucket[*net.Listener]struct {}#*http.http2roundRobinWriteScheduler#*map[uint32]*http.http2clientStream#*map.bucket[[8]uint8]chan struct {}#*map[string][]*http.http2ClientConn#*map[*http.http2ClientConn][]string#*http.http2clientConnPoolIdleCloser#*map[string][]*multipart.FileHeader#*struct { F uintptr; X0 time.Time }#*func(context.Context, string) bool#*[]*certmagic.RingBufferRateLimiterZoneNamejson:"zone_name,omitempty"APITokenjson:"api_token,omitempty"RRSetTTLjson:"rrset_ttl,omitempty"#*func([]uint8) (int, string, error)#*func([]uint8, string) (int, error)#*map[uint32]*server.udpSessionEntry#*outbounds.invalidOutboundModeError#*outbounds.PluggableOutboundAdapter#*func(*big.Int, int, uint) *big.Int#*func(string, int) (*big.Int, bool)#*func() (io.ReaderAt, int64, int64)#*func([]int) (reflect.Value, error)#*func(reflect.Value, reflect.Value)#*map.bucket[*reflect.structType]int#*struct { F uintptr; X0 *abi.Type }#*map.bucket[dnsmessage.Class]string#*map.bucket[dnsmessage.RCode]string#*func(*int, string, string, string)#*func(string, int16, string) *int16#*func(string, int32, string) *int32#*func(string, int64, string) *int64#*func(string, []int, string) *[]int#*func(string, uint8, string) *uint8#*map.bucket[reflect.Value]struct {}#*func(bool) ([]netip.Prefix, error)#*udpnat.Service[net/netip.AddrPort]#*func(netip.AddrPort, *udpnat.conn)#github.com/sagernet/sing/common/buf#*func(network.ReadWaitOptions) bool#*func() protoreflect.EnumDescriptor#*func(quic.Connection, uint64) bool#*func(congestion.CongestionControl)#*func(*wire.ResetStreamFrame) error#*func(protocol.StatelessResetToken)#*func(*list.Element, *list.Element)#vendor/golang.org/x/net/http2/hpackRendezvousServersdns:"domain-name"#*func(dns.ResponseWriter, *dns.Msg)#*func(*dns.Header) ([]uint8, error)UserDatajson:"user_data,omitempty" IncomingBytesjson:"incoming_bytes" OutgoingBytesjson:"outgoing_bytes" ArtifactCountjson:"artifact_count"#*govultr.ContainerRegistryPlanTypes#*govultr.ContainerRegistryUpdateReqMinValuejson:"min_value,omitempty"MaxValuejson:"max_value,omitempty" InstanceCountjson:"instance_count"ScriptIDjson:"script_id,omitempty"BackupIDjson:"backup_id,omitempty"MinNodesjson:"min_nodes,omitempty"MaxNodesjson:"max_nodes,omitempty" ClusterSubnetjson:"cluster_subnet" ServiceSubnetjson:"service_subnet" FirewallRulesjson:"firewall_rules"#*govultr.BlockStorageServiceHandler#*govultr.FireWallRuleServiceHandler#*govultr.databaseConnectionPoolBase FirewallGroupjson:"firewall_group" LoadBalancersjson:"load_balancers" ObjectStoragejson:"object_storage" S3Credentialsjson:"s3_credentials" StartupScriptjson:"startup_script"#github.com/babolivier/go-doh-client#*map.bucket[string]template.element#*map[danger.TypeID]map[string][]int#*map.bucket[reflect.Type]gob.typeId#*map[netlink.BondArpValidate]string#*map[netlink.BondFailOverMac]string#*map.bucket[netlink.BondMode]string#*map[string]netlink.BondArpValidate#*map[string]netlink.BondFailOverMac#*func(protoreflect.FieldDescriptor)#*func() protoreflect.FileDescriptor#*func(protoreflect.SourcePath) bool#appendDescriptorProto_ReservedRange#*func(protoreflect.EnumNumber) bool#*func(protoreflect.OneofDescriptor)#*func(int) protoreflect.MessageType#SetAckAggregationBandwidthThreshold#reduceExtraAckedOnBandwidthIncrease#bytesLostWhileDetectingOvershooting#*func(protocol.Perspective) []uint8#*func(protocol.ByteCount) time.Time#*func(...interface {}) *slog.Logger#*map.bucket[string]syntax.charGroup#github.com/hashicorp/hcl/hcl/parser#*map.bucket[reflect.Type]*gob.encOp#*[]protoregistry.extensionsByNumber#*[]func() protoreflect.ProtoMessage#*map[protoreflect.Kind]reflect.Type#*func(coding.Version, coding.Level)#*func(*coding.Bits, coding.Version)#*func(time.Time) protocol.ByteCount#*func() (bpf.RawInstruction, error)#github.com/cloudflare/circl/xof/k12#github.com/cloudflare/circl/dh/x448#github.com/hashicorp/hcl/json/token#*func(*internal.Vec, *internal.Vec) BindDevicemapstructure:"bindDevice"$*unique.Handle[net/netip.addrDetail] Salamandermapstructure:"salamander" DisableUDPmapstructure:"disableUDP" ListenHostmapstructure:"listenHost" StatusCodemapstructure:"statusCode" ListenHTTPmapstructure:"listenHTTP" ForceHTTPSmapstructure:"forceHTTPS" Masquerademapstructure:"masquerade"$*func(*os.dirInfo, *os.dirInfo) bool$*map[quic.Stream]*server.StreamStats$*[8]*trafficlogger.trafficStatsEntry$*func(*godebug.value) *godebug.value$*interface { As(interface {}) bool }$*func(int) (syscall.Sockaddr, error)$*runtime.goroutineProfileStateHolder$*func(runtime.goroutineProfileState)$*struct { name string; called bool }$*[8]func(*url.URL) (zap.Sink, error)$*map[string]*forwarding.sessionEntry$*func(*http.response) *http.response$*func(zapcore.ObjectMarshaler) error$*func(*sync.readOnly) *sync.readOnly$*map.bucket[interface {}]*sync.entry$*map[*http.http2serverConn]struct {}$*func(context.Context) *http.Request$*map.bucket[uint32]*http.http2stream$*map.bucket[string]*http.routingNode$*map[*http.persistConn]*list.Element$*map.bucket[http.http2ErrCode]string$*map.bucket[http.http2SettingID]bool$*map.bucket[string]http.RoundTripper$*struct { F uintptr; R *net.Dialer }$*struct { F uintptr; X0 chan error }$*func(context.Context, string) error$*map.bucket[string]*certmagic.Config$*[8]*certmagic.RingBufferRateLimiter$*map[string]*certmagic.soaCacheEntry$*map.bucket[string]certmagic.KeyInfo$*map.bucket[string]certmagic.Storage Algorithmjson:"algorithm,omitempty" Proxiablejson:"proxiable,omitempty"$*map.bucket[string]cloudflare.cfZone$*map.bucket[string]gandi.gandiDomain NotBeforejson:"notBefore,omitempty"Authorizationsjson:"authorizations" Validatedjson:"validated,omitempty" HookedReqAddrjson:"hooked_req_addr"$*func(*rand.Rand, *big.Int) *big.Int$*func(int, int) (cipher.AEAD, error)$*func(string) (reflect.Method, bool)$*map.bucket[*reflect.structType]bool$*func(string) (time.Duration, error)$*func(*int16, string, int16, string)$*func(*int32, string, int32, string)$*func(*int64, string, int64, string)$*func(*[]int, string, []int, string)$*func(*uint8, string, uint8, string)$*struct { F uintptr; R buffer.Pool }$*func([]uint8, []uint8) (int, error)$*func(io.Reader, int) (int64, error)$*v2geo.isDomain_Attribute_TypedValue$*func() (quic.receivedPacket, error)$*map[protocol.StreamNum]quic.streamI$*func(http3.QUICEarlyListener) error$*map.bucket[string]map[string]string$*func(int, map[string]struct {}) int$*func(crypto.Signer, []dns.RR) error SSHKeyIDsjson:"sshkey_id,omitempty" V6NetworkSizejson:"v6_network_size" Enumeralsjson:"enumerals,omitempty" NumberOfNodesjson:"number_of_nodes" NSPrimaryjson:"nsprimary,omitempty" SHA512Sumjson:"sha512sum,omitempty" Instancesjson:"instances,omitempty"GPUVRAMjson:"gpu_vram_gb,omitempty" Continentjson:"continent,omitempty"$*govultr.DomainRecordsServiceHandler$*govultr.FireWallGroupServiceHandler$*govultr.ObjectStorageServiceHandler$*govultr.StartupScriptServiceHandler$*govultr.databaseAdvancedOptionsBase$*govultr.databaseConnectionPoolsBase$*govultr.marketplaceAppVariablesBase$github.com/hashicorp/hcl/hcl/printer$*func(string) *properties.Properties$*func(string, string) (string, bool)$*map.bucket[netlink.IPoIBMode]string$*map.bucket[string]netlink.IPoIBMode$*bufio.syscallVectorisedWriterFields$*func([]netip.Prefix) []netip.Prefix$*func(protoreflect.ProtoMessage) int$*struct { pragma.NoUnkeyedLiterals }$*func() protoreflect.EnumDescriptors$*func(protoreflect.MethodDescriptor)$appendDescriptorProto_ExtensionRange$*func() protoreflect.SourceLocations$*func(int) protoreflect.ProtoMessage$*func() protoreflect.OneofDescriptor$*func() protoreflect.FieldDescriptor$*map[int32]protoreflect.ProtoMessage$*func(protocol.EncryptionLevel) bool$*func(time.Time) ackhandler.SendMode$*func(ipv4.ControlFlags, bool) error$*func([]string, slog.Attr) slog.Attr$golang.org/x/crypto/chacha20poly1305$*func(*gob.encEngine) *gob.encEngine$*map.bucket[reflect.Type]gob.gobType$*func(protoreflect.MessageType) bool$*[8]protoregistry.extensionsByNumber$*func(impl.pointer) protowire.Number$*func(time.Time, protocol.ByteCount)$github.com/cloudflare/circl/ecc/p384$github.com/hashicorp/hcl/hcl/scanner MaxPathLenasn1:"optional,default:-1"SubjectUniqueIdasn1:"optional,tag:2"%*func([]uint8) (int, net.Addr, error)%*func([]uint8, net.Addr) (int, error)%*struct { F uintptr; X0 *sync.Mutex }%*struct { F uintptr; X0 *time.Timer }%*func(*abi.Type) (interface {}, bool)%*[]weak.Pointer[net/netip.addrDetail]%*map[chan<- os.Signal]*signal.handler%*func() runtime.goroutineProfileState%*map.bucket[string]runtime.metricData%*func(io.Writer, string) (int, error)%*func(*cobra.Command, []string) error%*func(func(*cobra.Command, []string))%*map[pflag.NormalizedName]*pflag.Flag%*map.bucket[string]*template.Template%*map.bucket[interface {}]interface {}Initialjson:"initial" yaml:"initial"%*struct { F uintptr; R net.Listener }%*func() (*protocol.UDPMessage, error)%*struct { F uintptr; R client.udpIO }%*func(func(interface {}) error) errorTimeKeyjson:"timeKey" yaml:"timeKey"NameKeyjson:"nameKey" yaml:"nameKey"NewReflectedEncoderjson:"-" yaml:"-"%*map.bucket[zapcore.Level]color.Color%*struct { ptr interface {}; len int }%*func(string, *http.routingNode) bool%*map.bucket[http.connectMethodKey]int%*http.http2duplicatePseudoHeaderError%*func(string) (*http.Response, error)%*struct { F uintptr; R http.Handler }%*struct { F uintptr; R *atomic.Bool }%*func(string) []certmagic.Certificate AutoAddedjson:"auto_added,omitempty" CreatedOnjson:"created_on,omitempty" RRSetHrefjson:"rrset_href,omitempty" RRSetNamejson:"rrset_name,omitempty" RRSetTypejson:"rrset_type,omitempty"%*struct { CSR string "json:\"csr\"" }%*func(string) (server.UDPConn, error)%*struct { F uintptr; X0 *tls.Config }%*trafficlogger.trafficStatsServerImpl%vendor/golang.org/x/crypto/cryptobyte%*map.bucket[dnsmessage.section]string%*map.bucket[string]*singleflight.call%*func(string, []bool, string) *[]bool%*func(string) (map[string]int, error)%*func(string, net.IP, string) *net.IP%*func(string, string, []string) error%*func(string, string, string) *string%*func(string, uint16, string) *uint16%*func(string, uint32, string) *uint32%*func(string, uint64, string) *uint64%*func(string, []uint, string) *[]uint%*func(string, ...interface {}) string%github.com/sagernet/sing/common/cache%*struct { F uintptr; X0 *tun.System }%*struct { F uintptr; X0 *[9]uintptr }%github.com/apernet/quic-go/quicvarint%*func(protocol.EncryptionLevel) error%*map.bucket[string]quic.indexableConn%*func(int64) (*multipart.Form, error)%*func() (textproto.MIMEHeader, error)Reasonasn1:"explicit,tag:0,optional"%*func(int) (crypto.PrivateKey, error) TokenTypejson:"token_type,omitempty" ExpiresInjson:"expires_in,omitempty"PendingChargesjson:"pending_charges" IPAddressjson:"ip_address,omitempty" BlockTypejson:"block_type,omitempty" PrivateIPjson:"private_ip,omitempty"DatabaseEnginejson:"database_engine"MaintenanceDOWjson:"maintenance_dow" AltValuesjson:"alt_values,omitempty" EnableVPCjson:"enable_vpc,omitempty" AttachVPCjson:"attach_vpc,omitempty" DetachVPCjson:"detach_vpc,omitempty"DDOSProtectionjson:"ddos_protection"AvailablePlansjson:"available_plans"CompressedSizejson:"compressed_size"BackupSchedulejson:"backup_schedule"ContainerRegistriesjson:"registries"ConnectionPooljson:"connection_pool"FirewallGroupsjson:"firewall_groups"ForwardingRulejson:"forwarding_rule"ObjectStoragesjson:"object_storages"StartupScriptsjson:"startup_scripts"%github.com/refraction-networking/utls%*map[netlink.BondArpAllTargets]string%*map[string]netlink.BondArpAllTargets%*map.bucket[string]netlink.TuntapMode%github.com/sagernet/sing/common/bufio%github.com/sagernet/sing/common/shell%*map[protoreflect.Kind]protowire.Type%*func(protoreflect.ServiceDescriptor)%*func(int) [2]protoreflect.EnumNumber%*func() protoreflect.FieldDescriptors%*func() protoreflect.OneofDescriptors%*func(protoreflect.MessageDescriptor)%*protoreflect.ExtensionTypeDescriptor%*map.bucket[int32]impl.ExtensionField%SetLimitMaxAckHeightTrackerBySendRate%*func(congestion.ByteCount) time.Time%hasGoodBandwidthEstimateForResumption%*func(*wire.TransportParameters) bool%github.com/apernet/quic-go/congestion%*func() (bool, protocol.PacketNumber)%*func(protocol.ByteCount, bool) error%*flowcontrol.ConnectionFlowController%*flowcontrol.connectionFlowController%*func(*net.Interface, net.Addr) error%writeLiteralFieldWithoutNameReference%vendor/golang.org/x/text/unicode/norm%*map[*syntax.Regexp]syntax.printFlags%*map.bucket[string]internal.AuthStyle%github.com/hashicorp/go-retryablehttp%*func([]uint8) (kem.PublicKey, error)%parseOptionalWhitespaceCommentNewline%*func(protoreflect.MessageType) error%*interface { GoPackagePath() string }%*map[protowire.Number]*filedesc.Field%*map[protoreflect.Name]*filedesc.Enum%*map[protowire.Number]*impl.fieldInfo%*func(time.Time) congestion.ByteCount%github.com/cloudflare/circl/dh/x25519%github.com/hashicorp/hcl/json/scanner%*func(*internal.VecL, *internal.VecL)%*func(*internal.VecK, *internal.VecK)&github.com/apernet/hysteria/app/v2/cmd&*func(net.Addr, string, string, error)&*func(net.Addr, string, uint32, error) HopIntervalmapstructure:"hopInterval" IPv4Excludemapstructure:"ipv4Exclude" IPv6Excludemapstructure:"ipv6Exclude" TCPRedirectmapstructure:"tcpRedirect" DisableHTTPmapstructure:"disableHTTP" AltHTTPPortmapstructure:"altHTTPPort" RewriteHostmapstructure:"rewriteHost" ListenHTTPSmapstructure:"listenHTTPS"જ3GWɱd 3G)Q3G*ɱZ#/3G>/D3G B@23Gͱ-3GP i3G}/׌ 3G a3GS w :3G? @SߕY3Gb @ 3Gƃ@/2} 3G^X@/D 2tFG}( 2tFG'߸R%P 2tFG@ :Z 2tFG׃@1g+ 2tFG@|J 2tFG@1h3G ̱3G&*atomic.Pointer[internal/bisect.dedup]Y3GO@`Ȼw3G) 3GN3G) c3G-n3G/ ǿW3G0`ȿW3G0Ŀ3G:0ſl?J3G@Im3GuͶ3GlͶ 3G?+3GKy3G* ~33G O3GYN B3G`ʱgm3G ˱ +3G`{U3G* ˱?$3Gͱa3G*˱\]H3G ̱}F3Gm|&*map.bucket[net.hostLookupOrder]string&*struct { F uintptr; R *net.Resolver }RhJ3G/Q1g3Gu0k\3GYԿN3Go `3GC˱ 2tFG]$y 2tFG ̱KO 2tFGF&s 2tFG ̱ޏ$ 2tFG @U3G z3GNẔe3GAֱw:3G`#3G~@3G^ZʱH1N3GZ`˱sz; 2tFG3, 2tFGV ̱U~* 2tFGm`_F 2tFG۵3G@3GB`A 2tFGpM5%3GG&*func(unsafe.Pointer, uintptr) uintptr&*[8]weak.Pointer[net/netip.addrDetail]'3G-1-23G| 5&63G 5|83G n3G Dސ3GGf c3G} 僎3G0`7S3G|-`7ٝR>3G-@`3G5 &*go.shape.interface { Error() string } g3GGBȻ_W3G,˱֧3GoU3G α%3Gϱ:C3G{ϱr3Go6f|3G αTL03G]ͱY3G{/`˱i 2tFGͱ0 2tFG%`˱_3G@`Id3GDױh3G> UI3Gbp`3G '?b3GlR!`J3Gӷ i5yp3Gxpȿ,83GDph3G 203G]3G?3)3GIͱ6\3Go3F13GNO;3GpxW 2tFGk Սh 2tFG p3Gp@&*func() func(*cobra.Command, []string)&*func(interface {}, interface {}) bool]3GȜ@p3G ev3GZ n3G -3G=!\3G B|< 3Grf@3G93Gd { 3G/ !zC3G໰t!3G,]O3Gϸd6/3Gw@ Q3G`-3GK3G=n3G *Y3G#Y@S5B3G `<3GZ໰3G13G 7e3G g+3G sS3G|3GLlmj3Gqm3G]&*struct { F uintptr; X0 *[]io.Closer }t3GE@$F׈3Gŝ s3Gq  3GTcaT3GB@$z>83Gq s3G`&*struct { F uintptr; X0 *http.Server }Ư 2tFG_Ż&github.com/sagernet/sing/common/x/listk3G l 3G"F>3G0<3^3G q:3G#%3G r:F 2tFGTj^R3G@W3Gž@4|z? 2tFGR&*func(time.Time, time.Duration) uint643G ͱ5q3GǺ̱\3G``ͱQ,3Gʱc|3G ʱqR3G`zM3G2wu3GK&*map.bucket[context.canceler]struct {}&*func(string, *tls.ClientSessionState)&*tls.handshakeMessageWithOriginalBytesx3GG@]d{3G^k;3G/`J\n3Gt`b~3GŻ#23G@ ?P3G3N3GHu3*O:3G7m{3GAy3GO@Y>3GöfH3Gx&*func(uint32, http.http2PriorityParam)&*func(uint32, http.http2ErrCode) error&*func(string, *http.PushOptions) error&*func(*http.Request) (*url.URL, error)&*func(int, textproto.MIMEHeader) error&*map.bucket[string]*http.http2dialCall&*map.bucket[http.http2FrameType]string&*map.bucket[http.http2SettingID]string&*struct { F uintptr; X0 bytes.Reader }3G4༽}{ =3Gf7`HA2d3Gȿ@\k3G bv3Gg`?,3G +a3G+I 3GW@3G@I`= 2tFG7 ͱ;H3GI`֯Z 2tFGm^`\ 2tFG@} 2tFGg~tT 2tFGu@_R, 2tFG ɲ)3G9vîl3GBwn.C 2tFG y'W3GNb 2tFGvnh 2tFG @h 2tFG9Fv 2tFG8|% 2tFGSh3G~  ,# 2tFGޚ3G9 !:ST3G~@ti3G@*53Gw^t.3GI 3G޼mg23GQ<3Gؿ9K3G`&*func(context.Context, []string) error&*map.bucket[string]certmagic.Challenge&*func() (certmagic.Certificate, error)DomainKeysHrefjson:"domain_keys_href" DomainNamejson:"domainName,omitempty"3G4@ Identifierjson:"identifier,omitempty"<,3G {`9kV3G$ER3GDp3G4 3G$!o3G4ݮhp 2tFG[@q 2tFGەq. 2tFGەrH>3G[<M73Gy 3G5n3G!&*func() (*boring.PublicKeyECDH, error) 83GF& )3GZ&^3G<;3G z3Gq`ep3GOD&*func([]reflect.Value) []reflect.Value&*func(func(string) bool) reflect.Value.3G`A-3G|@Tne%3G|7@3G|9Ro3G' ͱ3G"'o/3G%S3GY`3G**AC!3GP'  +a U3G`&*map.bucket[string]*unicode.RangeTableQS3Gs`+&vendor/golang.org/x/net/dns/dnsmessage&*func(int, int, *syscall.IPMreq) error&*func(int, int, *syscall.Linger) error3G ]3G`+o 2tFG{MO 2tFG=MMtm3GNP3G?`ʱE<3G#@a|93G5&*func(*[]bool, string, []bool, string)&*func(string) ([]time.Duration, error)&*func(*net.IP, string, net.IP, string)&*func(*string, string, string, string)&*func(*uint16, string, uint16, string)&*func(*uint32, string, uint32, string)&*func(*uint64, string, uint64, string)&*func(*[]uint, string, []uint, string)fi3GY!b3Gc.l3G"~p*3G ǯ?Y3GP HG%Q3G)&*struct { F uintptr; R *flag.FlagSet }"3G`\`߱D3Gs`J3G`ͱf/3Gg3Gw -,3Gְ&github.com/sagernet/sing/common/logger&github.com/sagernet/sing/common/ranges&github.com/sagernet/sing/common/udpnat~3G`+3Gć3GP'03Gh6jb3GD,x]3GN43G0`- S3Gಿz3G`Mc3G D΅3GSln[ 2tFGR`طF^+3GF+@̖Tj3GR@z53GSoܷ3G߽6}3G@޽%5f3G]@I3GUo`ؽ{T3G@]ԼNpH3G3G`SE>3G@#˔03Gca?o3G @\p3G >S3Gu3Ga*e3GS¼ 3Go@&*func(bbr.connectionStateOnSentPacket)C3Gj@>q3GHڷ-K3GWSڷ93G: =3G (3GP > f3G-3G&>  3G} 3Gv9C3G2UM3G~&*struct { message string; num uint64 }&*func() (protocol.ConnectionID, error)&*func() (ackhandler.Frame, bool, bool)&*func(protocol.StreamNum) quic.streamI&*func(context.Context) context.Context&*struct { F uintptr; X0 *quic.stream }&*struct { F uintptr; X0 *utils.Timer }:3GNinWG3G]6$3G]3G\]@Y63G#`+P3Go ٽʝr3Gj>y3Gku3G@%g3GA>b 3GA@߶03GqP3G @l7>h3G ey3G @l3G {)3Go@uL$3G@U3G_@w$~3G#@wev3G  2r3Gi  W3G?}E3G MhQ3G}J3G`  ۾3GU9C3GM3G` ֯$(3G( @fZ3GN+U 2tFGO?@Y 2tFG~nqݓ3G\}3G ^T3G1@N[? 2tFGpe3G? %3Gst3G߶iT3G @ [E 2tFG/se2=5 2tFG`# 2tFG\W%g 2tFGB@ 3`3G@`ߟyQ3G͈ 3G-PҶ3GOH3G5„3G@EYC3GXX G2%:e3GѰ öB\3Gzd)^3G./d>933GR ö!'{3GOO 3Gm3Gݯȵ{3G}63G `ȵ&*map.bucket[hpack.pairNameValue]uint64@3G ܯ&vendor/golang.org/x/net/http/httpproxy&*map[crypto.Hash]asn1.ObjectIdentifier3Ge^J3Gr`ʻa)3Go 3Gʾ4m3G*3GY 3G9 Q73GUƨ3Gr R3Gky蟳3G@ܮU3G}0 3G!3G_ȹ3G^Bȶ_O3G`&*govultr.ContainerRegistryStorageCount&*govultr.ContainerRegistrySubscription Encryptionjson:"encryption,omitempty"ObjectStoreClusterIDjson:"cluster_id"&*govultr.BareMetalServerServiceHandler33GaGm 2tFGJb 2tFG̷3GM Ma3Gt*Vr3GMNT|3G*ЪfH3G@],3G}b1"3GH`IzӸ3G% "3G))OX3Gu `3GҴ[G3GETg¡3G :3G2Dߦ3G ^hI3G8ҴΖq3Gٷ3GHλ[3GC) tГ3G 4w3GH&SetReduceExtraAckedOnBandwidthIncrease&startNewAggregationEpochAfterFullRound&*func(time.Time, congestion.ByteCount)p3GW>3GÆ 3GG`z&*protocol.DefaultConnectionIDGenerator*K3GϡTa3G@k 3G J3G l3G)juߔ3G(d`°3G[3G) j3Gy|3GdU&*func([]wire.AckRange) []wire.AckRangeu3Gfo3GȐT)3Gʺ9ٖ3GѾͫ3GXlմK3GJմ&*flowcontrol.connectionFlowControllerI&*func(*handshake.cipherSuite, []uint8)3GW"3G";y3G6; S3GNeJj3G  MG3GW0d3GceJOt"3GvuAg3GxeӾ`ߋ3GOvn`3Gpm`Nԉ3Go>3G`Nf3G &github.com/google/go-querystring/queryK3GycǛM3Gú&*func([]uint8) (sign.PublicKey, error)~X3G_f``&*func([]uint8) (kem.PrivateKey, error):3GNL 3G;ٽ&github.com/cloudflare/circl/kem/hybrid3Gf Pa=i3Gf`PBI3G%M3GOV&*fiat.p224MontgomeryDomainFieldElement&*fiat.p256MontgomeryDomainFieldElement&*fiat.p384MontgomeryDomainFieldElement&*fiat.p521MontgomeryDomainFieldElementZJ3GHL`~ps3GcL"L3G~Lx/ka3GLJ\F3G@b?3GG`Y3G @QH3Gfሩ3GL&*map.bucket[reflect.Kind]gob.encHelper&*map.bucket[reflect.Type]*gob.typeInfo&*struct { F uintptr; X0 reflect.Type }[3Gv<P*V3G,Pމ3G_a/3GؽaOs3Gc`Y&*func(protoreflect.ExtensionType) bool O3G83GbV`_X3G++3G&*map[protoreflect.Name]*filedesc.Field&*map[protoreflect.Name]*filedesc.Oneof&*map.bucket[protowire.Number]struct {}<3G`&*func() *map[int32]impl.ExtensionField&*func(impl.pointer) protoreflect.Value&*map[protoreflect.Name]*impl.oneofInfo&*func(impl.pointer) *impl.extensionMap&*map[reflect.Type]*impl.coderFieldInfo-3G3G>7]3Gh`w3GdU@3`r@3G `mV3G̰`(=3G[3Gfg3GV>V3G`< 8+3G(6FW3m3Gm23Gy``q3Gj>`@l3G3 3G`bOq3G~>࠮%3G.03Gݰ`~K3GCT3G>1M'3G a3G@3Gg`alP3G[3G`eN3G0w:3GaG3G`?3G@1VZ13GaMT3G`Ĭ3G-ֹPw3G k3G.NESz3G-B|3GdN@ڷ 3GF$&;3G m9B3G <iN3GS<(3GOSKJ3GiPi?3GjP&github.com/cloudflare/circl/sign/ed448;|>3G%jcuP3G:j dgE=[3G@g>3GOj@Ty13G&github.com/cloudflare/circl/math/fp448e|3Gdj/3G`V@>3GP`C3Gf z9k3Gj &3GjdcsI3Gj`dD3G'*func(net.Addr, string, uint32, string)'*func(net.Addr) (net.PacketConn, error)'*struct { F uintptr; X0 client.Client }'*func([]uint8) (*ecdh.PublicKey, error)'*func(*ecdh.PrivateKey) *ecdh.PublicKeyDistributionPointasn1:"optional,tag:0"'*atomic.Pointer[internal/godebug.value]'*func(string, string) (net.Conn, error)'*unique.uniqueMap[net/netip.addrDetail]'*map.bucket[runtime._typePair]struct {}'*func(...zap.Option) *zap.SugaredLogger'*struct { F uintptr; X0 io.ReadCloser }'*interface { SetReadBuffer(int) error }'*map.bucket[uint16]func() *hpke.hkdfKDF'*func(http.http2PushPromiseParam) error'*func() (*hpack.Encoder, *bytes.Buffer)'*func(io.Writer, map[string]bool) error'*http.http2write100ContinueHeadersFrame'*struct { F uintptr; X0 io.ReadSeeker } IssuerDatajson:"issuer_data,omitempty"'*map.bucket[string]certmagic.ocspUpdate LatDegreesjson:"lat_degrees,omitempty" LatMinutesjson:"lat_minutes,omitempty" LatSecondsjson:"lat_seconds,omitempty" DigestTypejson:"digest_type,omitempty" ModifiedOnjson:"modified_on,omitempty"DevelopmentModejson:"development_mode"OriginalDnshostjson:"original_dnshost" ErrorChainjson:"error_chain,omitempty" ResultInfojson:"result_info,omitempty"'*map.bucket[string]acme.cachedDirectory'*func(quic.Stream, *server.StreamStats)'*map[string]outbounds.PluggableOutbound'*func(*ecdh.PublicKey) ([]uint8, error)'*struct { F uintptr; R *atomic.Uint64 }'*iter.Seq2[reflect.Value,reflect.Value]'*func(int, int, *syscall.IPMreqn) error'*func(string, []uint8, string) *[]uint8'*func(string, float32, string) *float32'*func(string, float64, string) *float64'*func(string) (map[string]int64, error)'*func(string, []int32, string) *[]int32'*func(string, []int64, string) *[]int64'*func(string, string, int, string) *int'*map[jwalterweatherman.Threshold]string'github.com/sagernet/sing/common/control'github.com/sagernet/sing/common/network TypedValueprotobuf_oneof:"typed_value"'*func(bbr.Bandwidth, bbr.Bandwidth) int'*func(context.Context) ([]uint8, error)'*func(*wire.NewConnectionIDFrame) error'*func([]protocol.ConnectionID, []uint8)'*func(protocol.EncryptionLevel) []uint8'*map[protocol.StreamID]quic.sendStreamI'*struct { F uintptr; X0 quic.quicConn }'*struct { F uintptr; X0 *bytes.Buffer }Responseasn1:"explicit,tag:0,optional" NextDomaindns:"size-base32:HashLength"VerificationURIjson:"verification_uri"VerificationURLjson:"verification_url" Descriptionurl:"description,omitempty" SnapshotIDjson:"snapshot_id,omitempty" EnableIPv6json:"enable_ipv6,omitempty" AttachVPC2json:"attach_vpc2,omitempty" DetachVPC2json:"detach_vpc2,omitempty" EnableVPC2json:"enable_vpc2,omitempty"DefaultPasswordjson:"default_password"'*govultr.ContainerRegistryRepoUpdateReq PublicHostjson:"public_host,omitempty"MaintenanceTimejson:"maintenance_time" TrustedIPsjson:"trusted_ips,omitempty" TableCountjson:"table_count,omitempty"HAControlPlanesjson:"ha_controlplanes" AutoScalerjson:"auto_scaler,omitempty" CookieNamejson:"cookie_name,omitempty" PrivateKeyjson:"private_key,omitempty" InstanceIDjson:"instance_id,omitempty" APIEnabledjson:"api_enabled,omitempty"ConnectionPoolsjson:"connection_pools"ForwardingRulesjson:"forwarding_rules"PrivateNetworksjson:"private_networks"'*map.bucket[token.Pos]*ast.CommentGroup'*map.bucket[netlink.BondAdSelect]string'*map.bucket[netlink.BondLacpRate]string'*map[netlink.BondPrimaryReselect]string'*map.bucket[netlink.VlanProtocol]string'*map.bucket[string]netlink.BondAdSelect'*map.bucket[string]netlink.BondLacpRate'*map[string]netlink.BondPrimaryReselect'*map.bucket[string]netlink.VlanProtocol'*func(int) protoreflect.FieldDescriptor'appendExtensionRangeOptions_Declaration'*func() protoreflect.MessageDescriptors'*func() protoreflect.ServiceDescriptors'*func(protoreflect.EnumValueDescriptor)'*func(int) protoreflect.OneofDescriptor'*struct { F uintptr; R *bbr.bbrSender }'ackElicitingPacketsReceivedSinceLastAck'*func(*ackhandler.packet) (bool, error)'*func(context.Context, slog.Level) bool'*map.bucket[string]qpack.indexAndValues'*func([]uint8) (sign.PrivateKey, error)'*atomic.Pointer[encoding/gob.encEngine]'*struct { F uintptr; X0 *gob.typeInfo }'*func(protoreflect.FileDescriptor) bool'*map[protoreflect.FullName]interface {}'*func(func(protoreflect.EnumType) bool)'*func(protoreflect.ExtensionType) error'*map[protoreflect.Name]*filedesc.Method'*func(impl.pointer, protoreflect.Value)'*func(protoreflect.Value) reflect.Value'*func(reflect.Value) protoreflect.Value'*interface { XXX_MessageName() string }'*congestion.SendAlgorithmWithDebugInfos'*func(mlsbset.EltP, uint, int32, int32) TrafficStatsmapstructure:"trafficStats"(*map.bucket[string]zapcore.EncoderConfig(*func([]uint8) (*ecdh.PrivateKey, error) PublicKeyasn1:"optional,explicit,tag:1"(*func(*bisect.dedup, *bisect.dedup) bool(*func([]uint8) (int, *net.IPAddr, error)(*func([]uint8, *net.IPAddr) (int, error)(*struct { F uintptr; X0 chan struct {} }(*func(func(*cobra.Command, error) error)Samplingjson:"sampling" yaml:"sampling"Encodingjson:"encoding" yaml:"encoding"(*map.bucket[string]*proxymux.muxListener(*func() (map[string]*v2geo.GeoIP, error)(*interface { SetWriteBuffer(int) error }LevelKeyjson:"levelKey" yaml:"levelKey"(*func(interface {}) (interface {}, bool)(*func(*interface {}, *interface {}) bool(*struct { F uintptr; R json.mapEncoder }(*struct { F uintptr; R json.ptrEncoder }(*func(http.http2HeadersFrameParam) error(*map.bucket[uint32]*http.http2writeQueue(*struct { F uintptr; X0 strings.Reader }(*map.bucket[string]certmagic.Certificate(*map.bucket[string]*certmagic.solverInfo(*map[string][]certmagic.dnsPresentMemory Subproblemsjson:"subproblems,omitempty"(*func(*protocol.UDPMessage) (int, error)(*masq.altSvcHijackResponseWriterHijacker(*func(reflect.Value, reflect.Value) bool(*struct { F uintptr; X0 *reflect.Value }(*func(int, int, *syscall.IPv6Mreq) error(*func(*[]uint8, string, []uint8, string)(*func(*float32, string, float32, string)(*func(*float64, string, float64, string)(*func(string) (map[string]string, error)(*func(*[]int32, string, []int32, string)(*func(*[]int64, string, []int64, string)(*func(*int, string, string, int, string)(*func(string) (fs.FileInfo, bool, error)(github.com/spf13/viper/internal/encoding(*func([]uint8, []uint8) ([]uint8, error)(*map.bucket[tun.flowKey][]tun.tcpGROItem(github.com/sagernet/sing/common/metadata(*func(bbr.Bandwidth, bbr.roundTripCount)(*map.bucket[uint64]protocol.ConnectionID(firstAckElicitingPacketAfterIdleSentTime(*map[protocol.StreamNum]quic.sendStreamI(*struct { F uintptr; R quic.connRunner }(*struct { F uintptr; R *quic.Transport }(*struct { F uintptr; X0 *error; X1 int }(*map[string]*http3.roundTripperWithCount(*func(string, string) (io.Writer, error)(*func(string) (crypto.PrivateKey, error)LastPaymentDatejson:"last_payment_date"(*govultr.DatabaseConnectionPoolCreateReq(*govultr.DatabaseConnectionPoolUpdateReqFirewallGroupIDjson:"firewall_group_id" Certificatejson:"certificate,omitempty" Descriptionjson:"description,omitempty"(*func(govultr.RequestCompletionCallback)(*govultr.ContainerRegistryServiceHandlerMarketplaceAppVariablesjson:"variables"(*struct { F uintptr; R *govultr.Client }(*func(*parse.Tree) *parse.IdentifierNode(*func(int) protoreflect.MethodDescriptor(*func() protoreflect.EnumValueDescriptor(*func(protoreflect.FieldDescriptor) bool(github.com/apernet/quic-go/internal/qerr(github.com/apernet/quic-go/internal/wire(*ackhandler.appDataReceivedPacketTracker(*func([]uint8) (*handshake.Token, error)(*func(retryablehttp.ResponseHandlerFunc)(github.com/pelletier/go-toml/v2/unstable(*func(protoreflect.FileDescriptor) error(google.golang.org/protobuf/internal/strs(*map[string]protoreflect.FieldDescriptor(*map[protoreflect.Name]*filedesc.Message(*map[protoreflect.Name]*filedesc.Service(google.golang.org/protobuf/internal/impl(*func(interface {}) protoreflect.Message(*struct { F uintptr; X0 impl.Converter }(github.com/apernet/quic-go/internal/qtls(github.com/cloudflare/circl/sign/ed25519(github.com/cloudflare/circl/math/mlsbset)*func(http.ResponseWriter, *http.Request) Extensionsasn1:"tag:0,optional,explicit")*func([]uint8) (int, *net.UDPAddr, error))*func([]uint8, *net.UDPAddr) (int, error))*func(func(*abi.Type, interface {}) bool))*func() func(*cobra.Command, error) error)*func(...interface {}) *zap.SugaredLogger)*struct { F uintptr; X0 []zapcore.Field })*func(func(int)) *list.Element[func(int)])*func(*list.Element[func(int)]) func(int))*func(io.Writer) zapcore.ReflectedEncoder)*func([]uint8, []uint8, []uint8, []uint8))*func(tls.QUICSessionTicketOptions) error)*func(net.Listener, string, string) error)*func(net.Conn, *http.http2ServeConnOpts))*func(http.http2SettingID) (uint32, bool))*http.entry[string,*net/http.routingNode])*map[http.routingIndexKey][]*http.pattern)*map.bucket[string]*http.http2addConnCall)*func(http.keyValues, http.keyValues) int)*interface { IsHTTP2NoCachedConnError() })*struct { F uintptr; R *http.connReader })*struct { F uintptr; X0 context.Context } LongDegreesjson:"long_degrees,omitempty" LongMinutesjson:"long_minutes,omitempty" LongSecondsjson:"long_seconds,omitempty" RRSetValuesjson:"rrset_values,omitempty" BearerTokenjson:"bearer_token,omitempty")*outbounds.errSOCKS5UnsupportedAuthMethod)*struct { F uintptr; R *godebug.Setting })*func(string) (reflect.StructField, bool))*map.bucket[unsafe.Pointer]unsafe.Pointer)*func(string, string, bool, string) *bool)*func(string, []net.IP, string) *[]net.IP)*func(string, string, int8, string) *int8)*func(string, []string, string) *[]string)*func(string, string, uint, string) *uint)*func(string, time.Time, time.Time) error)*func(string, string, func(string) error))*func([][]uint8, int, []int) (int, error))*func(func(netip.AddrPort, *udpnat.conn)))*func([]socket.Message, int) (int, error))*struct { F uintptr; R *quic.connection })*struct { F uintptr; X0 *quic.Transport })*struct { F uintptr; X0 *int; X1 *error })*map[protocol.StreamID]*http3.datagrammer)*func(string, func(string) string) string NetworkSizejson:"network_size,omitempty"SupportedEnginesjson:"supported_engines" DateCreatedjson:"date_created,omitempty")*func(context.Context, string, int) errorAllowedBandwidthjson:"allowed_bandwidth" BackendPortjson:"backend_port,omitempty" HealthCheckjson:"health_check,omitempty" SSLRedirectjson:"ssl_redirect,omitempty" GenericInfojson:"generic_info,omitempty"AvailableOptionsjson:"available_options"AvailableUpdatesjson:"available_updates")*func([]uint8) (*nistec.P521Point, error))*func([]uint8) (*nistec.P224Point, error))*func([]uint8) (*nistec.P256Point, error))*func([]uint8) (*nistec.P384Point, error))*struct { F uintptr; X0 *int; X1 string })*func([]uint8, properties.Encoding) error)*map.bucket[reflect.Type]*yaml.structInfo)*func() protoreflect.ExtensionDescriptors)*func(int) protoreflect.MessageDescriptor)*func(int) protoreflect.ServiceDescriptor)*func() protoreflect.EnumValueDescriptors)SetStartNewAggregationEpochAfterFullRound)github.com/apernet/quic-go/internal/utils)*ackhandler.skippingPacketNumberGenerator)*func(context.Context, slog.Record) error)*struct { A spew.t0; spew.t0; a spew.t0 }ErrorDescriptionjson:"error_description")*func([]uint8) (*fiat.P224Element, error))*func([]uint8) (*fiat.P256Element, error))*func([]uint8) (*fiat.P384Element, error))*func([]uint8) (*fiat.P521Element, error))*map[string][]protoreflect.FileDescriptor)google.golang.org/protobuf/internal/order)*map.bucket[protowire.Number]interface {})*map[protowire.Number]reflect.StructField)*map.bucket[reflect.Type]protowire.Number)*map.bucket[protowire.Number]reflect.Type)*struct { F uintptr; X0 impl.structInfo })*struct { F uintptr; X0 *filedesc.Field })github.com/cloudflare/circl/internal/sha3 BindInterfacemapstructure:"bindInterface" TCPForwardingmapstructure:"tcpForwarding" UDPForwardingmapstructure:"udpForwarding" RewriteDomainmapstructure:"rewriteDomain"**struct { F uintptr; R *cmd.clientConfig }**struct { F uintptr; R *certmagic.Config }yMЄ3Ge^nJ 3Gɱɱ493Gjɱc3G.//8+3G/>'3Go/ɱ{N?3G^ .G`|`ʱ@<  ɱ3GfPE 7. |FG̱`lloTX 7 3 .G`̱` ²X&k 7\z\&~ 7zέ(Fk>n j=F ` `d ` VdGɱ /G`ʱ .EQh ` el `@@$spH+ ``X; T kߕ3Gɱ@ `] /G&`˱ @f .G2``ʱ@H3G3G&l3GlE /G>`ʱ**func(io.Reader) (*ecdh.PrivateKey, error)AdditionalPrimesasn1:"optional,omitempty"**func(*godebug.value, *godebug.value) bool**struct { sync.Once; v *x509.Certificate }K[3Gl`ͱ3Ghͱ63Gy@ɱT3G a[P3GR`3G U3G@ͱWX3GtPͱw3GͱN3G}w3GbP3G Fʼ<>3GMͱ xFGͶ9*3GͶͶ xFGf3G;{($@ªɱ# /G`ʱ n(GP `A .G`ʱ# /Gʅ`ʱBᓨ /G`ʱB gAa /G˱ (# /G@E}JG ˱ V 1tFG  $鶏 1Gf̱` yȏ 1G`ʱAi 1G"`ʱl3G 3GD@1X%3G{Ȼ,3G˱_53G@H@佬3Gw@1gw3G] |T 2G˱ 㩨 |FGK ̱*! 2G`ʱ , .Gj`˱  zLRn LqB 5^+3GBɱ G)`ױ` LP- S $GG̈`ʱ ΍ xFGQyम44 6+ x4B α࡮ yB 4Gj̱` 3G̱̱ xx 4Gn `) /Gc1 F` 2n4 ϯ= /G ८i|3GJ˱˱_ 2$,o9`p 2G.o q΢ .G]( FG˱ k 4G".̱`ɲ 4G@.̱`,7' 2G)̱` pUT 4Gm.`ʱ:!Y |FGমW 2Gqi Ŋ /G``P0 4G1 I ]] 4G˱ DƆ3G E`E|b3G`˱ͱ. xFG̱`kV P1G4`ʱ ߀ 4GR`ʱ ҢQ |FG^`˱ | /G `ʱ@E}J .G ˱ u3G pɱ ~\& 4Gv`ʱp x 5GK`ʱp` /GX˱ 3gԲ FG`˱  PNGU ˱ 'TL α࡮@@Q`@J@@$sH+ ```R J  `]G&`˱ `XuT}`@t- 5G/`ʱ@<3GLp˱˱0r^ 5Gʱ`ʱ0\[ 2G`ʱ}  5G``ʱ)3G˱ͱwm3G& ˱ ˱~ .G`˱  s3GDCͱX@w$! +C 1fɱ -`!G` O " P5GA`ʱ i `5G`ʱ Acp h5GB`ʱA /G ̱#{> /G``ʱ ]s./J;3G:`ʱlf X6GZ ʱlBH'} |FG ˱hh3GW˱˱G% /G ʱ`& `6G& ʱ` @ .G1 ˱8( 4G ˱" .Gk ʱ`XP T p6GƲ`ʱ]3GĬ@@sN3G@ [3Gl ͱ0+1 3Gp ̱cmm3G c3G> @"3Gɱ ̱BUS3G^ K3G2@ͱ[hA 4G0I ̱6|3G˱ͱ9KG/0 ?IGvn@#3G@Q'3G_r@# 3G@w3G[=3GI3ɱ .3G Nԏ3G \ۈ3Gɱ` \}5LY@ ŋCMLb @<  5ܱ ވL`d \LD@`\)|u@ e|00FL M `@@sXHD ; w3GSɱ kJ3Gsɱ@3Gɱͱ[j3G&Eɱ˱7+3G;Eɱa3Gɱ`̱3Gjqɱ˱h:3G@@YHq!`@@|]iHq`!w԰dమ**struct { F uintptr; R *zap.sinkRegistry }l`3G`酆3GɱN3Gf`/3GG@fu3GɱFw3G4ɱ@$y3Gg@$sv3G@@$l3G!4 sͱG3G`U L|  L @b}J3G` ?ѱ)F_ @O3G L|3G<4 @M<3GsF +Lr4r3GF8d tFGP ̱*s3Gߧ=n~_-3G 3Gf 3Gg **func() (map[string]*v2geo.GeoSite, error) FWLľ@ @&L|F3GYh 3G *github.com/apernet/hysteria/core/v2/client**func([]uint8, *protocol.UDPMessage) errorf3Gu Ub3GDj ؏LaF൮E3G**func(*http.response, *http.response) bool xFGZ@3Gk|@@*github.com/apernet/hysteria/extras/v2/obfsxS3G@h` < ^3G| sx93G4 äV3Gɱ)~`3GvFɱͱ93G5ɱ ͱqfy3Gmɱ̱؁s3G'ɱ`ͱZ3G?ɱͱ3Gɱ ̱33Grɱʱ,p3Grɱ˱cؚ3GFɱ ʱ3Gɱ  1T3GFɱ`̱ 3GɱʱNg3Gɱ`˱\L3G5ɱ˱:3Grɱ`ʱK3GWɱ̱{3G/5 7ͱ3G@ۻz3Geh M"GoW`MGx3G̰3GIg  U&3G ɱX3GFͱ ̱B3G@aճG` @@Hds7`C3G6 ~**func([]uint8, []uint8, bool) interface {}**func(*sync.readOnly, *sync.readOnly) bool**struct { F uintptr; X0 func() hash.Hash }`Č'x  Lsd๮f3G[d]Q/3Gy`b`3G0ɱ`f q .Gέ`ʱ U(3G {dC 8G2`ʱ y3Gt ̱o^3G d `ELA ö໮̅;3G^h<3G$  3Gʱ`=3Gf xFGz3 [3G33 xFG`3#3G|3X3GwͱQ3G`Wͱg.Wp3G&ʱͱ 8Gf5`85u]Gڭʱ` nL @ү༮xǟ !22  ``#< ``6f3Gg[@* 8G`ʱ@00| 58!^ 44p' x4/^ 44BK x4! ` HLC@཮[ 9G`ʱ ZG/zV `GG`Pհ`Wຮ0GHW   ( ͽ`Wຮ NR h0G`Q .GT qSP .G` f{Χ 4Ge . /G `**struct { F uintptr; R json.arrayEncoder }**struct { F uintptr; R json.floatEncoder }**struct { F uintptr; R json.sliceEncoder }8)3GAͱ9xȸ3G˱53Gnb ̱ ̱ @[L`@@u;tH@T:3G$V|**func(uint32, http.http2OpenStreamOptions)**func(func(http.http2Setting) error) error**map[*http.Request]context.CancelCauseFunc**func(string, *tls.Conn) http.RoundTripper**map.bucket[uint32]*http.http2clientStream**map.bucket[string][]*http.http2ClientConn**map.bucket[*http.http2ClientConn][]string**map.bucket[string][]*multipart.FileHeader**struct { F uintptr; R *http.http2stream }**struct { F uintptr; R *http.persistConn }**struct { F uintptr; R *httpproxy.config }**struct { F uintptr; X0 *http.connReader }Wu3G`˱k3G`˱@Eb3Gu`ͱ R8 X0G `ʱ  ?3GС`˱!#3GHpe3G#9[?o3G@ͱ ČL7`? 3G@U3GD(C3G7ؿ媱3G@Vn3G)}=nX3Gɱ3G >Lr  ®ރ3GLŻ(3Ghi @= A(Lh*`® 9LLco®3GgŻ pLC®3GI3G9 ̱H!3GJ`˱ :c*L`Į`\tH/_aĮ`X;lXT{JĮ Ů:3Gvɱ@'r3G+ ɱu|96F!b`Ů tL19Ů? )q'9`ǻ`Ʈ`XEZT  ƮƮa@' Ǯ Ko;L^ Ʈ 'OLVn 4Lv`Ǯ uWLǮJ3Gɱ SLv@tǮ@LG @w Ȯ NFLn!@`Ȯ`X̄T!wȮȮ OL`x ɮ L9Ȯ p1LWx`ɮf3G`˱(K3Gw 1 4G `ʱ{@i :GC: `ʱ ?)aG!ʮ G#9 ˮAGK``ˮHG~ ˮ lLˮ L$: ̮iG`̮`XgT x`ʮ̮`XYCT""̮@@NTH: ͮHaH3Gؿ93Guؿ@<k  Lή:Y |FGӱͮ((%! `(GQH3G{ ^@(Gq`̱_-w3G`x{Ȇ3G4ؿz3Gؿؿ**func(context.Context, string, bool) error**struct { F uintptr; X0 *certmagic.Cache }HR3G)23Gͱ`\w '-Z:Ю3GfɱЮ'3G@@ dCfL|Ѯ ?zL~@Ѯ 5L`Ѯ ,L:sѮ`X̛TҮ@Ү``;},JҮ@4Ti8+}Ү@@'|HǻӮ$"g@Ӯ@@rH`PӮ0F@Ю#( 7$( 7  zD+ 7! P0G- d3GX /PL@vծ m%\+` ׮ X4Gh خ@@߭J-`l@ۮ*github.com/apernet/hysteria/core/v2/server**map.bucket[uint32]*server.udpSessionEntryF 3G_J`}3G{`˱s.@T3G`˱ɱ [-uLHy`ۮ]<3G% ̱R3Gէɱ߾3G%˱ͱ*github.com/apernet/hysteria/extras/v2/auth*github.com/apernet/hysteria/extras/v2/masq**func(*outbounds.AddrEx) (net.Conn, error)]E3GTS mLk@ݮCkV3G{ɱ@@H+H?ޮ lL@߮?$3Gp ? x;G ̱`?mQ ;Gw`ʱmG~ P0GANr*github.com/apernet/hysteria/core/v2/errorsBR3GheGdSA!3GNQ ̱GG3GUQQc3G ̱`̱Z3Gͱ |N3G,[Qa3GQ33G˱Qtِ3GW˱Q l3G ̱`ʱr 3G;ͱ 3Gʼ’3G<G`ʱ G `Ȼ`=X,x`*vendor/golang.org/x/crypto/cryptobyte/asn1 85G:`˱ <e /G`˱ L3G`D3G5@H /Gzy**struct { F uintptr; X0 []unsafe.Pointer }PK3G @TͱW!3G ̱J3GP3G ̱@T.3G<|ͱ&3Gm73G@T|YsP3G? ̱|3G[|3Gzɱ|^3G0 |V A3G||Ǽ3G ͱͱ- 3GROͱͱC{3GZ|ͱu3Gl||T3G< ̱ q&L!"G E .|| BLG@-3\3Gq`+ͱT3Gz ̱`+GcG} H3G0}H}AGG`ֱ3GF}`˱`˱=[3GH &~L@3G֬ Ƀ> 1tFG`@ɤ3G ̱/ 3Gr} ̱ i3 xFG˱ Fz xFG( α࡮w*3GcP ˱`˱**func(*bool, string, string, bool, string)**func(*[]net.IP, string, []net.IP, string)**func(*int8, string, string, int8, string)**func(*[]string, string, []string, string)**func(*uint, string, string, uint, string)**func(pflag.Value, string, string, string)@tG˱@e3Glɱܱ OL H "@%3G`ɱd~`mt|{ aG`@~ /D03Gi=R 4GxA`ʱ XCIL^lV33G ɱ`߱/?3G]ɱFm_4dx(3GR ̱J"]A3G  ˱ T)3Gʱc3G`˱3G˱R.m3G̪ʱmZ3G`˱!3G˱?$ 8?G`ʱ? 7o3G+`**func(netip.AddrPort) (*udpnat.conn, bool) o3G\ew3G .@NKGY`X=jT ~(*  r5!LR FC3GJʱ7&3GD;3G`3G` FL!3Gn `MB:3G@; N "ߐ3GV `Ϳ@)8o(X ` :L Tn 1tFG`ϴxP tFG`˱ wuwuH=(m`M`ͮ ﭢ3G\@3G ̱`ʱ=3G̱3G0o@ͱw3G-ͱ/`3GG_l3G ̱@>o3GB ̱EN]3G^ Dx~3Gp?  'd3G' >**func([]uint8, uint16, protocol.ECN) error**func(uint64, protocol.ConnectionID) error**func(protocol.StreamID, quic.sendStreamI)**func(protocol.StreamNum) quic.sendStreamI**quic.retransmissionQueueAppDataAckHandler**quic.retransmissionQueueInitialAckHandler**func(protocol.Version) protocol.ByteCount**struct { F uintptr; X0 *quic.connection }**struct { F uintptr; X0 *quic.streamsMap }**struct { F uintptr; R *wire.StreamFrame }**struct { F uintptr; X0 *quic.baseServer }^53Gtɱ.3G-ɱdrd3GO XM3GM:/3Go`ݶap3GI3GU3G kӔ3Gؒ k3GjMs3GP@wDEG>@w, =3G( @w@rՉ3GM_3G)T˱@saGxj$"> @Tc3GxͱQQ3Gͱm3G[7x73GG3Gx5T`s3GpA x<3G3GϦG%3G` @I3GM` @G9M@@THf,@@^:H #@@3G!M,'e3G, M#lP3GA  ߷˒3G$bI3Gt3Gc M`ϻUB43G¾3G`O3G ` ȇ3G@Y ҇ /L@2 3G: %@@@oH? %@XD3G=/]3Ge @`@@UH`~ouG_@# 4G@HG @@@<2hHA@ǰ3G &3G| 3G|x3G0! ,~y03Gn ,`\58. `\Um& @ z3G N qLG@@ ]~?3G==`\#_(` dz 3G ``\J*>)D@ r^3G; c@@*1 H%+ ` @@nHt+ 2 23G 2)3G!@NdE 1tFG_ྲྀ@]RH d` ߷Sij |FGw @F] O FG @^\D3Gͱ**struct { F uintptr; R *http3.connection }**struct { F uintptr; X0 *http3.Transport } Lټ Lי JGĵx#3Gh3G`սeO3G  E L `5_3Gm b NA hG> ~` tFG&@N}D @G˱_p3G ̱: 3G_ ̱@Q3G` jj&PX`H3Gp ö ö,3G   öqP3G  ö ` = @G`ʱ` Y AG)` AGB` ֝N H5Gg˱ `W  AGt`ʱ.r 3G!Gy~3GM ܼ){J 0?G`ʱƎO3G. @Lr3G `b˞93GɱY /.@ɭ ?X. `|(5M $r3G޼gF`'x,/=``X= ATA$/ 1G9I ̱ LLb$$ ɵ**func(*dns.zlexer, string) *dns.ParseError**func([]uint8, *dns.TSIG) ([]uint8, error){ΐQ3G^ͱ3G/`ʻͱi`3Gɱ([3G`ʱʾD3G yy143Gɱy3GY`ʻ$3GyѢ3G}pʻy@@xH  (S3GAy}=G1   LL` @ * G@>= |F|9Q ˃3G؛3G` ̱0J#3G ˱ ̱R"3G |x3Gaس3G#!xׂA3GCBͱ|3G`ͱ FGBI ̱K!3G  @f3G@StartupScriptIDjson:"script_id,omitempty" Applicationsjson:"applications,omitempty"**govultr.ContainerRegistryRegionDataCenterRedisACLChannelsjson:"redis_acl_channels"RedisACLCommandsjson:"redis_acl_commands"@X G=)vz3GAE 8=|1Ls໴03_3G[໴Ҕ`3Gy`L$b3G0ɱxőbF3GʱH@@aYYH٣``344T x4!`1i `GG0{w .G0**func(*nistec.P521Point) *nistec.P521Point**func(*nistec.P224Point) *nistec.P224Point**func(*nistec.P256Point) *nistec.P256Point**func(*nistec.P384Point) *nistec.P384PointY3GIĿĿC!f BG^`ʱCH B,4o@3eZ3GIſſ9 BGj`ʱ9 b B/5@48]Ai3GJ ǿ ǿ! BGv`ʱ! *6 B 0L4@˖3G0J`ȿ`ȿa/tcd CG`ʱa1 CG`ʱ1 Cx3c@5` C CGz` 5`B33G5` ֌;3G}` ;3G~R"M3GF +ͱ2XSa CG`ʱ2<4N4 $%v`ͻ@63G @2Og(3G)b H@2 G4 6ЋGH7.X 1tFG4Ź7ch 1tFG_`8)OL@b8 `LI@8 vvޚL Z@`X5(!T259**func(string, time.Duration) time.Durationi93G @9@c-3Gɱ@@3G1@**map.bucket[danger.TypeID]map[string][]int ~}L @: LL:**struct { handle []uint8; suffix []uint8 }6I3G@ 3Lx@ ;!9)6q> #ѧL.>|!ӷ ? Q5GxP`?*github.com/sagernet/sing/common/exceptions**map.bucket[netlink.BondArpValidate]string**map.bucket[netlink.BondFailOverMac]string**map.bucket[string]netlink.BondArpValidate**map.bucket[string]netlink.BondFailOverMac3Gͱt53GSGͱr .Gldͱ 0,x 6`շ?E{3GG@)ͱ*L3Gͱ (G (`@ lH<GĶ`@ נG @ $G A G%(``A v['GA bG(A ([G  B Gt `B l_GOG?(B )_LƍB?qG  C7.,%I`3Gφ ~dz3Gi`ͱKLr3GI`Ϳͱ((x /v7`CGи`I@DtޫG7`D3o3G0 ̱+3G4`#zc3G?#y**func(string) protoreflect.FieldDescriptor3G_ͱ?3G]  S3Gj ͱJ3GB G3G]  S33G  a3GS ̱  3Gf *,X3Gp ̱*Wj3Gxp ׽W&K3GSb ̱׽te3G `0#c*3Gp ̱`0nBh3Gu`ڶͱ3G t˽G3G8 `ڶ˽ 3G ̱˽3GE ̱1W3G ̱o |FG2E'(3G ̱a93G vͱkM3G; 1;-3G,) 1xL3Ga ̱1}3G `ؽn3G  ̱`ؽ'3Gه ̱0 |FG F63G ̱dF]p3Gͱ e3G\ɱ *3G  3G @]%Й3GT ̱@]ܦ3GO ̱v3Gp   .3Gb ͱ 03GH e>3G>ͱ 3Gp 3G،  dU3G0 @] ~3GW ̱0/3G^ ̱ /GΎ F`X(TjҴ`F;^3G @ڷTs3G ̱`S3Gjv ̱ٷ@@jHv0Fp 4*  G9zD3Gl3G*ͱT3Gq` ͱ) z3G ` ye\3G{ `by{Q3G#w BJt3GIͱ?3G63G 3Gϸ`83G)ִL"3G9eͱS3G:KWͱ~ EG ʱ~ Gw W J F`L  J%3G!4xV3Gw2y^3GD`J{3G4Z3GYwIfQ 05Gu`ʱzL@0 FG`ʱmb3G|ͱXc3G? ͱxxx%R|JL3GJO;3G8mɱOZ{/3GHw`  b3GTmɱ @@0H+@K73G~N2 /.KQKe{ZX. L|a| $ @L[(& 4G$`˱ |~ (FGM ̱<L4 @?G@M ̱D  `0G ˱@_Ym .G ˱7N3G@fͱ.8m /G @N **func(*syntax.Regexp, *syntax.Regexp) bool 3Gm`ͱdzY 1tFG;`N 并}L;`NpMPG Ox1 !F@O G`O7[3G=>cq3GmVJ3G-Lͱy$3GmPͱ|Z3GOi޻3GO -A xFG% P`ʱN]M FG%`P`ʱTf@ FG%P`ʱO 9a> FG%`ʱO Zu& 5G%P`ʱ**func(*fiat.P224Element) *fiat.P224Element**func(*fiat.P256Element) *fiat.P256Element**func(*fiat.P384Element) *fiat.P384Element**func(*fiat.P521Element) *fiat.P521Elementt 3Gͣ`~ ̱ 3G~`~`~~e&3G ̱l3G~{3G  ̱a^3G$Y3G' ̱'yU3GP>3G@}B3G@bͱ6_3GA**func(*gob.encEngine, *gob.encEngine) boolK3GyɱwoY3G/aaV xFG<aS s݅Lxc@U 2G7 [L`U L~aU@@ԃmYHV!U*google.golang.org/protobuf/internal/errors*google.golang.org/protobuf/internal/pragma**func(func(protoreflect.MessageType) bool)π/3GV ͱ"3G ̱-3G  \3Gc @<r  ;M V`XJXTVW3G`Sͱ[3Gh4Tͱxr3G{ٷͱH1$3G  U9$:3G$V`S{ W`3GVTw,3Gٷ@@~nHT@W An:L7W yjGлW**map[protoreflect.Name]*filedesc.EnumValue**map[protoreflect.Name]*filedesc.Extension@<}" Y vL Y h!]G{E ȸReLg`Z@@6(H3 [ s0Lg[3GY9 /$L=;`\ uLվ #\ m;LҔ@`] L ̿]c9(`^ W2L  ^ pbG@ _@*rGb`_**map.bucket[protoreflect.Kind]reflect.Type**func(impl.pointer) protoreflect.RawFields**map[protowire.Number]*impl.coderFieldInfo**map[protoreflect.Name]reflect.StructField**struct { F uintptr; R *impl.MessageInfo } TL3Gbȋ3G 00W3G Ty O3G" T Щ/3G@`2V3Gw@T ְ3G9-`ͱj3GP6`pU3GV` mLhn b~3Glj` /Lhn`bS3G`ҴW3Gɬ`Ҵ\3G %  3Gz  ͱr3G)  ҃3G6` 3G @i v&L-obQ,? `"3Gd cb,3GW|3G/W|@@.H_*b:N 3G   ̱d3GN@Q ̱xG3GKx@Q x;W3G`̱ ̱w@3Gpx@QZ:z3GC a 3Gx ZP3G **struct { F uintptr; R *socket.syscaller }n3Gx U GGU(`ʱ ` GGc(`ʱ` `KG GGq(`ʱ`+. GG(`ʱ v GG(`ʱ N3Gq.@bɱ3Gq.fɱ,S3Gfͱׯ] GGQ`ʱ Pr@ GG)c`ʱ @k] GG') d`ʱ@ 넥 GG5)`d`ʱ   HGC)`ʱ "Rj HGQ)d`ʱ ]3G,ͱ}!3G`-ͱۇ;3G-ͱ4 A3G//!+W3G 3Gߝ``*github.com/cloudflare/circl/ecc/goldilocks}ѳ3G `@Gͱ{v& pCG)`ʱt g4 HG)`ʱt W3GNyھھQxS3GR ͱo3GNy۾۾RH3GNy`ܾ`ܾl3Gq3Gߝ3G``MP3G`ʱ+*map.bucket[quic.Stream]*server.StreamStats+*struct { F uintptr; X0 *cmd.serverConfig }+*struct { F uintptr; X0 string; X1 string }+*struct { F uintptr; X0 *x509.Certificate }+*func([]uint8) (int, netip.AddrPort, error)+*func([]uint8, netip.AddrPort) (int, error)+*struct { F uintptr; X0 *net.pipeDeadline }+*map.bucket[string]*forwarding.sessionEntry+*func(string, zapcore.ArrayMarshaler) error+*func(zapcore.Entry, []zapcore.Field) error CallerKey!json:"callerKey" yaml:"callerKey"+*struct { F uintptr; X0 *context.timerCtx }+*func() ([]uint8, *tls.SessionState, error)+*struct { F uintptr; R json.structEncoder }+*func() (http.http2FrameWriteRequest, bool)+*func(uint32, bool, []uint8, []uint8) error+*map.bucket[*http.http2serverConn]struct {}+*http.mapping[string,*net/http.routingNode]+*[]http.entry[string,*net/http.routingNode]+*func(*http.Request) (http.Handler, string)+*map.bucket[*http.persistConn]*list.Element+*func(*http.Request, []*http.Request) error+*struct { F uintptr; X0 *http.http2Server }+*struct { F uintptr; X0 *http.http2Framer }+*struct { F uintptr; X0 *http.persistConn }+*map.bucket[string]*certmagic.soaCacheEntry LatDirectionjson:"lat_direction,omitempty" MatchingTypejson:"matching_type,omitempty"OriginalRegistrarjson:"original_registrar"+*struct { Status string "json:\"status\"" }+*struct { F uintptr; R *server.h3sHandler }+github.com/hashicorp/golang-lru/v2/internal+*struct { F uintptr; X0 *error; X1 string }+github.com/apernet/hysteria/extras/v2/sniff+github.com/apernet/hysteria/extras/v2/utils+*func(string, []float32, string) *[]float32+*func(string, []float64, string) *[]float64+*func(string, net.IPNet, string) *net.IPNet+*func(string, string, int16, string) *int16+*func(string, string, int32, string) *int32+*func(string, string, int64, string) *int64+*func(string, string, []int, string) *[]int+*func(string, string, uint8, string) *uint8+*func() v2geo.isDomain_Attribute_TypedValue+*bbr.entry[go.shape.uint64,go.shape.uint64]+*func(go.shape.uint64, go.shape.uint64) int+*func(context.Context) (quic.Stream, error)+*func(protocol.ByteCount) *wire.CryptoFrame+*func() (handshake.LongHeaderSealer, error)+*map.bucket[protocol.StreamNum]quic.streamI+*struct { F uintptr; X0 *error; X1 *error }+*struct { F uintptr; X0 *http3.ClientConn }+*struct { F uintptr; X0 *http3.connection }+vendor/golang.org/x/crypto/chacha20poly1305+*func([]uint8) ([]hpack.HeaderField, error) Certificatesasn1:"explicit,tag:0,optional" PublicKey!dns:"size-base64:PublicKeyLength" RefreshTokenjson:"refresh_token,omitempty" ReservedIPv4json:"reserved_ipv4,omitempty" AppVariablesjson:"app_variables,omitempty"+*govultr.ContainerRegistryDockerCredentials ReadReplicasjson:"read_replicas,omitempty" LatestBackupjson:"latest_backup,omitempty" OldestBackupjson:"oldest_backup,omitempty" ResourceTypejson:"resource_type,omitempty" NodeQuantityjson:"node_quantity,omitempty" FrontendPortjson:"frontend_port,omitempty"AvailableVersionsjson:"available_versions"AvailableUpgradesjson:"available_upgrades"ConfiguredOptionsjson:"configured_options"+*func(string, string) (string, bool, error)+*struct { F uintptr; X0 *properties.lexer }+appendEnumDescriptorProto_EnumReservedRange+*func(int) protoreflect.EnumValueDescriptor+*map.bucket[int32]protoreflect.ProtoMessage+*ackhandler.sequentialPacketNumberGenerator+*func() (handshake.LongHeaderOpener, error)+*func([]uint8, *uint64, *int8) (int, error)+*func([]uint8) ([]qpack.HeaderField, error)+parseLiteralHeaderFieldWithoutNameReference+*struct { F uintptr; X0 *[]order.mapEntry }+*func(impl.pointer, protoreflect.RawFields)+*func(protoreflect.ExtensionTypeDescriptor)+*struct { F uintptr; X0 *impl.MessageInfo }+google.golang.org/protobuf/internal/descfmtMaxIdleTimeoutmapstructure:"maxIdleTimeout"DisableTLSALPNmapstructure:"disableTLSALPN"AltTLSALPNPortmapstructure:"altTLSALPNPort"UDPIdleTimeoutmapstructure:"udpIdleTimeout",*func(server.StreamState) server.StreamState,*map[string]*trafficlogger.trafficStatsEntry,*struct { F uintptr; X0 chan cmd.modeError },*struct { F uintptr; X0 **certmagic.Config } NamedCurveOIDasn1:"optional,explicit,tag:0",*func(string, string, syscall.RawConn) error,*map.bucket[chan<- os.Signal]*signal.handler,*func(*runtime._defer, *runtime._defer) bool,*struct { len int; buf [128]*runtime.mspan },*map.bucket[pflag.NormalizedName]*pflag.Flag,*map[string]func(*url.URL) (zap.Sink, error),*func(string, zapcore.ObjectMarshaler) error,*struct { F uintptr; X0 *context.cancelCtx },*func(string, []uint8, int) ([]uint8, error),*func(func(interface {}, interface {}) bool),*func(uint32, http.http2PriorityParam) error,*func(*http.Server, *tls.Conn, http.Handler),*func() (net.Conn, *bufio.ReadWriter, error),*func(*http.Request) (*http.Response, error),*[]func(string, *tls.Conn) http.RoundTripper,*func(context.Context, string, string) error,*func(context.Context, []string, bool) error,*func(context.Context, acme.Challenge) error,*map[string]*certmagic.RingBufferRateLimiterDomainRecordsHrefjson:"domain_records_href" CAAIdentitiesjson:"caaIdentities,omitempty",*func(quic.Stream, *string) ([]uint8, error),github.com/hashicorp/golang-lru/v2/simplelru,*func(*big.Int, *big.Int, *big.Int) *big.Int,*func(*[]float32, string, []float32, string),*func(*[]float64, string, []float64, string),*func(*net.IPNet, string, net.IPNet, string),*func(*int16, string, string, int16, string),*func(*int32, string, string, int32, string),*func(*int64, string, string, int64, string),*func(*[]int, string, string, []int, string),*func(*uint8, string, string, uint8, string),github.com/spf13/viper/internal/encoding/hcl,github.com/spf13/viper/internal/encoding/ini,*func(netip.AddrPort, netip.AddrPort) uint16,*func(*buf.Buffer, metadata.Socksaddr) error,*func() (handshake.ShortHeaderSealer, error),*func(context.Context) (quic.streamI, error),*quic.retransmissionQueueHandshakeAckHandler,*struct { F uintptr; R *quic.connIDManager } RequestorNameasn1:"explicit,tag:1,optional"LastPaymentAmountjson:"last_payment_amount" RedisACLKeysjson:"redis_acl_keys,omitempty" IPXEChainURLjson:"ipxe_chain_url,omitempty",**govultr.ContainerRegistryDockerCredentials,*func(*regexp.Regexp) *properties.Properties,*map.bucket[netlink.BondArpAllTargets]string,*map.bucket[string]netlink.BondArpAllTargets,*map.bucket[protoreflect.Kind]protowire.Type,*func() protoreflect.ExtensionTypeDescriptor,*map[protowire.Number]protoreflect.RawFields,github.com/apernet/quic-go/internal/protocol,*func(protocol.ByteCount) protocol.ByteCount,*func([]uint8) (*wire.ExtendedHeader, error),*func() (handshake.ShortHeaderOpener, error),*map.bucket[*syntax.Regexp]syntax.printFlags,*func(func(protoreflect.ExtensionType) bool),google.golang.org/protobuf/internal/filedesc,*map.bucket[protowire.Number]*filedesc.Field,*map.bucket[protoreflect.Name]*filedesc.Enum,google.golang.org/protobuf/internal/filetype,*map.bucket[protowire.Number]*impl.fieldInfo,*func(*internal.VecK, *internal.VecK) uint32-*struct { F uintptr; X0 *masq.MasqTCPServer }-*func([]uint8) (int, syscall.Sockaddr, error)-*func([]uint8, syscall.Sockaddr) (int, error)-*func() go.shape.interface { Error() string }-*struct { F uintptr; R runtime.metricReader }-*struct { F uintptr; X0 *bool; X1 io.Writer }-*struct { F uintptr; X0 io.Writer; X1 *bool }-*struct { F uintptr; X0 zapcore.WriteSyncer }-*func([][]uint8, [][]*x509.Certificate) error-*func(*zapcore.CheckedEntry, []zapcore.Field)-*func(string) (*tls.ClientSessionState, bool)-*func(tls.QUICEncryptionLevel, []uint8) error-*struct { F uintptr; R json.condAddrEncoder }-*map[http.connectMethodKey]http.wantConnQueue-*[8]func(string, *tls.Conn) http.RoundTripper-*func(context.Context, string, []uint8) error LongDirectionjson:"long_direction,omitempty" PrecisionHorzjson:"precision_horz,omitempty" PrecisionVertjson:"precision_vert,omitempty"AutomaticSnapshotsjson:"automatic_snapshots"-*func(context.Context) ([]libdns.Zone, error)-*struct { F uintptr; X0 *reflect.structType }-*func(fmtsort.KeyValue, fmtsort.KeyValue) int-*func(string, string, []bool, string) *[]bool-*func(string, net.IPMask, string) *net.IPMask-*func(string, string, net.IP, string) *net.IP-*func(string, string, string, string) *string-*func(string, string, uint16, string) *uint16-*func(string, string, uint32, string) *uint32-*func(string, string, uint64, string) *uint64-*func(string, string, []uint, string) *[]uint-*func([]uint8, map[string]interface {}) error-github.com/spf13/viper/internal/encoding/json-github.com/spf13/viper/internal/encoding/toml-github.com/spf13/viper/internal/encoding/yaml-*func(tun.PackageManager, exceptions.Handler)-*[]bbr.entry[go.shape.uint64,go.shape.uint64]-*func() (protocol.ByteCount, []uint8, func())-*map[protocol.ByteCount]quic.frameSorterEntry-*func(utils.ByteInterval) *utils.ByteInterval-*map[protocol.ConnectionID]quic.packetHandler-*func(protocol.StreamNum) quic.receiveStreamI-*map[protocol.ConnectionID]*quic.zeroRTTQueue-*func(quic.Stream, *http.Request, bool) error-*map.bucket[crypto.Hash]asn1.ObjectIdentifier-*func(string, string, uint16, int64) *dns.Msg-*func(int, int, int, *x509.Certificate) error-*func([]uint8, string, string, []int) []uint8-*func([]uint8, func([]uint8) []uint8) []uint8 PersistentPxejson:"persistent_pxe,omitempty"-*govultr.ContainerRegistrySubscriptionBilling AccessControljson:"access_control,omitempty" BGWRITERDelayjson:"bgwriter_delay,omitempty" CheckIntervaljson:"check_interval,omitempty" ProxyProtocoljson:"proxy_protocol,omitempty" FirewallRulesjson:"firewall_rules,omitempty"-*func(string) (*properties.Properties, error)-*map.bucket[netlink.BondXmitHashPolicy]string-*map.bucket[string]netlink.BondXmitHashPolicy-*func(protoreflect.MapKey) protoreflect.Value-bytesLostMultiplierWhileDetectingOvershooting-*func(logging.PacketType, protocol.ByteCount)-github.com/apernet/quic-go/internal/handshake-*func(context.Context) *retryablehttp.Request-github.com/cloudflare/circl/sign/eddilithium3-google.golang.org/protobuf/runtime/protoiface-google.golang.org/protobuf/encoding/protowire-*func(func(protoreflect.FileDescriptor) bool)-*map.bucket[protoreflect.Name]*filedesc.Field-*map.bucket[protoreflect.Name]*filedesc.Oneof-*map.bucket[protoreflect.Name]*impl.oneofInfo-*map.bucket[reflect.Type]*impl.coderFieldInfo-google.golang.org/protobuf/encoding/prototext-github.com/cloudflare/circl/sign/eddilithium2~tFGX@ )?tFG QtFG@!dGFG@; *>+$GG]w C$GGެ@+C~Ko$GGÆ.xFGK@/4C$GG"/ys$GG 2/#>`GG(20(c `GGK@0$GG@6KAtFG~1:K;"c tFGr:K;;$GG1@;Kj |FG<K@| tFG>KK2tFGC?K>bcFGwq?K} `GGq@@K34v tFGq@KlP |FGq@K^s tFG@CN tFG@FN]$GG@T={ `GG)R;tFGGRqmFG*)T")$GGYVu$=|FGWܼtFGWY~`GG*X?-tFGX(hHGPY dHGPZ(X|FG}ZT.-b$GGk`l"tFG=\VFGBKtFG ~LDtFG(\Aõ|FGQ^wi&hHG*_w4FGZ_w! |FGm`wMtFGk`w|FGawQotFG>law4ck$GG|`wHtFGQwe:% tFGlDtFGW@N  tFG CN oK |FG'@@x]j |FG@LB |FGOԎ `GGO}btFG;RtFGzZx `GGJ?t `GGM?t6tFG"6@ǗBNtFGv-tFG@! QiYXtFGr! QCVFGK"KTFGv@"Kl.FG4"K׮FG"KV%FGK#KơtFG%bPtFG@% tFG'< tFG']'#tFGhh@)P$GGh)u$GGF)-!$GG*ĪtFG@*(D $GG5+1QtFGJ+ptFG,AftFG-sWtFG^6@.z `GG:7@ JPrm `GGa@2Jaϓ `GG,2J( `GGa2J3>- `GGa3JOtFGn3JRtFG(5 z  |FGz>] | |FGb?] ˘tFG"?]  *tFG@] _6|FGAE$GG@AELX.$GGIAEtN|FGcAE׷$GG[B]q_M$GG=d@CH矨$GGICH'$GGICH?$GG)DH;$GGj9@DHo$GG DH#F$GG)DHqr |FGxk@Fbj |FGWFb- |FGkGb0Nn|FGG$4|FG*Gh$GGސJa }ttFG:OtFGfPx]IH tFGr@R3ޯEtFǴRAI$GG@TחY$GGUHN_ `GG S@UH%$GG;UHI6tFGeVUqtFG,` UttFG@],\7x:tFG_{  $GGgcEitFGkY<$GGmd |FGr0o TU `GGrVug `GGZ@utFGnu' `GGVubtFGv8ttFGvAW,tFGzwGe$GG&Wx6 KeepAlivePeriodmapstructure:"keepAlivePeriod"m3G^/ɱ˱*3G^/ɱ-eH3G/ɱɱ3G׊ɱɱaގ3G//lK/3GE/F)83G ͱ 3G PɱɱͱI3G ͱ4n3Gz @ @ͱ D3G@/@/ͱV xFGҩpvoFGdǦq3Go ̱.*func(*big.Int, *big.Int) (*big.Int, *big.Int)3Gڎ 7`}3G,ʼ8TB3G'Xʼ|H3GE<:I3G>QQͱY3GfQQ@n3G{XͶͶͱ3GͱuF3G,.*func(bool, func(int32) bool) ([]uint8, error)j3GUp ˱ ̱p{3Gɱͱͱ{F3GPɱ ̱A3Ga ˱.*func(context.Context, string) (string, error)43G{ ̱ :3Gn ˱eR3G˱3G˱Ե3Gvm ̱ ̱ͱ 3Gp,, ̱3G@,@, ̱' 3G ̱ ̱%3G455ͱ[3GͱN3Gg ͱ-mA3GI ͱ۱3GE`7`7ͱ>d3GtC@@ͱ{3G* B@.ͱayt3G B@.ͱ~y!t3G α̱̱׏3Gl α αͱ 3G ̱`ͿǓ 3G ̱i3G: ̱^3Gō ̱93G޽ɱ3Ghɱ 3Gɱɱ63G=gAA ̱9z F#-3P I3Gw44ͱB3G̱ɱ ̱ۛ3Gbg ̱˱d3G˱˱ͱi&3GC αͱՙ b3GJ ϱϱͱf3G̱̱ͱ5b3G4̱̱˱/.3GPR˱˱ͱ]<3Gv̱̱ϼno tFGd*C3G;2 ˱ ̱_3Gq  α ѱk3GɱK+33G ̱ ̱ ̱Q)3G ̱ ̱*R3G.*func(context.Context) (*cobra.Command, error) @L3G3@GEV3G4 ɱܱW3Gd@%1*3G =@į3Gd3ɱͱ 3Gy ͱEA13GrɱɱW3G~ɱU3Gr ̱K3Gɱ "3G  ͱʼn?3G3ɱ ̱ɱ2=3Gɱɱɱ3|3Gɱɱͱ.*func(zapcore.Level, string, ...zapcore.Field).*func(zapcore.Entry, zapcore.SamplingDecision) Thereafter#json:"thereafter" yaml:"thereafter".*struct { F uintptr; X0 zapcore.LevelEnabler }'3G  sɱ@ۻa÷3G0  sɱp3G ؿ@S^̗3G? `a3Giɱ.*struct { F uintptr; R *proxymux.muxListener }Ss3A|FGXd33GT ̱ɱtO3G=  ir3G `dHQ3GɱŻ?d3G5ɱb3G`Z 3GF~ U@Q ̱H3G8j櫈3Gl@@ͱ8B3Gt ̱ MessageKey#json:"messageKey" yaml:"messageKey" LineEnding#json:"lineEnding" yaml:"lineEnding".3Gɱ` I!3G/ɱ r߭ 3Gɱ 3G̑ ? @ۻ[[3Gp ? @ۻ,n3G ? @ۻ:%AQ3G1 ?@ۻ@ۻG.3G!?CB3G @˱;d3G5ͱ2]3GZ d9N3G~ `@]h43G d'<J3GCɱ`fͱH3G k3GIZ  ͱgi3GsZ33ͱ@33GXͱnz3GhA-U3Gr`΀3G`ʱ3Gѐ`ʱɱ3G+`ʱ ̱L3GGKK ̱'3Gƙ ]] ̱.*[]func(*http.Server, *tls.Conn, http.Handler).*map[http.connectMethodKey][]*http.persistConn.*func(net.Conn) (*http.http2ClientConn, error).*map[http.http2FrameType]http.http2frameParser.*struct { F uintptr; X0 *http.transferWriter }.*struct { F uintptr; R *http.http2ClientConn }.*struct { F uintptr; R *http.http2serverConn }"+3GQuͱ@w3G`˱ؓe3G`˱9"3Gnu`˱`˱赎y3G0'@ ~U|OG3GG a3GɱɱͱR3GCiɱ`~3G7@' 3G =Ż=Jh3GCŻ)O3GɱfpO@3G h`˱ͱՅO3GV ̱ɱ33G|ɱͱܡR3Gn@ɱtpl3Gqn{Rk3G nؿ3G0ɱ7ߺK3G Ż"Z3GH ̱.3Gɱp3Gh^^ ̱u3Gɱ{jOa3G=n! W3G ^n\\2a3GDɱؿ.*func(http.ResponseWriter, *http.Request) bool;3G~=ɱ#x3Gj=ɱͱ7}A3G=}F3G ^nͱ'dK3G)=OH3G=خTermsOfServicejson:"termsOfService,omitempty".*func(context.Context) (acme.Directory, error)[b3G =@Ƽ.*func(net.Addr, string, uint64) (bool, string):3Gޫ@/(ޟ-3Gwɱl 3GͱɱͱK^3G\j ̱.*func([]uint8) (int, *outbounds.AddrEx, error).*func([]uint8, *outbounds.AddrEx) (int, error).*func(acl.HostInfo, acl.Protocol, uint16) bool.*map.bucket[string]outbounds.PluggableOutbound3GD@Żt@3G @`o]3GɱԿy-3GU^ɱ53G #ɱͱC8p3G,ɱͱ}D3GGɱͱamv3G  ̱2Y |FG{d]D3G@`˱ͱ '=3GQQQlVV3G0z ̱@3G˱˱Q3GQ`̱Q)W+|3G`QQxp3GJ<1̨3Gl`˱˱ 3G ɱ.*func() iter.Seq2[reflect.Value,reflect.Value]X23GjɱͱkD3G  ͱJoD3Gk\||ͱ͑3Gl|X(3Gy ̱ ̱|)3G߀ɱͱ۶3G< ̱ɱ/ <3G\ ̱ ̱ ̱*%3Gw~~ ̱jI3GD`ͱ3G_ͱͱͱ#^3G ˱ ˱ͱtNjy3G[`˱`˱ͱ.*func() (int, syscall.Sockaddr, string, error)͸3G˖ ̱ɱ"3Gs˱9V0$GG~jdt3Gj ɱ;5E3G ̱̱ α.*func(*[]bool, string, string, []bool, string).*func(*net.IPMask, string, net.IPMask, string).*func(*net.IP, string, string, net.IP, string).*func(*string, string, string, string, string).*func(*uint16, string, string, uint16, string).*func(*uint32, string, string, uint32, string).*func(*uint64, string, string, uint64, string).*func(*[]uint, string, string, []uint, string)^3GR{ɱ`̱)|_3GCɱ˱83Gaɱ ˱C3Gɱͱ3Gɱ`ͱ 3G+ɱ@צ'3Go{ɱͱ_3Gɱ1X3G[ɱɱ1e3G{1ɱɱ=[>3Gɱ 3GɱGz3Gɱ sҪ3GɱGF3Gɱ?A3Gɱ`3Gl ɱulU3GɱʱUu7=3GɱTv3GɱkqO3G{ɱ ʱ@Ô3Gɱ>3Gɱ73GKɱ@/ 3Gg]ɱO%3G3ɱʱ 3GRɱ`˱P̦3Gqɱ˱y|3Gɱ`ʱ53Gɱ0V3G. `/23Gɱɱ<3Gdɱɱ-3G | ̱d@3G ||SN3Gɱ`ɱ.*map.bucket[jwalterweatherman.Threshold]stringVF3GC ̱ɱdqD3Gɱ`˱ͱ]53GɱȻeZ3G> ɱ #h3G!3Gu G3Ga  ̱tZ}3Gkɱɱ`h<33G @Iɱɱ^3G ̱ ̱z/W3G:| ̱<3Gͱb3Gʱ Q3G`˱;"3G˱.*func() (unsafe.Pointer, unix._Socklen, error)e3Gp:  α߱%o3G ͱ .*func(netip.AddrPort, *udpnat.conn, time.Time).*func(network.PacketConn) network.PacketWriteri|V3G`˱ɱͱxB3Gnͱ ߇ǟ3G@ɱ ̱b3Gt| ̱@3G7 ʱ4E3Gr!`hd3G `MͱK3G;  `M εF\3G2 N= "H 3G ~;p2z3Ge@@.*func(net.PacketConn) (int64, net.Addr, error)TO3G; ̱ ̱{d3Gi ̱.*func(*buf.Buffer) (metadata.Socksaddr, error)u3G> @@GK3G @@.*func(bbr.extraAckedEvent, bbr.roundTripCount)43GM ̱o 3G  ̱3G >ͱ@c3G< ͱԩ?3G'@Ժ@Ժ ̱?r(3Gu$$ ̱.*func(qerr.ApplicationErrorCode, string) error.github.com/apernet/quic-go/internal/utils/tree.*func(utils.ByteInterval) []utils.ByteInterval.*map.bucket[protocol.StreamID]quic.sendStreamI.*func() (ackhandler.Frame, protocol.ByteCount).*func([]uint8, protocol.EncryptionLevel) error@M(3G jG3G=:d o3G( =Eh_3GA ɱ%C3Gv = 3GAM= B3Gzo`ս˱ͱ3G7v @ʱTa3G MNV&3G\ M,P3G`kU3GO. @w@v b3G ˱@w>3G8 ~:3G֓ ` Q˂3GxE @N@U83Gx ߷ͱͱX@3GB ` T3Ghv =`սx3Gno ` `q93G_ ` ͱѾ3G/DlX3GA @w`ͱv՟ 3G @w`ͱUP3G @`ͱ d3Gv  gn3G=[M43G4  ,oQg 3G =,0sA3Gi =N3GE  NBv3G* ̱ͱk5l3G7 =b3G>˱S3G =ֽ#3G׊ =`ս=Q3G   ö ö.*func(textproto.MIMEHeader) (io.Writer, error)3G+ɱ lw3GpK . D3Gѓ˱.*struct { F uintptr; X0 *[]hpack.HeaderField }}3G î.*func(string, uint32, string, string) *dns.Msgq=3G? ̱ ̱T 3G,?@ɱǶT3GF ̱~h 3G[`ɱ313Ge@@ܮhy3G$@ܮ[vP3G!ʱͱyq3Gɱʱyj3Gy ̱y53G>@w싀3G!tK3Gpë3Gɱ`H3G ̱ ̱D3G ̱ ˱ ̱l3G ̱.3G, ̱`br3GIɱ ̱#3G`ɱ ̱`+Y3Gɱ ̱ E3G ̱ڗ#3G=8(3GUmɱ@xɱ.*func(string, ...oauth2.AuthCodeOption) string383GR ɱɱZߢ3G =@`93GJ =@(AttachedToInstancejson:"attached_to_instance" MySQLSQLModes json:"mysql_sql_modes,omitempty"RedisACLCategoriesjson:"redis_acl_categories" LogLinePrefix json:"log_line_prefix,omitempty" MaxStackDepth json:"max_stack_depth,omitempty" MaxWalSenders json:"max_wal_senders,omitempty" TempFileLimit json:"temp_file_limit,omitempty" TrackIOTiming json:"track_io_timing,omitempty"Recommendationjson:"recommendation,omitempty"StickySessionsjson:"sticky_session,omitempty"I3G  ̶໴3GZ ̶໴ @D3G~  ̶@%,n3G  Ry3GCɱxͱf˿3G~(3G ĿĿĿ23GYoĿCH w3G ſſſ})K3GoſP͋i3GK  ǿ ǿ ǿu23Go ǿr3G `ȿ`ȿ`ȿg3Go`ȿ&3Gy ` ` F73G ̱Gd3Gɱ@3GQɱ@@_*3GɱͱͱJ3Gɱ ̱ ̱J3G0hɱ˱˱)3GU'ɱ`̱`̱O3Gwɱ˱˱P*?3G0p.*map.bucket[netlink.BondPrimaryReselect]string.*map.bucket[string]netlink.BondPrimaryReselect.*struct { pragma.NoUnkeyedLiterals; Size int }.*struct { F uintptr; X0 protoreflect.Message }t3G_0  TJ3Gy 0ϗ3Gmfyh3G7 03GA @z3GrE{̳.*func(protoreflect.Name) protoreflect.FullName.*func(protoreflect.MapKey, protoreflect.Value)}O3G    b3G  ͱqB3Gh  ͱ z3G{ `u 3G .*struct { F uintptr; X0 *brutal.BrutalSender }#23G$  TM.*func(time.Duration, time.Duration, time.Time)R~3G_ @@  Z3Gm) @NV3GGw?3Gk ` .?3G  ` D3G# @N3G) `` ̱N3G~o3GmT.github.com/apernet/quic-go/internal/ackhandler[,3G ` ͱ?}|3GUմͱ(3G9 &_3GӚͱ蝣V3G( ` i3Gz @13GJͱͱ.3GOcִؖ63G/vں3G ̱E3GHw/3G`ͱ]3GCU=ͱH3Gy||ͱ4"3Gq=ӾҹO3G||'3G1{ =ɱ`.*struct { F uintptr; X0 *[]qpack.HeaderField }~3GBs33G8Z3Glz``ͱg6 3GɱüY 3G {83G  S^|3GN   _3GU Ц|3G- .*func([]uint8) (kem.PublicKey, kem.PrivateKey).*func(kem.PublicKey) ([]uint8, []uint8, error).*func() (kem.PublicKey, kem.PrivateKey, error)H&Y3Gh PeH3Gi P 3G(.Pzq3G2ߢ_3G `~`~`~4F3G4r`~8'3GG Tp3G_r8@3G |3Gr &;3G #'3Gr:_&3G,aaͱ*o3G~ ̱`%.*map.bucket[protoreflect.FullName]interface {}9 3G  tlϒ]3G ɱ 3G9  `SN3G$  ٷk$3G{ ɱٷ.*map.bucket[protoreflect.Name]*filedesc.Method.*map[filedesc.Edition]filedesc.EditionFeatures}Y43GN ˱ ˱ ˱=%3G| `oA3GT ``o.github.com/apernet/quic-go/internal/congestionL3G.github.com/cloudflare/circl/kem/kyber/kyber512.github.com/cloudflare/circl/kem/kyber/kyber768.github.com/cloudflare/circl/pke/kyber/kyber512.github.com/cloudflare/circl/pke/kyber/kyber768q:i3G?```˱3G ```|/3Gn`ʱ ̱_`03G?`˱F3G ;3G`ʱ`ʱ/*struct { F uintptr; X0 *proxymux.muxListener }/github.com/apernet/hysteria/app/v2/internal/tun/github.com/apernet/hysteria/app/v2/internal/url/*struct { F uintptr; X0 *context.afterFuncCtx }/*func(uint32, http.http2ErrCode, []uint8) error/*[8]func(*http.Server, *tls.Conn, http.Handler)/*struct { F uintptr; X0 *http.http2ClientConn }/*struct { F uintptr; X0 *http.http2serverConn }/*func(context.Context, string) ([]uint8, error)/*func(context.Context, string, int, bool) error/*map.bucket[string][]certmagic.dnsPresentMemory/*struct { F uintptr; X0 *certmagic.ACMEIssuer }/*struct { F uintptr; X0 *certmagic.jobManager }OverrideDomain json:"override_domain,omitempty"/github.com/apernet/hysteria/extras/v2/outbounds/*func(string, string, []uint8, string) *[]uint8/*func(string, string, float32, string) *float32/*func(string, string, float64, string) *float64/*func(string, string, []int32, string) *[]int32/*func(string, string, []int64, string) *[]int64/*func(map[string]interface {}) ([]uint8, error)/github.com/spf13/viper/internal/encoding/dotenv/*func(context.Context) (quic.SendStream, error)/*func(*quic.packetBuffer, uint16, protocol.ECN)/*func(context.Context) (quic.Connection, error)/*func(protocol.StreamNum) (quic.streamI, error)/*map.bucket[protocol.StreamNum]quic.sendStreamI/*map.bucket[string]*http3.roundTripperWithCountSingleExtensionsasn1:"explicit,tag:1,optional"/*func(crypto.Signer, *dns.Msg) ([]uint8, error)/*func([]uint8, []uint8, []uint8, []int) []uint8DatabaseEngine json:"database_engine,omitempty"MaintenanceDOW json:"maintenance_dow,omitempty"TrackFunctions json:"track_functions,omitempty"MaxConnections json:"max_connections,omitempty"DDOSProtection json:"ddos_protection,omitempty"EnableFirewall json:"enable_firewall,omitempty"UpgradeVersion json:"upgrade_version,omitempty"PrivateNetwork json:"private_network,omitempty"StickySessions json:"sticky_sessions,omitempty"/*func(string) ([]*doh.ARecord, []uint32, error)/*func(*bigmod.Nat, *bigmod.Modulus) *bigmod.Nat/*func([]uint8, protoreflect.ProtoMessage) error/google.golang.org/protobuf/reflect/protoreflect/*func(congestion.ByteCount, bbr.roundTripCount)/github.com/apernet/quic-go/internal/flowcontrol/*func([]uint8, []uint8) *handshake.xorNonceAEAD/*struct { F uintptr; R *handshake.cryptoSetup }/*func(*net.Interface, net.Addr, net.Addr) error/*func(context.Context, string, ...interface {})/*func(kem.PrivateKey, []uint8) ([]uint8, error)/github.com/pelletier/go-toml/v2/internal/danger/*func(string) (protoreflect.MessageType, error)/*struct { F uintptr; X0 *[]order.messageField }/*map.bucket[string]protoreflect.FieldDescriptor/*map.bucket[protoreflect.Name]*filedesc.Message/*map.bucket[protoreflect.Name]*filedesc.Service/*func(impl.pointer, *impl.coderFieldInfo) error/github.com/cloudflare/circl/kem/kyber/kyber1024/github.com/cloudflare/circl/pke/kyber/kyber10240*struct { F uintptr; R *sockopts.SocketOptions }Version(asn1:"optional,explicit,default:0,tag:0"0*func(context.Context, string) ([]string, error)0*func() func(func(*abi.Type, interface {}) bool)0github.com/apernet/hysteria/app/v2/internal/http0*func(client.Client, *client.HandshakeInfo, int) EncodeTime%json:"timeEncoder" yaml:"timeEncoder" EncodeName%json:"nameEncoder" yaml:"nameEncoder"0*func(*tls.ClientHelloInfo) (*tls.Config, error)0*func(context.Context, net.Conn) context.Context0*map.bucket[http.routingIndexKey][]*http.pattern0*struct { F uintptr; R *http.http2clientStream }0*func(http.ResponseWriter, *http.Request, error)OriginalNameServersjson:"original_name_servers"0*func(*[]uint8, string, string, []uint8, string)0*func(*float32, string, string, float32, string)0*func(*float64, string, string, float64, string)0*func(*[]int32, string, string, []int32, string)0*func(*[]int64, string, string, []int64, string)0*func() (*buf.Buffer, metadata.Socksaddr, error)0*list.List[github.com/apernet/quic-go.newConnID]0*func([]uint8, protocol.ByteCount, func()) error0*func(context.Context) (quic.sendStreamI, error)0*struct { F uintptr; X0 *quic.packetHandlerMap }0*map.bucket[protocol.StreamID]*http3.datagrammer0*map[*http3.QUICEarlyListener]http3.listenerInfo0*func(*protocol.UDPMessage) *protocol.UDPMessage0*func(interface {}, *list.Element) *list.Element0*struct { F uintptr; X0 *httptrace.ClientTrace }Version(asn1:"optional,default:0,explicit,tag:0"Version(asn1:"explicit,tag:0,default:0,optional"WALWriterDelay!json:"wal_writer_delay,omitempty"0*struct { F uintptr; X0 *os.File; X1 *exec.Cmd }0*struct { F uintptr; X0 io.Writer; X1 *os.File }0*func(string) ([]*doh.MXRecord, []uint32, error)0*func(string) ([]*doh.NSRecord, []uint32, error)ObfuscatedTicketAgejson:"obfuscated_ticket_age"0*func(protoreflect.EnumNumber) protoreflect.Enum0maxCongestionWindowWithNetworkParametersAdjusted0*func(logging.ECNState, logging.ECNStateTrigger)0*func([]uint8) (sign.PublicKey, sign.PrivateKey)0*func() (sign.PublicKey, sign.PrivateKey, error)0github.com/pelletier/go-toml/v2/internal/tracker0google.golang.org/protobuf/reflect/protoregistry0*map.bucket[string][]protoreflect.FileDescriptor0*map[protowire.Number]protoreflect.ExtensionType0*map[protoreflect.EnumNumber]*filedesc.EnumValue0*func(protoreflect.ExtensionTypeDescriptor) bool0*map.bucket[protowire.Number]reflect.StructField0*map[reflect.Type]protoreflect.MessageDescriptor0*struct { F uintptr; R *congestion.cubicSender }0github.com/cloudflare/circl/sign/dilithium/mode30github.com/cloudflare/circl/sign/dilithium/mode21github.com/apernet/hysteria/app/v2/internal/utils1*struct { F uintptr; X0 *sockopts.SocketOptions }1*struct { F uintptr; X0 func(string); X1 string }1*struct { F uintptr; X0 string; X1 http.Handler }1*func(context.Context, string) ([]*net.MX, error)1*func(context.Context, string) ([]*net.NS, error)1*struct { F uintptr; X0 func(int) error; X1 int }1*concurrent.node[*internal/abi.Type,interface {}]1*struct { F uintptr; X0 func(func()); X1 func() }1*func() (unsafe.Pointer, syscall._Socklen, error)1*func([]string) (*cobra.Command, []string, error)1*struct { Level *zapcore.Level "json:\"level\"" } Development%json:"development" yaml:"development" OutputPaths%json:"outputPaths" yaml:"outputPaths"1*func(string, int, fs.FileMode) (*os.File, error)1*struct { F uintptr; X0 net.Conn; X1 chan error } FunctionKey%json:"functionKey" yaml:"functionKey"1*func([]uint8, []uint8, []uint8, []uint8) []uint81*map.bucket[*http.Request]context.CancelCauseFunc1*func(string, url.Values) (*http.Response, error)1*struct { F uintptr; R *http.ResponseController }1*struct { F uintptr; X0 *server.udpSessionEntry }1*func(string, string, []net.IP, string) *[]net.IP1*func(string, string, []string, string) *[]string1*func(reflect.Value, reflect.Value) (bool, error)1*func(time.Time, time.Time, time.Time, time.Time)1*func([]uint8, protocol.Version) ([]uint8, error)1github.com/apernet/hysteria/core/v2/internal/frag1*func(context.Context, string) (*dns.Conn, error)ActivationEmail!json:"activation_email,omitempty"MaintenanceTime!json:"maintenance_time,omitempty"DeadlockTimeout!json:"deadlock_timeout,omitempty"DefaultPassword!json:"default_password,omitempty"HAControlPlanes!json:"ha_controlplanes,omitempty"ResponseTimeout!json:"response_timeout,omitempty"BackendProtocol!json:"backend_protocol,omitempty"ForwardingRules!json:"forwarding_rules,omitempty"1*func(string) ([]*doh.PTRRecord, []uint32, error)1*func(string) ([]*doh.SOARecord, []uint32, error)1*func(string) ([]*doh.SRVRecord, []uint32, error)1*func(string) ([]*doh.TXTRecord, []uint32, error)1*struct { pragma.NoUnkeyedLiterals; Flags uint8 }1*struct { pragma.NoUnkeyedLiterals; Buf []uint8 }1*func(protoreflect.ProtoMessage) ([]uint8, error)1*map.bucket[protoreflect.Name]*filedesc.EnumValue1*map.bucket[protoreflect.Name]*filedesc.Extension1*map.bucket[protowire.Number]*impl.coderFieldInfo1*map.bucket[protoreflect.Name]reflect.StructField1google.golang.org/protobuf/internal/encoding/text o&qG``ʱ* _G5C pWG4R@?`ʱK u<GR `ʱNbp3G3GX7N kGL9 RoFR?6tFG@  &y9GA@`ʱ< F"G@x ddG>)U`ʱ XGjV`ʱ h.GH ̱U o9G `ʱ Mw'G<%ɱ@6tFG}|x='^6tFG{`ʱx-"$6tFGJ;`x 2CG&Y uIGnl<`ʱW.GeoUpdateInterval mapstructure:"geoUpdateInterval"2github.com/apernet/hysteria/core/v2/internal/utils2*func(server.StreamState, server.StreamState) bool4ל3G./ɱɱ:3GV/ɱ`˱<3GhE/ɱ`˱ɱ2*ecdh.nistCurve[*crypto/internal/nistec.P256Point]2*ecdh.nistCurve[*crypto/internal/nistec.P384Point]2*ecdh.nistCurve[*crypto/internal/nistec.P521Point]T3G8 8&3G= ʼ< `3GQQQQ@x3GPͱޗ3G ̱ 3G H ̱1e3G3  I ̱ã3G˺ ̱-3G ̱/= Na3GL ̱@n$H3GԊ/ ̱N3Gx@n ̱7Zf3Ge ̱@޽ׄ3G@ ̱ Hv3Gf@޽ ̱V 53Gm ̱3GX ̱oȓY3GXo ̱]3Gɱɱ`QZU3G} =ɱ$3Gp=ɱɱ# F3G =ɱ3Gr =ɱR*3G =ɱ y5p,3GFɱɱŻ3ϓ6tFG`ʱd2*concurrent.entry[*internal/abi.Type,interface {}]Ǘ3G   ͱŸ3G!B@.@.ͱ.^&6tFG`wdHÞ3GD˱ ̱X3G˱ ̱˱/3G  ɱ ̱c&\3G޾ ̱ ̱ ̱  j3G= ̱ ̱ ̱c3GBrɱ ̱ ̱ ̱2*func(*pflag.FlagSet, string) pflag.NormalizedName3G @.)S3G || 2*func(zapcore.Level, string) *zapcore.CheckedEntry2github.com/apernet/hysteria/app/v2/internal/socks52github.com/apernet/hysteria/app/v2/internal/tproxy$h3GP =Żixh3G =Ni2*struct { F uintptr; X0 *udphop.udpHopPacketConn }?3G ?nk=3G `b dM3G  `b dY3Gtg8}3G    ͱ,\3GX    ͱu#3G,ͱ kN13G#  ˱@@ ̱^7v3G`˱ͱ13Gr `˱9{U3G1 =@=??3G ɱG 3Gg @ɱɱy? 3G, nɱH3G7 nவ{3Go ɱ`{ GCxd -3GXs =ɱrn?3G< =ɱ}1:j3G.=ɱf3G8= :q03GW =ɱKNA3G_ =`dMO3G)`Ю9d3G =ɱ 3Gֈ =@@|P3Gi =}3G,=ɱͱw3Gͱ=ɱɱC@3G=ͱ}3G =Ƽ9P3G, = ̱]N3G =͍3G =ɱЮKeyAuthorization!json:"keyAuthorization,omitempty"{ 3G =@kP»3G =ƼƼ@3Gk ̱ɱݼ3Gkɱ ̱I)>3Gdɱ˱˱ͱ0;3G@/2*struct { F uintptr; X0 *outbounds.socks5UDPConn }C 3G"  ̱@W3G@" @ ̱H^3Gp"  ʱͱ~3Ghɱ ?e<3Gɱͱͱ&3G=QQQQd3GLlQ ̱`̱Q(3Gqlɱ ̱Qͱre"3G ̱ ̱A2*struct { F uintptr; X0 func(reflect.Value) bool }˯3G ̱ ̱ ̱|@I3GQ ̱ ̱3G*  ̱ ɱ+ v3G ̱ ̱ ̱_3G% ̱ ̱`ʱvP3G ̱ ̱Fi3G,K ̱ ̱GM_J3G\ ̱ ̱@Gb3Gl ̱ ̱ 0l 3G[ ̱ ̱ ̱,?3G ̱ ̱G2*func(*[]net.IP, string, string, []net.IP, string)2*func(*[]string, string, string, []string, string)>#3GI ɱͱɱ@3HxO3Gaɱ ɱ`MV3G`ɱ ɱ3G$@3ɱͱɱX h3GUKɱɱs>%_3G\ɱɱLi/3GHɱɱɱ1g3Gm1ɱɱɱ3G ɱ@ɱ(3G ɱɱ@E3G( @ɱɱZb3G ɱ@ɱD3G~Kɱ`ͱɱ2g3Gɱ ɱ`a 3Gk`ɱ ɱ;3G]2ɱ`ͱɱRF3GKɱͱɱ3;1E3Gɱɱ࠮"=I3G࠮ɱɱq3G=]3ɱͱɱN3GɱԿɱ` y3Gվɱuɱ up!3G@,  uɱuɱPgm3G ɱ?ɱr3Gdzɱ?ɱ3G&kɱ`ɱ x3G ɱ`ɱOz 3G`ɱԿɱJ3Gɱ ̱ɱ13Gmɱʱɱ0"gn3GQ0ɱʱɱ#lD3Gmɱ ˱ɱ0P3GKɱɱI93G]ɱɱP3Gw0ɱ ˱ɱ#oP3Gnɱ˱ɱ1[3G"LɱɱMy3G]ɱɱtz63G1ɱ˱ɱuO3G ɱ ʱɱ/ 3G/ɱ ʱɱT&Y3G-nɱɱ RҦ3GÁ ɱɱ3G1ɱ ̱ɱ㳽c3G֑ɱɱ;3Gɱɱɱ@/3V3G|kɱɱ`3G`ɱɱbN3G. ɱɱ`pl3G ɱ@/ɱf83G< ɱ@/ɱT3G. `ɱɱ]3G ɱɱ |'E3G  |ɱɱ"3G@@/ɱɱɱPI3G ɱ`̱ɱ1^3G$ɱʱɱ@0%3Gh@0ɱʱɱS3GKɱ`˱ɱ0'=w3G0ɱ`˱ɱO3Grɱ˱ɱ@133G@1ɱ˱ɱ3GRnɱ`ʱɱ/JU3G/ɱ`ʱɱ3Gɱɱ VŎ3G ɱɱ'#3G1ɱ`̱ɱ=2=3Ghɱɱɱ73G |ͱ-93GS ||g3Gn ||ͱ3Gέɱ ̱ ̱3Gkɱ k3G^ɱ ͱ^3G 'ɱ&ɱ"(3Gc^۷3G5 ̱o<3G$'  `MͱH3Ge  `M ͱx&%3G[ ̱˱G3G ̱ ̱~ z3G0> F˱/2*func(*quic.ClientHelloInfo) (*quic.Config, error)2*func(context.Context) (quic.ReceiveStream, error)2*func(protocol.StreamID) (quic.sendStreamI, error)f3G6=T@wEm*3G ʱTP!3Gf  ~G+u3G8 `>3G  ,Z3G~l ̱ ̱v3G @Nͱ |T3G& @w@w`ͱQ53GԌ @N83GRnͱF3G1`ɱɱ o3GB ̱ ̱ɱ?3GɱɱԿͱ$3G ɱȠe3G]w @y@3GX?!C3G: =ɱ`H2*func(context.Context, *oauth2.Token) *http.ClientI3G.=ɶClusterTimeZone"json:"cluster_time_zone,omitempty"2*func(context.Context, string, *govultr.Soa) errorFirewallGroupID"json:"firewall_group_id,omitempty"nF3GW/ =ҭ{N3G =ɱԭv3G>3 =ɱ@٭췟K3G3 =ɱڭW3G3 =ɱ@ڭ8{3G8d =@ޭ{t3G =ɱ(3Gi( =ɱH3Gn=ɱ ̱Y3Gl =ɱg*P3GT =ɱ{(3GV5 ={(3G( =ɱ䶓3G0 =ɱM;3G  =ɱ@m`3G =ɱ3G( =ɱ@~I3G@T =ɱTR3G =ɱ2*func(string) ([]*doh.AAAARecord, []uint32, error)}v3Gxy ɱ ?V3G ɱ@ ߼g3G ɱ. 43G ɱ@. "3G" ɱ. 3G ɱ. ѯ^3G8 ɱ/  3Gk ɱ@/ [p3G ɱ/ %!"3G `L OL3G  `L ƥ[3Gp ĿĿʇ3G, ĿĿ ̱Ŀk3G ſſP3Gp ſſ ̱ſ3G  ǿ ǿxR3G  ǿ ǿ ̱ ǿWI3G* `ȿ`ȿ]3G `ȿ`ȿ ̱`ȿhS3G ` `̱` 3G ` ` ld,M3G `  J3Gh +ɱ ̱ͱ2*func(io.Writer, properties.Encoding) (int, error)63G7ɱɱɱͱ"W3G   ̱Y3G ̱ ̱ɱCi3G" TJ;X3Gt 03G GH3G[3 2*func(logging.TimerType, protocol.EncryptionLevel)e3Gn //@w@wN|3G_ TFnn3G ` CT3G `3G  ̱[963Gh /`В33GZ2/k3Ggp / `3GQ @Nͱ@3G GHvP3Ge  L?)3G{ w//l3G =ɱ`qi3G =ɱJ2*struct { F uintptr; X0 retryablehttp.ReaderFunc }E3G  Z)0W3Gb{ P3Gh .k3G P߄3G `~`~ ̱`~m|3GH  ̱uuw3G  ̱_3G  ̱2*func(string) (protoreflect.FileDescriptor, error)2*map[protowire.Number]protoreflect.FieldDescriptorz03G  ̱` ̱YS3G, Z`@3GX `o` ̱:3Gd ``o ZO*3G` @@ͱF13GW``̱ ˱ ˱3*map.bucket[string]*trafficlogger.trafficStatsEntry Extensions(asn1:"omitempty,optional,explicit,tag:3"3*func([]uint8, *syscall.SockaddrInet4) (int, error)3*func([]uint8, *syscall.SockaddrInet6) (int, error)3*func(context.Context, string, string) (int, error)3*func(*abi.Type, interface {}) (interface {}, bool)3*go.shape.struct { internal/weak.u unsafe.Pointer }3*func(*runtime.statAggregate, *runtime.metricValue)3*map.bucket[string]func(*url.URL) (zap.Sink, error)3*struct { F uintptr; X0 *http.Server; X1 net.Conn }3*struct { F uintptr; X0 *client.udpSessionManager } EncodeLevel'json:"levelEncoder" yaml:"levelEncoder"3*map[http.http2FrameType]map[http.http2Flags]string3*struct { F uintptr; R *httputil.maxLatencyWriter }3*map.bucket[string]*certmagic.RingBufferRateLimiter3*struct { F uintptr; X0 chan struct {}; X1 string }3*struct { F uintptr; X0 *server.udpSessionManager }3*func(*outbounds.AddrEx) (outbounds.UDPConn, error)3github.com/apernet/hysteria/extras/v2/outbounds/acl3*struct { F uintptr; X0 chan outbounds.dialResult }3github.com/apernet/hysteria/extras/v2/trafficlogger3*ecdsa.nistCurve[*crypto/internal/nistec.P224Point]3*ecdsa.nistCurve[*crypto/internal/nistec.P256Point]3*ecdsa.nistCurve[*crypto/internal/nistec.P384Point]3*ecdsa.nistCurve[*crypto/internal/nistec.P521Point]3*func(string, time.Duration, string) *time.Duration3*func(string, string, []float32, string) *[]float323*func(string, string, []float64, string) *[]float643*func(string, string, net.IPNet, string) *net.IPNet3*func(string, int, fs.FileMode) (afero.File, error)3*func(bbr.extraAckedEvent, bbr.extraAckedEvent) int3*list.Element[github.com/apernet/quic-go.newConnID]3*func(protocol.StreamNum) (quic.sendStreamI, error)3*func(context.Context) (quic.receiveStreamI, error)3*struct { F uintptr; X0 error; X1 *sync.WaitGroup }3*func(context.Context) (http3.RequestStream, error)3*func(io.Reader, string) (crypto.PrivateKey, error)IgnoredDatabases"json:"ignored_databases,omitempty"HealthyThreshold"json:"healthy_threshold,omitempty"FrontendProtocol"json:"frontend_protocol,omitempty"3*func(string) ([]*doh.CNAMERecord, []uint32, error)3*func(protoreflect.MapKey, protoreflect.Value) bool3*map.bucket[protowire.Number]protoreflect.RawFields3*func(func(*ackhandler.packet) (bool, error)) error3*func([]uint8, kem.PrivateKey, kem.PublicKey) error3*map[protoreflect.Name]protoreflect.FieldDescriptor3*interface { ProtoMessageInfo() *impl.MessageInfo }MaxIncomingStreams!mapstructure:"maxIncomingStreams"4*func(context.Context, string) ([]net.IPAddr, error)4*[]*concurrent.node[*internal/abi.Type,interface {}]4github.com/apernet/hysteria/app/v2/internal/proxymux4github.com/apernet/hysteria/app/v2/internal/redirect4github.com/apernet/hysteria/app/v2/internal/sockopts4*struct { F uintptr; X0 *error; X1 func(int) error }4*func(interface {}, interface {}, interface {}) bool4*func(string, string, *tls.Config) (net.Conn, error)4*map.bucket[http.connectMethodKey]http.wantConnQueue4*struct { F uintptr; R *http.socksUsernamePassword }4*func(context.Context, *acme.Client, acme.EAB) error4*func(func(string) bool) (reflect.StructField, bool)4*func(*time.Duration, string, time.Duration, string)4*func(*[]float32, string, string, []float32, string)4*func(*[]float64, string, string, []float64, string)4*func(*net.IPNet, string, string, net.IPNet, string)4*func(reflect.Value, ...reflect.Value) (bool, error)4*func(reflect.Value, ...reflect.Value) reflect.Value4*bbr.WindowedFilter[go.shape.uint64,go.shape.uint64]4github.com/apernet/quic-go/internal/utils/linkedlist4*map.bucket[protocol.ByteCount]quic.frameSorterEntry4github.com/apernet/quic-go/internal/utils/ringbuffer4*map[protocol.StreamID]quic.streamControlFrameGetter4*func(protocol.EncryptionLevel, bool) *wire.AckFrame4*map.bucket[protocol.ConnectionID]quic.packetHandler4*map[protocol.StatelessResetToken]quic.packetHandler4*map.bucket[protocol.ConnectionID]*quic.zeroRTTQueue4*func(context.Context) (quic.EarlyConnection, error)4*func(quic.EarlyConnection) http3.singleRoundTripperDatabaseEngineVersionjson:"database_engine_version"WALSenderTImeout#json:"wal_sender_timeout,omitempty"RedisACLChannels#json:"redis_acl_channels,omitempty"RedisACLCommands#json:"redis_acl_commands,omitempty"4*func(context.Context, string, string, string) error4*func([]uint8, *bigmod.Modulus) (*bigmod.Nat, error)4*func(protoreflect.Name) protoreflect.EnumDescriptor4*func(protowire.Number) protoreflect.FieldDescriptor4*struct { F uintptr; X0 protoreflect.Map; X1 *bool }4*func(*impl.MessageInfo) *impl.messageReflectWrapper4*func(*internal.VecK, *internal.VecK) *internal.VecK TrailerField(asn1:"optional,explicit,tag:3,default:1"5*func(<-chan singleflight.Result, context.CancelFunc)5*concurrent.indirect[*internal/abi.Type,interface {}]5*[]*concurrent.entry[*internal/abi.Type,interface {}]5*[0]*concurrent.node[*internal/abi.Type,interface {}]5*go.shape.struct { internal/concurrent.isEntry bool }5*func(zapcore.EncoderConfig) (zapcore.Encoder, error)5*struct { F uintptr; X0 *socks5.Server; X1 net.Conn }5*func(*tls.ClientHelloInfo) (*tls.Certificate, error)5*struct { F uintptr; X0 *context.timerCtx; X1 error }5*map.bucket[http.connectMethodKey][]*http.persistConn5*map[string]func(string, *tls.Conn) http.RoundTripper5*map.bucket[http.http2FrameType]http.http2frameParser5*func(context.Context, []uint8) (acme.Account, error)5*func(string, string, net.IPMask, string) *net.IPMask5*func(string, map[string]int, string) *map[string]int5*func(netip.AddrPort) (*udpnat.conn, time.Time, bool)5github.com/apernet/hysteria/core/v2/internal/protocol5*func(protocol.StreamID) (quic.receiveStreamI, error)5*func(protocol.EncryptionLevel) protocol.PacketNumber5*func(protocol.ConnectionID, quic.packetHandler) bool5*interface { SyscallConn() (syscall.RawConn, error) }5*struct { F uintptr; X0 int; X1 func([]uint8) error } NextUpdate*asn1:"generalized,explicit,tag:0,optional"AutovacuumNaptime#json:"autovacuum_naptime,omitempty"PGPartmanBGWRole$json:"pg_partman_bgw.role,omitempty"5*func(*bigmod.Nat, uint, *bigmod.Modulus) *bigmod.Nat5*func(protoreflect.Name) protoreflect.FieldDescriptor5*func(protoreflect.Name) protoreflect.OneofDescriptor5*func(protocol.EncryptionLevel, protocol.Perspective)5*func([]*ackhandler.packet, int64, int64, int64) bool5*func(*retryablehttp.Request) (*http.Response, error)5*map.bucket[filedesc.Edition]filedesc.EditionFeatures5*func(protoreflect.ExtensionType, protoreflect.Value)5*struct { F uintptr; X0 func() congestion.Bandwidth }5github.com/cloudflare/circl/pke/kyber/internal/commonח13GW7N3GNw@$ɱFdControlUnixSocket"mapstructure:"fdControlUnixSocket"6*struct { F uintptr; R *utils.LocalCertificateLoader }b+5G |ɱɱUF 5Gx@ͱU.Q5Gz` VFl5Gcɱ@VFl ʮ5G ɱVF 5Gɱ@WFl Pj5G"ɱ`aWFdl `ě5G/ɱ sXFT =5G,`ɱ ̱`XFl dx5Gɱ@XFL 6*func(x509.SignatureAlgorithm, []uint8, []uint8) error6*elliptic.nistCurve[*crypto/internal/nistec.P224Point]6*elliptic.nistCurve[*crypto/internal/nistec.P384Point]6*elliptic.nistCurve[*crypto/internal/nistec.P521Point]6*elliptic.nistCurve[*crypto/internal/nistec.P256Point]3G QQQQ`5Gɱͱ \FT /G5Gʹ˱ͱ\GTAFa{P`Q FL0FM. T;kFk.6*func([]uint8, []uint8, *net.IPAddr) (int, int, error)^3G =ɱɱ`QJI 3G =ɱɱ @"$3G =ɱɱF5Gpɱ \F 83G$ =ɱɱɎs5G* ̱ɱ@]\GlZ5G ɱ]\Gl;lBG5GmɱYF *|5GpQɱ^Fl B{5GɱA`^F B&3GN =ɱɱŻf|3G =ɱɱ`3Gb =ɱɱ` .3Gh =ɱɱ ̱6*[0]*concurrent.entry[*internal/abi.Type,interface {}]L5G6 B@._  k< 5G_\GL5GQ`ױ @`\GLQ5G1 ˱ α`\GLf5G3 ̱ ̱a\GLZA5G%@J@`aGL85GKɱ aF ڐn5G>ɱJ bF ]5G+`˱b\G R5G2 α ˱b\GL5Gbɱ˱@cF p3G# @ɱ ]5Gf4 c\GLC5GܱdFl Ib5G޿ɱ`d`dFl c}5GGsɱdFl +5G3ɱ| eF cO5Gdsɱ ;eF U3G   3G @T@T  ׉n5G  eJr05G-ɱ!@fF $װ5GKɱ`!fF /5Gɱ gFl u25G7+ ɱ `gFl 3Gp ɱ ̱Ȼ 6github.com/apernet/hysteria/app/v2/internal/forwardinghAv5GE|ɱgFl M=@5G/ɱrhFl Fee0~FI,d5GɱľjFl "5GTɱ| kFl 0a]5Gs`˱k\GL6github.com/apernet/hysteria/extras/v2/transport/udphop*FTGa+@UFYPZ@ EncodeCaller)json:"callerEncoder" yaml:"callerEncoder"U95G s`@lH챔<5G5 sɱlHT, 5G7@mFL6*func(interface {}, interface {}) (interface {}, bool)ē@5GYɱd`mFl ^ޱ3Gɱ ̱B)]3G 5GӠ`8ɱmHTAiv5Gʱͱ nK$S5Gʱ@үnK<'5Gː ʱnK5G.ʱ`@oK |5Gר @oJlg5Gt @pJL$ 5G?ɱ``pFl C 5G@TͱpFTyL5GF@T ̱ qFl6*struct { F uintptr; X0 chan bool; X1 chan struct {} }Au:\3G/`˱ͱAk3G  ``˱7&[5G}`?@q\G,i5G ɱqFl |x5Gߑ*@@r\G,)5G7o@r\G,<`45GS`˱s\GLE5Gɱ`sFl "5GvhaĮsp r9ai5G9ɱb tF 5G`˱t\GL;B3G ɱɱ@]Ż :75G `ǻ Ʈt L 85Gм`ǻ@u #5G}^ öu\GLơ5Gnv\GLB+5G^`ǻ ̱`v  *;3G =ؿn{5GR ɱvFl md3G =ؿɱ *5Gi`˱@t w\GL'ȝO5Gϒ@w@w:l0\5G!jɱȮwF 5Gɱ`x@xFl ,C5GFjx\G m5G4ɱxyFl :3G' ^VFZ:r FhP ~N5GTXɱ`y\Gl޽5G 9ɱy\Gl`5Gw`ɱ zHT< 5G zH4(D5G@ zH4k5G3 ɱ@{HTv5GKͱ{K$n:5GTɱ|K\5Gjɱ`ʮ`|F S5GXɱ|F #5Gjɱ }F |3G ɱɱ{6*func(context.Context, string, bool) ([]string, error)6*func(context.Context, string, string, []string) error~\3GX =ɱͱڨ3G"n =`pƼƼǤN5Gɱ`Fl $p3Gz =`L3G =ɱɱg3Gs =ɱ ̱ͱ435GǪɱFl kOY5GWɱ Fl eŸ5G~ɱ`Fl IV5GɱsFl :5G[ɱҮ@F {)5GYɱ@Fl bE 5G\ɱJFL є5Gɱ}`F( ADz5G$ɱǻF pZ5Gɱg F )Hm5Gɱ`PF 1~3Gދ =ɱЮЮ25Gbɱ Fl{B25Gɱ``F$l OnlyReturnExisting#json:"onlyReturnExisting,omitempty"\UH3G =Ƽ@Ƽnn43G( =Ƽɱ*`3Gr =Ƽɱ@ЮSC3G =Ƽ M M lZ3G ɱ ̱Ȼ G5GOɱ@Fl 6*struct { F uintptr; X0 *tun.System; X1 net.Listener }[mv5G ?( xC3G(l ̱ ̱[5G\ ʱ2 ~5G|ʱ`K<X#5G A3Gk  ˱`Mͱ@23GL= @i=fh3GA= @i޶s3G/= N@iz53G] `ಿo5G2+ ̱@ \G,\5GlI ]ߒ5G`ʱ`ʱ@Hi5G5 ˱ɱ\Gl"?g5GHɱ ˱Fl 6*func(protocol.ByteCount, protocol.Version) wire.Frame6*func(protocol.StreamNum) (quic.receiveStreamI, error)6*struct { F uintptr; X0 quic.packetHandler; X1 error }43Gi @N޷ͱͱsp!5G ˱@w`GZ5Gg GxV5GMM, Gӵ35G) M#GD=3G,@N{3G>@NΪ3Gb@@Ný'T3G` @N)-L3G@Ný@D!3Gܶ@N W'3GHj ͱ@N*'3G@Nr!l3G' cS5Gɱ %F Q>5G@w`@@5G @`@5G͂ G۾C5G_˱@`Gl"D5G__ ,Gl5G.  G d85G82 G jFx KF 5G#@w@@ەKI5GX `@G 8f5GDU G f5G `GfI5GA 2`GM5G*mMټGl'g5Gf.˱˱G5SA3Go `Eͱ+}5G. ĵ@\GL65G`ɱ`Fl \g$5GɱࡸFl 5Gc˱@  +6S5G`Ȼ\G 3GL ɱ`˱ɱɱy= 2_3Gɱɱʱ˱yy3G ̱ ̱ ̱]{5GOɱ (F Fl5Gh ɱ`K\YA5Gɱ F\ \5G9ɱ`ʱ FT L5G Bʱ` K<oɜ5G0ʱɱसK\g5GG`ʱ`Ȼ@H4)5G_`ʱɱHTj3G yɱy@5S$3G y`Hy@Vs3Gw  3Gɱɱ" 3GJ=ɶ@Pe3Gc =ɱ@)*3G =ɱɱ@LogErrorVerbosity$json:"log_error_verbosity,omitempty"DisablePublicIPv4$json:"disable_public_ipv4,omitempty"6*func(context.Context, string) (*http.Response, error)6*func(context.Context, string, *govultr.UserReq) error3Go =ɱ@ԭ{@'3G=խ@խ{v3Gj =ɱ@խ{gW5GTɱv`F \3G =ɱխ{~z3GO =ɱ֭{p3G =ɱ@֭{=鏹3G =ɱ֭{WǨ3G4 =ɱ@{c3G =ɱ{,/3G =ɱ@ح{L3Gh=٭٭{og3Ga, =ɱ٭{/A3G/=ڭݭ{Udt3G=ɱݭ{P3h3G=ӭ{:{3G7=@{3G0 =ɱ{D,+3Gj =ɱ{{3G(=ɱ@{!3G^ =ɱ@{-3G/ =ɱ{Ϳ13G =ɱɱ{3G+=@{3G =ɱ@{ 3G! =ɱ{̓3GPv =ɱɱ3G={a3/c3G^ =ɱ{] 3G =ɱɱ{!^3Gx8=@{hϣ3G{ =ɱ{ 3Gd =ɱ{"3G =ɱ@{v3Gg =ɱ{tAa3Ge! =ɱ"{w_aj3G! =ɱ@{73G=ɱ{\3GN- =@{<3G =ɱ{6\w3G2=@{y83G{ =ɱɱɱ3Gx =ɱ@{8bD3G! =ɱ{g3G=@{6ζ3G- =ɱ{T3Gc=ɱ%{3G3={QS3GŽ =ɱ{k3G0_ =ɱ{D3G܉ =ɱ{; 3G=@{y3G2={;C3GL" =ɱ{T-3G={yA73G 0={D_3Gƕ =ɱ{ k3GF,={SC3G% =ɱ{f3Gj=@{%Wb3G_ =ɱ{zn_3Gd =@{L_3G =ɱ@{03G- ={8d3G =ɱ{ #3G+e ={*3G5 =ɱ{3G" =n {\5GYɱ໴Fl nU5G]ɱ F w5G`̱``\Gl?5Ggɱ ৸Fl C_x5G;ɱ@FT 45G2`˱ ˱\GL ~5G@bT  z@B'5G̋ɱ Z`Fl 55GhɱF k03Gڪɱɱɱͱ w5GԌ@ͱસ\G4LQ5G ͱ@JTզ5GhɱqF L e5G:@T.Flo55Gɱ@`Fl umI5GɱӷF ី5Gџ@TPFlO75Gɱ୸\Gl`r5G`ɱ@\Gl15Gt ɱ\Gl 5Gtɱ\GlKA5G`ɱ`\Glxȁ5G+ɱ\Gl5GRɱ \Gl;5Gx ɱ\GlbN5G ɱసK\ĩ5G'ɱ@\Glե#65GG ̱\GLd5GkɱFl Z5Gɱ``Fl #5GBuɱ Fl 7hr5Gguɱ Fl #j5Gɱ`Fl R35GSɱ೸Fl F5Gɱ @Fl `\5G!ɱ F\ 5G>ɱ F\ v5Gɱ`Fl wnFCo!NEF0pJ! ~D5G`I`H6*func(protoreflect.Name) protoreflect.MethodDescriptor6*func(protoreflect.FieldDescriptor) protoreflect.ValueD*5GҴ@\G -5GK ˱0\Gli_:A5G~F ˱ `\G G3GO3 ͱ~3G3 ͱ6*func(protocol.EncryptionLevel, protocol.PacketNumber)m^83GTѾ3z$3G CTѾ)ҏ 5G|d˱๸G Ԃ3Gg I˱˱˱ͱa3G6 T ͱ$ >3G Ѿ` ͱv3G3 ͱ`'3Gp` /@w@w f3G@1/ ̱*5GUKWɱ@\Gll5G' ̱ \GLS3GE  ̱/S3G / ̱ٟ=5GɱF [15Gc ˱`8 &5G, ` ̱\GL<>Q5GK`˱ \Gl5G` \G4b,5G7ɱ༸F +g5Gɱ`@Fl ;wy3G ɱɱ {]*"5G^ ɱ``F g;3Gb6  Zͱb3G Y 3G $ Poz~3G`$ PҸ5GʓPͱ\G4RF5G cͱ`\G4U*C5G`\GLo{5GE@Ta Fl*05G@TcFlc#5G@T!࿸F45G9V F GI5GrɱVF l%5G T`\Glɱw5Gv 7Fl F{T}|F{6 El5G ɱл ¸Fl 5G̈¸Fl &% 5GH ¸\GL{M#5Gm ̱@øFl 5G5`øFl b5Gɱ`ĸFl O5GΜ``ĸ\GLh K5G  ĸF W5G!dɱ ŸF \5G  Ÿ\Gl0(65G5ŸFl mi5G@@Ƹ\G,뽉5G;ƸFl 15GKd #ǸFl r5GV@`ǸFl FZ5Gud ̿ǸFl 75GM ̱ ȸ  5G ȸFl ]K3G/ ˱ ˱`Z\`ؽ:(3G ˱ ˱`Z\*cϑ5G@n bȸ\Gl[5G@ɸ  , r`5G&x`I@TɸHT6*struct { F uintptr; X0 protoreflect.FieldDescriptor }&5Gn`ʸ\GLd5Gx6nʸFl 5G_  ˸\Gl~a5GDo˸\GL 5Gas˸\G4T15Gp@̸F4 F5G_@T̸FlG5G_@T͸\Gl/"F 0??FXWpܱ5G6@To`͸Fl]_5Gކ @T*͸FʵB3Gh0@ 6*struct { F uintptr; X0 *error; X1 prototext.encoder }5Gjɱͱ@ҸF 7*func(*big.Int, *big.Int, []uint8) (*big.Int, *big.Int)7*func([]uint8, []uint8, *net.UDPAddr) (int, int, error)7*interface { Network() poll.String; PollFD() *poll.FD }7*struct { F uintptr; X0 []mapstructure.DecodeHookFunc }7*[]func(zapcore.EncoderConfig) (zapcore.Encoder, error) DisableCaller)json:"disableCaller" yaml:"disableCaller" EncoderConfig)json:"encoderConfig" yaml:"encoderConfig" InitialFields)json:"initialFields" yaml:"initialFields" StacktraceKey)json:"stacktraceKey" yaml:"stacktraceKey"7*struct { F uintptr; X0 *tls.Conn; X1 context.Context }7*map[string]func(*http.Server, *tls.Conn, http.Handler)7*func(string, func(http.ResponseWriter, *http.Request))7*struct { F uintptr; R *http.http2serverInternalState }7*struct { F uintptr; X0 func(io.Reader); X1 io.Reader }7*func(context.Context, tls.Certificate, []string) error7*func(context.Context, string) ([]libdns.Record, error)7*struct { F uintptr; X0 *server.h3sHandler; X1 string }7*func(string, []time.Duration, string) *[]time.Duration7github.com/spf13/viper/internal/encoding/javaproperties7*func(*list.List[github.com/apernet/quic-go.newConnID])7*func(protocol.StreamID, quic.streamControlFrameGetter)7*func(protocol.StatelessResetToken, quic.packetHandler)7*func(protocol.ConnectionID) (quic.packetHandler, bool)7*func(context.Context, quic.Connection) context.Context7*map.bucket[*http3.QUICEarlyListener]http3.listenerInfoMySQLSlowQueryLog%json:"mysql_slow_query_log,omitempty"UnhealthyThreshold$json:"unhealthy_threshold,omitempty"BalancingAlgorithm$json:"balancing_algorithm,omitempty"7*struct { references int; anchor int; serialized bool }7*struct { F uintptr; X0 *int; X1 proto.MarshalOptions }7*func(protoreflect.Name) protoreflect.MessageDescriptor7*func(protoreflect.Name) protoreflect.ServiceDescriptor7*func(protoreflect.FieldDescriptor, protoreflect.Value)7*func(kem.PublicKey, []uint8) ([]uint8, []uint8, error)7*map.bucket[protowire.Number]protoreflect.ExtensionType7*map.bucket[protoreflect.EnumNumber]*filedesc.EnumValue7*func(protoreflect.Value, int, impl.marshalOptions) int7*map.bucket[reflect.Type]protoreflect.MessageDescriptor7github.com/cloudflare/circl/pke/kyber/kyber512/internal7github.com/cloudflare/circl/pke/kyber/kyber768/internal8*struct { F uintptr; X0 *url.URL; X1 *cmd.serverConfig }8*func(x509.VerifyOptions) ([][]*x509.Certificate, error)8*func([]uint8, []uint8, *net.UnixAddr) (int, int, error)8*func(context.Context, string, string) (net.Conn, error)8*func(context.Context, string, string) ([]net.IP, error)8*concurrent.HashTrieMap[*internal/abi.Type,interface {}]8*func(*concurrent.node[*internal/abi.Type,interface {}])8*map[netip.addrDetail]weak.Pointer[net/netip.addrDetail]8*[]*go.shape.struct { internal/concurrent.isEntry bool }8*func(func(*pflag.FlagSet, string) pflag.NormalizedName)8*[8]func(zapcore.EncoderConfig) (zapcore.Encoder, error)8*struct { F uintptr; X0 **redirect.sockAddr; X1 *error }8*struct { F uintptr; X0 *tproxy.TCPTProxy; X1 net.Conn }8*struct { F uintptr; X0 context.Context; X1 chan error }8*func(zapcore.Entry, zapcore.Core) *zapcore.CheckedEntry8*func(string, string, io.Reader) (*http.Response, error)8*struct { F uintptr; X0 *http.conn; X1 context.Context }8*func(context.Context, []uint8, []uint8, []string) error8*func(*big.Int, *big.Int, *big.Int) (*big.Int, *big.Int)8*struct { F uintptr; X0 go.shape.int64; X1 *[5]uintptr }8*func(*[]time.Duration, string, []time.Duration, string)8*struct { F uintptr; X0 *error; X1 func(uintptr) error }8*func() *list.List[github.com/apernet/quic-go.newConnID]8*func(*wire.CryptoFrame, protocol.EncryptionLevel) error8*func(*dns.Msg, string) (*dns.Msg, time.Duration, error)8*func(context.Context, *oauth2.Token) oauth2.TokenSourceBGWRITERFlushAFter%json:"bgwriter_flush_after,omitempty"MaxParallelWorkers%json:"max_parallel_workers,omitempty"MaxWorkerProcesses%json:"max_worker_processes,omitempty"RedisACLCategories%json:"redis_acl_categories,omitempty"8*func(context.Context, string, *govultr.ReverseIP) error8*func(context.Context, string, *govultr.SSHKeyReq) error8*func(*bigmod.Nat, []uint8, *bigmod.Modulus) *bigmod.Nat8*func(context.Context, slog.Level, string, ...slog.Attr)8*func(impl.pointer) (impl.pointer, *impl.coderFieldInfo)8*struct { F uintptr; X0 reflect.Type; X1 *impl.mapInfo }8github.com/cloudflare/circl/pke/kyber/kyber1024/internal9*func(*x509.Certificate, func([]*x509.Certificate) error)9*func(*ecdh.PrivateKey, *ecdh.PublicKey) ([]uint8, error)9*func([]uint8, []uint8, netip.AddrPort) (int, int, error)9*func(*concurrent.entry[*internal/abi.Type,interface {}])9*func() *concurrent.node[*internal/abi.Type,interface {}]9*[0]*go.shape.struct { internal/concurrent.isEntry bool }9*func() func(*pflag.FlagSet, string) pflag.NormalizedName9*func(reflect.Value, reflect.Value) (interface {}, error)9*struct { F uintptr; X0 func(zapcore.Core) zapcore.Core }9*struct { F uintptr; X0 *proxymux.muxManager; X1 string }9*func(context.Context, net.Conn, metadata.Metadata) error9*func(*list.Element[func(int)], *list.Element[func(int)])9*func(json.reflectWithString, json.reflectWithString) int9*struct { F uintptr; X0 *http.http2stream; X1 time.Time }9*func(context.Context, string) (certmagic.KeyInfo, error)9*struct { F uintptr; X0 go.shape.uint64; X1 *[5]uintptr }9*func(string, map[string]int64, string) *map[string]int649github.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo9*func(protocol.ConnectionID) protocol.StatelessResetToken9*func(protocol.StreamID) flowcontrol.StreamFlowController9*struct { F uintptr; X0 reflect.Value; X1 reflect.Value }FerretDBCredentials%json:"ferretdb_credentials,omitempty"MySQLLongQueryTime&json:"mysql_long_query_time,omitempty"MaxFilesPerProcess&json:"max_files_per_process,omitempty"9github.com/apernet/hysteria/extras/v2/sniff/internal/quic9*struct { F uintptr; X0 *syscall.Errno; X1 []unix.Iovec }9*func(func(protoreflect.MapKey, protoreflect.Value) bool)9*func(protoreflect.Name) protoreflect.EnumValueDescriptor9*map.bucket[protowire.Number]protoreflect.FieldDescriptor9github.com/cloudflare/circl/sign/dilithium/mode3/internal9github.com/cloudflare/circl/sign/dilithium/mode2/internal84/G+@!`ʱ h2GC6̱` KH-tFG\7`˱ Kw/G' `ʱNwG-` Ұ`ʾ3GLa  s৾3G"s  ৾z 3Ga @৾ND3G@b ๽৾p3G8sb ɱ৾gG@e ~`RoG g ~`RoxFG}` `ʱ˄y3G^` DBGA@ ~`*k0?G`ʱ =8O/Gz`ʱ x]52Gh OAGX ~`3p~I3Gn{<<3<% Ŀ3<<N><%` ſ4<<H<%; ǿ4<<QU<%a `ȿ5Gg@ ~`J3G$ɱɱ 3G $ɱɱ>H3G#`%࠿(aY.GӸB`ʱE c/GN`ʱ 'Z$GXQ ~`0J/G %S`˱  |n.P5GTNm]3G>wT@5h}3GW 3{Bw3GX nB3GKY o3GO@Y { $ZQ/G/]˱  ﭖ/G0]˱ 0I5G80^˱ HkU /G`0@^˱ Gd ~`xExFGd sVxE AG `ʱ8t Ps]/G` `ʱ j8^~4G `ʱ8yW/G{)/`˱  i5hHG΂d x:EhCGW @ e 3I AG`d X{4GDW@`eȖ  қP5GW eȖ /GDW@`e. ϕO4GW e. ʢAGDW`@`eg WkAGW@ fg ; /G΂d @35GW `f PW/Gd  P]2G{)`ʱ z IgnoreClientBandwidth$mapstructure:"ignoreClientBandwidth":*struct { F uintptr; X0 client.Client; X1 chan struct {} }ʪ3G QQQQQQ?3G* QQQQJQ3G8  ̱ ̱{Cl3Gi1 H ̱ ̱3G1  I ̱ ̱ifE3G @n ̱ ̱vƻ3G @޽ ̱ ̱z83Gx  ̱ ̱-"3G o ̱ ̱3Gpf =ɱ߽߽ :*func() *concurrent.entry[*internal/abi.Type,interface {}]& 9tFG׉ SkipLineEnding+json:"skipLineEnding" yaml:"skipLineEnding"I FG p䶮ɱ:*func([]uint8, []uint8, []uint8, []uint8) ([]uint8, error)9RT3G| 63GP"@]y`\?3G4@]dy@Ι,3G@]d`ʱS2k3Gl@]y@:*map.bucket[http.http2FrameType]map[http.http2Flags]stringYξ3Go =ɱɱ@]Ż:*struct { F uintptr; X0 *certmagic.RingBufferRateLimiter }:*func(context.Context, acme.Account) (acme.Account, error)TermsOfServiceAgreed%json:"termsOfServiceAgreed,omitempty"i3G) =Ƽ M MUо3Gn =Ƽ@ ̱FGPfɱ2FG0Dzɱ$3G `ͱ82gU3Gɱz~t3G@  LGf 0ѫ:*func(*map[string]int64, string, map[string]int64, string)P53GQ1  `M$3GW  :*func(*list.Element[github.com/apernet/quic-go.newConnID]):*func(*wire.Header, []uint8) (*quic.unpackedPacket, error):*struct { F uintptr; X0 *quic.Transport; X1 quic.rawConn }:*struct { F uintptr; X0 func(wire.Frame); X1 *[3]uintptr } 3Gs ߷@Ný@Lf3G=ɱ@]jb:*func([]uint8, int, dns.compressionMap, bool) (int, error)3G|  ̱@^ͱ ̱3G =yɱy@D3G( =y`Hy@RedisEvictionPolicy&json:"redis_eviction_policy,omitempty"BGWRITERLRUMaxPages&json:"bgwriter_lru_maxpages,omitempty"MaxReplicationSlots&json:"max_replication_slots,omitempty"!Q3G,L=ӭӭ{h3G=ӭӭ{-5ED3G=ӭӭ{M3GL=ɱ׭@խ{W3G(%=ӭӭ{3G%=ӭ@ӭ{hf3GU=ӭӭ{xQ3G3=ɱ@ݭɶ{=3G=ɱɱݭ{!5N3G=ӭӭ{]3Gph=ɱޭݭ{JU"3GC0=ɱ@߭{3G/=ɱ{;3G0=ɱ@{~mU3G[=ɱ{Fi3G=ɱ@{H3G$=ɱɱ{} G3GG+=ɱɱ@{L3G1=ɱɱ{s:B3G1=ӭ{\C3G<=ɱ {$A>3G2=ɱ ӭ{=3G= ӭ{5,3G6=ɱ!{F3G8=ɱ@!ӭ{E)3GX=ɱ{> }Q3Ge=ɱ@@{ 3G=ɱɱ{%3Gu=ɱ{mRb3G=ӭ ٮӭ{ 3G)=ɱ@{dhȶ3GV2=ɱɱ@{n٠3GY=ӭ!ӭ{3G*=ɱ{ѝl3G|=ɱ ̱{3G( =ɱ@3֭{"sf3Gx*=ӭ"ӭ{6@3GT=ɱ{Σ03GC=ɱ{[J3G0=ӭ"ӭ{JJ3G/.=ӭ#ӭ{oGta3G=ɱ@{ !3Gp =ɱɱ{"$3G%=ӭ$ӭ{+S3G.=ɱ{8>3G=ɱɱ{(3GJ=ɱɱ{s(3GV=ӭ@%ӭ{$3G`&=ӭ%ӭ{<3G+= ̱ɱ{53GY=ӭ&ӭ{}3G>=ӭ@&ӭ{qG3G=ӭ@ӭ{l3GY=ӭ&ӭ{T3G=ɱɱ{r"3G=ӭ'ӭ{-53G1=ӭ@'ӭ{TnI3G1=ɱ{)D3G*=ӭ'ӭ{'3G=ӭ'ӭ{Ke3GdZ=ӭ(ӭ{#O3G=ӭ@(ӭ{3G=ӭ(ӭ{Am3Gy=ӭ(ӭ{>3G" =ɱɱ nzŽ3G5 ɱɱɱ@/ o3GP"@@ ̶3G4@໴@ @Ͷ_\]3G@໴̶ʱX3Gl@@ @ͶeF*F˳Y:*func(...func(string, string) bool) *properties.Properties:*func(io.Writer, string, properties.Encoding) (int, error):*func([]uint8, protoreflect.ProtoMessage) ([]uint8, error)d< xFG̳Y :*func(protoreflect.Descriptor) protoreflect.SourceLocation:*func(protoreflect.SourcePath) protoreflect.SourceLocation3G,` @N ̱@U&3G 4T` ͱgo3GV M:3G PI tFG<@S]&γ ̱m* tFG<S]&γ ̱a{ tFG<S]&0ϳ, ̱4jX tFG<T]&pϳ0 ̱Ph tFG=@T]&ϳ4 ̱ tFG=T]&ϳ8 ̱o tFG*=T]&0г< ̱:*map.bucket[protoreflect.Name]protoreflect.FieldDescriptor;3Gk ˱`>c3G`o`:github.com/cloudflare/circl/sign/dilithium/internal/common;*func([]uint8, []uint8, syscall.Sockaddr) (int, int, error);*func([]uint8, []uint8) (int, int, int, *net.IPAddr, error);*struct { Layout string "json:\"layout\" yaml:\"layout\"" };*struct { F uintptr; X0 *tls.cipherSuiteTLS13; X1 []uint8 };*func(*http.Request, string) (*http.http2ClientConn, error);*func(context.Context, []string) ([]tls.Certificate, error);*go.shape.struct { Key reflect.Value; Value reflect.Value };*func(string, string, time.Duration, string) *time.Duration;*func(string, map[string]string, string) *map[string]string;github.com/apernet/hysteria/core/v2/internal/congestion/bbr;*func() *list.Element[github.com/apernet/quic-go.newConnID];*map.bucket[protocol.StreamID]quic.streamControlFrameGetter;*map.bucket[protocol.StatelessResetToken]quic.packetHandler;*struct { F uintptr; X0 *http3.connection; X1 quic.Stream };*func(*dns.Msg, *dns.Conn) (*dns.Msg, time.Duration, error)MaintenanceScheduled&json:"maintenance_scheduled,omitempty";*func(protocol.PacketNumber, protocol.EncryptionLevel) bool;*func([]uint8) (int, *ipv4.ControlMessage, net.Addr, error);*func([]uint8, *ipv4.ControlMessage, net.Addr) (int, error);*func(context.Context, slog.Level, string, ...interface {});*func(string, string, interface {}) (*http.Response, error);*func(protoreflect.FullName) (protoreflect.EnumType, error);*map[protoreflect.FullName]protoregistry.extensionsByNumber;*func(protoreflect.ProtoMessage, protoreflect.ProtoMessage);*struct { F uintptr; X0 protowire.Number; X1 reflect.Type };*struct { F uintptr; X0 reflect.Type; X1 protowire.Number }MaxStreamReceiveWindow%mapstructure:"maxStreamReceiveWindow"<*func([]uint8, []uint8) (int, int, int, *net.UDPAddr, error)<*func(context.Context, string, string) (net.Listener, error)<*func(context.Context, string, string) ([]net.IPAddr, error)<*func(context.Context, string, string) ([]netip.Addr, error)<*struct { F uintptr; X0 *forwarding.TCPTunnel; X1 net.Conn }<*struct { F uintptr; X0 *proxymux.muxListener; X1 net.Conn }EncodeDuration-json:"durationEncoder" yaml:"durationEncoder"<*func(*tls.CertificateRequestInfo) (*tls.Certificate, error)<*struct { F uintptr; X0 *tls.cacheEntry; X1 *tls.certCache }<*func(string) (multipart.File, *multipart.FileHeader, error)<*map.bucket[string]func(string, *tls.Conn) http.RoundTripper<*struct { F uintptr; X0 *http.Transport; X1 *http.wantConn }<*struct { F uintptr; X0 *server.h3sHandler; X1 quic.Stream }<*func(*time.Duration, string, string, time.Duration, string)<*func(*map[string]string, string, map[string]string, string)Ip9protobuf:"bytes,1,opt,name=ip,proto3" json:"ip,omitempty"<*quic.outgoingStreamsMap[github.com/apernet/quic-go.streamI]<*quic.incomingStreamsMap[github.com/apernet/quic-go.streamI]<*struct { F uintptr; X0 *quic.packetHandlerMap; X1 []uint8 }<*struct { F uintptr; X0 *quic.baseServer; X1 quic.quicConn }<*struct { F uintptr; X0 *http3.connection; X1 *quic.Stream }<*func(context.Context, string, *govultr.AttachVPC2Req) errorAutovacuumMaxWorkers'json:"autovacuum_max_workers,omitempty"TrackCommitTimestamp'json:"track_commit_timestamp,omitempty"EnablePrivateNetwork'json:"enable_private_network,omitempty"AttachPrivateNetwork'json:"attach_private_network,omitempty"NextScheduleTimeUTC(json:"next_scheduled_time_utc,omitempty"DetachPrivateNetwork'json:"detach_private_network,omitempty"<*func(*nistec.P521Point, []uint8) (*nistec.P521Point, error)<*func(*nistec.P224Point, []uint8) (*nistec.P224Point, error)<*func(*nistec.P256Point, []uint8) (*nistec.P256Point, error)<*func(*nistec.P384Point, []uint8) (*nistec.P384Point, error)<*func(protoreflect.FieldDescriptor, protoreflect.Value) bool<*func(sign.PrivateKey, []uint8, *sign.SignatureOpts) []uint8<*struct { F uintptr; X0 *gob.userTypeInfo; X1 reflect.Type }<*func(protoreflect.ExtensionType, func() protoreflect.Value)<*func(time.Duration, time.Duration, protocol.ByteCount) bool=*struct { F uintptr; X0 *cmd.clientConfig; X1 client.Client }=*func(context.Context, string, string, syscall.RawConn) error=*func([]uint8, []uint8) (int, int, int, *net.UnixAddr, error)=*struct { F uintptr; X0 *zap.SamplingConfig; X1 *zap.Config }=*func(zapcore.Entry, []zapcore.Field) (*buffer.Buffer, error)=*func(context.Context, *url.URL, string) (http.Header, error)=*struct { F uintptr; X0 http.http2closeWaiter; X1 chan bool }=*func(context.Context, string, map[string]interface {}) error=*func(context.Context, string) (certmagic.Certificate, error)=*func(io.Reader, []uint8, crypto.SignerOpts) ([]uint8, error)=*func(string, string, map[string]int, string) *map[string]int=*func(reflect.Value, ...reflect.Value) (reflect.Value, error)=*quic.incomingStreamEntry[github.com/apernet/quic-go.streamI]=*func(context.Context, string, string) (*oauth2.Token, error)PGPartmanBGWInterval(json:"pg_partman_bgw.interval,omitempty"=*struct { F uintptr; X0 *exec.Cmd; X1 chan<- exec.ctxResult }=*struct { F uintptr; X0 func(func() error); X1 func() error }=*func(*nistec.P521Point, *nistec.P521Point) *nistec.P521Point=*func(*nistec.P224Point, *nistec.P224Point) *nistec.P224Point=*func(*nistec.P256Point, *nistec.P256Point) *nistec.P256Point=*func(*nistec.P384Point, *nistec.P384Point) *nistec.P384Point=*func(logging.TimerType, protocol.EncryptionLevel, time.Time)=*func(*fiat.P224Element, *fiat.P224Element) *fiat.P224Element=*func(*fiat.P256Element, *fiat.P256Element) *fiat.P256Element=*func(*fiat.P384Element, *fiat.P384Element) *fiat.P384Element=*func(*fiat.P521Element, *fiat.P521Element) *fiat.P521Element=*func(protoreflect.FullName) (protoreflect.Descriptor, error)=*struct { F uintptr; X0 impl.offset; X1 reflect.StructField }BsxFGa@%xFGW Z*XXxFGq `MxFGj r pzxFGkr Z bxFGWr ]xFGW@s `3UxFGO`Ԋ)xFGtwaxtFG7  ! / /-ltFG8  // . $GG:  !$ $Z=xFGlC 3xtFG= C /P, )8XtFGm= C /#Ñ tFG`z KdH # tFG`B KqSxFGc8 K tFGv} K#xFGmC<KxFGG@=KO#tFGm C K /?  tFGcKFGTDI  !< (S&"tFGBJ  /ܺ\gtFG0K  /p0|tFG2K h4<60^6U〩3GI@ FGL  !XH\[wzIxFG0r r g%FGI ^ 2r  !ylgy}JFGf^ 2r  !D3G8_5@F|]7:>tFGj 5 97:xFGH@a 5$GGu@n Ro /Q$Iӄ$GGKn Ro#@ܣQ Ia `GGu`o Ro /QJnD]ptFGo Ro /QNvJ+tFGo p Ro /QJm tFGtW@w Ro !8QyIJ/IFGy Ro@ 1tFGO  ! ""}GtFGu`  !,-<-`tFGs H /4ztFG!>@ H /4j`xFG'@ Fca`xFG/`F8[xFGj cxFG@c)KxFGzK ?Zp$GG]@  / GOlxFGj 1xFG1v5 xFG8u }xFG)@`A8tFGٗ  /w'F3 _FGZ 9^ !TNRa]&ɹ|ͱIxFGb]&\ItFG@ bJ$yy:4[xFG Md`x@hxFGWhjYb3Gld  ̱  Ji tFG' dbJDž^jtFGU  /=tFG'@  CBΥxFGA| Ǣ xxFG o &RxFG `o )xFGV@A1xFGGe?lxFG$ "FbWxqe`qe=]rFqWxqeqeInitStreamReceiveWindow&mapstructure:"initStreamReceiveWindow"MaxConnectionReceiveWindow#mapstructure:"maxConnReceiveWindow"DisablePathMTUDiscovery&mapstructure:"disablePathMTUDiscovery"?3Gj ` >*func([]uint8, []uint8) (int, int, int, netip.AddrPort, error)>*func(context.Context, string, string) (net.PacketConn, error)3G  ̱ ̱ ̱@nq13G  ̱ ̱ ̱@޽sn3G  ̱ ̱ ̱  3Gu  ̱ ̱ ̱ou3G =ɱɱɱɱ`>*func() (netip.addrDetail, weak.Pointer[net/netip.addrDetail])YraFG dd!ZBF* I0 >*struct { F uintptr; X0 net.Conn; X1 net.Conn; X2 chan error }>*struct { F uintptr; X0 context.Context; X1 context.canceler }>*struct { F uintptr; X0 context.canceler; X1 context.Context }>*func([]uint8, tls.ConnectionState) (*tls.SessionState, error)>*func(tls.ConnectionState, *tls.SessionState) ([]uint8, error)>*struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }>*map.bucket[string]func(*http.Server, *tls.Conn, http.Handler)>*struct { F uintptr; X0 *http.http2serverConn; X1 chan error }ExternalAccountBinding'json:"externalAccountBinding,omitempty">*func(*map[string]int, string, string, map[string]int, string)>*func(protocol.StatelessResetToken) (quic.packetHandler, bool)>*struct { F uintptr; X0 quic.connRunner; X1 *quic.connection }A3G @A  ̱ͱIݎI3G ` C3GO /ʱT ̱PGAvailableExtensions(json:"pg_available_extensions,omitempty"DatabaseEngineVersion(json:"database_engine_version,omitempty"BGWRITERLRUMultiplier(json:"bgwriter_lru_multiplier,omitempty">*func(context.Context, string) (string, *http.Response, error)>*func(context.Context, string, string) (*http.Response, error)>*func(context.Context, string, *govultr.LoadBalancerReq) errorWm3GT=ɱӭӭ{C3G@U=ɱӭӭ{>3G= ̱ӭӭ{3G=ɱӭ@ӭ{"Z33GŠ=ɱɱޭݭ{ )3G(=ɱ@@ ӭ{gg3Gx3=ɱ {挸3G=ɱɱ{׼ 3GC=ɱɱ@{>Jp3GH;=ɱɱ{3G==ɱӭ`ٮӭ{Z(3G==ɱӭ!ӭ{]P3G D=ɱӭ@"ӭ{e3G=ɱӭ@ӭ{?{>3G =ɱӭӭ{[L^3G=ɱӭ#ӭ{U23G\=ɱɱ@{Gu3GD=ɱӭ%ӭ{3GD=ɱӭ$ӭ{&Ko3GV=ɱӭ&ӭ{'3G=ɱӭ)ӭ{K83G&ɱɱɱ@ H>*struct { F uintptr; X0 *yaml.decoder; X1 *yaml.Node; X2 int }mFP#0b \  a/53G5 GH v>github.com/apernet/hysteria/core/v2/internal/congestion/brutal>*func(protocol.ByteCount, protocol.Version) protocol.ByteCount>*func(kem.PrivateKey, []uint8, kem.PublicKey) ([]uint8, error)>*func(kem.PublicKey, kem.PrivateKey) ([]uint8, []uint8, error)>*struct { F uintptr; X0 *gob.encOp; X1 int; X2 gob.encHelper }>*func(protoreflect.FullName) (protoreflect.MessageType, error)>*func(protoreflect.ExtensionTypeDescriptor) protoreflect.Value>*struct { F uintptr; X0 func(); X1 *protoreflect.MessageType }/3Gh``o >github.com/apernet/hysteria/core/v2/internal/congestion/common?*map.bucket[netip.addrDetail]weak.Pointer[net/netip.addrDetail]?*struct { F uintptr; X0 *sync.WaitGroup; X1 *json.encoderFunc }?*struct { F uintptr; X0 *certmagic.tlsALPNSolver; X1 net.Conn }?*func(string, string, []time.Duration, string) *[]time.Duration?*func(netip.AddrPort, func() *udpnat.conn) (*udpnat.conn, bool)Key;protobuf:"bytes,1,opt,name=key,proto3" json:"key,omitempty"?*func(congestion.PacketNumber) *bbr.connectionStateOnSentPacket?*func([]uint8, []uint8, protocol.PacketNumber, []uint8) []uint8?*[]quic.incomingStreamEntry[github.com/apernet/quic-go.streamI]?*func(context.Context, string, *govultr.FirewallGroupReq) error?*func(context.Context, string, *govultr.ClusterReqUpdate) error?*func(context.Context, string, *govultr.StartupScriptReq) error?*func(protoreflect.EnumNumber) protoreflect.EnumValueDescriptor?*func(protocol.Version, []protocol.Version, []protocol.Version)?*func(wire.transportParameterID, wire.transportParameterID) int?*func(protoreflect.ExtensionTypeDescriptor, protoreflect.Value)?*struct { F uintptr; X0 *error; X1 *socket.Option; X2 []uint8 }InitConnectionReceiveWindow$mapstructure:"initConnReceiveWindow"@*func(*big.Int, *big.Int, []uint8, []uint8) (*big.Int, *big.Int)@*func(netip.addrDetail, weak.Pointer[net/netip.addrDetail]) bool@*map[string]func(zapcore.EncoderConfig) (zapcore.Encoder, error)ErrorOutputPaths/json:"errorOutputPaths" yaml:"errorOutputPaths"@*struct { F uintptr; X0 *redirect.TCPRedirect; X1 *net.TCPConn }ConsoleSeparator/json:"consoleSeparator" yaml:"consoleSeparator"@*[]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }@*func(context.Context, certmagic.CertificateResource, int) error@*struct { F uintptr; X0 *certmagic.ACMEIssuer; X1 http.Handler }@*struct { ID string "json:\"id\""; Name string "json:\"name\"" }ExternalAccountRequired(json:"externalAccountRequired,omitempty"@*struct { F uintptr; X0 *server.serverImpl; X1 quic.Connection }@*func(io.Reader, []uint8, crypto.DecrypterOpts) ([]uint8, error)@*func(*[]time.Duration, string, string, []time.Duration, string)@*func(protocol.ConnectionID, protocol.StatelessResetToken) error@*quic.outgoingStreamsMap[github.com/apernet/quic-go.sendStreamI]@*[8]quic.incomingStreamEntry[github.com/apernet/quic-go.streamI]@*struct { F uintptr; X0 *http3.Server; X1 quic.EarlyConnection }@*func(context.Context) (*govultr.Account, *http.Response, error)PGStateStatementsTrack)json:"pg_stat_statements.track,omitempty"@*func(context.Context, string) ([]string, *http.Response, error)@*func(context.Context, string, *govultr.ClusterUpgradeReq) error@*func(protoreflect.FullName) (protoreflect.ExtensionType, error)@*func(protoreflect.OneofDescriptor) protoreflect.FieldDescriptorA*struct { Code int "json:\"code\""; Type string "json:\"type\"" }A*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }A*func([]uint8, []uint8, *syscall.SockaddrInet4) (int, int, error)A*func([]uint8, []uint8, *syscall.SockaddrInet6) (int, int, error)A*func(zapcore.Entry, *zapcore.CheckedEntry) *zapcore.CheckedEntryA*[8]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }A*struct { F uintptr; X0 func(reflect.Value, reflect.Value) bool }A*func(string, string, map[string]int64, string) *map[string]int64A*func(network.PacketConn) (context.Context, network.PacketWriter)A*func(context.Context, string, *govultr.BlockStorageAttach) errorA*func(context.Context, string, *govultr.BlockStorageDetach) errorA*func(context.Context, string, *govultr.BlockStorageUpdate) errorMySQLRequirePrimaryKey*json:"mysql_require_primary_key,omitempty"AutovacuumFreezeMaxAge*json:"autovacuum_freeze_max_age,omitempty"MaxLocksPerTransaction*json:"max_locks_per_transaction,omitempty"MaxStandbyArchiveDelay*json:"max_standby_archive_delay,omitempty"TrackActivityQuerySize*json:"track_activity_query_size,omitempty"A*func(context.Context) (*govultr.Versions, *http.Response, error)A*func(string, string, string) ([]*doh.SRVRecord, []uint32, error)A*struct { F uintptr; X0 *int; X1 protoreflect.Message; X2 *bool }A*func(protocol.PacketNumber, protocol.ECN, time.Time, bool) errorA*func(sign.PublicKey, []uint8, []uint8, *sign.SignatureOpts) boolV˾q 6tFGN 4؄u@@POq 6tFGk 48 6tFG ! / /1 6tFG@. !// 6tFG:@ !//p]& 6tFG  ///q~ 6tFGo` !//@ 6tFGХ !// 6tFG. !8/8/ 6tFGwY//j 6tFG` !$$-p 6tFGKA/ !X X bG 6tFGȱ*s<&<&SLNe` HoHo}zy 6tFGNe` nn:q 6tFG'mNe` nno 6tFG]PN5 hhWJ 6tFGTD` !< < ?!Q 6tFGQu !BB7~r 6tFGB /+ 6tFG0 /ppֹ& 6tFGpR !Q 6tFGu Ro /QQ[MC 6tFGK`Ro#@ܣQܣQj9c 6tFGRo;E 6tFGuRo /QQӐ4 6tFGRo /QQP 6tFGo Ro /QQ=a 6tFGc8pRo'@ QQ 3޲Gc8p `ʱRo'@ QD%OW'l7 6tFGڑ xRo'@ #O#O>Nnl 6tFGd aRo'@ ,#O,#O3> 6tFG] ;Ro'@ QQ 6tFGr8`;Ro'@ QQm 6tFGgRos8 R8 R% 6tFGERo !OOh 6tFG RoQ!<R<Rp 6tFGaRosw"r 6tFG~)w"rMM$$2 6tFG*wqkk 6tFG@`V Uc 6tFGh; !ĉĉh 6tFG;+y.. >$]G; J+y.X$ 6tFG0Mk+y; & &*$} 6tFG;Ƽ+y; 3 6tFGM /H 6tFGM @~~}:d 6tFGftqtq6 6tFGZ `' ttc 6tFGey `' 44Iu 6tFGy` `' 6\t 6tFG1~t  /TݚTݚ8^ 6tFGT`#~t  !S? 6tFGOj#~t  ! 1d 6tFGd $~t  !00$' 6tFG <~t  !hϛhϛb 6tFGl@@~t  !\Л\Л5 6tFGVN ! _ _1 6tFG$ !__Z 6tFG2$ !__;ms 6tFG1@% !__B 6tFG_`&` L&A 6tFGg( ( S^ 6tFGk ձ # ~ 6tFGv%< !\\v 6tFGz< !Jm< 6tFG&< !0e 6tFG< Ns /||U 6tFGJ@Cs`#`#0 6tFGvgr`rJ9" 6tFGn&gX!{${$ Gn&` `ʱgX!{$`$i 6tFG) /l%l% aGG)  /l%\$I 6tFG> %%v 6tFGߴQ!gB 6tFGO ! " "d_ 6tFGT|=s  p 6tFGu  !,-,-鰧 6tFG@zXshd hd  6tFG= EXs Y 6tFGs`H /447TU 6tFG|HN@@Nb 6tFG!>H /44~' 6tFGHN5 j 6tFG^i`>HD6' 6tFG6'{H<^ D 6tFG`LH ~SJ 6tFGO@}H !EE 6tFG`}} !h h "4 6tFGy~h ! ' '``9 6tFG]  /N 6tFGN$uTT i<G[`ʱ /`21 4JvVG}[`ʱ /h2 1 U 6tFG yR),X1,X17E 6tFGٗ` /W[`3G @  || n̼ 6tFGZ9^ !TNRTNRN 6tFG=  !] 6tFG(`e: w<w< 6tFG Ҽe: ,w<,w<M-4 6tFG.*@e: Lv<Lv<y, 6tFG~be: T<T<{d 6tFGRce: u<u<>v 6tFGVe: <<iC\ 6tFG1R e: u<u<#" 6tFGQe: ,{<,{<Z 6tFGce: x< x<a 6 6tFG~ce: y< y<Fn 6tFGe: p{<p{<˫ 6tFGpRe: {<{<6ڃ 6tFGB*ee: <<b 6tFGV*ee: < <y 6tFG?`e: Pz<Pz<Xs 6tFGe: |y<|y<5T 6tFGe: <<&D 6tFGM ,<,<gh 6tFGҼe: ؃<؃<  6tFGd5 <<0H 6tFG\goJܸqܸq{jo 6tFGoJqqQ 6tFGd`oJqqm 6tFG@oJqq<[ 6tFG|W|N> wwx 4 6tFG|`W|N> ܇w܇wg 6tFGm N  ! 6tFGBN  /s/ 6tFG`N (ΆΆ[Bd 6tFG+N (DʆDʆ I 6tFGN (ɆɆ" 6tFG.nN (ȆȆ9 6tFG<@N  !Z 6tFG @  ~/pz 6tFG   ~>i 6tFGx]X`?j?j3 6tFGýx]No(h(h:"} 6tFGPmx]5(h(h5. 6tFG@x] !pokpok# & 6tFGMx] ! pk pk.M 6tFG}`x] !tftfP:# 6tFG}`x]@f@f 6tFG@k`ȧmȧm 6tFG v !nn7gn 6tFG@smmu3G^ ͱu. 6tFGAŵ / n nA# 6tFGs`ŵ<nn@j7 6tFG.ŵ<*n*nc@] 6tFGX Ƶ<nn/G 6tFG [!Y 6tFGx<$n$n+ 6tFG/xҜnnxG 6tFG  8|o|o`e 6tFGy`~@xQ& 6tFGg !==P 6tFG&@s(`$(`$ 6tFGz@sR$R$p 6tFG`\sT>T>H%v 6tFG 'qs F FR 6tFG-ۼq@;hEhEd0 6tFGw qbEE. 6tFG1qsDEDEC3 6tFGD'qQ!FF  6tFGF !<9E<9E? 6tFGF !(E(E.M 6tFG~@FsEEW`L0 6tFG'3p !GG¾ 6tFG`3p !GGãD 6tFGXP' HHpϚ 6tFG@(' lHlHP?f$ 6tFG/' HH7 6tFG` ' `H`Hh, 6tFGKa 6tFGU`'YZ 6tFGo !\ى\ىNKs 6tFGY( !؉؉qF 6tFGZ /׉׉L 6tFG~r`$ĉ$ĉ 6tFG  /aa41( 6tFG /HH, 6tFG` m,5 6tFG̵ !@Ɗ@Ɗ_$ 6tFG&bx{@? 6tFG !{m 6tFGs@ !+`C=3 6tFGB'v 6tFGl࠻zZ !>i 6tFG=! zZ!E8ʟ 6tFGzZ!ETT 6tFG>ڵ  PP| 6tFG ۵@ H 6tFG` 8U8UX^9 6tFGD@ xnxn|J7 6tFGoǗYۢۢv1 6tFGsǗ /??yK8 6tFG Ǘ /$@$@fm 6tFGs`LǗs LLT 6tFG'Ǘvdd#@ 6tFGG`Ǘ /@@m 6tFG`hǗ&@pӣpӣaZ 6tFG>vǗBBo 6tFGa`Ǘh| \A\Asm 6tFGȽǗ`)f 6tFGU^ 'pVpV/ 6tFG@BXZ!XZ!oF 6tFGB [- 6tFG;BD D  * 6tFGaB4!4!9 6tFGV4 !\/ 6tFG  Q|*4*4H% 6tFGP` QUd+4d+4 _ 6tFG`ͻ Q /*4*4je 6tFGK /} 6tFGEF) !TTfgY 6tFG`) !TT Ot 6tFG)8T8T_z 6tFG`iTiTl 6tFG`XkTXkTf 6tFG/ /' 6tFG ![[ 6tFG1 /[[/< 6tFGF  /=d 6tFGc` /T=3GF@+ - ̱@ 6tFG `[J /ssDK 6tFGJ /duduDR: 6tFG:7 J / Bs Bs܈ 6tFGsa J /uuuu{gt 6tFG `JZ>s>sY| 6tFG`J /wuwu1]< 6tFGgJ /xuxu<Î 6tFGN7\JZ=s=sI䵋 6tFG J /luluU] 6tFG' J /PmuPmu 6tFGi`J /ouou܀ 6tFGJ /nunu}h 6tFG'J /pupuL͝ 6tFG J / ru ruRC 6tFG`J /TsuTsu 6tFG/J /tutuJ3 6tFGFJ /juju6 6tFG,i*J !yuyuD5y 6tFGnG@KJ) 6tFGy J / fu fu ÷ 6tFG`J /dhudhuˁz 6tFGO J /! 6tFG@׷Jc!`GuGu+ 6tFG]׷Jc!`xIuxIuW 6tFGд.z !vv 1ȀG .z !vvW 6tFG7 z bJzz+ 6tFGҴ z bJzz DG `ʱ z bJzOz_9 6tFG S] Kh7`h7`i 6tFG֏E /Te_Te_L 6tFGc Epo`_ i_i_DK [ 6tFGoI` E /Ta_Ta_ 6tFG E / c_ c_|5 6tFGV9 E@ &xb_xb_ ] 6tFGN|bf`''b'b;+P 6tFG9a d/ 6tFG ` a  /QcQcZh)a 6tFGl@s LdLdh 6tFG  /dd!L 6tFGϻu-ȞdȞdh  6tFGbJ$y$yD8 6tFG Yafdy}dy}6' 6tFG@` n @@ : uG@ ˱ n @~ H 6tFG'dbJEo 6tFG.> Zdd, VO 6tFG d `̅̅"m 6tFGU  /==(T 6tFG'` C̖T 6tFG'۹D->7 6tFG'@76 6tFG-Z0o Kl_bl_bem- 6tFGcVW\`# 6tFGAW2 ,.?GA W2dS& 6tFG@8tcq# 6tFGHC /,,M= 6tFGW XH Cƞƞ0? 6tFGW XH C))/ 6tFGy -.!+&+&B*func(*big.Int, *big.Int, *big.Int, *big.Int) (*big.Int, *big.Int)yD3G  ̱ ̱ ̱ ̱ N3G  ̱H ̱ ̱ ̱H3G  ̱ I ̱ ̱ ̱B*func(netip.addrDetail) (weak.Pointer[net/netip.addrDetail], bool)?# 6tFGf@.,X1``,&`,&B*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *poll.FD }B*struct { F uintptr; X0 *net.TCPConn; X1 net.Conn; X2 chan error }B*struct { F uintptr; X0 net.Conn; X1 *net.TCPConn; X2 chan error }B*func(zapcore.Entry, zapcore.CheckWriteHook) *zapcore.CheckedEntryB*func(http.http2FrameType, http.http2Flags, uint32, []uint8) errorB*go.shape.struct { net/http.key string; net/http.values []string }B*struct { F uintptr; X0 *sync.Once; X1 chan struct {}; X2 func() }3 6tFG-`N (` ll- 6tFG` %qFrww 5E> FNsww@r  ]Fv#tw`w: F} `' F%; ;r`"Fh==7F&==MaF&=@=<_6F^@==`<EFo==X< JfF*X`XQ!:F6@XXskysFhX Xe`ghFaXX7†F-@XXJFBX@X!P|F;XX1 ҡJFhXXk`9aFhX`XsFiXX e45G@ɱ aF Ax83Ga $  3G $@T@T  F49^@!9^H97 uFG9^!9^78 KFl"e: M.F%L`"LN> ?F=L"L7i@x]#x]@F 1RF,x]@$x]y@G d}F6@x]$x]DG SXFߝx]%x] l.8zFV@x]`%x]+ZF΃%!FA@ y & yD*@=FD~ y& yNKFt y& y @F5A y@' yb*F/'' D2&FEG@'۫('  /F`(n{A[)FzZ(zZ{ ^<FZzZ )zZ!EF@)  5F)@ ~F@*` G @FF3@*@ IJe5G8ɱ aF ɌpFv`+Q!//5G{@#ɱɱUF g?C$F# ,qFNx&ת,6Q F@'ת,F) 'ת@-3SFF@(ת-3@'JF8G@/T.T.{ۍFg/T`.T. k,Fa/T.T^m7F71J /JZ%C F܍@4I/IԸF4H/H /qAF(j7 z@0 z [` &F@@]ӳ0] KDLFjPx1x@*?juFRPx`1x%*]F’R+1+prؗFS~ 2~J!f 6F~V(-2(-S%@g nRfFW(-2(-6s1F7W @3 7b3GKX $={ͱѠF3G@X $@@ ̱{@B 73G͈X ${ ̱{W;FO,Y 4 f FZY 5Y-{pF~@ZY5YWSL[QFO^%5%0<`fF4b]&@6]&h\BFE@b]&6]&s@$F@dx7xO`=v5Gme F 5GeT`\Gl ADj5GHV@e 7Fl UdF>=f s8 sN'`"ɧHqFR=f s8 sN'j:[5G>  ˱ `\G dF'@pd9d^n@a,PFpd:dTR@1`FZ?pd`:dd,@@`F qd:dRF@qd ;d.@dF˱qd;dôTF$r0o;0o KFSt@<@ LSGE-<; ɱU ɱ b(0 <e ̱wɱ96JP= ̱uu= ̱yL} > ̱O~Op p> ̱`ٻ`v?u> ̱ި0? ̱`~? ̱ه ? ̱LA>mP@ ̱@$/;E@ ̱0 tEA ̱U zpA ̱Ż ߈#kA ̱ɱT'a 0BU t  ԩBgu ?B ̱fPC ̱,z/C ̱/cD ̱[pD ̱uD ̱ "0E ̱`W׌XE ̱@F*func(func(netip.addrDetail, weak.Pointer[net/netip.addrDetail]) bool)7FH d@Fd ! XGF ̱ ̱$: |FGD`8KF#@/ ˱8 4GKPG ̱`ʜS)G ̱ y~H ̱1(=MGpH ̱ͱ hH ̱` }xFG{ƫ0ICɱ6ͱϿc I ̱మ8I ̱]7fPJ ̱5ژ J ̱@ư]Vwޅ K ̱Ű |? pK ̱@ 1K ̱60L ̱=(L ̱ػq0 L ̱r $*$PM ̱ @q M ̱rAGN ̱`˱ &IU+GpN ̱D QkN ̱5H% 0O ̱y2 O ̱n cr O ̱x{r]PP ̱v8~{P ̱@wrMQ ̱7 hpQ ̱7><Q ̱ ܁ U50R  ̱5{`!ՠR ̱`R ̱ PS ̱ .-pGS ̱#_\ZT ̱??OZpT ̱lJT ̱ F 0Uk`J! "U ̱@yjU ̱r@ғp PV ̱|> V ̱65E[W ̱ +FjpW ̱ Ow3~W ̱߽ z"i0X ̱p X ̱f\or X ̱@t PY ̱`?I8d Y ̱sh Z ̱اf!8pZ ̱^}`9k Z ̱~u?0[ ̱+d[ ̱ F9][ ̱)er P\ ̱R\ ̱`HQdn's ] ̱`??vĢp] ̱^r5] ̱dbY~0^ ̱@ ^ ̱ %JH^ ̱@F$ P_ ̱}E _ ̱#F*func(context.Context, *tls.ClientHelloInfo) (*tls.Certificate, error) s P` ̱`pX` ̱`uy| a ̱046t pa ̱ \|nMia ̱= j0bͱìɱ >G- b ɱêɱ ˭o be ̱Ыɱ @66hGH*Pc^Ŭɱx{ ̱Pxuңc ̱Ud ̱@]iDGՋ pd ̱`H d ̱@@#FN@eN ( ( -%R e ̱`E~r e ̱߯F*struct { Streams []trafficlogger.dumpStreamEntry "json:\"streams\"" }8DJf ̱zjf ̱̼\*mPg ̱ 8` \g ̱uJSHh ̱Iph ̱ % h ̱#<& 0i ̱+qF i ̱li ̱࡮ Pj ̱ |Au2 j ̱(F*func(string, func() (interface {}, error)) <-chan singleflight.Result;$QPk ̱HYLnk ̱;F*func(netip.AddrPort, int64, func() *udpnat.conn) (*udpnat.conn, bool)/^Pl ̱ʘ5l ̱l<G(\mZɱ˱F*[]quic.incomingStreamEntry[github.com/apernet/quic-go.receiveStreamI]:m ̱`B/ln ̱j 7Ā)_pn ̱O ~W!n ̱j  "0o ̱U_o ̱@c8"o ̱ lPp ̱@cUdd"p ̱`⸡aʁ q ̱`Cypq ̱wI\q ̱ N0r ̱%T  5r ̱M=7Nr ̱`jPs ̱PU85s ̱`~]Ct ̱hbĂ pt ̱`Ŷ{ϺPL t ̱`î@4=m 0u`xgK0 |F|HuQqQ g . u˱+ҭAutovacuumVacuumThreshold,json:"autovacuum_vacuum_threshold,omitempty"F*func(context.Context, string, string, *govultr.DomainRecordReq) error+c |FGvp ̱q ̱3|a0w ̱+ m Gec^wɱ%ɱ w ̱y Px ̱࠿G>k תxF̩ =,` ȮG(תypD,ͱ ΌLSתpy1B F*struct { F uintptr; X0 *[]uint8; X1 *error; X2 proto.MarshalOptions }7 $GGя zY F"`ʱ ڸG pzY 7s$ tFG[ zY  ̱r < 0{Y `Oc {;[ { ̱cF*func(congestion.PacketNumber, congestion.ByteCount) bbr.sendTimeState T0| ̱ 0_ | ̱ "vF3G ` Tͱo z P} ̱LPf } ̱@rt ~ ̱@@u|Up~ ̱c fI3~ ̱@TK70 ̱@X_{  ̱XMFL l  m &FlP&`#DDM&s ̱ ̱N)e tp ̱`tzE#Ё ̱]r q 0 ̱o aXd ̱   ̱ :rW P ̱R#lHC  ̱@:w  ̱!G*struct { F uintptr; X0 client.Client; X1 chan error; X2 net.Listener }G*struct { F uintptr; X0 string; X1 chan error; X2 *masq.MasqTCPServer }G*[]atomic.Pointer[go.shape.struct { internal/concurrent.isEntry bool }]G*[]*concurrent.entry[go.shape.*internal/abi.Type,go.shape.interface {}]G*concurrent.indirect[go.shape.*internal/abi.Type,go.shape.interface {}]G*map.bucket[string]func(zapcore.EncoderConfig) (zapcore.Encoder, error)G*struct { F uintptr; X0 func(zapcore.Entry, zapcore.SamplingDecision) }G*struct { F uintptr; X0 *client.udpSessionManager; X1 *client.udpConn }G*struct { F uintptr; X0 *sync.Mutex; X1 *bool; X2 http.ResponseWriter }G*struct { Code int "json:\"code\""; Message string "json:\"message\"" }G*func(trafficlogger.dumpStreamEntry, trafficlogger.dumpStreamEntry) intG*func(string, func() (interface {}, error)) (interface {}, error, bool)G*func(encoding.TextUnmarshaler, string, encoding.TextMarshaler, string)G*go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }G*[8]quic.incomingStreamEntry[github.com/apernet/quic-go.receiveStreamI]G*func(context.Context, string) (*govultr.Backup, *http.Response, error)G*func(context.Context, string) (*govultr.VNCUrl, *http.Response, error)AutovacuumVacuumCostDelay-json:"autovacuum_vacuum_cost_delay,omitempty"AutovacuumVacuumCostLimit-json:"autovacuum_vacuum_cost_limit,omitempty"G*func(context.Context, string) (*govultr.Domain, *http.Response, error)G*func(context.Context, string) (*govultr.S3Keys, *http.Response, error)G*func(context.Context, string) (*govultr.SSHKey, *http.Response, error)G*func(net.Addr, net.Addr, protocol.ConnectionID, protocol.ConnectionID)G*func(kem.PublicKey, kem.PrivateKey, []uint8) ([]uint8, []uint8, error)H*[0]*concurrent.entry[go.shape.*internal/abi.Type,go.shape.interface {}]H*func(runtime.goroutineProfileState, runtime.goroutineProfileState) boolH*struct { F uintptr; X0 httputil.switchProtocolCopier; X1 chan<- error }H*func(context.Context, string, []libdns.Record) ([]libdns.Record, error)H*func(context.Context, acme.Account, string) (acme.Authorization, error)H*func(context.Context, acme.Account, string) ([]acme.Certificate, error)H*struct { F uintptr; X0 *server.udpSessionManager; X1 <-chan struct {} }H*struct { F uintptr; X0 io.ReadWriter; X1 io.ReadWriter; X2 chan error }DomainAprotobuf:"bytes,2,rep,name=domain,proto3" json:"domain,omitempty"H*struct { Algorithm pkix.AlgorithmIdentifier; PublicKey asn1.BitString }H*func(context.Context, string) (*govultr.Invoice, *http.Response, error)AutovacuumAnalyzeThreshold-json:"autovacuum_analyze_threshold,omitempty"H*func(context.Context, string) (*govultr.Cluster, *http.Response, error)H*func(context.Context, string) (*govultr.Network, *http.Response, error)H*func(*wire.AckFrame, protocol.EncryptionLevel, time.Time) (bool, error)H*func([]uint8, []uint8, protocol.PacketNumber, []uint8) ([]uint8, error)H*struct { F uintptr; X0 *int; X1 *error; X2 *socket.Option; X3 []uint8 }I*struct { F uintptr; X0 client.Client; X1 chan error; X2 net.PacketConn }I*struct { F uintptr; X0 func(context.Context, bool); X1 context.Context }I*[16]atomic.Pointer[go.shape.struct { internal/concurrent.isEntry bool }]I*map[uint16]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }I*func(context.Context, context.CancelFunc) (certmagic.Certificate, error)I*[]struct { Code int "json:\"code\""; Message string "json:\"message\"" }I*func(context.Context, acme.Account, crypto.Signer) (acme.Account, error)I*[]go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }PrefixBprotobuf:"varint,2,opt,name=prefix,proto3" json:"prefix,omitempty"I*func(quic.newConnID) *list.Element[github.com/apernet/quic-go.newConnID]I*func(*list.Element[github.com/apernet/quic-go.newConnID]) quic.newConnIDI*struct { F uintptr; X0 func(quic.packetHandler); X1 quic.packetHandler }I*struct { F uintptr; X0 *http3.connection; X1 uint64; X2 *http.Response }I*struct { F uintptr; X0 func(quic.ReceiveStream); X1 quic.ReceiveStream }I*func(context.Context, *dns.Msg, string) (*dns.Msg, time.Duration, error)I*func(context.Context, string) (*govultr.Upgrades, *http.Response, error)I*func(context.Context, string) (*govultr.UserData, *http.Response, error)I*func(context.Context, string) ([]govultr.VPCInfo, *http.Response, error)I*func(context.Context, string) (*govultr.Database, *http.Response, error)I*func(context.Context, string) (*govultr.Instance, *http.Response, error)I*func(context.Context, string) (*govultr.Snapshot, *http.Response, error)|FGT`~@3FG@mɱdEFGfk 1ɱFGG1ɱwFG$@mɱgtFG.@޻ ̱;}tFG ޻ ̱0q^FGEɱk9Gs `H y$Gք"C~qFGKA: / /5ɱFY@)**u29tFGmCCkiV9tFGR+@C@C8e9tFG CC{a|FG`< CC5ɱR59tFG ^C`Cz9tFG; CC`FGAC C5ɱʂ!9tFG#`CCkXx9tFGCCPJ@D^QFGJ@-@C7ɱb@`ҵn > FVi 5U@T,Fti 5U@Tk\tFG aRo\o`˱o RoଵRoA k G>@dRo@Ro`7ݹ9tFGt8`6RoRo䶹>FGE s RoRoɱnrp3Gu Ro^n؄uNN,ב|FGJv Ro'˱ $GGj Ro>eͱ^F y RoRoXp{FG!Ro௵Roɱ$vFGK@ @Ro|ɱ @ G RoRo3GnRo(o༽@93FG`~ Ro`RoCɱ7F}RoRo^WtFGo`: wɱfFGM;IkɱFGZ ವɱgrFGey @mɱ[9Gy (& Fy ~t ? SF%<1`~t ?JF@<3~t 6U`o [F'l ~t  ?@G@  8 Fz ൵<U@T%R}S|N`<@Ur6tFGMz"= ̱=F@-jF2Gh`V` ,PMG XXV`Ϯ ,GBX XdNʮ@@oS\".ivXX ͼ@@:`">iDXีX2@ ( `V$~i@H@HV`w0(p[9"gOHƾO80Z "HmW`$$"@x`HvW`$$;gb"'yHCyP0GsI h  <.GIhi}(F>`cԩ໵c 0h69tFG/?@ ?@?@=@ptFG^j??ẕ 7G..?`$GG} 1`1;\Gj@}}TK$GG{ ͱtFGAA* ݱ<_HfFN~ྵA ]R GtQ @ p8*J9tFG)  07d\F @m6( o` oY%9tFG N ) /G.n@ N ԿPQ|FG   ˱3v<$GG `  *ͱb_F[ h@µh EҋTFnµh ; {Gnx]õx]{>T|FG} `õx]fĩ˱PF x]õx])L9tFGpsx] ĵx]ĩ`aB9tFGWtx]ĵx]ĩ`xCtFGX@ĵ ̱]FGA @ŵCɱ-40;|FGs@ ŵ8˱CG|FG. ƵpoM˝|FGX `Ƶ8˱2&|FGCX` 蜩Ƶ s */Gݧ ǵݧu@֓tFGsF ^uǵ^u[`ȻAG[OǵO5@:'8 FG@@ȵV/7ɱFFa~ȵV/KfF# ɵ8 LL;$$G@`ɵ= ؆ݣ@ɵFƩ5Q Gy ʵ& n? L!zʵ z L!ʵA` ( L!z@˵ ,$lE,$ ˵ KL L!Vz@̵A`( { d z`̵84T lz`G̵a+`R%[FG` ͵ɱHFG͵P{ɱ L@~G@͵` fB5GF0@ε dGε`'W.`GG&Hϵʱ m?:G5H`ϵ -ԒGZ0ϵ3 7Gn0 е]ltFGGе !ɱ WdG0 BеBo]FG&ZB@ѵBoɱ)]9G61ѵa@U K!FGC@ҵ[êɱKFG`ҵ.`ɱ݀9tFG6ҵa@3{ G0  ӵݫ`@46#F $@ӵ1 VFG#Pӵ~Ĭɱ8FG@Եêɱ ޕFG7[@Եêɱ+2dHG6CյM`ͱ-RFG`յɱQFG յɱFG@ ֵ'"ɱ`wFGlCֵ~Ĭɱ T@Gv2@ֵc2FG@׵ɱFGc@׵.`ɱYFGH\صɱ G:`صc$1}FGCص"1ɱrRFG$d ٵxɱFG@ٵBQɱ 4,G_Dٵh]9tFG@ڵ"1@/ meGӝڵ29tFG>` ۵8+K=9tFG `۵8+h9tFG@ ۵8+\9tFG ` ܵ8+&!q9tFGܵ8+kO9tFGsܵ8+l D9tFGa`J@ݵ8+l609tFGݵ8+J:9tFGԴ@,޵8++j9tFG`޵8+Wz9tFG@޵8+8p9tFGϬ@يm9tFGTf sS9tFGE `b%9tFG %$9tFG  ^Ϭ@حsCR9tFG Ԫ֭/9tFG ~uwq9tFG @ N9tFG/ 9tFG! WY9tFG/]@ `R "GŅa% 9tFG@ 99tFGfs9tFG *bǗn &Z@Gj` +zDEFGV4 @aɱ vG { uF` 0D HĖGo' `p89 $6G p8'~SFŦ(ת  6G7` TT/ DG'`JA G6@JAstFG  J]%`˱EW#)y` J M)U! `J O)b7 J e)@ J „Fcc  MjG=O.z.z C8024%]ӳ@] bj>btFG(% Ea ̱O09"P0G@ ]q]q C|FG_F`H8N.G,J`b!@QK@|FG9 bJ:|FG bJE|FG0` bn˱ vCGRd @b!H .G b @wQj/.Ga* b @wKB-|FG` a`a 6]dF= |a  ٽttA0%!@mz mz Z:+ m/GKűu 1/GKű>}@tFG `@ `˱t,tFG4ϩ[oF$ xxYSOFs U`U$/FGJfZ#OɱinEFϭ. .c' gJUtFG@. .o ̱ a ,/G6  u@_9F\@  vd/G`~  yٳ/G 0~5G` @H+ֳ/G KF:<@_^ ^ G c c'R bGg  \ iVeGg@ ]&ѩ 0GNa]& ]&.R$GG { K2${hFGC~ K !4E \ ~E LUF]@BK3K ! ~FdBN`3N N@x7@ ,ttFG҈ N1 ~\ /šF,TL 4 H !vfFHTM 4 H !vvFM'4' H@v !ttFO@N\@5\ H@v !u%FgN\5\ H@v !bĭ F2Q ʰ6  ~`` C\FQ ̰`6    FtFr@R6 Q!Fa@V 7 @K43FW7 P%dcFyW7N77N '`0 -}FYҵ@8ҵ  U) $GG ҵ ! D> /D`>F\ҵ9ҵ BR@`'F2u]ҵ`9ҵ D*@N[F9bRo9Ro 5 v ~_P%  tFG Ro /QxI5FbRo:Ro /ַo% |FG Ro# ~Ƹ ~yoxFG] r @;Ro'@ Q&O xFGr8`r ;Ro'@ Q )O-xFGV`u <Ro؄u RO%JFg9hRo`<Ro 8 p?xFGWz <Ro ! QX|IUgF3kRo =Ro I`W6xFroRo=Ro R_r )F&y@p= `U`Gc]Fqw@>w C(` BlF4Yvw>w $; $ 3; $ XxF@|? (` -`! }Fg|`? !LRFg~? !K&W8F~~t @~t (" - # CxFGl @~t  !\ЛU Fg@;@; ;@`) JFX;@A; U) ;@=F1 A  i ~@1 ~&c=F<<B< 7`f)Q|C|FG% <7`,f|@FGN <7`` fh_3%$GG <7`4 fؕ HcxFGJ Cs`#b#TZFC `@`Jl$GG -""+""<&Fb=D= %_?\FhXEX !sxFG= `EXs lp IFhXEX sQ!Ի.FX FX !Q!W'FhXFX s FĖ@XFX k`N AFՖX@GX e:nN`KN A=F@x]Kx] }"U"$F"}x] Lx]  %*>F>ox]Lx] ` ` FKaVa `'}pp7FlLűW DG DG %~FOO޻`W޻ 0<`|tFGN} k$ee /ejVxFGCX X%0<`%%guhF"^@Y 1 ~UFw@c^ӬY^ f`*'FMlYZY  > jxFG.> `Zdd, SxFG-` Z0o Kl_b.b0OFsW [W * 4kF@tW[W ݆@qTFtW[W ` :QFV@wP@\P fO`N*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *net.netFD; X4 int64 }N*[16]atomic.Pointer[internal/concurrent.node[*internal/abi.Type,interface {}]]N*[]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)N*struct { F uintptr; X0 *int; X1 *go.shape.[]go.shape.string; X2 *[4]uintptr }4{F,d]d (" - # N*cache.Option[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]N*struct { F uintptr; X0 *int; X1 string; X2 bool; X3 control.InterfaceFinder }N*func(context.Context, string) (*govultr.DatabaseUsage, *http.Response, error)N*func(context.Context, string) (*govultr.FirewallGroup, *http.Response, error)N*func(context.Context, string) (*govultr.ObjectStorage, *http.Response, error)N*func(context.Context, string) (*govultr.StartupScript, *http.Response, error)N*func(*wire.ExtendedHeader, protocol.ByteCount, protocol.ECN, []logging.Frame)N*func(*logging.ShortHeader, protocol.ByteCount, protocol.ECN, []logging.Frame)N*func(net.Addr, protocol.ConnectionID, protocol.ConnectionID) ([]uint8, error)N*struct { F uintptr; X0 *int; X1 *unix.Sockaddr; X2 *error; X3 *[65536]uint8 }N*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 reflect.Type }18vFa0b \  m _m O*struct { Type asn1.ObjectIdentifier; Value [][]pkix.Extension "asn1:\"set\"" }O*[8]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)O*struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }O*struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2startPushRequest }O*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest }O*func(acl.HostInfo, acl.Protocol, uint16) (outbounds.PluggableOutbound, net.IP)O*ringbuffer.RingBuffer[*github.com/apernet/quic-go/internal/wire.DatagramFrame]O*func(context.Context, string, ...oauth2.AuthCodeOption) (*oauth2.Token, error)O*func(context.Context) (*govultr.ContainerRegistryPlans, *http.Response, error)O*func(context.Context, string) (*govultr.BackupSchedule, *http.Response, error)O*func(context.Context, *govultr.UserReq) (*govultr.User, *http.Response, error)O*func(context.Context, *govultr.VPC2Req) (*govultr.VPC2, *http.Response, error)O*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }O*func(protocol.PacketNumber, protocol.ByteCount, protocol.ByteCount, time.Time)P*struct { F uintptr; X0 func(string, func() error); X1 string; X2 func() error }P*func(context.Context, string, *net.TCPAddr, *net.TCPAddr) (*net.TCPConn, error)P*struct { F uintptr; X0 client.HyUDPConn; X1 chan error; X2 network.PacketConn }P*struct { F uintptr; X0 network.PacketConn; X1 chan error; X2 client.HyUDPConn }P*map.bucket[uint16]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }P*struct { F uintptr; X0 chan struct {}; X1 http.RoundTripper; X2 *http.Request }P*struct { F uintptr; X0 <-chan bool; X1 context.CancelFunc; X2 context.Context }P*struct { F uintptr; X0 *server.udpSessionManager; X1 **server.udpSessionEntry }P*cache.LruCache[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*[]*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*[]cache.Option[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*func(protocol.ByteCount, protocol.Version) (ackhandler.StreamFrame, bool, bool)P*func(tree.NodeIterator[github.com/apernet/quic-go/internal/utils.ByteInterval])P*func(bool, protocol.ByteCount, protocol.Version) (*quic.coalescedPacket, error)P*func(context.Context, string) (*govultr.BareMetalServer, *http.Response, error)P*func(context.Context, string) (*govultr.DatabaseBackups, *http.Response, error)P*struct { items_data []yaml.yaml_node_item_t; style yaml.yaml_sequence_style_t }P*func(protocol.EncryptionLevel, protocol.PacketNumber, logging.PacketLossReason)P*func([]uint8, protoreflect.Value, uint64, impl.marshalOptions) ([]uint8, error)P*struct { F uintptr; X0 impl.Converter; X1 impl.offset; X2 reflect.StructField }P*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.Converter }P*struct { F uintptr; X0 reflect.Type; X1 map[reflect.Type]*impl.coderFieldInfo }P*struct { F uintptr; X0 reflect.Type; X1 reflect.Type; X2 *impl.coderFieldInfo }Q*struct { F uintptr; X0 *struct { sync.Once; v *x509.Certificate }; X1 *[]uint8 }Q*[]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }Q*func(context.Context, *certmagic.ACMEIssuer, acme.Account) (acme.Account, error)Q*func(context.Context, acme.Account, acme.Identifier) (acme.Authorization, error)Q*func(context.Context, acme.Account, *x509.Certificate, crypto.Signer, int) error AttributeGprotobuf:"bytes,3,rep,name=attribute,proto3" json:"attribute,omitempty"Q*func(protocol.EncryptionLevel) (protocol.PacketNumber, protocol.PacketNumberLen)Q*func(http3.StreamType, quic.ConnectionTracingID, quic.ReceiveStream, error) boolQ*func(context.Context, string, string) (*govultr.NodePool, *http.Response, error)Q*func(net.Addr, logging.PacketType, protocol.ByteCount, logging.PacketDropReason)Q*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.structInfo }Q*struct { F uintptr; X0 func(impl.pointer) (impl.pointer, *impl.coderFieldInfo) }!I 6tFGAF !.r} 6tFG H@v !ԾԾ(@ 6tFGj`H@v !w 6tFGkH@v !b/ - 6tFGWHȩȩ !v$ 6tFGW H !v\\E9 6tFG }(P(P# 6tFG@3 !|/|/.//hi 6tFGY=* !ZZ.ZZC 6tFG=* ![[.  [ [B 6tFGkuCp,p, /,, Gk u `ʱCp,0}) /,x~)fR 6tFG3C\t*t***3 6tFG+:CIw,w, /x,x,Cc 6tFG.`:C !,$,,$,$,$,CBy 6tFG] ɱCa`'`'\l- 6tFG+ 0CI$@,$@, /@,@,$ 6tFG~ZpC8"$")$")Z$)$)w 6tFGZ`4Ctf@~(~([ 6tFG,f !ll.mmq[C 6tFGhn1K !@B @B  ~B B  1 tFG[`5Khhh 6tFGK ! ~ԩԩr 6tFGnK ! 6tFG6@ҵBR@BB`dBdB" 6tFGUuҵBR@BB`XBXBV 6tFGE`ҵBR@BB`BB:k* 6tFG6ҵBR@BB`BB_ 6tFGXҵ !e?e?.e?e?42^ 6tFGtҵBR@CC`CCUC 6tFGҵBR@\B\B`BBLb 6tFGu5 !77.77 ` 6tFG߽ j5O@c9c9 0885Dz 6tFG9Ro /QQ(w 6tFGHRo /@Q@Q'\Q\Q?0 6tFG!Ro /LHLH'HHL% 6tFG:Ro# ~Ƹ ~WҮ 6tFGRo!xPxPsPPE@' 6tFGRoIMOMO /,MO,MOb_ 6tFG. @bRosvMMĴ 6tFGV zRo!`7N`7Ns4N4Nt 6tFGw`~Ro!pMpMsTMTMaϥ 6tFGL9Roa 6tFGO>Ro!QQs\Q\Q f D 6tFG@4Ro!QQsQQx@ 6tFGǤ {Ro!XLXLsLL= 6tFG4Ro QQ QQ4b 6tFGޤ Ro!\H\HsTHTHN 6tFGKRo !LQMLQMhQMhQMBne 6tFG)HRo/RRַRRO 6tFG!H@5Ro/PQPQַQQ&{w0 6tFGW5Ro/QQַRo/ Q QַQQdoX 6tFGxw@?Ro/4Q4QַQQР 6tFGRo/XQXQַQQ NB5)G HRo/XQLַQ,L΄ 6tFGRoM R R؄u0 R0 R/ 6tFGL6Roe`QQQ!PQPQ 6tFG :@7Ro !pRpR.RRdͿ 6tFGX7Ro !RR.RRFh 6tFG |Ro!PPsTPTPVl 6tFG?Ro !HQHQ ~QQ%- 6tFGe@Ro!TQTQsQQ 5 6tFG`@Roi ~DQDQ@1 ~QQa 6tFGaIRo @ 6tFG?e:p: ~l l 8 6tFGI:k 6tFG@8w !LL.4M4MN< 6tFGw ;(; ~""K 6tFGtvtvQ;(t(tg~ 6tFGJ+y !D)D)**x| 6tFG~;+y !&&''nt 6tFGLj+y ɈɈ@LjLj.n 6tFGM*+y--Mt 6tFGZ.!((||pe 6tFG! (` yy-`! HzHz 6tFG:o `' g 6tFGN`.%`,N`T$T$.5 6tFGy~t (" TT- # U U&p 6tFGl@9~t  !ЛЛ.ћћ2 ژ 6tFG`~t (" dd- #  6tFG'lവ~t (` ޚޚ-`! LL9 6tFGi4Y7`s ns 6tFG  /xx@# 6tFG{9 !T_T_.(_(_  6tFGkN@: !<_<_.,_,_B 6tFG6#!xTxTQ!QQK 6tFG< i ~HJ HJ @1 ~J J & 6tFG? i ~  @1 ~  } 6tFGμu `/ `/ ;/ / =t 6tFG%<7`ԗԗfܘܘ ݘ$G% `ʱ<7`ԗD fܘ4  6tFGN:<7`fB 6tFG'K<7`fllg 6tFG% B<7`,,fWq 6tFG &`<7`f qG & A<7`f< 6tFG  <7`f@@ u$G  A<7`lf@ct 6tFGNB<7```fhh[ 6tFG@<7`f _]G ̱<7`$f<#J` 6tFGB<7`44fؕؕy>B 6tFGNK<ؑؑڼ`ؒؒ0 6tFG?<X!  / i G?` ̱<X! 0 / 6tFG֕@wr`$$]K 6tFGhwX!H$H$$$d0He 6tFGD -""+"" 6tFGT = 2 ~P P + 6tFGXQ!Pw Pw 7tx tx  6tFG=:X! s܍ ܍ u< 6tFG&`GH @xЮЮx< $K( 6tFG9Ghe / 6tFGY Hhe /o 6tFGlHhe / 6tFGj`ci ~`l `l @1 ~pl pl  6tFG/??DM@ ~1 6tFGWTT, 6tFG]  ~?+ [br 6tFG}@  _H 6tFGj`1i ~T| T| @1 ~d| d| z 6tFG} 1w w .!w w g[ 6tFGPLA !d5d5.d5d5? 6tFG + !00.00AʽE 6tFG9H# /A; 6tFGL# /)( 6tFGtQ  !H<H<A <<I 6tFG=9^H9|JR|JR'XHRXHRnj 6tFG=@9^78LRLRp 6tFGA`Cu H97 kRkR78 kRkR< 6tFGC۴H97 aTaT78 bTbT{) 6tFG DMH97 UU78 UU]rU 6tFGD|H97 XX78 XXi 6tFGDH97 [[78 ĸ[ĸ[TH 6tFG`&w``U0`U0 / V0 V0ʜ 6tFG; i\i\j4o 6tFGњP!Q!((u 6tFG'dvT~<T~< $<$<c 6tFGmdv4<4< << 6tFGvt}<t}< D~<D~<Y0 6tFGToNqq&`AB 6tFG,BUoNqqJqq} 6tFG o d~ud~uUuuj 6tFG"iN (`ц`цXZ@ΆΆcK)S 6tFGBSN (<ކ<ކچچ\ 6tFG[µh  kkkk0i 6tFGt@Yx]_!sfsfrfrfg& 6tFGx]5@,)h,)hNo)h)hK 6tFGfnx] !ggpgpg<4 6tFG} õx] ! g ggg * 6tFG3Fx] !0Fk0Fk.FkFk'v 6tFGHx]][9i9i@;i;iv}F 6tFG_x]][<3i<3i@H6iH6i/r 6tFGõx] ! h h.hh'& 6tFG\!x]][phph@hhk; 6tFG`x]][8h8h@HhHh$54 6tFG!x]][hh@hhS4 6tFG x]_!HmkHmkTokTok+( 6tFGv!$/n$/ns,n,n@ 6tFGqM /]o]oh4h^oh^o?% 6tFGzJ! ~====z 6tFGdFnq@>>@>>^ 6tFGsF@ǵ^uF)>)>~qd&>d&>!q 6tFGM ^u*.>.> ->->}' 6tFG P^uq@ @>@> `=>=>R 6tFG_{O&``qm 6tFGD|qQ!EE"bz 6tFG`dV/Y\tFtFYKU 6tFG'P !iGiGsZV 6tFGݟO !jGjGTe 6tFG#ȵ8!GGQ!GGUEf 6tFGX@<' !.PP\ 6tFG'Q !mm" 6tFG @ZJ*,Cs,CsU@Cs@Cs iΟ 6tFG>y J*\Cs\CsUpCspCs'p 6tFG\J*D1sD1sUX1sX1sJ־ 6tFGNy ַJ*AsAsUBsBsI 6tFG `J*AsAsUAsAsn 6tFGħ଻J*0s0sU0s0ss 6tFG ַJ*AsAsUAsAs>- 6tFG sJ*?s?sU?s?sP 6tFGէJ*?s?sU?s?s;u 6tFG)J*h?sh?sU|?s|?s#| 6tFG^yJ*8?s8?sUL?sL?s 6tFG`jJ*@s@sU@s@s 6tFG`kJ*T>sT>sUh>sh>s`2 6tFG@J*$>s$>sU8>s8>s?S 6tFG+J*0s0sU 1s 1s, 6tFG= *J*vuvuUvuvu: 6tFG;J*42s42sUH2sH2sl 6tFG**J*d2sd2sU4wu4wu 6tFGNJ*;s;sU;s;s'] 6tFGy 6J*2s2sU2s2sy/ 6tFGNJ*0s0sU0s0sx 6tFGyJ*80s80sUL0sL0sT0 6tFGU! J*h0sh0sU|0s|0sSTK 6tFGNJ*t1st1sU1s1s{8 6tFGb7J*1s1sU1s1s~ 6tFGXַJ*1s1sU1s1syu 6tFGJ*0s0sU0s0s Yp 6tFGs(طxvvN> uuʼn 6tFG.z !0v0v.  ̱ਯ ~ݔsdXP ̱@3 1 ̱ @3 ~[  ̱L`5d p ̱Ż y  ̱` Wdq 0 ̱ػŻXd  ̱rŻ V :  ̱ɱ "q{ P ̱@/ 6a+  ̱  h  ̱/@dv p ̱ŻZ  ̱Ż@ ֙8dX 0 ̱`Ż)  ̱=@ ''  ̱N/Qd( P ̱nFpild  ̱@w ѴP`  ̱=7 vmP p ̱7= R*[8]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) },V` ^u0c'[`ȻfRʱ ?CRb ^u'I ̱0 ̱w9Od  ̱7= m< P ̱^@׿ 6  ̱x gƲa&  ̱9_&D# 6tFG^sQQJQQ9 6tFGU_!RRsRR @;X$ 0 ̱ b  ̱`?f^@  ̱  h͎R P ̱ !`d@  ̱o= O<}   ̱@t@ U p  ̱`?@C 6hb  ̱`?@ ٖ 0  ̱`@3d  ̱ Ư N   ̱``fx P  ̱Iٯ(rdd,  ̱`p@ )   ̱@ɱ ?% p  ̱s(d&  ̱(ŻQiMd e0 e ̱ЫɱI ֮ e7`@ ZɱOѫɱb{ɱR*func(http3.FrameType, quic.ConnectionTracingID, quic.Stream, error) (bool, error) Ns?& P ̱@j\H?d  ̱ TH  ̱ɱd:Md- p ̱/`ս |zy\h  ̱@ۮ   0 ̱@  , ̱/ɱ E@E ̱ǒ 6tFG κń*[ 6tFG" Ϻń*C:  6tFGW Ϻń*jnj 6tFG кń*L  ̱` ` <w 0 ̱$` ;dxA  ̱ @ ru1B ̱ Yb P ̱/R*struct { F uintptr; X0 quic.streamSender; X1 protocol.StreamID; X2 *quic.stream } ,  ̱`C2K p ̱9 1r[  ̱Oj &IZV0 ̱// hZ_ ̱/ ̱}dt  ̱@c uYtdB P ̱`% qpw'  ̱`C d6P  ̱`C@w Ellp ̱1/ v+  ̱Y(޾d# 0 ̱` s,  ̱`QPPE  ̱` 21 P ̱twdQ  ̱ 6y. ̱P@8Ѱ!d/ p ̱-b ̥*}i ̱M$'d 0 ̱`EUd  ̱E p]{  ̱ ̱| P ̱||rX Ph?˱Nɱ+ѭR*func(context.Context, string) (*govultr.ContainerRegistry, *http.Response, error)R*func(context.Context, string) (*govultr.DatabaseMigration, *http.Response, error)R*func(context.Context, string, int) (*govultr.FirewallRule, *http.Response, error)R*func(context.Context, string, *govultr.BackupScheduleReq) (*http.Response, error) k p ̱ `3 z`  ̱ @ 0  ̱  DO  ̱`3 S  ̱ h P! ̱@޿ Op! ̱1ɱ{2G| ת" !: ̱ ,  }h G `>תp"̩ ̱pD ̱̩ͱ Y4:Ŝ " ̱@R*func(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) |m |e #Y `OcF"`ʱ d#Y 0cc O9P- P$ ̱1 5 $ ̱`λcMOS % ̱ t@3 c'q .GqLp% < D -Nd % ̱`@T<0ځp&C 0& ̱jzl & ̱@T rI8`% & ̱ ~@=,d$P' ̱o@TWLI ' ̱@T.* ( ̱@Tq  ]- p( ̱@T $$(:@&8 ( ̱/@S*struct { F uintptr; X0 chan cmd.clientModeRunnerResult; X1 *cmd.clientModeRunner }S*concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]S*unique.uniqueMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]S*func(*tls.ClientHelloInfo, []certmagic.Certificate) (certmagic.Certificate, error)S*struct { Certificate string "json:\"certificate\""; Reason int "json:\"reason\"" }S*acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]S*func(*tree.Node[github.com/apernet/quic-go/internal/utils.ByteInterval], int) boolS*func(context.Context, string, string) (*govultr.DatabaseDB, *http.Response, error)S*func(context.Context, *govultr.DomainReq) (*govultr.Domain, *http.Response, error)S*func(context.Context, int, string) (*govultr.ObjectStorage, *http.Response, error)S*func(context.Context, *govultr.SSHKeyReq) (*govultr.SSHKey, *http.Response, error)S*func([]uint8, protocol.EncryptionLevel, protocol.Version) (int, wire.Frame, error)S*func(protoreflect.Value, protoreflect.Value, impl.mergeOptions) protoreflect.ValueT*struct { IPv4 string "mapstructure:\"ipv4\""; IPv6 string "mapstructure:\"ipv6\"" }T*func(context.Context, acme.Account, acme.Authorization) (acme.Authorization, error)T*acl.compiledRule[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]TypeOprotobuf:"varint,1,opt,name=type,proto3,enum=Domain_Type" json:"type,omitempty"T*map[protocol.StreamNum]quic.incomingStreamEntry[github.com/apernet/quic-go.streamI]T*func(context.Context, ...oauth2.AuthCodeOption) (*oauth2.DeviceAuthResponse, error)IdleInTransactionSessionTimeout4json:"idle_in_transaction_session_timeout,omitempty"T*func(int32, int32, []filedesc.Enum, []filedesc.Message) protoreflect.EnumDescriptorU*struct { F uintptr; X0 <-chan struct {}; X1 context.CancelFunc; X2 context.Context }U*[]*concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]U*[]acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]U*func() *cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]U*cache.EvictCallback[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]U*bbr.RingBuffer[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.ackPoint]U*func(context.Context, string, string) (*govultr.DatabaseUser, *http.Response, error)U*func(context.Context, string, string) (*govultr.DomainRecord, *http.Response, error)U*func(context.Context, *govultr.ClusterReq) (*govultr.Cluster, *http.Response, error)U*func(context.Context, *govultr.NetworkReq) (*govultr.Network, *http.Response, error)U*func(congestion.PacketNumber, congestion.ByteCount, congestion.ByteCount, time.Time)U*func(time.Time, protocol.ByteCount, protocol.PacketNumber, protocol.ByteCount, bool) @^N6 `4(@ͱ MbL}Gk  7 4(H 6 |G5 5(ɱͱ '|G5(1ɱOɱGN5( ɱ  G@6( ɱy 3GAGO@6(Pkɱ! ɱ߳nG|k@7(1ɱ@ &-Gח`7( ɱy G @7( ɱ .GxO 8(Pkɱ! ɱ lEG,/8(ɱͱ"ȖGNj8( ɱ@ G@@9( ɱ@ 3G9(1ɱ]ɱ 32 G@:(ɱnͱ6@nX `:(ɱ1}|!ԩ:(10(M_"U0@" ;(h/e` xG'";(Xlͱ_ ̱((Τ/NY@#;(r d {?p$@<(~ ̅ ilH|FGl%<(Q ̱ @(EGl&ԩ=({!ɱx/ɱ=^&`=(|u y>AY`t *=*(/ɱ <1Gt * >*(/ɱy ˲G%+@n>C(ɱHɱrZo>C(Կɱ P;f@?C(Կu  CE03G>Z?C(ɱɱ qcG@C(Uɱ-ɱTF+*C`@C(0!,85|KC@C(k cF+C AC( !I (% GtJ,AC(7ɱQʱʤ\-CAC(1"B,ɱ s[T-@B(ͱ.ɱYB(KɱTfz|F|}.C(ALJ|FG4K`CK(h`˱L`˱F|FGF@5KCK(C ױ`ױ @|FGP5K DK("`˱M`˱ky|FZA KDK(/ ˱,h/@@o:B KDK(࡮h J|FG[7K@EK(H̱Ḏ(/tG~z KEK(`ʱQtFG\@8KFK(.\u̱Fuy|FGg9K`FK(o̱ X?.G6@9KFK("`˱N|F|\K GK(b"99Yߦs/GKGK(ੰ e|FG9KGK(Ḇ k.G:K@HK(˱ M̱~FGXC@:KHK(H ̱  4G*<KIK(VM# ̱B|FGA=K`IK(j̱==tFG{1IK(3` !`˱W>K JK(3 M ~&|F|AKJK(@ D  ֍DBKJK(M` D|c` N@KN(p5F !ɱ  d`H N MN(ɱLNvDMN(5`u 1P0GEMN(fʱUʱN}2@E@NN(M!zENN(5  w%7|FG@ ON( ˱! ˱R|FG `ON( ˱' ˱AYjFGFON(˱˱)$&.GF PN(  oU.G@GPN(}`˱@|FG]I PN(-/f`˱.Qa|FGG@QN(% ˱5 ˱AF?HNQN(GJsQ!YcWG R(k &ͱG\` `R(k ͱ }"Gp`K ƫR(2ɱlɱ "MGJ S(ɱ%ɱC FKЊSЊ(!Q! aGr S (Ӎ   sG{^4d8 @T' (6mUݩ40^j8dI` T\ (6mUݩ5 @GisrUr (Vɱ@$CFP ʰ`U (!"Q # 7FN`O ʰU (!(` -ѝ?FGQ V (&˱&˱ ]m`G@QV (ͱT˱"x(UuV(i" st6G`` @W(Q@N`hU4ZҵWҵ('{կ7G[ҵXҵ('H`˱ P0Gb[`Xҵ(+'ʱ8ʱqm[Xҵ(Uʱ k, Yҵ(ʫ  Pջg Yҵ(˱,'TҵYҵ(%ְwA 4ǷNu@ҵ@Zҵ('ְwA F!Fi]ҵZҵ(%_G'` l^ҵ[ҵ(J1 FX@^ҵ`[ҵ(BR@4``7_[ҵ(3ͱ&nԎG5ҵ \ҵ(;7ͱOe4G@h 5\5(/ɱ6˱3 th \5(!|sɱ feu/G5`5@]5(9ͱͱ Tov@`]5(9@T{ &`5^5(|ɱ 9' Ro`^Ro( sc ȆG dRo^Ro(uɱ`9nF:vcRo _Ro(5Q! y|FGWfRo_Ro(/ ̱{|FGRo_Ro(' ˱9 ˱ @RGf@`Ro(h/ɱ5 vFgRo`Ro(fsQ!X2tFG@Ro! ~XJXJ  ~JJRKdq Ro`aRo(=ɱ '+/Gs RoaRo(S`ʱ]ͱ :׫lhRo bRo(. ̱5ɱk=|.  RobRo(o :Į \td@hRobRo(@Nɱ $YexG@u Ro@cRo(ɱ ̱^|8RocRo(d) e4Gϩ@jRodRo(9د' Yq{F:kRo`dRo(5(CD|FG RodRo(`˱9\FkjnRo eRo(8 px ~ wPG&x~ eRo(mɱmɱoFT|F|? e(nn;6fO,q@fw(Zթq  Tr~|?:@ wfw(q `:Argw(Ǔͱ" -|g(w`gw(07Jɱ((ŷ+a/Ltgw( ! 'xZeuw hw(rr:൴ pp@"X@uwhw(Tl te0GLxhM;([êɱf ̱ '.G@x@i(8@R& s %.G`;xi({(+R& sԾвHO`;j(8`iIkɱ  vHLGy`j+y(wɱR$ɱL[.GL` +yj+y(#U s  Gaz k+y(.`ɱt Jɏ[\G@zk+y(EMɱKɱ@<\3n@"0M@ k+y(UƼ$ͱ< *IG7z@l+y(ЫɱL{ jHH>dd"b{+yl+y(Ԕ@Ƽߔ 4?F{m(!e J S FM|`m(/&! (` - ! +h}m(>`  LmOFG} n(&˱&˱ ڣ|F|$/n(07hrs !~n( ͱ ɱ \|: @o(8`9ɱ-FB%@~to~t (!e J Sd`~tp~t (HUŻQUŻ 5~G2`p~t (f`K?.Kd{3p~t (UeU?f( q~t (ɱr?w0d@q~t (5Żj|,~tq~t (4Կ =,~t@r~t (4Կ -FG@r ( ˱˱YnЙP0Gs( %ʱʱ|FG  `s (" ˱`˱ܰw|F|@ s ( αp α _~`  t (&sJ@e|8 t (;Z t (U ;@t?/  @u (t4ரϫjGg u ()xRͱ =Gμ v (]) sJLXsQNs`vNs(ͱ@qFlFgvF(R;wQ ЫFm wg(`ȻOɱ͔a|FG֕ w(v ̱`Ȼ"|FGh w(Q ̱{j,jz@x(U!  0(ցv<x(H[` y(U J4G.hߴ`yߴ(aɱ/. lF==y=(%UVpFG@= z=(˱˱`L zX(˱3cF=O@XzX(!sQ!n,.T=@X@{X(i" s<,-K<d!`H{H()|)`> O56'` H|H(/`˱{ bt|J'H`|H(w" =|F|^'@H|H(K 'Q @(ӝ"zH }H(`;0 ^rt2pGO }H(h/ɱ cG` }}(h/ɱ {4 @~'(|!| ֨|0FK~K(fE@zy hh(5ɱ~5G}cԩ`c(``˱G>cԩc(` ˱ 6G.j@cԩ c(``˱;G??(ǪLְ ۄ9P`( s)-1p|FG3@( ױ`ױ$$e["O{(`w $$5"j }(`w 2tFG>1`1(3` ! ˱bFPӫ@(ο` /ee)AA(Cɱ !|8"|F||(% t \(|FGiA@+`+([ ̱ ̱@<#Q  (I*p|4fG=` 9^ 9^(v` `V".G= 9^9^(v `?FNlww(ο` /JiG?`?*@*(˱@tG>j`@**(˱JG>`A**( ˱Mnlԫ`(0; ~@~~( /n/P6G? (5ʱ xœHG.*` (ɱ& |FG ( `˱`˱1Ƀ|FGd @(-/f`˱.G(5ʱ ධpq Sd5GV(` Y`(fʱ6@/v'P0G (fʱUʱGi/G o(+`ʱh/`ʱڤM"/G@ o(+`ʱ6`ʱBϰy|`W|W|(A y#eFW|@W|(2 ^m F 4|l.GmW|W|(Y}Y̱;>FqW|W|(! % p9Gm` `N (ɱFZ ̱X!;BS N (aZ* G+ N (Rɱ`ʱ !:< N (FZ ̱`Oɱ\G+@x]x]( w ̱ K4 x]@x](@Z`˱~dFlSx]x](@DM  4Xx](*/ͱ nq`x]( (@ ~ 4 x]x](" LFx] x](T`G J,G [QFx]x](DG nq`I =  X`x]x](  ̱gކFb-x]@x](`* * t.G} x]x](Ϊ@N ;@#-@x]x](f[ĩ LL`&# x]`x](p@Y`HEPF(0@J ! tg|\ @` (&ũs ̱d d (2oO \"L./@蜩(p s5yF^q蜩@(*0<`C*| #dnqnq( ̱۫8AG@OO(V@::8|w `q(! ``.{ d1 qq(2  ĴW  F(3 ̱ɱ|FG~` FF(2@ܿ" ̱  Gք3p3p(Cɱ !ɱaPB`4@(@ `ձ#*.*Y(uo K@/(6`ձ`N`  A`(& Կ Y(& Կ$VՔ@r (yͱI? B}}y(& 0 /1yࡷ(& GGC @(& Aɱvj$ @(& ~Yɱ2, (&  ɱ0 $z`(& 0ɱE$e4 G(& ȅ˱L8 G@ (& N˱J!< G.z(& `˱` \ष(& ɱNmdd \@(& *ɱ9lh \@(& Aɱ:l \(& XɱWZt ]`(& oɱQ' (& Bɱ Rrvi*@ (& 5Ѫñ ](& ɱ=  ৷(& ɱ+ i@(& rɱV` ˠ(& ۫ɱ ϴAz0(& GѪa& z@`(& ۫ɱ 52{"(& G h({' (& Gv G2{'(& `˱ [9 (ષ(& }+ɱ=w F{*@(& .ɱ…s(]  U?~ @(& ɱ 'p >s`(3ʱɱ bβ Ns (Z{ʱמɱ aw (3ʱ pcO)`$ ZB(  ָ|.tB B(%Q2|FHBB(`˱VЭmHBషB( B +@ 0(ʪLwB@B((B{$ !yƦ4 PZ`UU(&/ɱtn5H dzZ(0(- ('l Gt`(gҪɱyҪɱ>|FCI(0 ̱1ӭ *nMt G (ɱ┯@/ S G߀@( ɱa@3 % S@೷(k ̱]ɱ0,g $ @(?ӪࢻݫࢻG+ G(`ͱ`ͱth> $(xUҵlގ |F|h@`(I1@3FT|F|q(ͬ@3La@/ j& G>@ (~̬ɱ]ɱ JG(êɱ4 O G*භ(ҪɱӪɱ m(! "@(rD|FG\@(Ŝ ̱Wޫ ̱ l< G (#ɱ㜬ɱ NT Gb2`(ɱޫɱ &\ G'(~%ɱ[ɱ Md G[@ (9rɱ-Oɱ 7| G@(┯ɱ]ɱ   G๷(QɱWaɱ ~| Go@(.`ɱWaɱ mh G3(lYɱɱ^(tg%(qԪӭ ^?z`(߫qԪӭ .(%&qԪӭ 1@ (1qԪӭ bX(άqԪӭ nfXe༷(qԪӭ  @@(ݖqԪӭ (qԪӭ L{{(@qԪӭ VQ|y`(o 6%( qԪӭ wye@ (e qԪӭ הIe@(f@!qԪӭ l7࿷(fqԪӭ _!8f@(`ٮYӭ ~t҉(O ٮqԪӭ a,@ (+!qԪӭ e):pf `(r!qԪӭ =ag@ (f"qԪӭ 7E  ·(qԪӭ   ·(@qԪӭ Sb@ ·(Ԫ"qԪӭ f @÷(r%qԪӭ t ÷(R$qԪӭ   ķ(s@%qԪӭ LYO`ķ(&%qԪӭ .Pķ(&@&qԪӭ y-(@ ŷ(y&qԪӭ bS@ŷ(@qԪӭ LWuCz3ŷ(1&qԪӭ Q_@Ʒ(8R@"qԪӭ XQ`@Ʒ(o#qԪӭ  WD]Ƿ('Oӭ Y^7&`Ƿ(@'qԪӭ Рr-Ƿ(f'qԪӭ @ ȷ('qԪӭ p1[E@ȷ((qԪӭ Zg)3@ȷ(3@(qԪӭ V"&@ɷ($qԪӭ *[5E@ɷ(#qԪӭ fJ)ʷ(ժ@qԪӭ !b@`ʷ(2)qԪӭ 3 ˷(ժ(qԪӭ JW@˷(ժ(qԪӭ xA ` ˷c^(ɱ p bc^@̷c^("` G0 c^̷c^([ ̱J| bgZ GJ@ͷ?t(7ɱQʱ P0G̵`ͷǗ(+ʱBʱ xǗͷǗ(p3Q VϫG ηǗ(T`˱ Ea2KηǗ(4 /h+64ǗηǗ(' {-%G@Ǘ@ϷǗ('H`˱  6 ǗϷǗ(ڶ O"6@ ǗзǗ(u |n TǗ`зǗ(%ְwA  I u ǗзǗ('ְwA  , @Ǘ ѷǗ(J1 ~^,ѷ (6˱ J=|FG@ ѷ(  αf ̱@<b2##'@ҷ'(I*p|4 ! 5&ҷ(9@T!:/G*תӷ(, ʱ, ʱZh*ת`ӷ(1x5 |FG@-תӷ(u ̱ ! ̱ ,'l /ת Է( ! VɱXp O TԷT(Zɱ&Y ԷJ(*ͩ ̱Կg6@@շJ( ̱~` J| 0JշJ(D ̱~ɱ4,>t  JַJ(,V~ ̱00)Ny `ַJ( `˱Фj)  ַJ( ]%`˱C,*X ׷J( ɱ_,P0G ׷J( %ʱʱW.|FG] ׷J( %`˱`˱8P0G+4@طJ(ʱʱ$  q z4xطx({@9@.4o ds( ٷx(0NN ʳ!.@5c`ٷc(? s 4SuF+H8 zٷ z ( @afO`YFH@= z ڷ z (.``ZF*8= zڷ z (. /UB?//O@>]ӳڷ] (Z GZFGDE@۷H(68:o ۷b( E  Uf4 ܷb(6 n:FGG* `ܷb(poMm ڕ0FG) ܷb(poMm  8ڇP G@ ݷb(U ##  `  GGJ ݷb(U W e)FG@ ݷb(poM՛ 0*gd@޷b(.|ͱ  FG l@H޷(( OG8@I߷a (`-GSUCŮdd I`߷a (`-@UGSUk.FGJ߷a ( %wHbGr@a a (3@I# h`%ͣ!l (`bwͱd2FȇMű(n: c DG  R›F@Mű@(DG nq`I FMű(n: c DG  e?E @ű(%ְwA @FG7޻`޻(˱˱!4G:޻޻(p s Q2G<@O (5ʱ b@sU3H<G^}@ (`˱,|WFGgR (Eܹ ̱ uY GI$@(J`E`/|`xx(`> Y @Q++(j`ʱ`9P T?4GքR`(Cɱ !ɱʆTG;@S~~(ebʱi ˱| P0G$` ~ ~(ʱʱ +hG:@(oɱ$ ESa\GR H(3 u ɱJ5UH@H( ̱( j, UU( s)@wqzrhG  (86u}yFXZ#`#(X!D*@7.MlF[zz(X!|D*@7.x:|<` . .(7@u|tf..(7@uws|f ..(7uldpG,`-Ʊ@-(_ eY G0$5w -Ʊ-(_ݹe` ( 8%gg(7~ 9L! @ `w(@bA>N<cc(Qͱl|FGh_ c(6`˱8`˱yGcc(@ b ̱ '0G (VM@Rbѩ ̱ UG߮@]&(ɱ|P9G`]&(ѩP  crG`]&(ɱ|PsE@`]&(ѩ!R L _G]&]&({V J2|FM ^(`˱G|FGM L(ѩ ̱ ̱XqLL(5ɱfFc\Ʊ@\(M ~J! ~ / -\$f s s(\ jpg@f s s( [Gyh`Y(EO / O?}gY(   X0GhY Y(ͱbFCI*`Y( LD|-&"Y( ͹0,ڝ@@Y( ഻ ,G-h@jY(EO WйI@kYY( }oɱ6F7@l㹱`( l  m &A"$G_@mdd(/ ̱ߩͱO_5GI ˱0\Glda @yCndd(@]+.`,ݧf|F| @idd(8`8J<d@d(| V@d dd(`G@TAR:xDdhidd(`G@TA}i`d`d(`G@TeKidd(`G@TeE«2d d(`G@TeD {H@dd(`G@TerLdd(`G@TeĂҿd@d(`G@Te[Y dd(`G@Te`bdd(`G@Te{i`d`d(`G@Te^dd(`G@Te>|F|Nd d(8`ԻRTdށ d(U@T`ؽ~ G'ߪ(S ̱ ?F @rߪ@(`/&7 Ndd6@;ee(/f/k28|FGcV W(-/f`˱ 8/dt`W(&f`˱HHP&/sWW(`@ܹ$zp+(<W W(JɱA`Q$LR(91G̖|| (߹@$1*V1Gioo (@$iO1Gi@o@o (@ GG(۲۲(t`~l#IG.DZ(_e`[ 44{ 29 DZ`(_޹e໻ jD&1 d(ͱ.ɱ;F|p `O (d`P/@s| `P(dযP/@~| `Q(d P/@$| `R@(dP/@V*concurrent.indirect[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]V*[]*concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]V*[0]*concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]A0|)`..(%ةFgJ/K  5d(|ɱ UzABhGKhRo`Ro(uɱ !V7RoRo(5 Į)  9G Ro d(uɱ`9V*func(context.Context, *x509.CertificateRequest) (*certmagic.IssuedCertificate, error)V*[]acl.compiledRule[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound] *@N (r?#<ԿD<dF"v@(@% ̱@Bsb~1@ N ((ܮ5!  v`d(r]#<ԿD<<"(% ̱@}`l N ((߮5! D<'"4(& ̱@ udCAd(r?#<Կ z4 @ d(|!| G|FGɫ  P( %`˱`˱ AHGn`:x x(?ಿYSSr~|FG>` P( %P݇ ` d(4@ʱnB.lF|Hʯ H(Ѻ ̱ R4G? x x(?YSStP*h#8K]ӳ ] (Zͱ~"vFGA@]ӳ@ ] (@ (kT/G]ӳ ] (@  (=/G1]ӳ ] (@@Ժ$ Y/]ӳ` d(Z GtP?5 h#RX]ӳ d(Zͱ~"vtP&Vh#|.]ӳ d(Zͱ~"@FGH@]ӳ] (@$$ xf (  x]x](X9aͱ Y,  x]@x](X9Naͱ 0 t x]x](X9`aͱ cT4  @ x]x](X9caͱ{әFG `d( %V*struct { F uintptr; X0 *http.Request; X1 *http3.ClientConn; X2 *http3.requestStream }W*[0]*concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]W*struct { F uintptr; X0 context.CancelCauseFunc; X1 *http.Transport; X2 *http.Request }W*struct { F uintptr; X0 context.Context; X1 context.CancelCauseFunc; X2 *http.Request }W*acl.CompiledRuleSet[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]W*struct { F uintptr; X0 int; X1 uintptr; X2 func(unsafe.Pointer, unsafe.Pointer) bool }W*func() []*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]W*func(*cache.LruCache[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn])W*udpnat.Service[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]W*func(context.Context, string, *tls.Config, *quic.Config) (quic.EarlyConnection, error)W*func(context.Context, string, string) (*govultr.LBFirewallRule, *http.Response, error)W*func(context.Context, string, string) (*govultr.ForwardingRule, *http.Response, error)W*func(context.Context, *govultr.SnapshotReq) (*govultr.Snapshot, *http.Response, error)W*func(int32, int32, []filedesc.Enum, []filedesc.Message) protoreflect.MessageDescriptorX*atomic.Pointer[github.com/apernet/hysteria/app/v2/internal/utils.localCertificateCache]X*func(*tls.Config, *tls.Certificate, *tls.clientKeyExchangeMsg, uint16) ([]uint8, error)X*struct { F uintptr; X0 context.Context; X1 net.Conn; X2 chan error; X3 chan struct {} }X*func(context.Context, string) ([]govultr.MarketplaceAppVariable, *http.Response, error)X*func([]uint8, impl.pointer, *impl.coderFieldInfo, impl.marshalOptions) ([]uint8, error)Y*concurrent.HashTrieMap[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]Y*func(*concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]])Y*struct { F uintptr; X0 net.PacketConn; X1 *client.clientImpl; X2 *quic.EarlyConnection }Y*struct { F uintptr; X0 []uint8; X1 []uint8; X2 uint16; X3 *tls.cipherSuite; X4 []uint8 }Y*struct { F uintptr; X0 context.Context; X1 *tls.Conn; X2 chan error; X3 chan struct {} }Y*struct { F uintptr; X0 *certmagic.Config; X1 *context.Context; X2 *tls.ClientHelloInfo }Y*struct { F uintptr; X0 *quic.client; X1 chan quic.errCloseForRecreating; X2 chan error }Y*func(context.Context, string, string) (*govultr.PlanAvailability, *http.Response, error)Y*struct { F uintptr; X0 impl.Converter; X1 impl.offset; X2 reflect.StructField; X3 bool }xu9tFGng @"|?|FGC`˱ Kڰo$FF N`N, 7@}; FL ǫ !G\[ -@F Њ Њ[" !^X^ 9tFGz`r 7]K& cy cyFG9_  aQɱ !=#Fj 5@5[" ! e9d9RH@k 55@9 9\7u&9Gk 55R` 977{9Gl 5`5>o` 9 8 8QC9G`l 55R` 988M/9G'l 5 5R` 9L8L8q9tFGm RoRoQ!d%Kd%K(9tFGgr RoRoSs O Oޟv-Fs Ro@ Ro, Q!<ROF@t Ro Ros R kOX9tFG8t Ro!Ro|sPOPO`/9tFGK{ Ro`!Ro؄u|"Q|"QyLV39tFGX`{ Ro!RoAoQ! O OyvLF{ "Ro08 Q!RR ]pF8X} Ro"Ro[" !DRR 7/bF!~ Ro"Ro, 7R4M{TFG @#w^TӱEXSg}$GGT #~t `ʱ !-g v$GGOj $~t h/`ʱ ! @-tFGd` `$~t 6 ̱ !0 tFG $ ̱ !__Y&\FG2@ %`Oɱ !_D_{uFG1 %`Oɱ !__aFGv %<ɱ !\%FG @&<ɱ !dH3G wɱ`D0D0 /00!CF @'@2s(`$W$җ+O9tFG q`'q8 ܼsEEYYMFD@ 'q08 Q!FFߡbF (3p !GGV5z9tFG (' 8H8HςtFGY (6 !؉yġFGEF` @)ɱ !TpTaK$FG )ɱ !TpTVFG *Cɱ8TiTj%*= `*J`Uvu(1s#)* *JDU4wux2s.Κ:F,i J +J[" !yuPyu-IF +\9sh``hF +++ !Um#m 2/sG @, Q ~$TN,! ~ PG$@-,8 ~b&9tFGy` .`-. !-!+&+&Z*func(*concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]])Z*func() *concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]!Y9tFGf` ,.,; αX1`T&T&Z*map[uint16]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }Z*struct { F uintptr; X0 chan struct {}; X1 func(time.Duration, uint32, bool); X2 *uint32 }Z*struct { F uintptr; X0 *unsafeheader.Slice; X1 uintptr; X2 *abi.Type; X3 unsafe.Pointer }Z*func(context.Context, netip.AddrPort, network.PacketConn, *buf.Buffer, metadata.Metadata)Z*func(context.Context, *govultr.SnapshotURLReq) (*govultr.Snapshot, *http.Response, error)Z*func(protocol.ByteCount, protocol.ByteCount, time.Duration, time.Time) protocol.ByteCount[*func() *concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]][*struct { F uintptr; X0 *http.http2ClientConn; X1 *error; X2 *[8]uint8; X3 chan struct {} }[*acl.compiledRuleSetImpl[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound][*map.bucket[protocol.StreamNum]quic.incomingStreamEntry[github.com/apernet/quic-go.streamI][*map[protocol.StreamNum]quic.incomingStreamEntry[github.com/apernet/quic-go.receiveStreamI][*func(context.Context, string) ([]govultr.DatabaseDB, *govultr.Meta, *http.Response, error)[*func(context.Context, *govultr.ReservedIPReq) (*govultr.ReservedIP, *http.Response, error)[*func(time.Time, congestion.PacketNumber, congestion.ByteCount, congestion.ByteCount, bool)[*func(time.Time, congestion.ByteCount, congestion.PacketNumber, congestion.ByteCount, bool)[*func(protocol.PacketNumber, protocol.ECN, protocol.EncryptionLevel, time.Time, bool) error\*map[*pflag.Flag]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)\*func() []acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]\*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }]*atomic.Pointer[internal/concurrent.entry[go.shape.*internal/abi.Type,go.shape.interface {}]]]*struct { F uintptr; X0 *socks5.Server; X1 *net.UDPConn; X2 client.HyUDPConn; X3 chan error }]*struct { F uintptr; X0 *certmagic.httpSolver; X1 context.Context; X2 *certmagic.solverInfo }]*struct { F uintptr; X0 *tun.System; X1 net.Conn; X2 *tun.TCPSession; X3 metadata.Socksaddr }]*func(context.Context, protocol.Perspective, protocol.ConnectionID) *logging.ConnectionTracer]*func(utils.ByteInterval) *tree.Btree[github.com/apernet/quic-go/internal/utils.ByteInterval]]*func(context.Context, *govultr.DatabaseCreateReq) (*govultr.Database, *http.Response, error)]*func(context.Context, string) ([]govultr.DatabaseUser, *govultr.Meta, *http.Response, error)]*func(context.Context, *govultr.InstanceCreateReq) (*govultr.Instance, *http.Response, error)etFG //.d`d"!%Fj'*9*0-!Q!1FGC !@A,q*A,Hr*I|B,8r*JùxFG+@v @:CIw,l* /x,*2‡xFG.v :C !,$,g*$,g*$GGCK /@ 0|G\F_Kǫ`;0³ nZ`F6@M~;~ 0WvVvSFEN( <( 00dv:dvEF7Nr<r 00d@u:dv@NBxFGNs <@]ă\K|]\mFW@W7N@=7N0f'`!@z<Fg@]ҵ=ҵ06 6@    BFG5R@R9F7x'PS9F7 /T9F7)FX@bRo`>Ro0'P9`6@樘xFGO` >Ro!QLs\QL-!xFG[w ?Ro/ Q$LַQLVxFGxw@ ?Ro/4QLַQLixFG@ ?Ro !HQ 8   jCUFgǗHǗ06 6 @  o^3$GGG z ezybJz y /zXyp`$GG7 z e0z\ybJ̻zy /xzy.FD@8 zJ z 0PE@^ ^fO` @F78 z`J z 0PE^ _fO`ځ$GG` z ezybJإzy /zyG!sF9 z K z 0PE@_ _fO`_FY9 zK z 0PE_ `fO`1i\Fb: zK z 0 a#]fO`B{JF): z@L z 0 b#@bfO` h@F7 zL z 0PE@c cfO`IVFH; zM z 0 @d#dfO`bNF< z`M z 0PE@e efO`KFj< zM z 0 e#dfO`|FGB9E`%g_T_%@h_tU_U%h_U_ tFG E /\_U_a{WF |FG-*bPܤ`ȓ``O`` /x``z2 FIa@Oa 05@s .(@(@o \FݢMűO0DG x &nq`I {FROxPx0P e :e ͥvإvV MFY `P 0% !%>Fz\zPz0X!|D*@;`.7.)m tFG"]&bC8 , pi ̱Ż @Xh8 ) i ̱ U ^ *pF3pf 0j ̱ U@ N~[Dpg j ̱N@ Ull PjH@ww'! ɰHXd αhll{6PRPkH@ww'!`ɰHXd αhLL(;fkH@wర'!˰(Xd αHCW8 l ̱Fڻ ^AG.plH@w@|'!ӰXḏTT ( WlH@w@|'!wXd αPLL[ 0mH@wӰ'!|HXd αHllyPhmH@ww'!հHXd αhTT8q mH@w@ڰ'!wXd αP$_GPnH@wڰ'!zXḏ <<)/BX!}GnH@wڰ'!ڰXd α8/'fg oH@wڰ'!۰Xd α||_$!poH@wڰ'!@۰Xd αxll:}}D|oH@w`'!ܰHXd αhLLf 0pH@w`'!|HXd αHll㷐P^pH@ww'!HXd αhTT;+T!pH@w@'!zHXd αPllx*X!PqH@w@'!|HXd αh,,}Kx!\qH@w'!|(Xd α(ll4;P rH@ww'!HXd αh,,mx!iprH@w'!|(Xd α(,,Uux!ErH@w'!|(Xd α(LL7R0O}0sH@wర'!(Xd αHll8Pu}sH@ww'!HXd αh6Hk'@ sH@w'!hXd α 'PtH@ww'!HXd αLL֔[tH@wర'!(Xd αHLL)`# + uH@w@'!Xd αHl@LD,5 puH@w@'!Xd αLL>$uH@w'!@װ(Xd αHLLs[< 0vH@w@'!(Xd αH  똽,+vH@w@'!|Xd αllXP vH@ww'!HXd αhLLk\PwH@wర'!@(Xd αHlltw!iwH@w'!HXd αh&xH@ww'!HXd αlltPppxH@ww'!@HXd αhpT'xH@w'!@(Xd αllPh0yH@ww'!HXd αhllǟ`<yH@w'!w(Xd αhllUR`}yH@w@'!w(Xd αhTTM? |PzH@w'!wXd αP44(! zH@w'!Xd α044! {H@w'!@Xd α0TT&Y p{H@w'!wXd αP$D{|G}{H@w'!zXḏ \\n~!0|H@w'!wXd αXs&|H@ww'!HXd α#8c&_|H@ww'!HXd α^YQ4' ~P}H@ww'!@HXd α#< } ̱@ ~ ȋsg ~ ̱@ne)p~ ̱ !n >3@] ~ ̱1ͮ` olk$ 0 ̱@@3 @ ̱@tn ۯ b$  ̱`x=ɱ F+P ̱`?@EY%  ̱`@^ Ti8  ̱= nyU% p ̱n`z l}p Ё ̱ @3^ O h 0 ̱`֯= cx-o[H@ww'! HXd αllP~H@ww'!HXd αhll~wPz PH@ww'! HXd αhlluPH@ww'!`HXd αhllxұP[H@ww'!HXd αhrh%&s pH@ww'!HXd αllTPЄH@ww'!HXd αh{g>p-00H@ww'! HXd αu d,H@ww'!`HXd α)i4'=H@ww'!HXd α5=[(HPH@ww'!HXd αzY14'}H@ww'! HXd αj ̱@W` m>6p ̱'=sO 0Ї ̱`=llߠ4P0H@ww'!HXd αhll/P+H@ww'! HXd αh}W,Xwɱêɱɱf ̱ -6JPH@ww'!HXd αLL)cGH@wర'!(Xd αH% x  ̱EE @llPPPpH@ww'!HXd αh}4'" ЊH@ww'!@HXd αll֮PT>0H@w'!HXd αh{# ̱2@ FfT ̱ȼ@@ iC.P ̱@ %0 ܈D'H@w'! (Xd α44rE"H@w '!z(Xd α0LLJ mpH@w '!|(Xd αH%N\(>ЍH@w '!zXd αLL͒j0H@w௰'!௰(Xd αHih4 ̱ ̱̱ llg+PH@ww'! HXd αh\\Ƭ;"<PH@ww'!ڰHXd αX\\[X!OmH@w`'!wXd αX\\P>!tmH@w'!wXd αXTT;-/ pH@w'!wXd αPll?P:АH@ww'!HXd αhllD"0H@w`'!`(Xd αh,0\'H@ww'!HXd α44z!H@w`'!཰Xd α0llqOaP>PH@ww'! HXd αhllO`6 H@w '!w(Xd αhllܹ#wnH@w '!|hXd αhllp bPpH@ww'! HXd αhBt,^ГH@w'!HXd α+(3 0H@w'!ڰXd α<<8!H@wڰ'!@Xd α8s0(C5H@w'!Xd α,WG=PH@w|'!|(Xḏ(!(H@w'!Xd αQ)Xd~  ̱`=@XSGTpH@w`'!`Xḏll `r`{ЖH@w'!w(Xd αhll\\0H@ww'!HXd αh!HFG _H@w '!`%HXḏa@( H@w`&'!&HXd α(z (A PH@w`)'!)HXd α!S( H@w`)'!)HXd α/4'H@ww'! -HXd αOIi( pH@w`%'!-Xd αJ( ЙH@w .'!-Xd αn()0H@w.'!.HXd αlle!K H@w '!HXd αhuɽ(v H@w.'!)HXd α~(1PH@w.'!`0HXd αa((H@w.'!0HXd αAR(( H@w`%'! 1Xd αqb(D3pH@w.'!1HXd αzoC(hWМH@w.'! 2HXd αQO([-0H@w.'!2HXd α5(-H@w.'!2HXd α)O~9 ̱@ o tP ̱M wllyHt! H@w`)'!5HXd αhnJ]G@H@w '! HXḏLLA   pH@w5'!6(Xd αHll0@}Pv ПH@ww'!7HXd αhse@n 0 ̱˱{8' ̱P@ vk,  ̱-  1' P ̱ Pomx ̱nPۿ llPH@ww'!@<HXd αh<)hpH@w='! Xd α/HD'ТH@w'!>(Xd αƑ4'~0H@ww'!AHXd α\\q<!H@w`B'!wXd αX\\"H@ww'!`BHXd αXTT(͘X PH@ww'!`HXd αP<<!H@wڰ'!BXd α8\\`C!(BH@wڰ'!wXd αX4.GհpH@w`'!Xḏ0TT ХH@w`'!wXd αP^*func(context.Context, string, string) (*govultr.ContainerRegistryRepo, *http.Response, error)I\'xeH@ww'!GHXd αll@PhH@ww'!GHXd αhu6&4gPH@ww'! HXd αllLx$U %H@w@'!H(Xd αhllY\H@ww'!OHXd αhTTvXdtpH@ww'! PHXd αPLG&ШH@wర'!(XḏHy )aR0H@wP'! QXd αllfRPքH@ww'!`QHXd αh7ջ&H@ww'!QHXd αLLnRPH@wR'! S(Xd αH))HH@w '!|hXd α44N"-H@wS'!z(Xd α0TTEVT!gpH@w`'!zHXd αPLL1+ЫH@ww'!THXd αHllr D[p0H@w@'!@THXd αhll~zPH@ww'!SHXd αh ġh'PH@ww'!THXd α %6" P ̱ @ ̱ ll̮ X!tH@w@'!THXd αhlls`RH@w`W'!w(Xd αhllUL`_pH@wW'!w(Xd αhll"h`UЮH@wW'!w(Xd αhllŅ`DU0H@w X'!w(Xd αhll6!`RH@w`X'!w(Xd αhllK3 `uH@wX'!w(Xd αhllIvn`P[ PH@wX'!w(Xd αhllD`H@w Y'!w(Xd αh\\,V!]H@w`Y'!wXd αXll`SpH@wY'!w(Xd αhLL!CIбH@w|'!Y(Xd αHll-0F\.S0H@ww'!`WHXd αhll7\H@ww'!WHXd αhll\pUH@ww'!WHXd αhllSO\UPH@ww'! XHXd αhllH,!\WSH@ww'!`XHXd αhll/\[ H@ww'!XHXd αhll+\pH@ww'! YHXd αh\\D"дH@ww'!`YHXd αX\\V"<0H@ww'! ZHXd αXll`\SH@ww'!YHXd αhe6GH@w['![Xḏ K"5PY `Oc7F"`ʱ iy  ̱/ MpP\ ̱  t `λBuD'F pH@w@h'!h(Xd αwh5 з ̱1c@3ll c  %0H@w'!i(Xd αh  (d\+™H@w'!i(Xd α^*func(*wire.ExtendedHeader, protocol.ByteCount, protocol.ECN, *wire.AckFrame, []logging.Frame)^*func(*logging.ShortHeader, protocol.ByteCount, protocol.ECN, *wire.AckFrame, []logging.Frame)^*func(logging.PacketType, protocol.PacketNumber, protocol.ByteCount, logging.PacketDropReason)OD*kH@w '! HXd αllt-`5pH@ws'!w(Xd αhLLs_fкH@w|'!s(Xd αH&4'lU0H@ww'!wHXd α#gMc)hH@wx'! Xd αLLE2 H@w {'!|(Xd αHllj%PH@w {'!(Xd αh44N"H@w {'!`{(Xd α0)Vt(mwH@ww'!{HXd αll!8\pH@ww'!{HXd αh%4'нH@ww'!HHXd α4 G^0H@wT'!z(Xḏ044C">H@w '!z(Xd α0LL)2H@w`'!(Xd αHlliDwPH@w@'!HXd αhllS>M#D2H@w@'! HXd αh58t'UH@w@'! HXd αs d$ p ̱a ̱` ίK4'l H@w'!`HXd αt)& 0H@ww'! HXd αll&- %J H@w@h'! (Xd αhll' P H@w'!`HXd αhll "\P¸H@ww'!HXd αhllSPj ¸H@w@'!HXd αhLLu_ øH@w'!(Xd αHll\&@\9pøH@w@'!|HXd αhllJ_1PøH@w@'!HXd αhllhPX0ĸH@ww'!HXd αhLLeĸH@w@h'!(Xd αH`S4'< ĸH@w@'!@HXd αj4'&| PŸH@ww'!@HXd αll' %v ŸH@w@h'!@(Xd αhll/ePƸH@w@'!HXd αh,jG5pƸH@w@h'!|(Xḏ(lluPƸH@w@'!HXd αhll~PW| 0ǸH@w@'!@HXd αhll+#Pn ǸH@w@'!HXd αhllvP| ǸH@w@'!HXd αh⁤*UPȸH@w'!|Xd αllt(P ȸH@w@'!@HXd αhlܷAG ɸH@w'!(Xḏh,,Bl+,YpɸH@w'!{Xd α(TT[4&ɸH@w['!@Xd αP^*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 protoreflect.OneofDescriptor }LLJhʸH@w@h'! (Xd αHll'PGʸH@w@'!HXd αhll_8 %6sP˸H@w@h'!`(Xd αhLLgiUА ˸H@w@h'!(Xd αH, ̸H@w@h'!(Xd α=, p̸H@w@'!HXd αll}X!s̸H@w@'!@hHXd αhlln/g %s0͸H@w@h'!@(Xd αhll왼NDv͸H@w@'!HXd αh#!1Tt' ͸H@w@'!HXd α 5CPθ ̱ @=D8څ3h&4l θ ̱ DDhh|&l ϸ ̱<||&p pϸ ̱<DDBQ|&ϸ ̱@]<DDto|&a 0и ̱@T<z- и ̱ ~@= wHx*m и ̱@T@T oPѸ ̱`ࣲ@] Wx/Ѹ ̱// ΐ0* Ҹ ̱/` Vz\'npҸH@ww'!HXd α_*func(time.Duration) interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool }_*func([]utils.ByteInterval) *tree.Btree[github.com/apernet/quic-go/internal/utils.ByteInterval]_*func(*quic.packetBuffer, protocol.ByteCount, protocol.Version) (quic.shortHeaderPacket, error)_*func(protocol.ByteCount, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)_*func(context.Context, string, string) (*govultr.DatabaseConnectionPool, *http.Response, error)_*func(context.Context, string, *govultr.NodePoolReq) (*govultr.NodePool, *http.Response, error)_*func(context.Context, *govultr.LoadBalancerReq) (*govultr.LoadBalancer, *http.Response, error)_*func(protocol.ArbitraryLenConnectionID, protocol.ArbitraryLenConnectionID, []protocol.Version)_*func(protocol.ByteCount, time.Time, []congestion.AckedPacketInfo, []congestion.LostPacketInfo)_*struct { F uintptr; X0 func(); X1 *protoreflect.MessageType; X2 protoreflect.FieldDescriptor }`*func(io.Reader, interface {}, []pkix.RevokedCertificate, time.Time, time.Time) ([]uint8, error)`*func(string, func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)) error`*struct { F uintptr; X0 client.HyUDPConn; X1 chan error; X2 *net.UDPConn; X3 *tproxy.UDPTProxy }`*func(*qerr.TransportError, protocol.ByteCount, protocol.Version) (*quic.coalescedPacket, error)`*func(context.Context) ([]govultr.ContainerRegistryRegion, *govultr.Meta, *http.Response, error)`*func(context.Context, string, *govultr.ReinstallReq) (*govultr.Instance, *http.Response, error)`*struct { F uintptr; X0 *int; X1 int; X2 proto.MarshalOptions; X3 protoreflect.FieldDescriptor }a*map.bucket[uint16]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }a*func(string, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound])a*map[protocol.StreamNum]go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446a*map[protocol.StreamNum]go.shape.87e097673d66065977bf56ddb90476ff1df6fc654105bae45be323a5e117aaf8a*func(context.Context, *govultr.FirewallGroupReq) (*govultr.FirewallGroup, *http.Response, error)a*func(context.Context, *govultr.ListOptions) ([]govultr.OS, *govultr.Meta, *http.Response, error)a*func(context.Context, *govultr.StartupScriptReq) (*govultr.StartupScript, *http.Response, error)a*func(congestion.ByteCount, time.Time, []congestion.AckedPacketInfo, []congestion.LostPacketInfo)a*struct { F uintptr; X0 impl.Converter; X1 impl.offset; X2 reflect.StructField; X3 reflect.Type }a*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 reflect.Type; X3 impl.Converter }m@ݸ4 ɱKɱmɱ ]QG@ݸ41ɱOɱ@ rJ.s@޸4ct@/y08@/k޸4 ɱɱɱ QG@߸4~ɱ1z ̱  A<@3o߸4ͱɱ o 6tFG8 ///d`dA8X!ԩ4z HL@q A#@4@`x gK<l`c-*O"4^Yg`x,nYK\LDI@$@45F</Kլ`( < .%4m!QQt!Q@8i6%@4H ̱O`x4QQ 6tFG*n* e00:44*e`// 6tFG9C !@A,@A,A,A,I|B,|B,Pl,@C4Կ ̱ ɱ͑,'@C4Կ ̱ ɱƐ( 6tFG5Cs**Jy*y*xImc 6tFGf?Cf@))I\)\) /x)x) F3u CC4 s"`0@ 8;( 6tFG>Z`?C !p*p*q*q*Iq*q*=#G 6tFG?C !o*o*p*p*Ip*p*ݏ 6tFGAC !.k 4 ̱0 b1G 6tFG" \  .G=5KK4#̱̱"ẖ\TB5K@K4ɱ;ɱ٩@/V, tFGB KTh^hHLkFGr6K@K4`˱ ̱=k pG`KK4b"Հ`.GK@K4̱#˱˱ } 6tFG\FKLL'% 6tFGΚKxIZZz#ZZd\d\G1@| KK4Ư`H$ 64G\K@K4̱̱`tG4KK4\ i ર[Fpo;K@K4MM@ 5`} 2GS=KK4a ˱Z o?> 6tFGC:K /@ @ G\5F N 6tFG{IK>X )))).! ))h 6tFGc KB\(x 6tFG q;K@xC xC !C C  ~D D BG.G=q@>K@K4H )`G 6tFG!/ KXdn c.>K@K4Xdکmj 6tFGRK.oM ~䒢Fo`E K@K4ϱ4˱N α <8%P_KK4A αͱ$` BM.GAK@K4s#̱[̱$۩̱.K4Q N4}ɱɱ ko4.F N@N4Nɱ۩ ](0eNN4s ̱$N`(С 6tFGeNN@x7@ 1XXGNN45ɱY˱k ̱ U$`N@N4u2 3 5EnF4GH NN4 ̱  m gS.G  @N4f`˱% ˱U ˱ ԡ.GUFN4۩ ̱5 ̱ ̱ K.G-G@N4 N N ˱·WG޲@I4Cɱ2 ̱k%ͱ < 6tFGRf66E\6\6@66 ZGR@f66E\66@66W`? 6tFGj`vЊ!x_x___Q!__yNЊЊ4``4 F P`o -n 6tFGЊ"^^ ~t^t^`,^,^ ELЊ4 ̱ ̱ȫŰ'#Њ@Њ4 s ,m`  6$O  47 U Iͱ k(t ܝ @ 46mU7ɱݩ3Uڼ 6tFG o 0lOplOpPpPp!HQpHQp3i/GM'@' 4p0ʱ {P 6tFG8] _ލ8up8up_XvpXvp ?բ.8@] 42@/c0E@/7w(<( \\ 46mUI@ݩ`5!TbD4ʴ@2r 4ɱɱ 澙LG22r2r 4mɱmɱ~ީͱK 6tFG22r m /,}y,}ym,,_ .Ï@O 4ԩdԩ  5_ 6tFG$ !oo"Q oo# oo U  ̰ 42XQ` p sV= 6tFG U  $Շ$Շ ҇҇u $}o n   4Կ&` aQɱFD 6tFGn  I\\ /xx1" 6tFGr๽Nn]] /̾]̾]]];1 6tFG"s 0p\p\b*\\3@\\P 6tFGz@ ~|\|\p\p\\\DDN  @w7N@ 7N4("`,f 0ۥy 6tFGs7N !&&h&h&I&&44 x4!a@Zҵ@ ҵ48}Q}R ,k=@[ҵ ҵ40R'ʼ$'Ķ׈ 6tFG/HҵBR@BB4`kBkB` [B [BvI 6tFGH5Gҵ0DDJ>J J<DG 7dRo@Ro45ɱͱ'ͱ z 6tFGBRo7NYS (B^Y8Ro@Ro4, 3 6tFGY8Ro\JJ'\ J\ JQ!4J4Jx$,\VeRo@Ro4M9jp ~ed6xueRoRo4@l9Ro@Ro4/ ˱;-v  6tFG_RoU ,wRo@Ro4tp`˱8ͱO* 6tFG,wRo /LL/TLTLַLLqbo 6tFGxVHRo/LLַLL1LLPO 6tFG`Ro! ~QQ  ~JJ  ~QQ2 6tFGQJERo!8P8PsGG@iRo@Ro4{ _.j iRoRo4ٯ.  0F0iRo@Ro4^8: *,J~RoRo4;ƮS ̱ Ʈ8I 6tFG!Ro5(QQQQChQhQ vXG!ARo5(QlHQ\HChQH2+ 6tFG!Ro5(QQQQCLQLQ ـG! Ro5(QwIRo/@L@LַPLPL1LL"C} 6tFGxRok`QQJ!0Q0QlQlQj 6tFG|Ro !RRRRIRR = Gx"Ro@"Ro4/ɱJͱ 6tFGx"Ro !"J"J0"J0"JI"J"J@ 6tFGX@JQ!TdTd+  ~gg ~pipi^ɯ4ʴ`#LT4ɱɱ lRG2$LT@$LT4mɱmɱ~ީͱ`^ 6tFG2$LTm , , /L,L,mإ,إ, Xr@%w4q@3f:? 6tFGRyJw""DD*"ĥ&w@&w4`pTƼ8" 6tFGĥ&w:6r`   'w@'w4/ ˱ƻ`pJɱ9 6tFG 'wT דדT ͓͓'hғhғsU 6tFGg gwT T ړړһ 6tFG`wT FFT GG  `H`H@@7"~ w@)w4L:>4T<@,Ex@tw)w4TɱTɱ@iqcLtw@*w4Cɱ87@$ $$8k "` w*w4ɱfɱT  jGpzs@+4Ikɱt(`$T s  7_ G2;+2;4IkɱMtɱR& s 5G>r@,r4$jɱU$R& s lza($w,r4zɱêɱ~Ĭɱopn 6tFGJmxxfl{l{2|| GCx-4خDخ ˱ hخ ˱Y 6tFG+y++"++",,E|t Z .45`ս@;ɱݩ ?Ԕ 6tFG$@n!K& @@ KSG@~/4Īɱ!Īɱ ˱^| 6tFGAJ5//Q!00 (( ll!0~t 4mԿsԿ Or@ @1~t 47ɱʱ mD 6tFG%< ~t (" ܚܚ- # ܚܚ~UXښXښDy@2~t 4ɱ8 о? b 6tFG p~t (" - # |š|š~U@@I> 6tFG{p~t (" $$- # ĵĵ1ӂ 6tFG@<~t !e llJ \\ -ךt i Y@4Y4;D 6tFG5fy&PP VK4G4rfdyH&PH0Gn<`$5$4 ̱ sԱsG}<$@6$45Y˱ k ̱LLDz2" #6#4[m ̱@% Dfz@7#4UɱU& 0% 7 4ԩs` 6tFG@t U B B UB B s`? ? ^D 6tFG  ~  1 ~  ~ ӣ% 6tFG=9  XK XK ' ~L L  ~TM TM mEARG=9 9 43"J`˱K9:,N <@:<4V@wVAABDGiNs:Ns4@( ̱ V ̱ .@;F4 Q#Q&QҐkt <gթ;g4c'?@<K& 6tFG;g&`@!@!(!!X!@!@! oռ.=<4Qt!QQ @=4`ȻqV`Ȼ*"߄,=4|ͱ !$W4"@>4Q>Y d[`;YG& >4թ K`xnYK./8ߴ@?ߴ4CɱuV<G~h@?4n`ʱF@@3 6tFG~h?%T"T"U""Vd"d"گ 6tFG(|=% _ G'`P P  AP 6tFG>| =%  _  G'`L L $h<Gj|BA4V V V *g 6tFGj|A%#-#-Uh(-h(-V#-#-h|g 6tFG෵Xsp p Jt t t t I 6tFG`X! s Jl l p 6tFG{Xe` Q! 7 ]~ 6tFG>iX!D D Nd@ Q! Wd4>ED)4ɱɱb 6tFG>D) !,%,%I&&.&&d`o"|OHEH4V W`LH l`!.H@FH4 K '  cGx"|@HFH4 9 ̱Q|s[[S| iH@GH4H αL α@Te+fh0GGW4ʱʱ<ʱ oC`.G@HW4`˱`˱<`˱)dyO@HW4 ` ̱V 6tFGsີhet:ن 6tFG@hetO1G?cԩ@Jc4`˱<G>jcԩJc4`˱⽒ 6tFGP? !    I!!f 6tFGz? !\u\uuuIxuxu h.Gw?@L?4 ̱ ̱{ ̱kMFG ? ?L?4"˱i)`˱p)`˱ +od\}@M4x x=ͱ$#$? 'M4`wWʱ uʱ"0(?P"(@N4`wV W$ V+.| N4 6̱0(y"@O4`wV X8 $ G?`1O143` !˱2-G>j1@P143` !˱u 6tFGر` 2 2 /22U22' 6tFG(ر`D2D2 /22U̽2̽2 6tFG) ٱ`22 /D2D2U(2(2&f 6tFG)`ٱ` 2 2 /22U22m 6tFGGٱ`t2t2 /22U22y~ 6tFG[`22 /22U22* 6tFG3= `22 /22U22YJ& 6tFG`0|20|2 /22U22^Ҟ 6tFG*)ٱ`Z2Z2 /L[2L[2U0[20[2W 6tFG`DR2DR2 /22ULS2LS28 6tFG>)`D2D2 /`C2`C2UF2F2͹ 6tFGj`h$2h$2 /#2#2Ul&2l&2 6tFGY ڱ`22 /22Up2p2;ь 6tFG`ڱ`4141 /11U11^" 6tFGڱ`11 /@1@1U$1$1d 1 6tFG*ڱ`11 /11U11p 6tFG ۱`11 /4141U11 6tFG `11 /D1D1U,1,1pG 6tFGP`۱`11 /11U11ɝ* 6tFGP۱`d1d1 /$1$1U11X[ 6tFG}۱`H#1H#1 /#1#1U#1#1t9 6tFG`\1\1 /`2`2UH1H1$j[ 6tFG}``11 /h2h2U11T 6tFG=`ܱ`11 /11U|1|1$] \ 4+> &OV 6tFGO H97 TT78 TTcC 6tFG H97 ԣUԣU78 UUc݈ 6tFGZw lޱw //`(/(/ /H/H/,}A 6tFGQ@;wοV0V0`W0W0 /W0W0jfLG~ b4 ?`˱4GR @c4 ̱  qi,`G~ c4 Q`ʱ  1.G' @d4U`˱s*`˱z*`˱ S[.Gm d4U`˱v`˱x9`˱ @ IlB* @e4#" ̱I 0 OpGV* e4?ɱɱS, xG*@f45ʱN ˱} 5u.GBf4 N N ˱\ @go4+`ʱw`ʱW' 6tFGC +W|Q@nxnxl; XxXxmxxDD*ܛ4#j@hW|40 © 0 c|^h^4DBDͱHD_T#Z+@i^4kɱ0@@(i"` iN 4 OZͱ"" 6tFG^X vkk@` x]lx]4C ׼ ׼e ׼ CG|x]@mx]4` {{6P x]mx]48@^o@no  XC] x]@nx]4P@ͱ}ͱ =n  Gf@ nx]4poM՛ 7ͱܠoox]@ox]47 ~y}`* K 6tFGox]`*pipi *iiii$ Gx]@px]4@wYʱ]ThP׮qx]px]4R& s.(I87U  6tFG׮px]K[ggZ,tgtgw" g gф 6tFGWx]@MfMfDM MfMfMfMfB#rx]@rx]4@N`˱87Urĩ`- g.w 6tFGrx]@MfMfDM MfMfKfKf,((#x]@sx]4T[/   6tFGpõx]0F LiX>i?i?i!x?ix?i5nt4zͱGͱ*`M:Fvu@u4R& sR8`  6tFGvuz. gngn9mnmnA  in inZmX  @v4D$`ݼ `   v47ͱ՛Mɱ d{l ,w@w4[`ٯFͱlR 6tFGw!mms$m$m ~L* @x4xͱͱ*`Mk2/ x42;`ս.X/@Gy蜩@y4q ̱ ̱v89 6tFGy*0<`  @"x G ũ@z45Y`ʱ`ʱW  @z@4M smƢc 6tFGF[^u1;$``'j@G_ O{O4 :F` Fǵ`!-_ @q@|q4, yɱ yŶcBa D q|q4 @/ͱ '@F@}F4a`@4,}V/48" aͱn 6tFGj/޼3pzy|G|GHGHG /GGh 6tFGX 3p HGHGU' ~GG  6tFG<]8sGG ~GGGGjR 6tFGPAP'kA+@@4( ̱Kk>[S 6tFG?Y@^2P#  L!@4& \ʱ4`ɱ$ D 4& ɱ ɱ$ H H@ @4& NɱƩɱ JGsf~E~@H 6tFGb?|E|E*eDDDD2JGY@@B4 % ̱ B ̱#E, ;Z`BB42+ͱ. ̱ ${ >tB@B4$еh4ѵ 0 -eT0 G@BB4`˱>ͱ. ̱zʜ 6tFG @cB#::=д 6tFGeZU !,,H0`--& UU e 6tFGzZ8` UjjL  zZzZ4=1ɱ $r 0@48Fݫ@ {R; V@4 ɱ챬ɱɱ U @4 ɱ챬ɱɱŸ G4ɱ ̱ ̱ 0A ~@4"ɱɱX ɱ lp Gb4ǁ`ͱL[ ̱M`ͱ ;~ Gk@4䁬`ͱa[ ̱M`ͱ:? G'@4Ҫ tԵ@ ?@4ɱ0ɱpɱ ެ.G@4?Ӫ ̱b ̱t ̱VtI b@4Ųɱ ̱pɱ O.QC41@3@31@34 :2@4άɱ7ݫɱɱ$~8 A@4άɱmɱɱ ` @4uɱ챬ɱɱ>4_ _4kQɱ-aɱyɱQ @@4êɱ~Ĭɱ$@3Ռ 4ɱɱɱb5* zD@@4lYɱYɱ~άɱA4ά@Q@ qԪӭr{ @ @4i qԪӭ) 6tFGP`c^&`XQvXQvQ!LvLv-  J`K@?t47ɱ(`9 ] 6tFGWǗTR@^_KY 6tFG/HǗBR@rr`HHU^  4wAժ@ C{.@4G> B0.(4`~G`~>`~ N.N @4G> j.t`4G>O 6tFG 1"",","Ț"Ț"@i$ G4#˱g˱X:ͱ  y0}K @4/ s) r3Z.G'_ 4  αf ̱ ̱BP1G! Q@ Q4ͱ^ͱɩͱ+ԑ 6tFG_fZTZTEZTZT@\T\T 7G_fZTSEZTS@\TS'8[ 6tFG, < @WW /WWb*@V@V a֏` n5@&@4]ͱhͱ\ɱ uM\ h &4ɱ!|EOx5@3@4Pͱu `:t 6tFGlMf [ [E[[@D[D[ ^GlM|f [hO[E[P[@D[xO[ 6W.G< )ת4w" ̱[ ̱pA ̱pj 6tFG5`iMy^x' XOG@,ת4pDw" ̱ Yui/*+ @J4 B @); J4  3)N @J4 E ̱G!ڔ{ 6tFGJX! W`gu`gu+t+t /tt9 6tFG@cxzvxzv7\xv\xvzvzv" c/ "^cc4 Ea`Q@ ٷX2 6tFG^czvzv7zvzvzvzvTT+|% .z.z4}0`@LXn 6tFGGI z ezzbJzz /zz 2 6tFG7`I z e0z0zbJ̻z̻z /xzxzeA 6tFG`J z ezzbJإzإz /zz; 6tFGWD-K-H`4G9@@# 4˱˱˱F2 6tFGdHE&`\_\_fL]_L]_ /]_]_  GdH`ʱE&`\_G_fL]_G_ /]_G_gM 6tFGB9ME`%g_g_%@h_@h_U%h_h_j\R 6tFG @NE /\_\_a{G 6tFG@wE&`^_^_f____ /t`_t`_D 3]q@]q4x5ɱϩɱ  6tFGdx]q ly`y`(lz`z` /|`|`F* L!"]q@]q4V`!ͱf $ 6tFG-*NbPܤ`ܤ``O`` /x`x`Jr 6tFGp`b !``М`М`.\`\`Β2  b47ͱ՛ɱ {X;4G` @b4poM՛ ۤ5 6tFGgd޷b< ``8`3L`L`fa |`|`1  b@b4٪`ʱͱҀѾ$$1"qH4ϩ[# w'9 6tFGO{a y(lblbO`nbb|s bbV 6tFGq௻a `'ԂbԂb}p(b(b' ~ b bK 4G({a@a 4f[I| ̱ d&EG`ű4#`u@$ͱ%{ FGű@4#}*y$ͱ 6tFGGDG ,9d,9dDG 9d9d%G <:d<:do@N@4 +^SJ 6tFGn: c ccDG cc xcxc q28Gű@4w@&V,@w S% 6tFGDG ccnXcXcq`I ccl 6tFGKAc `d`dXR@t ZdZdT d H^dH^du 6tFGK@A` lkdlkdT` PidPid~`Hf::E$:$:@::fiG)%`H4N % ̱ B ̱ =.&<`!.@¹.47QGQ,,?%ng¹g47~ (((Px%`g@ùg47Q GQ$00a1V%|@gùg47 `,R 6tFG!gX!|TWTWD*@8:8:7.UUB2/`"gĹg47ٽ-P-Pl 6tFGN`,eRR1RR ~ 6tFGS`# R R1RR ~ oqdGW_^@ƹ^4o ̱], ̱ ͱ bi ƹc4N`Oɱ  6tFGN<cFUUUUܻUܻUK_ 6tFG"P]&bC Y@ҹY4]u 0/44yH,&7kҹY4EO ia 44= @0&g @ӹY4 ර g0 HL!8 YӹY4^u 0/@ 6tFGh@>YTT % /ll[c 6tFG*>Y  %  /88OA- 6tFGl`dOEO7O((9'>~ 6tFGO dz,,EO@7 7ڮ 6tFGId"a\ 6tFG ?`d l ;; m \<\<&==$ uT& d@׹d4`ؽ`G@T) tp,P `d׹d42.`S9.@T EH?d@عd4`G@Tsc|c]uLl dعd4|sc |c[r" 6tFG4n๻dM ~J! ~hh //q 6tFGtºd !MPP.͠ 6tFGNd[`J! ~Ύ 6tFG@Ql p;p; /`<`<ww 6tFGVQ6 /i G' ۹4E ̱ < ̱$2~j '@ W@ܹW4 lc -.G^`ܹW4% ̱ ̱f ̱ 6tFGݹAX!ȝȝD*@ɝɝ7.ʝʝ  G`ʱAX!ȝD*@ɝ,7.ʝ 6tFGn&޹GeX!XXD*@XœXœ7.ÜÜ /Gn&`ʱGeX!X@YD*@XœX7.ÜX (  HG̖Ȗ@߹} 4@ @ > 6tFG̖߹} H`o o`=`dd W4(HGi.@o 4@  3 6tFGio H`o T1T1o`P3P3=`44 N5N0HGig@ p 4@ @ W 6tFGi p H`o yyo`{{=`|| 6tFGyjົ X!oA=Ahh_6 AGll4x..8p 6tFGl aa aa ~`` T:@?@x66 4Ą 7`%L 6tFGyjȖ H`o TҟTҟo`=`ǟǟ (ʝ HGyjȖȖ 4@ @ h 6tFGyj. H`o o`=`DD eSH(HGyj.. 4@  U* 6tFGyjg H`o hahao`=`VV B| 0HGyjgg 4@ @  6tFGyj` X!oE=E  CD9cԩ@c4ٰ` αb*struct { F uintptr; X0 *http.http2addConnCall; X1 *http.http2Transport; X2 string; X3 *tls.Conn }mn 6tFGRop$j08* `璯4u !`MT˱; 6tFGS`ѺHLyLy`yy`yy$\g0璯4u !T˱Z ]ӳ ] 4 @:é?{u  ]ӳ] 4 :é?$NFaGxb]ӳ ] 4VMӺի ̱B >]ӳ] 4$:é@̀u Q ]ӳ ] 4$:é@$HG,]ӳ] 4VMԺի ̱b*func(*qerr.ApplicationError, protocol.ByteCount, protocol.Version) (*quic.coalescedPacket, error)b*map.bucket[protocol.StreamNum]quic.incomingStreamEntry[github.com/apernet/quic-go.receiveStreamI]p 6tFG @պ @8k8k8k8k8k8kDD x#4 @l` 4@պ ̱<@Wf| @A@A 4`9 ̱DD$gk< x#4 ` 4׺ ̱<@0?@ G(@ d4n˱W@wS@b*func(context.Context, *govultr.BareMetalCreate) (*govultr.BareMetalServer, *http.Response, error)b*func(context.Context, *govultr.BlockStorageCreate) (*govultr.BlockStorage, *http.Response, error)b*func(context.Context, string, *govultr.DatabaseVersionUpgradeReq) (string, *http.Response, error)b*func(context.Context, *govultr.ListOptions) ([]govultr.ISO, *govultr.Meta, *http.Response, error)b*func(context.Context, *govultr.ReservedIPConvertReq) (*govultr.ReservedIP, *http.Response, error)b*func(context.Context, *govultr.ListOptions) ([]govultr.VPC, *govultr.Meta, *http.Response, error)b*struct { F uintptr; X0 protoreflect.FieldDescriptor; X1 protoreflect.Map; X2 proto.mergeOptions }IGU;cԩc4` αb*struct { F uintptr; X0 func(impl.pointer) (impl.pointer, *impl.coderFieldInfo); X1 reflect.Type }b*struct { F uintptr; X0 prototext.encoder; X1 string; X2 *error; X3 protoreflect.FieldDescriptor }c*map.bucket[*pflag.Flag]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)c*quic.incomingStreamsMap[go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446]c*func(protocol.StreamNum) go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446c*quic.outgoingStreamsMap[go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446]c*quic.outgoingStreamsMap[go.shape.87e097673d66065977bf56ddb90476ff1df6fc654105bae45be323a5e117aaf8]c*func(protocol.StreamNum) go.shape.87e097673d66065977bf56ddb90476ff1df6fc654105bae45be323a5e117aaf8c*func(context.Context, *oauth2.DeviceAuthResponse, ...oauth2.AuthCodeOption) (*oauth2.Token, error)c*func(context.Context, string, *govultr.DatabaseForkReq) (*govultr.Database, *http.Response, error)c*func(context.Context, *govultr.ListOptions) ([]govultr.User, *govultr.Meta, *http.Response, error)c*func(context.Context, *govultr.ListOptions) ([]govultr.VPC2, *govultr.Meta, *http.Response, error)c*struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }c*struct { F uintptr; X0 *sync.Once; X1 protoreflect.FieldDescriptor; X2 *protoreflect.MessageType }d*cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]d*func(protocol.EncryptionLevel, protocol.ByteCount, protocol.Version) (*quic.coalescedPacket, error)d*quic.incomingStreamEntry[go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446]d*struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }e*struct { F uintptr; X0 *http.http2clientStream; X1 *http.Request; X2 func(*http.http2clientStream) }e*struct { AutoAdded bool "json:\"auto_added,omitempty\""; Source string "json:\"source,omitempty\"" }e*func(context.Context, *govultr.ListOptions) ([]govultr.Backup, *govultr.Meta, *http.Response, error)e*func(context.Context, string, *govultr.DatabaseUpdateReq) (*govultr.Database, *http.Response, error)e*func(context.Context, *govultr.ListOptions) ([]govultr.Domain, *govultr.Meta, *http.Response, error)e*func(context.Context, string, *govultr.InstanceUpdateReq) (*govultr.Instance, *http.Response, error)e*func(context.Context, *govultr.ListOptions) ([]govultr.Region, *govultr.Meta, *http.Response, error)e*func(context.Context, *govultr.ListOptions) ([]govultr.SSHKey, *govultr.Meta, *http.Response, error) 0D|:@@8 (Zթ7ɱ !/. ^GZ@> C@ C(0ɱVf LG`?  (ɱ/ɱ !le&%ɜF1@Kǫ@ 8% !% G G L ǫ (Cɱeɱ !HI\[F3R@ 8/& PQ!@ )cFuZҵ ҵ8 nq  S|t m 5@ 5(F`R` 98rFK7aRo Ro8sV }'2F@cRo@ Ro8 *  ~o@K ?ee  v Ro Ro( ̱aɱ !0RNaM~Fֺ@kRo@Ro8!sgK   kx | Ro(39@/ɱ !Qt|I g8Gh; @(1ɱSɱ !ĉsc{]/G < ~t (mͱsͱ !hϛh߬@Fw@ 8f@2 ؄u@;  / @2Yѣ5G6 ɱɱUF z` X*X*8/`O l+l+FHBB8Nt7NC/ Ew" P `P m5< GeZU@U(/ɱ+ ɶ& UTF8> 8`   @[ .{F@8>@[ 8 [ @ @ $F \8>^ 8 @^  @ 빗!FV@8>@` 8 ` @ @` V|^F3%@8>b $J@b 8 b  ͢hF@@8>b 8 c  @ #H͏F98>@c 8 c @ @ pzF @8>c 8 d  @@ \F\8>@d 8 d  @` fFuǗ@Ǘ8 nq  S=YF0JJ8H97@X!U5 /3Fx@0J@J8H97@X! V /U61GMF۷: z z 8 "``E` afO`DFE; z@ z 8PEb2b cfO`ӌ UFGN| b(qaf`''b`xF @Ja@a 8y@G O b |  61#,0G^; +(ɱ!ɱzylVm8RmeZF@[#@ #8X!D*@;@7.`) %@ ( %@b-ɱ ~ t!- @!(Y@8 ~S3KFO&@`]&!]&8@3C`-3h4f*func(netip.addrDetail, weak.Pointer[net/netip.addrDetail]) (weak.Pointer[net/netip.addrDetail], bool)f*func(*tls.Config, *tls.clientHelloMsg, *x509.Certificate) ([]uint8, *tls.clientKeyExchangeMsg, error)f*struct { F uintptr; X0 chan struct {}; X1 *error; X2 *http.Request; X3 net.Conn; X4 **http.Response }f*func(string, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]) boolf*struct { F uintptr; X0 *outbounds.dohResolver; X1 *outbounds.AddrEx; X2 chan outbounds.lookupResult }f*[]quic.incomingStreamEntry[go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446]f*struct { F uintptr; X0 chan struct {}; X1 *http.Request; X2 *http3.requestStream; X3 chan struct {} }f*[]struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }f*func(context.Context, *govultr.ListOptions) ([]govultr.History, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Invoice, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Cluster, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Network, *govultr.Meta, *http.Response, error)f*func(string, string, string, map[string]*parse.Tree, ...map[string]interface {}) (*parse.Tree, error)g*func(time.Duration, func()) interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool }g*struct { F uintptr; X0 *http.Client; X1 map[string][]*http.Cookie; X2 http.Header; X3 **http.Request }g*struct { F uintptr; X0 *outbounds.directOutbound; X1 net.IP; X2 uint16; X3 chan outbounds.dialResult }g*cache.LruCache[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]g*[8]quic.incomingStreamEntry[go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446]g*[8]struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }g*func(context.Context, string, *govultr.DomainRecordReq) (*govultr.DomainRecord, *http.Response, error)g*func(context.Context, string, *govultr.FirewallRuleReq) (*govultr.FirewallRule, *http.Response, error)g*func(context.Context, *govultr.ListOptions) ([]govultr.Instance, *govultr.Meta, *http.Response, error)g*func(context.Context, *govultr.ListOptions) ([]govultr.Snapshot, *govultr.Meta, *http.Response, error)g*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 bool; X3 protoreflect.FieldDescriptor }h*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest; X2 *http.http2writeData }h*func(string) (acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound], bool)h*bbr.packetNumberIndexedQueue[go.shape.902903003faf34a055924cbe1de57446bb60c6dcbdda00962fff07e2be322cb9]h*func([]ackhandler.Frame, protocol.ByteCount, protocol.Version) ([]ackhandler.Frame, protocol.ByteCount)h*map.bucket[protocol.StreamNum]go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446h*map.bucket[protocol.StreamNum]go.shape.87e097673d66065977bf56ddb90476ff1df6fc654105bae45be323a5e117aaf8h*func(context.Context, *govultr.ListOptions) ([]govultr.PublicISO, *govultr.Meta, *http.Response, error)h*func(context.Context, string, *govultr.ForwardingRule) (*govultr.ForwardingRule, *http.Response, error)h*struct { F uintptr; X0 net.Addr; X1 net.Addr; X2 func(*tls.ClientHelloInfo) (*tls.Certificate, error) }i*struct { F uintptr; X0 <-chan struct {}; X1 func(); X2 *time.Timer; X3 *atomic.Bool; X4 chan struct {} }i*func(context.Context, *govultr.ContainerRegistryReq) (*govultr.ContainerRegistry, *http.Response, error)i*func(context.Context, string, *govultr.DatabaseAddReplicaReq) (*govultr.Database, *http.Response, error)i*func(context.Context, string, *govultr.DatabaseDBCreateReq) (*govultr.DatabaseDB, *http.Response, error)i*func(context.Context, *govultr.DBListOptions) ([]govultr.Database, *govultr.Meta, *http.Response, error)i*func(context.Context, *govultr.ListOptions) ([]govultr.ReservedIP, *govultr.Meta, *http.Response, error)i*func(context.Context, string, *govultr.ReservedIPUpdateReq) (*govultr.ReservedIP, *http.Response, error)i*func(net.Addr, protocol.ArbitraryLenConnectionID, protocol.ArbitraryLenConnectionID, []protocol.Version)i*func([]uint8, []uint8, time.Time, protocol.PacketNumber, protocol.KeyPhaseBit, []uint8) ([]uint8, error){6yFt 3 !|/../ؕ.X5F@ 408  ^ܰ]Q! ^L ^]9tFG Ro4Ro @t!LLs{L{LF }F Ro5Ro QL QL(vHtFG!H Ro5Rotp`˱/PQLַQLjtFGW` 6Ropo`˱/QLַ Qɩ1|l44\44Ux54h54`o|FGhEYTz~ % z~ /l,z~I|FG* FY $~ % ~ /88~SUtFGĨ ?`˱@Ye5e /Ze5e5tFG? @@`Se,#e /Te0$e(tFGe@ @x`˱@_eEe /x`e@Ee`GG A@dWe,2e /XeT2etFG A`˱@Qe!e /xRe"e4,Ll-{Amͱ; U Ξ( !pB ̱=` ɱɱj*func(*concurrent.node[*internal/abi.Type,interface {}]) *concurrent.node[*internal/abi.Type,interface {}]W4 PC ̱1/@3 `#x|5C ̱ ^ U @WoLy .PD ̱ U@ ^Ws D ̱=7 @@d'PE ̱`9 `ή !1E ̱/`| @VCxdPF ̱xɱ 7@FF ̱`?`6n uSځ! PG ̱=Ż @@j*func() (string, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound], bool)]"(0H ̱Կʱ߯sU'T/H ̱ ̱  αB:x0I ̱`@ɱ j*map[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]*list.Element[go.shape.*uint8]40?@#6J ̱Ż@i@"@^ J ̱1ɱͱJ CountryCode^protobuf:"bytes,1,opt,name=country_code,json=countryCode,proto3" json:"country_code,omitempty"j*bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]0X$K ̱@nۿ @j*func(context.Context, *govultr.ListOptions) ([]govultr.Application, *govultr.Meta, *http.Response, error)j*func(context.Context, string, *govultr.BareMetalUpdate) (*govultr.BareMetalServer, *http.Response, error)|`$_תPMR̩`=@- @-@-,|( M ̱1 ̱   ɾ PN ̱aa ̱  ̱` N ̱1/ H8kph&PO ̱ ͱDLLɱl&0O ̱ @TDHH`_@ ɱ@/ɱͱXԩ_@0/}Hͱ&]#``@@p/`n `xnYK, ?*$`@H ̱QXKhXm+!A'`a@P`xp0`x0 ̱` ̱dxpFY@'*a*@s e ~! :!gF4+)C`bC@I /p0eIlGJm*bC@0ͱ@f@ " ̱(f-GF`C`cC@GJ@@b Hש ɱ$ ]|Y`3CcC@k9ɱ0ͱ Ƭu0(^ਮLnZC`dC@1"8f ?`kJ $r!$GBf@,dC@0ɱʱLfʱ 0ʱ !l@`,C`eC@~fͱiͱcשxxsGh["CeC@81 JɱdJɱlL@t#~[`f@`1ɱCɱȻ  ȫF,x f@ɱɱɱ .s @ `g@ s ̱  ̱uX.G7KgK@#EP٩̱]٩̱ ẖ4G.C8K`hK@`˱w٩`˱˱٩˱59xG8KhK@82ʱ`ʱ=z.G;K`iK@5i`ϱ. ̱ 3 ̱h2FG1=KiK@ j̱`˱p ˱"$̱ Q/G1D K`jK@k˱˱ک˱˱4/GC@KjK@̱2˱4˱ [˱mlFq~ K`kK@j $k .k ]/ɱ t\֣  F KkK@mN`X4̱ `4 &,YE tFG]N !|PtIԄ %c.G%rClN@5ʱʱ`˱5`˱_.GV2@D`mN@5ʱʱ @w4x4G' I NmN@ ̱5`˱}t ò#?DH`nN@`˱`˱5 ۩ͱ LGZIn@˱w"`ʱr%ͱ y%ͱ TP0GJ`o@"ͱ5ͱDͱcͱhuJ]oDG ==@/y0 ̱V ̱ @$"vt T@ =`=@Sy%V ̱ $C"(|@==@Sy ̱@ _$g">|A=`=@Sy ̱@ _$"a==@Sy ̱@ _\mp<Gn`@5`t ̱P˱T\xFG{CXe` ̱ wz[E,$#w@ɱ%ɱ!@I`uɱ Q!Ae*`e*@/ ̱  ?.G@@5ʱʱ`˱5`˱)"&.G@`@5ʱʱ @w8vӾN4GV @}5`˱?`˱ Q4)x4G1R `@ ̱5`˱}`TGQ@ @`˱`˱F"`ʱQ F_dG`@5ʱ? Q`ʱ 80{h;@pR @ʱ7ɱz.G`@5ʱv`ʱ#" ʱְ$|G@ @N ̱`˱`˱f }G@@`@ʱY`˱`˱`˱ ү)G @ř`˱Й`˱J`˱ @7|FG@`@3ʱ`ʱ`ʱh`˱.MiFGj*@v`˱'`˱ ?`˱(?`˱ yFRW|`W|@!7 +7 ; >; %Kvn+N @U߱!ɱ* * )s54+@횳` @" úؚ ˱+C 44횳 @" úؚ ˱+C@#MF7x]`x]@]!OpoQ![Fnx]x]@!*vCQ! FDx]`x]@!`,oN ]:T G` @o٫˱uͱ Ϫͱ fq#. `@[= cp dJ`蜩@N{[˱Z ʱչJ ` @*ʱ*!`ʱo ̱PF #dF nqnq@ ö öd!  gfdM ^u`^u@ @ǵ\ fRʱՌJ V/@5Ż8Aͱ>\ͱ j@ LIHG@3p`3p@(gb\`ʱ`ʱ" @3p3p@îũ˱ 0/ N(hj"X~3p`3p@$o`˱Y`˱ r`˱$K` K @ɱ"Ʃɱ}\ɱͱLL4!$$g@`@G`xy0G<QHf,)Y@C`xT\K7 ,< $#v `@3ɱɱvƩ^($M5 ,$y@࠺@& `ʱ ɱɱ ( b"#`@& <`˱F"ʱ`,(r@ ࡺ@& 'ɱ8zɱBzɱ$,$)e,$= `@& Lfʱ ɱ ($y@ ,$1]ࢺ@& ǩʱ ɱAɱ / L!$`@& `ʱU`ʱɱ |] L!<{@)ࣺ@& Lfʱ0ʱ20ɱD @=! zZ`zZ@`( sV@2@1ߛP C@ऺzZ@^ɱ%Iɱ{ɱ|V)x f`@ ̱êɱҪɱ ɱѰ 4pIॺ@7ݫɱ]ɱm ̱Yɱ,~ `@xɱ ̱]ɱ ɱf *঺@êɱІͱxɱ %êɱ@4 w $[q`@["ݫ ՛00(Z L"৺@SF F$LF ȳ`@"ɱ'"ɱX ɱñHH $b@਺@DzɱͬɱEɱͬ` q&( `@]ɱYɱHbɱdbɱAt f0 `੺@Xɱ|ɱ,bɱPY ̱ZEFlF;`@2``E`` !^h c઺@wɱ|c1#1 $ ̱ SQDp 2`@ ɱêɱ~Ĭɱ>άɱ t Iૺ@ ɱ)ɱ"1ɱDzɱ^U $`@xdɱY ̱sɱ ìɱzr r\଺@xɱ~Ĭɱ)Dɱx ̱  ܳ`@ ̱xɱ#ɱ ɱ 5* ɢ୺@ ɱêɱŴɱ)ɱ6n `@xɱ~Ĭɱ)Dɱx ̱X Gu@஺?t@0ɱʱLfʱ 0ʱ $$gBL Lt Ǘ`Ǘ@3û0 Hʱ=@8k2%'` Ǘ௺Ǘ@``ʱ$(K4PHa %vǗ`Ǘ@Hʱ8ʱ^|Dg&FǗ఺Ǘ@%̎J! ~Q!ӔzF`@?` ^ ̱+`̱ ` \8F! Q౺ Q@`| /U ,J`3kZd G|,ת`@R~ͱ\~ͱ ̱  .಺@֢@i̩>ᢩ ̱6`")>y `J@ ʱ Dʱ)8$*N ೺J@ ɱsت =O BFG?` z <@]zybJzyz@y64z8yp:}GഺW@E ̱ < ̱=- ̱ j~/G@?]ӳ`] @^éjé@( $ GCൺH@ժ@w$` x !kt GZE`H@poM68Wͱ8J Gk යb@n˱P˱W@wS@%, Fk `b@9ͱ՛˱Ф˱ 1#ɱX,M7 $@G෺b@m s W@w0S@E Ql*mz`mz @Z:+tpMt@||eͱ \Gűฺ@w@&VQ ,@w @`@ ̱NԿ5Կb ̱'FtFGx%*lL-lO@xl(&l @,l'l /ll"lRʷGQ`@(gKb\`ʱ`ʱ\>.@ ~຺~@ ̱3x-Lց`˱aǒ1Gr;`~`~@W - ̱ - ̱ͱ؊?%໺H@ `˱`˱{  CASFpdd@5`@ Kf V ͘ G2?d`ºd@Y !a2xFGtºd !MP0.@c"Gn?rd`úd@Y !aJrFGU'`@ /&Al 7 BT /8C HFGZ`(`=\/&>(7 `? /@t:lFG(`(D\/& EL7 E /4F((9&'V %`ź% @(' ($$((gj@&@!0oź0o @(' `$)p=. e`ƺe@L sXrcc IN8H"gn/|\|ƺ| @,߹@>@(Ht e/|o`Ǻo @`-@>@(HE/|@oǺo @-@>@(dtFG*)y & SS8S4S&T SdS / S$S( Ig5W@6Ⱥ6 @)DɱpH $ͱ& Fyqe`ɺqe@)Dv@Dx<` ^dDD4(9gOl%./qeɺqe@\5S$A ̱0V\ 5B`ʺB@Xdu  !  r`HpI)`7BʺB@XduB !@.?.e `B`˺B@`Xdu ! ɪA=`B˺B@Xdu !@.lFHʯ`̺H@ ! n*struct { F uintptr; X0 bool; X1 *certmagic.Config; X2 context.Context; X3 string; X4 *certmagic.Certificate }n*func(string, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]) (bool, bool)p_)=ͺ@o ̱,(`(U f@κ@o ̱,߮( )U 2" κ@d`c'  _V@rs"" @Ϻ@dc'  _VaK"W Ϻ@dযc'  _V.Ӷ" @@к@d c'  _Vn*struct { F uintptr; X0 *interface {}; X1 *bool; X2 *go.shape.bool; X3 *func() go.shape.bool; X4 *[3]uintptr }n*struct { F uintptr; X0 *sync.Once; X1 func(); X2 *bool; X3 *interface {}; X4 *go.shape.bool; X5 *[3]uintptr }4(FlFSHʯѺH@!` bFlF^ Hʯ ҺH@  !  ResourceHashaprotobuf:"bytes,3,opt,name=resource_hash,json=resourceHash,proto3" json:"resource_hash,omitempty" ResourceHashaprotobuf:"bytes,4,opt,name=resource_hash,json=resourceHash,proto3" json:"resource_hash,omitempty"dӣG1]ӳӺ] @US ̱ Z ̱ͱRL bG)D]ӳԺ] @US ̱ Z ̱ͱ /GH@]ӳԺd@^éjé@( )GX]]ӳպ] @U@S ̱ Z ̱ͱ< 53  պ @@l!k DL $ @Aֺ@A @!x$0@ ʱ4G* Bֺ @US ̱ Z ̱ͱ"Gc B׺ @US ̱ Z ̱ͱuw{3G=O@w@w@w@wK@j@]ͱEU@N%< w8  غ @   ! !D $w6 @Aغ@A @!  $ 0@ ʱn*func(context.Context, *govultr.ListOptions) ([]govultr.BareMetalServer, *govultr.Meta, *http.Response, error)n*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPCInfo, *govultr.Meta, *http.Response, error)o*struct { F uintptr; X0 <-chan struct {}; X1 *net.netFD; X2 chan error; X3 context.Context; X4 chan struct {} }o*[16]atomic.Pointer[internal/concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]] InverseMatchbprotobuf:"varint,3,opt,name=inverse_match,json=inverseMatch,proto3" json:"inverse_match,omitempty"o*func(*list.Element[github.com/apernet/quic-go.newConnID], *list.Element[github.com/apernet/quic-go.newConnID])o*map[string]struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }o*func(context.Context, int, *govultr.ListOptions) ([]govultr.InvoiceItem, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.DatabaseListAlertsReq) ([]govultr.DatabaseAlert, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPC2Info, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.NodePool, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPC2Node, *govultr.Meta, *http.Response, error)p*func(*concurrent.node[*internal/abi.Type,interface {}], *concurrent.node[*internal/abi.Type,interface {}]) boolp*func(*tls.Config, *tls.clientHelloMsg, *tls.serverHelloMsg, *x509.Certificate, *tls.serverKeyExchangeMsg) errorp*struct { F uintptr; X0 *singleflight.Group; X1 *singleflight.call; X2 string; X3 func() (interface {}, error) }p*func(bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket])p*func(context.Context, *govultr.ListOptions) ([]govultr.ContainerRegistry, *govultr.Meta, *http.Response, error)q*func(*tls.Config, *tls.Certificate, *tls.clientHelloMsg, *tls.serverHelloMsg) (*tls.serverKeyExchangeMsg, error)q*struct { F uintptr; X0 *httptrace.ClientTrace; X1 *tls.Conn; X2 context.Context; X3 *time.Timer; X4 chan error }q*map.bucket[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]*list.Element[go.shape.*uint8]q*func() bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]q*func(time.Time, []uint8) (protocol.PacketNumber, protocol.PacketNumberLen, protocol.KeyPhaseBit, []uint8, error)q*func(ackhandler.Frame, protocol.ByteCount, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)q*func(context.Context, *govultr.DBPlanListOptions) ([]govultr.DatabasePlan, *govultr.Meta, *http.Response, error)q*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.Converter; X3 protoreflect.FieldDescriptor }0= 6tFGW0d@ťťuåå:dvl˥l˥@4ʥ4ʥ0yo 6tFGO`WvDDVvDDX{ 6tFGt0dv:dvw9o9 ԩ4=Id !/. GХ`9 4=@/ȱH/ɱ !/.h 6tFG*!`@M> 6tFG `pC !h*h*m*m*Ik*k*.th*th*W 6tFGB8Cf , ,'`",",#,#,!@** 6tFG+C !\v*\v*w*w*Iw*w*.@v*@v*z 6tFGF cC0 X&(X&( ,(,(%(%($&($&('P 6tFGlC !Xr*Xr*r*r*r*r*Itr*tr*g~(d> CC40ͱ0ɱ0ɱ m@@\|? C C48࿽ 1ɱ0["8 !.E$7 6tFGćC" ~**np*p*g**u**lP?  4ɱ/ɱ0ɱ !P]&F% 6tFGKKCīī00z#C 6tFGK#3$$"#xxݫQ 6tFGn\@K" L- 6tFG:K7 ~!!E ! !# ~d$d$?G 6tFGCKڰ"Go$4q tFGK.N ~ U8 6tFGNN@x7@ $ً ~9h, 6tFG] lN !I"2% 6tFGӎӽll16x%P@M Њ Њ4Bk ̱u  !  t_t^ !y: 6tFG`TЊD&+gv 6tFG#Њ9^^E^^ h^h^Pܬ^ܬ^'v 6tFG = K&HoHoPoo o o%8o8oEK> 6tFG\\ _xrxrrrPrrrruܹ 6tFGz@r 2 IyIy^m8ay8ay F SySyK&cycyW 6tFGʴ2r  !HdyHdyhfyhfyIdeydey.,dy,dyy4 6tFGm෼ A yy` vvRu 4Q@F%6P]]*[ 6tFG`ƻ7Nfp&p&'`(&(&&&!@,&,& 6tFG{)7Nf&&'`X&X&l&l&!@&&<<7< x7N7N4(u,M ~8f&&.:}/f ҵ4ɱ?`5Ż ! DD? 6tFGH`ҵ !n?n? 6tFG$ ȼM@ ঙঙ؄u44uQ 6tFGA\85119 **Q!33 33  6tFG;~t (" <<- # ??3//?U88YK 6tFGo~t !@L@Le ,E,EJ FFy ~CCt 6tFGSK~t (" x"x"- # **ה``DD 6tFGNgX!|$|$;@~$~$`l$l$`) $$ 8:GN``ʱgX!|$b$;@~$a$`l$\c$`) $Xd$ѓr 6tFG`=N`l$l$ /%%1=%%lY 6tFGh %--U8!-8!-V--`T-T-| 6tFG`{H LLJ!`@@!  + 6tFG&(Nh!84 ' '2 ' 'e& 6tFG>c>X@ p p l l .!`l l @ln ln lI 6tFG} c>X* b b @b @b .!`b `b |b |b  6tFG9P- u'u'=+ x'x'j ''=|}'|}']Bz. 6tFG?1;@ 6tFG| ߱w //ο//`// ///!,l 6tFG0`-r`-r'-r-r.r.r!\/r\/r 6tFG`W|x<< wwHwHw`wwMww  4B N 4ɱmԿsԿ /h f 6tFG>lx]w(ggC )tgtg$(tgtgeE LgLgW 6tFGx]9`|g|g9[ ~0g0gx gg ~ggO 6tFG`Vx] !RkRkRkRkISkSk.TkTkKFh 6tFGGWɻx] !TGkTGkGkGkIhHkhHk.HkHkWe 6tFG!mmsԣmԣmpomm}mm 6tFG. !JoJos@Ko@KopoKoKo}/ 6tFGCXƵ*0<`hh!_ 6tFGkŽ'~_!sttJ! ~Q!зз  G  4ɱɱͱ' `HHB# 6tFG^` ~HHQdGdGy `H`HB GU` '۫'4yɱĝ ̱+ ̱ Y XG`'fHآE̴@䶉袉k@ХF( 6tFGq`ǽ'\\nglZ 6tFGr࠷A\\o\ٍ\ٍ1Az 6tFGPZ`U'66 !55H0`66.66@v# 6tFG@ܵbW xx@  HH 44j3D 6tFG ((8   44fܶx4!>v Ǘ4B}^}^ B.44ֲJex4!a ǗǗ48}Q}R h| \AX.. 6tFGu̻Ǘ6 6 @  89 6tFG਻Ǘ6 6 @  >.v` Q  Q4|` ( H|-4-4 .v  Q Q4|` ( H|.4.4 X /@ 4. ̱pɱ /l"Ul 6tFG઻ !VVعVعV|VV /VV˕8 6tFGXDWW @WW /8W8Wb*LVLVPR 6tFGM`qXDxWxW @WW /WWb*VV, 6tFGZb`λJ+!%:e 6tFG? z <@]zzbJzzzz64z4z= 6tFG] # ~D_D_@0_0_@__@@j__X¾: 6tFGT` b !@`@`\`\`0`0`I ` `GC 6tFGw b !x`x```h`h`IX`X`ҩ 6tFG,Jb !t`t`0`0`̤`̤`I``p"b 6tFG4 ۷b< T`T`8`3``f n|`|`9 <`<`d.E! 6tFGDG >7 `?`? /@@B 6tFGĺ`(D(D/& E E7 EE /4F4Fk 6tFGV_!A\\s܍܍J! ~Q!44qS( 6tFGV_!AԇԇsTTJ! ~Q!J 6tFG~@_!ALLs̄̄J! ~Q!$$\ 6tFG Ⱥ)y & S S8SS&T ST S / S S%o# 6tFG2f)y%@!S!S6@"S"SbJ0S0S /#S#SN 6tFGNH0TR\ yO BR ~O 6tFGm)`н_!BqqsssJ! ~xrxrQ!4q4q. 6tFG\} =X!o`=`&Y 6tFG@o =t2t2X!@55o`(4(4=``5`5' 6tFG p =8z8zX!}}o`{{=`$}$} 6tFG:`Ȗ =ΟΟX!o`=`ƟƟmĻ 6tFG:. =ppX!o`=`DDq~4 6tFG: g =]]X!o`=`UU9; 6tFG.ɺqe.%%## /p&p&EI 6tFG h >X@.!LLxi 6tFG3h >X@.!@@@@xh# 6tFGY@h >X((.!``xLL$2 6tFGUc>X.!& 6tFGoc>X``@.!xx@y\И 6tFGc>X$7$7d&7d&7.!%7%7y\%7\%7Ӎn% 6tFGzc>X.!@< 6tFG(c>Xxx.! `ppV 6tFG^Fc>X  `  .!( (   r*func(*concurrent.entry[*internal/abi.Type,interface {}], *concurrent.entry[*internal/abi.Type,interface {}]) bool< 6tFGJ c>Xh;%h;%=%=%.!<%<%;%;%. 6tFG ʺB~"g1W 6tFG c>X9%9% H;%H;%.!`:%:% @:%@:%-f 6tFGbWc>X&& 4&4&.!`&&,&,&$ 6tFGI)ʺB~" g10F 6tFGSc>X&&|&|&.!&&`t&t&)d 6tFGDFqL&i 6tFGc>X (>Q(>Q@?Q?Q.!@?Q@?Q>Q>Q^HD 6tFGc>X R R (T (T .!@S S  S S ` 6tFG>c>X P P pR pR .!Q Q @hQ hQ Ð 6tFGn x_@C yyIC yyC yyR ~yyr*func() *bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]r*func(context.Context, string, string, *govultr.DatabaseUserACLReq) (*govultr.DatabaseUser, *http.Response, error)j)5 6tFGUc>X@l qq3qq.!4qqqqs*struct { F uintptr; X0 *tproxy.UDPTProxy; X1 *net.UDPConn; X2 client.HyUDPConn; X3 *net.UDPAddr; X4 *net.UDPAddr }s*func(context.Context, string) (*govultr.DatabaseAdvancedOptions, []govultr.AvailableOption, *http.Response, error)s*func(context.Context, string, *govultr.ListOptions) ([]govultr.DomainRecord, *govultr.Meta, *http.Response, error)s*func(context.Context, string, *govultr.ListOptions) ([]govultr.FirewallRule, *govultr.Meta, *http.Response, error)s*func(context.Context, *govultr.ListOptions) ([]govultr.ObjectStorageCluster, *govultr.Meta, *http.Response, error)s*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 bool; X3 reflect.Type; X4 impl.Converter; X5 bool }t*func([]ackhandler.StreamFrame, protocol.ByteCount, protocol.Version) ([]ackhandler.StreamFrame, protocol.ByteCount)t*struct { ExpiresIn int64 "json:\"expires_in\""; VerificationURL string "json:\"verification_url\""; *oauth2.Alias }u*struct { F uintptr; X0 net.addrList; X1 net.addrList; X2 *net.sysDialer; X3 chan net.dialResult; X4 chan struct {} }u*struct { F uintptr; X0 *concurrent.HashTrieMap[go.shape.*internal/abi.Type,go.shape.interface {}]; X1 *[62]uintptr }u*struct { Protected string "json:\"protected\""; Payload string "json:\"payload\""; Sig string "json:\"signature\"" }u*go.shape.struct { Outbound github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound; HijackAddress net.IP }u*func(context.Context, netip.AddrPort, *buf.Buffer, metadata.Metadata, func(network.PacketConn) network.PacketWriter)u*struct { F uintptr; X0 func(string, string, syscall.RawConn) error; X1 func(string, string, syscall.RawConn) error }u*func(int) *bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]u**struct { ExpiresIn int64 "json:\"expires_in\""; VerificationURL string "json:\"verification_url\""; *oauth2.Alias }u*func(context.Context, string, string, *govultr.DatabaseUserUpdateReq) (*govultr.DatabaseUser, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.PrivateNetwork, *govultr.Meta, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.LBFirewallRule, *govultr.Meta, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.ForwardingRule, *govultr.Meta, *http.Response, error)u*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error)w!HA`q @F(!ɱ !Υ.xϥƉFą*CFCH!e@ oJ q|5 @G(X8AN^w]Q4^] I9)H5ҵGҵ(n @07@]=@G @HRo(x`˱ /@Q J'\QJ<,|FG) RoHRo(tp`˱/`˱/RLַRLz+FGa` Ro@IRo(z#˱:˱ |:I_$d I(yECTE|:`~HDΣP" @J+y( Uޯ j8 !D)(*<# A0J( ̱.g^5/.Q!00($G'@ @K<(&ƕ ̱ 7`!fl!JGN K<(&ƕ ̱ ؑڼ`ؒ P @LA(ɱ !d5=4.d5H>4 l@$G L(ɱH# /: WF⚪@MH ` /8>@>0< TJFl(M(H%` !`%``&`%``=;F-S@L@NLH!? oN> zݛF̀x]Nx]HVsopom ##zFx]@Ox]HG D-o%7@,% @1F3OH%_!@sJ! ~Q! \5 G' @P('ɱ +ɱ !iG$Gk5GPAɱYF 'kA+ s G'@ 屫@Q('ɱ +ɱ !memf4F QH`  / @>+`2 8 U@RU(["+ ɶ !lWV& YWlFRHHB >@W 8 PB W  @ F@@SH> 8 `  ^ua @` _ 3 c^Sc^(x5ɱ !hvh v.iv vΥF; z@T z HbdPE@^2end ^fO`ɍСFl< zT z Hf`"f z!rag ֵFP@B]q@U]qH%X7h7%`&@ knF@LmzUmz H##||qJ!}S4QF3],@V,H%_!/sJ! ~Q!xG? V(x`˱@ Ve+e /Ve+e0|FG @W(`˱ ̱@Nee /Oede|G` W(5 x`˱@Kele /Lee|FG @X(`˱ ̱@0Pee /Qee_M~Gw X(5  ̱@TMee /NeeLYwG. @Y(N  ̱@TeH(e /|Ue)e LEZY ̱= xɱయ((?0Z ̱" @$blP\ Z ̱1/@3 k˱֍70[ ̱ k@ =@"`j[ ̱3@3 ``$$w|| (0\ ̱F/ U` fOD 4<\ ̱ ^ U @޽@޽ crQ S0] ̱ ^ U ɱ@#UlFO Hʯ]H( ̺ ̱P0y y|1y y0(P~Zw qCL?" ̱k ̱ɱ1 =F"( oqLCɱo˱ȻCK (0*G@H rL ̱ɱ"J"`1̱(pG`iKrKL$@| $@|٩˱˱٩ͱ on-6K sKL M``} `˱ `˱$4GE KsKLN)಼k@jk( N j$N:0w@G N tNL !ɱ~k ̱x5ɱ @G$ Co_n4GG NtNL5ʱʱ`˱5`˱l :/Gq2D uNL5ʱʱk`˱}k`˱őFGEuNLf`˱UʱF"ʱ`˱`˱ ($ZQ@J vLx6ɱ!ɱҲɱRɱ`Oɱ \QFjvЊݩ6!x_^__Q!__ eE G~ w~ L6mUJm@ɱ ݩ;^`9 LJF<`w LmɱQɱn  s#,$ 4 ʰ x LX5R&`)` 8`˱$/ͱ(lds ٞ@xL&?[ߩ6L&ͱT& X& `` NaX yҵL ұ%` &ʱ d$tfLi z ҵyҵLn`˱8`˱''#`˱ ( *ndf  ҵ zҵL1ͱSͱw``ʫ2+f`ҵzҵL!Oʱ@'ͱuʼi`ݎ ($.H!'`i {5L!ɱU@T6˱9ɱ!ɱ $m55{5L(9ͱ.$˱ U224uc |RoLpo`˱d`˱e6ͱY`ʱ,(ܒM-!6Ro|RoLoɱ9ɱɱoɱ$vg VvfRo }RoL`19ɱؿ 84 ]@$$Er!Ro}RoLNYS@(g  x!d`pRo ~RoL``}w"@b<pĮL:yX((*,!w Ro~RoL,^2DY˱/˱ 8K JRo RoL w wLXF ϫsH $#ɱ,YF(w:`PT FT G  `H@   w wL s ̱; ̱ $Ӯm(,,ťn vL>Ĭ j7«ͱ ^Ĭ`֮tԮ` Jv((p#w rLۏɱɱ)ɱink ̱$$ ͽ$L"#@wrLIêɱ꽱ͱɱ ݯɱɱ( e$w rLe ̱Ыɱzɱ *$ɱz`׮((P`0tl"L5`ս@;ɱ; A mr> 44zx";@ LX@ ?g@R&`)'0)`b N@ Lr ̱ ̱GS@W@]>ͱ|MG<   L, s`˱`˱ ۩ֱCG<  L, s`˱`˱ ۩ֱhz[. @   L`˱@4`˱ ̱; α  α$e Pz g<L( ̱  ̱ͱ& ѕ(}tgթ gLc'^@<`?<=uFCX9! $m s  Jl 4m (=RPX XL2`˱˱!˱/˱ $nnHHL?)޾ 꾩̱F) ̱M) ̱ b <Gi> >L  @t ̱˱t`Ȼ0("(@L 9p { ̱ )@$ Z;G  LV ױ=ʱ=ʱ`˱`˱ \,-4jLɱXɱX ̱ɱ7ͱ,Dl=G(@} }L Y`˱ /`˱$A`˱(Ȥ  ` ttLB* s% x5w Gw@9FZ^w w8' ʱ X`˱ x8/GL5ʱʱk`˱}k`˱ gXGc  Lʱʱ v`ʱ `R $FG~L5ʱF"ʱN`˱v`˱l`˱ W!zhG`  LF"ʱN`˱Y`˱`˱ `, ftG? LN ̱˱`˱ `ʱfs?V|FG@ L5`ʱG`ʱF"`ʱ#"`ʱ?"`˱ aٔ( d oL+`ʱ;`ʱ*A`ʱH?(tzU/GQW| W|LJY}SY}\Yʱ eYʱ"*`˱$<<W,J0#`W|W|L>ʱ©`©`Y@B4YB84,2D<#| W| W|LD@EB ̱84 0 ͱ04,3c<#| W|W|LD@EB ̱84 0 ͱ0$BtB N LrɱNɱ͚ɱ#<ɱFZ ̱ $$+E{횳 L" úؚ ˱+Ce'ɱL@#$i4횳  L" úؚ ˱+CJ۳B`˱ p`!x]L`bͱdwͱeH@Nh:ͱl0(.m#6, x] x]L$lCwͱ0n$<4\ZZ#>`x]x]L[@x ;@>T$[@0(#[8 x] x]L84lѾ`4: J l#x]x]L$@@Nĩ@@ ;<4F*Q#\! x] x]L[@x ;@>T$[@0<4&ô# x]x]L[@x ;@>T$[@0<4[#!@ x] x]L[@x ;@>T$[@0,(fb1#z`  L *) ͱ(4,zK1$  GLXɱ&LK ɱ( `ʱ0<4Ꞷ$^ LPA.Ʃؿؿ :Ʃ$Nr0TL* $/ L@ ̱ nr`x 4ڝH,(p&j]G@L& ꬩ`ʱ`ʱTYԿʬɱ$  U L!\ L& Aʱ`ʱƩ`ʱЪɱ :λ L!L& F"ʱk`ʱ`ʱ۫ɱ$ Yw # L& UʱAʱ`ʱ ɱ O& L!tL& F"ʱk`ʱ`ʱ۫ɱ  L! L& %`ʱ{`ʱ`ʱⲫɱ$ I; U #{@#L& Lfʱ0ʱʱ ɱ bH L!]$ L& Aʱ`ʱƩ`ʱЪɱ 1b6 L!`L& %`ʱ{`ʱ`ʱⲫɱ$ W? #;* L& <`˱7`ʱ`ʱЪɱ gdL3ʱ5ʱSH`ʱU`ʱNԿ($מO$l@ zZLo{՛ɱ1Ҫɱ{ɱ $ p F@L ɱ)ɱ~ĬɱҪ ̱Dzɱ($Ts| aI L7ݫɱɱɱYɱ;ɱ rq d@L ̱Ҫɱ~Ĭɱ `ͱܫ`ͱ/5<  @ L1`ͱZ`ͱZ`ͱZ`ͱ ̬ɱ$ `LlYɱXɱ|ɱ,bɱPY ̱ $+7  Lêɱ"ɱ"ɱӪɱҪ ̱ V@ F_#LêɱYɱYɱ ̱Ԯ1 p| 4  Lxdɱɱ& ̱ɱWn ̱,$n~کL ɱ;Ԫɱݫɱɱw߫ ($0Y  L~̬ɱsɱ┯ɱ]ɱQɱ ($7$ML㜬ɱlYɱQ@3Dɱ $/\ _ Lxɱ~ĬɱRɱɱp ̱ (IO@Pc^c^L ̱x5B, ̱l^˱  ]?t ?tLCɱV ( `˱ : $DO` 3@ǗǗLT|`ʱ+ʱg[ 1٥/`Ǘ ǗL!Oʱ@'ͱuʼi̶ݎ (i/Gnv55L ˱˱˱ ˱ ˱ ;G_y L@`G`(>`PV`x5 @@?.L^ͱ+ͱxCͱ6+$ 'D%` LZɱ[ ̱pA ̱ uk,ɱ-:r G@1JL ̱~ͱBͩ`˱F"`˱ D`˱) JL ʱʱrͩʱ~ͩͱh)  JL  ̱% ̱ ̱ ̱@`)ħ` JL @3ͩ00N@3Oa@3JL! ̱L ̱V ̱ͩ ̱ ͩ =Xμ"@E HLé@ܲ ܲPܲ%u ! ~$$H h%pbbL7ͱФ˱՛N ɱ!,G>| bL椩 @ ! ˱' ˱Y-˱$T*,aa LV|Gڪ |̽Yڪ$1Gqa a LP3Tϩ\ 0(v,%@NL;$ͱ*˱1+Б$Py   ű L;$ͱJ d 1+@w$Б@w9tl`%ļ~~L-M\M yu\zh/k.w Lͱ@Lͱ` l} 0(9tFG>~HH8f`:`:Ed_:d_:@`:`:($:Z0$E  ULo{՛ɱ1Ҫɱ{ɱ 44ˌd$VULɱɱE%ɱ`F  , GH~c cL`   ̱( ̱E|"@  L 7[g7H ̱ ̱ T ̱T=j YLEO (-*>* ͱ ͱ80Sz&TgYL /-`Z\V^ ],d\H\&I@gY YLbڽp`Z4\@(U^L]X*+ހYYLbൻ`ͽd`˱ s k U1k YL/z*zI `I bp((|lH2= 읳 t L@@   ( $(({%CH2yj읳 L@@   ( $TT<^Xc B BL  s`1(gɖ=;lF `#BBL K2g F@*C ƻCP!s*oQ!xFG`ƻ7Nfp&&'`(&ı&&Ա&!@,&&AlxFGu ǻҵ6 DC6@ DC (DC DC!$v RoǻRo@'ɱ7ɱɱ(:ͱ /QPR4FJ"pw ȻwP8 :    i  .! @1  tFG;\d r`4  T /4 n|L tFGW@)"pH$I$I% /J "UJ%D-^Fx]ɻx]PG  H `H H TH T I r, x`dwrxFGGW  ʻx] !TGkDiGk`iIhHkpi.HkinF\ʻP5  /` ?L  >+ M 2 _vFY@ ˻P!9 ~*sQ!t`AלF˻P>@Z 8 Z Y XBZ  @` Q:Fd ̻PHB` W@a >a 8 PB a @ @ F"@̻PHB >d 8 PB e  !`" @` axFGu ͻǗ6 6 @   EF[0  Qͻ Q@ . pɱ[ ̱ /*42 Hh:kF Q λ Q@|` ( H ̱ |/4/4Q qxFGZbλJ=|+H;|!0|j3F75 z ϻ z P<#O  gbJf hg sFKmzϻmz Pa ~#4#||}Tb S4fw л@ʱ`ȻB ̱9 `c u-Ȟdco4CFwлP U@ X/ (  `/.Y`` tFG&`$j8& /~*func(quic.newConnID, *list.Element[github.com/apernet/quic-go.newConnID]) *list.Element[github.com/apernet/quic-go.newConnID]*struct { F uintptr; X0 context.Context; X1 func(context.Context, string, string) ([]net.IPAddr, error); X2 string; X3 string }*struct { F uintptr; X0 *http.http2Framer; X1 *error; X2 *bool; X3 *hpack.Decoder; X4 *uint32; X5 *http.http2MetaHeadersFrame }*[]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*func(*list.List[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]])*[8]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*struct { F uintptr; X0 *http3.connection; X1 func(http3.StreamType, quic.ConnectionTracingID, quic.ReceiveStream, error) bool } 6tFG~[ f"llPP /U$5 tFGmලK~Xi0 ~Ď2 ~NfE 6tFGDo:K.@LӇ@i}G 6tFG@GK.@LӇ@HK 6tFG\K)M ~"%+# ~QQ8X 6tFG%XD\XD\ !E\E\E\E\%\F\\F\G\G\n, 6tFGGv~ K&oo@m4o4oZ2ToToi2TpTp_ ~2 6tFG<`w >`  ffϋddggj$n$nLXiXiV 6tFG= !oo(` |o|o-hohonToToboo 6tFG2 r !oo(` ToTo-ooJoo6@PoPo T 6tFGٞ`xQ@ \\% \\P8 \\Q!\\# ~I|t 6tFGE/& ^^PD^D^^^H^H^Q!@ ^^[0_ 6tFGf7Nf'''`\'\'p'p' /<&<&!@&&`65A 6tFG577Nf8&8&'`&&p'p' /''!@''T/G 6tFG`87Nf&&'`4&4&X&X& /p&p&!@&&. [e 6tFGi97NfP&P&'`&&&& /&&!@&&G35s 6tFGҵ%!?!?J! ~ "? "?X!?X!?#?#?Q!|"?|"?# 6tFGTYҵ?? ??n??q  @?@?S0?0?լ 6tFGuZҵ?? ??n??q  ??S|?|? 6tFG5`{5LF8F8!5 ~b(H8(H8# ~ 6tFG༽Ro5 tQtQ /(Q(Q: ~v ~II 6tFG8DRo5 LQLQ /XQXQ: ~v ~QQZ 6tFGW@ERo5 XQXQ /dQdQ: ~v ~QQ ̿G8RoRo4a둪z!RlRQ!4RR- 6tFGizRoshLhLV LLLL}LLxLxLmX 6tFGJ~Rou P P',P,P7SPP 6tFG`Rof@uI@uIsqIqIQ!TuITuIbK` > s`,; ,; 2 v 6tFG`M  3 3 U`2 2 UH4 H4 h6 h6 UD7 D7 cm 6tFGX)& j j se e 1 h h  Tg Tg j j sc 6tFGWȻ)"pHpHIIII /JJUJJ+ 6tFG3KfЬ&Ь&ET&T&<`P&P&c ~&&@&& &G3ɱKfЬ&Ps&ET&`s&<`P&$o&c ~&t&@& t&_ 6tFG ?L?(=xzxz0=wwNjxx8=l{l{tx}x}1d 6tFG> 1Xu Xu >X@* t t `t t .!t t (u (u R 6tFG?O1v v >X  v v u u .!u u dv dv e 6tFG>jP1>X` `.!y y * 6tFG1>X { {  { { { { .!L{ L{ =0{ 0{ " 6tFG(} `pMpM=OO MM= ~PP= ~dQdQA 6tFG&@ToNHqHqH-Jqq/y 6tFG@L1HuHuuuuu"@u@ušS 6tFG?lx]DgDg}E gg LgLgRgg \g\g> 6tFG#`x]\`PhPh! ~hhdhdh#D hhhh 6tFGz` %==J! ~======Q!==s~ 6tFG[.Fu3E3E@t5Et5E @x,6E,6Eu6E6Eh9@L8EL8E" 6tFG'fHHE̴̴@䶉䶉@k@G"M 6tFGx`eXLƌLƌ?訌訌 *eHH] 6tFG9%ttJ! ~Q!_ь 6tFG>s x>ЫЫ /ોો @2i 6tFGNsx> /  @2̪̪_@ 6tFGn0ϵx> /ऋऋ @2n 6tFG x> /ؠؠ @2䟋䟋 6tFGଷx>xx / TT@ММ2R! 6tFGx>ؖؖ /䘋䘋 薋薋@ll2HH" 6tFG^s@x>@@ / 00@PP2`` 6tFGnsx> / @2ȎȎP= 6tFG~sx> /\\ @ 200 Y˥ 6tFGs`ax>dd /xx ll@tt2A 6tFGDHx> / @2DDT 6tFG`x>h}h} /~~ @||2x}x}T" 6tFG`x>ll /yy {{@ll2ttXLM 6tFGx>jj / l l tB" ~{$} 6tFG0еBNt;;7NC,;,;/ E;;w" P p;p;`P ~;~;v 6tFG&ZѵBNt|;|;7NC};};/ E|;|;w" P }; };`P {;{;z 6tFG;ZBNt4;4;7NCd;d;/ ED;D;w" P T;T;`P H;H;~ 6tFGRU'\0\0 !lWlWH0`00& YY.x0x0tRm 6tFG ޵> ,u,u8` {{  (w(w ||@[ PyPyï 6tFG޵>@[ ̎̎8 [ HH@ 䔗䔗@ +oW 6tFGdߵ>^ 8 LL @^ || @  6tFG >@` HWHW8 \\ ` XX@ x^x^@` ZZI@y 6tFGZ`>b $J@b tt8 b  NNH 6tFG>b dd8  c  ||@ Z 6tFGS >@c 8 c <<@ 88@ ,,5bl 6tFG>c ||8 tt d  @@ 觘觘 6tFG e>@d 8 << d  @` . 6tFGG`ǗM 6tFGιYH0`8~8~ e~~#dl~l~f~~O`~~o 6tFGM@  l ̂̂ ~~ m ((> &tt$aV9d`d4T !o @n%U!<* 6tFG)`=dPEb8>8>2b>> cp@p@fAAO`BB %D 6tFG ׹d. ``/[@Ukp 6tFGF?`d.RReiSS`O@iSS`TT`UU[a@ 6tFG'V ź% pG`dl_dl_@j$k_$k_8$s_s_-Ptp_tp_'$2 6tFGź0o pGXbXblWblWb8P_bP_b-P\b\b' 6tFGW ~dd@XdXddd@dd,P0G9( "4 `$`ʱϨ`ʱ@\e7e /]e8ec 6tFG@>A\r` / ,& $)y4U Ⱥf-ɱ``2d$SS /%SSҠ 6tFG&лj8& /M 6tFG??Ge\r` /,,q 6tFG:Z X!pĞpĞoAll; Þ Þ=A@XX/I 6tFG: \ X!X'X'oD;&&=Dpp  sF9' ̱ ~@3 3 `W/( 6tFG1>X` t> t> ` ? ? ? ? .! H? H? = ? ? *struct { F uintptr; X0 *forwarding.sessionEntry; X1 net.PacketConn; X2 net.Addr; X3 client.HyUDPConn; X4 *forwarding.UDPTunnel }J^Fa( ̱`H/@3 @/0 s00p!p) ̱ Ϯ@ɱ˱D$@F($ 0"i* ̱`/ =ͱɱ%4(* ̱@$pt=xɱ`u,({'"5P+ ̱@EE` Aɱ$F+ ̱ ~@3 3`*func() *list.List[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]tt\N3D#- ̱ @W`M i Xp* 6tFG @x]H H kH kNd hkhk`/kkxH kko`/k$ 6tFG x]I kkNd kk`/hkhkxI kko`/*struct { F uintptr; X0 *http3.ClientConn; X1 func(http3.FrameType, quic.ConnectionTracingID, quic.Stream, error) (bool, error) }*struct { F uintptr; X0 *http3.roundTripperWithCount; X1 context.CancelFunc; X2 *http3.Transport; X3 context.Context; X4 string }*func(context.Context, string, *govultr.DatabaseConnectionPoolCreateReq) (*govultr.DatabaseConnectionPool, *http.Response, error)[}Gתp0 !]ͱ r6ͱ `ͱͱMͱ, Î$F.D1Y F"˱`\TR ] \d,\ت`](()9% 1 ̱ /  XX4Gd&)P2 ̱ͱ @THPTPVqx&}>2 ̱ͱ<@T@HͱP*map.bucket[protocol.StreamNum]quic.incomingStreamEntry[go.shape.3162325ebd462a414fa2f9959b9c8a5f20c5b910ce61a19006f75b690a627446]*func(context.Context, string, *govultr.DockerCredentialsOpt) (*govultr.ContainerRegistryDockerCredentials, *http.Response, error)*func(*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]])*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }) struct { pragma.NoUnkeyedLiterals; Size int }*struct { F uintptr; X0 func(<-chan singleflight.Result, context.CancelFunc); X1 <-chan singleflight.Result; X2 context.CancelFunc }*struct { F uintptr; X0 chan error; X1 io.ReadWriter; X2 io.ReadWriter; X3 *server.StreamStats; X4 server.TrafficLogger; X5 string }*func() *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*struct { F uintptr; X0 *sync.Once; X1 *protoreflect.ProtoMessage; X2 *protoreflect.ProtoMessage; X3 *filedesc.Builder; X4 []uint8 }4(s@ 7X Iɱq*f! @թ $/ ̱0nXfGF'*`8*X ͱfIͱͱ4e ̱! ̱0 ̱ )^D dB`C9C(>J==f ,,'`",",#,#,84'Z|xg@ 9XRCɱ(UK0gͱ4ةͱ5.ͱ60G`GDo@K@:KX@G˱iͱ$Lͱ%#̱(̱,0 3K:KXiO#`KI̱3˱˱ iͱ(U 4Gg@<K;KX̱/̱e̱̱ ̱̱ xG qK <K(/ɱ̱@xC < !C  ~D  P@AK<KX`˱~"̱Cɱ3ɱ[ ˱ ˱<$U@x ` `= X6mU7ɱI@ݩ@4) R&`$ li  ʰ> X*w2 8U! ̱) s/ͱ8(E r@t ̰> X5FA 6FQ s0n$B s0LH\V| `R@?X% si Nɱ`Oɱ 88๽($ɱDl s ;?X3U`8ͱ` ̱ Ƶ <<؛` d @ҵXZթ ;`޵ /t,_80,7p 865 A5X, ͱ-ɱ ɱ(Yuu@zRoARo(]༽{ 5 w Ro@IRoXtp`˱9ɱؿ  !⺩`˱6DzeRoIRo(]༽t6 5 QQ /Q4Q$ w!X#JX #1T@ sV` ͱ LLHH"Ry%w Kw(${ D""  ll SK~t Xh;߽ɱ(ͱ oͱ ɱɱ,$";`L~t X`ԱZU߽cU߽Jɱ lUԿuUԿ 0,ʞ"ŐtM X(`rXc@ U$;ɱ( M X3{! α̱; α̱ å4G@H@NHX ֱ2̱o̱<̱ ? ̱E ̱ Xr.G&(hNhXʱgʱʱWʱ$ʱ1ʱ @@_L#AOAX >`>@X` 68ޘ <LDX ] P (qɱCH97 TTT78 TTc2|<њ PXF ,    ̱%  i/G`QX5ʱ>ʱk`˱}k`˱X`˱|؂FGFRRX5ʱʱ`˱`˱F"`ʱ  u \G[R@RX5ʱʱ? ʱ =`ʱ  ߦ`/G@SX5ʱʱ`˱?෰ Y෰෰-GSX5`ʱ`ʱUʱ?" ˱F"`˱@6`˱ &+@&ToX+`ʱ`ʱ0`ʱ)`ʱ&Y/Y4,i]B @ UoX05`ʱ )`ʱ &Y/Y (F@,B UoX+`ʱ`ʱ0`ʱ)`ʱ8YAYe. FɘW|`V W|Xd!< ` ~* %* ۇFB@W|W W|XB (J@< !JBsQ!7  G[@ oW oX{z# ̱  ̱8k ̱pTͱ,$>\#C횳@X X" úؚ ˱+CG.Dɱo@ ӺsP^jX X`˱wʱ@`ʱ%`ʱɱ HDp#t x]Yx]X8@f/Z { ]T,0 65t+wx] Zx]XD`Bĩ@pp sx@'ثͱVͱ ,,jF#R.ZXZ@$L s[ĩ$( 0VK#` `[X0T@[;b NxJ u^FGF{^u\^u(D˱H˱1;$`xB>4, #` \Xyo ̱ @N`ʱ(H@ő+$r3p@]3pX@A k\`˱(K`˱,̟ͱ0, 4<   ,<8]8X2a/˱  yͱHA˱,|?Y^(,2P#T] Gy@ _X!ɱͱ !`ʱ ʱ [ ̱ pA ̱$ ;D #@_X& `ʱF"`ʱBǩʱv`ʱʬɱH@Gu"zy``XA{ͱt@=@ܮ$ @ܮ0&@ܮ< 5.G aX|ʱʱ^]ʱg]ʱp]ʱy]ʱ Q ,.Gs aX3ʱHʱAʱ !ʱ|˱➩`˱,9ͩ & @bX]< ɱ+ ̱ I ̱${ ̱(&\ dbXT[ ̱pA ̱uͱͱXPCx$ BcBX ̱Q{+] ((B4<4Ս@ $I@zZ dzZXɱmɱɱ̬  ,2@4HH"*$ntzZdzZX{ɱɱl?ɱ,8B4~t @<4N{\ $4I`ezZX2ɱyBɱNɱɱ$ H˱4<4 ]'` $4IfzZX2ɱyBɱNɱɱ$ H˱4$Y   fX ̱Ҫɱwɱ ~Ĭɱ`ͱܫ`ͱ ($wEs $@gX ̱ "ɱ'"ɱ QӪͱpɱ̬ɱ ,(  $gXӪɱӪ ̱Ӫɱ '"ɱCɱ0ɱ$0, "@hX]ɱ~̬ɱLaɱYɱHbɱ dbɱ((sD ;@ iXwЫɱYɱlYɱYɱԮ ̱  ̱$ 7jX iXK@3Yɱݳɱ |c ̱# ̱$ ̱( &$VF\`jX"1ɱxɱޫɱ9ͱxͱ@#LLQ`!d@kX ̱!@/^r ̱r ̱ Q@3^ά$ h $rkXɱn@3Gy@ Wı@3yɱ$ɱ,(C8 !)@lX\ɱxɱ~Ĭɱ)Dɱx ̱ )ɱ$0,$S lX ɱ)ɱɱêɱwɱ ɱ(0(N$$3J@mX ɱêɱ0ɱX@3ɱD$,(o !{ nX ɱxɱ~Ĭɱ)Dɱx ̱ )ɱ$,(= !BJnX ɱxɱ~Ĭɱɱp ̱ )ɱ$,(֝O <@`oX ɱɱw ̱~Ĭɱwɱɱ$<<o  pǗXZթ ;0޵ /t,_84,=I%p XU`ʱH`˱꣪ժ8˱ !( phtH/GM``@q(GR < XDxWV @W4V /WV (qXɱ ̱ͱ ͱ | ̱hDT,/ תrXD`$`iX@@`i~ͱ~ͱeG,/Nת sXd``$`i0%ͱD ̱~ͱ)  sJX `˱`˱`˱%Կ7ԿF 6 z`t z X#` ]#]bJfWa] N'^㯘F(7 zu z X ?"OEO 6`V O`XE $] G>8>]ӳu] XIͱC"ͱ{G {OpLi8 l#>]ӳ@v] Xw oS߬ $ի 8XC`uLH{ Gj?]ӳv] Xf8z8ͱm@  c`u^é@!/GEwE(Sn`ʱ&`^_J_f__tJ_ /t`_4K_,}l Gl]q x]qX{ͱE@@ @P@#@$GFFGdx]q( % ly`lr`(lz`Hs` /|`s` *G b`ybXpoM6 Wͱ.|ͱͱd@A> #bzbX= _Ȁ`ʱPx Q$`RT\6:FeHz X  P E RkP`{` _ 40 J:%Oa@{a X- ˱3 ˱g-˱JQ߷aѾ,3ͱ0XH/% Ka{a Xaa`V tl 4#HPVfQFh)Lmz| mz X##|*q|qJ!}S4qN }x(ɱ! X!uplk /lk~L0 H[N%}+}+XR& s ͱ Rͱ t\54,f## ,`~,Xyo ̱ @N`ʱ(84}%-` ccX{b@  ,b"ͱ4 /` X( ̱ ̱C:sͱͱ w,GR]&@]&XFgSͱ ̱ ɹ``b%KgYXEO ҩqݪͱ$U (e`ؽP`O*X((r%+&@YYXZu 0/}(G@}0G@} .}$((B& Y YX [u 0/}(G~0G~ .@~$`T $&hiYX/-ϹϹVӹ8zΩͱT!ͱUbV00܉D&m-@nd`dX^ҩ`˱ sn !S  ,Ϙp& @oddXoBRг% @Gnv$$ǿ`G@0o0o X QͱEV@`˱(ͱ , !S @WXcX / ̱ h ̱$F" ̱($$6&!WWX/ ̱\. Z$ ̱>@N@ I(4G0@yqeX`̱`̱}`̱`̱ `̱t`̱*concurrent.node[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]$Q?"- N Xr?)"k  ʱUʱ#<Կ$|(TS"XW@@N Xr])"k  ʱUʱ#<ԿpL5@l# ]ӳdXw oS߬ $ի 8XC`uL*func(context.Context, string) (*govultr.DatabaseConnections, []govultr.DatabaseConnectionPool, *govultr.Meta, *http.Response, error)*concurrent.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]*struct { F uintptr; X0 *sync.Once; X1 func(); X2 *bool; X3 *interface {}; X4 *go.shape.interface { Error() string }; X5 *[3]uintptr }*func(context.Context, string, string, *govultr.ContainerRegistryRepoUpdateReq) (*govultr.ContainerRegistryRepo, *http.Response, error)*func(context.Context, netip.AddrPort, *buf.Buffer, metadata.Metadata, func(network.PacketConn) (context.Context, network.PacketWriter))( ev l" HLɱVɱU@T}|?" ̱$NjF`V` x]x][" !RkQkRk|iISkTi.Tkdi4- Gr `LɱhAʱ(ʱ `˱ yʱj <1003%5` L+7X5@b xY (, ~|$XFIN`'ddV@T.0CXGC`lD`E<FV`)@@T_!A\s܍0J! ~Q!4X!FV) G_!AԇsTJ! ~Q!dTF~`*娩S_!AL|s̄ J! ~|Q!$xWh6Gl lLG8>p /*concurrent.indirect[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]*[]*concurrent.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]*struct { F uintptr; X0 certmagic.Certificate; X1 *zap.Logger; X2 *certmagic.Config; X3 context.Context; X4 string; X5 *certmagic.Cache }*func(context.Context, string, string, *govultr.DatabaseConnectionPoolUpdateReq) (*govultr.DatabaseConnectionPool, *http.Response, error)*[0]*concurrent.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]*struct { F uintptr; X0 bool; X1 protoreflect.FieldDescriptor; X2 impl.offset; X3 reflect.StructField; X4 reflect.Type; X5 impl.Converter }*concurrent.HashTrieMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]*struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2responseWriter; X2 *http.Request; X3 func(http.ResponseWriter, *http.Request) }ߤ+`Gnz K K@˱G ̱2ͱ `α !ͱD>h04~'ftFG+ . e`ԍ^n@(/䏆 /8U$hSFx] x]`V]!OsopoQ!d2F4?x] x]`,!, ~@CF Qg ~T*~o! tFGHUH0`(R4< @R C3T:[;CS;@da@/ Q Q@|` ( H+` |+4+4U,4 ,4&,hFGQ_ Q Q@( H|`  ̱ |`24P24U24t240@ Q  Q@|` ( H+ |8.4(.4U\.4L.4^qǤ Q Q@|` ( H- |@,40,4Ud,4T,4}ML @2 Q` Q@|` ( H+ɱ |x64h64U6464$& DQ@U@b-ɱQ ͱ /tRR!TRhR~,Fs0o 0o `{a4 8 ~ b Ac@ P "t %8-P@q&G|FGi @@ʱ`ʱ`ʱh`˱@Je@ e@,Kep e 7tG` ࣼ@ `x`˱$`ʱϨ`ʱ @l[e6e /D\e7e*struct { F uintptr; X0 func(context.Context, context.CancelFunc) (certmagic.Certificate, error); X1 context.Context; X2 context.CancelFunc }MK,(k ̱@$ɱ  ~ͱ0(vt< ɱêɱ# ̱ɱYɱ;ɱ$ͱ,1ͱ-*go.shape.struct { Start github.com/apernet/quic-go/internal/protocol.ByteCount; End github.com/apernet/quic-go/internal/protocol.ByteCount }*func([]uint8, protoreflect.Value, protowire.Number, protowire.Type, impl.unmarshalOptions) (protoreflect.Value, impl.unmarshalOutput, error)*struct { F uintptr; X0 *int; X1 func([]uint8, tls.ConnectionState) (*tls.SessionState, error); X2 *tls.Config; X3 func([]uint8, bool) bool }*map[netip.AddrPort]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]$ 6tFGaHHuHuww0d }}{{:d 00` 4pG d˱j׳˱q*˱˱}@ O˱( ͱ0@898nd ɱ%O9{߸Wzɱ,ɱ4}zͱ<LL}@6kC`CdRp0 ̱(0 ̱,֩ͱ0Cɱ4"/<"/D$)?H+Cdɱɱ0ɱͱ שͱ!ͱ"Zg 6tFG#@CGJ4*4*ID*D*0 **s**Q!d*d*EU 6tFGCGJy,y,Iy,y,0 y,y,sd*d*Q!**zn'# 6tFG`q"LKXXDD((b4KKd/ͱ2ͱ̱̱ ~ 54;'q 6tFGHKI#~"@hhZLP#s+ 6tFG2- K^#@|h ؒؒDDhh`ݥ 6tFGn@(Kd@o@he_-?[I/[@7KKḏ̱J  α ̱̱̱άQ tFGK ~2~L2L0tRK@KdE/ L Ḻ٩O ‡O(r. tFG4K7&@3jC|.w 6tFGoK.@L# ~Ӈ@u*4GZq} K Kd^]@܊˱˱n]˱ ˱ک˱˱$kGAKKdC˱[˱ %N˱0`˱: ͱ!i.GC`Nd5ʱkʱN ˱5ʱN`ʱ $`ʱ @w (GRH NNdkʱN ̱5ʱN`ʱ $`ʱ @w  <<< ^dCɱ@6ɱ ˱(k˱0]@I8pa 6tFG^` / " "0a H!H!1l%l%|))PPw 6tFG_ p( K&qq@m|r|rT rT rrrrr DrDrA@ 6tFGW2r u@7 @x# u((: m`  d2ɱɱ`@u m  $4_ C\GP dT˱ȫ˱^˱T˱n`@ @(ͱ0$ K?I $` d`˱m̯4Q &n`x ~8ͱ P 6tFG4w "oo(8oo" ~ܽoܽooo|o|oՋ 6tFG`I/& ̫]̫]P]]%|]|]]]l]l]Q!@ 8]8]N_f7N@7N4>J=u p f'''`\''p''8B 6tFG.ҵ`DDQ!NDND ~qd8gx 6tFG+@RoR QQfoQQpoάɱIɱ$Dzɱ,$M&x \d,ԮɱY ̱\dɱ (ı ̱l ̱ ̱r ̱ 40.z $\d ɱxɱRɱɱ ̱ "1ɱ$ ɱ,$ 58 Gu@?tdnɱPɱ<`˱W ˱b) ˱= ˱^`˱ ʮ| 6tFG<_ Q`[3[3|,4,4 /X3X3U,4,4 [3[3,J`X3X3^b 6tFG@: Q`PL3PL3|-4-4 /H3H3U-4-4 xͱkha >&8TLIL`P%f(תd.̩ :̩>~$;0[<HhLӷ\%b ,תd`V4!f~x$N M4:̩P>~\dX+=x%q!`Mx@xd=0{` @f@00 "P@X^s 6tFGG  yb< lalalH>l*+ll_!+\l\lLlLl0tlD-@5dP   T\C`8 ̱db}hߣP 6tFGn~`XH&::X!z::8F::0,:: /:::::40__`$ f @Udɱɱgɱɱ rɱ$Kɱ,z 6tFGn¹gX!|ttD*@44;`.TT7. /s) 6tFG|ùgX!|D*@;`.<<7. /ĚĚsd 6tFG~೻c- U U2hUhU2dUdUUU'PUPU!0U0UBdl 6tFGg }NVNV MV MV# ~_ 6tFGȹ]&@3tqtqSqSqCqq`PTqPTq-3qqh4PVqPVqp]t 6tFGk&ȹ]&@3@q@qVqVqCTqTq`WqWq-3pqpqh4,Zq,ZqVY 6tFG`]&@3qqZqZqC̴q̴q`X[qX[q-3qqh4]q]qBl 6tFG]&&`8p8pf$p$pJ! ~\p\pQ!pp7@pp aBRd?`]&]&dy@T@T- ̱/ ̱< ̱ڂ ʱ䂩 ʱW/)T ]&dF G`b@  Iܪ.tt%y&g]& ]&dR& s,`Ϯ}@jѩɹɹS l?j 6tFG͹YPE@e~~H0`|~|~ e@~@~f,~,~O`~~|m~~WĬR 6tFG3ϹYPE@c~~H0`~~ cd~d~fP~P~O`~~|m$~$~gC 6tFG=ϹYPE^ ~ ~H0`~~ _~~f~~O`L~L~|m\~\~p 6tFGйYPE@_~~H0`H~H~ _ ~ ~f~~O`~~|m~~l 6tFG>ҹYPE_L~L~H0`~~ `~~f~~O`x~x~|m~~* 6tFG8ӹYPE@^~~H0`~~ ^~~fp~p~O`4~4~|mD~D~ a!M㹱 4b`c` '  l ̂  m (|&t؄ zu= Od d4Z$`ʱf #$ ̱ zʃ,ʃEO@7 Xʃo5 6tFG>9d#@? ` #Wa`N'`" ( 6tFG`d5`@ Kfll llV$$ ((c\ 6tFGhid5`@@@ Kfdd ||V<< sȧ 6tFG}i d5`PP@ 44Kf Vxx <<G 6tFGid5`II@ KKKfKK dLdLVPGPG LL 6tFG2d5`OO@ QQKf Q Q hRhRVLL RR'e 6tFGH@d5`UU@ WWKf(W(W XXVRR XXe 6tFGd5`[[@ ]]KfD]D] ^^VXX ^^{7 6tFGҿd5`bb@ ddKfcc ddV^^ ee]Tr 6tFG`d5`gg@ iiKftiti jjV4e4e jj#VE 6tFGd5`mm@ ooKf0o0o ppV(k(k ppW' 6tFG d5`PsPs@ uuKf$u$u vvVpp vv 6tFG^d5`zz@ ||Kf|| `}`}Vvv }}:Q 6tFG?عd5`@ ||KfXX XXV七七 $Wʥ' dH@Q% `l ̱ *ө ̱6 ̱@.`c 6tFGW TRTV u&t G`ʱW TRTV du&Pdtdi( 6tFG.WBZ$C`\d\dN`xG/. Wd/N`˱5`˱ GJ/~`˱F" ˱Aq 6tFG^ܹW dddd@7dddd8<,d,da4d4d\dd]5? 6tFG̖@| V`o X!|D*@DDo`7.=`q 6tFGio V`o p:p:X!|KKD*@MMo`@F@F7.,I,I=` G G 6tFGio V`o 44X!|D*@llo`7.=`䎠䎠hG 6tFG`B &`X!D*@oANLL=A>d 6tFGg AX!4˝4˝D*@t̝t̝;@8͝8͝7.ΝΝ`$ϝ$ϝ`) 0Н0Н jnGg`ʱAX!4˝̦D*@t̝;@8͝7.Νd`$ϝ`) 0НxY 6tFG(`۲`^(\ 6tFGNGeX!``D*@;@dd7.`PP`) \\ G=hGN``ʱGeX!`XUD*@0X;@d$V7.W`P,W`) \ZG#HG`dA o ̱(*,2 ̱lup8 ̱Ύ 6tFGgl)DPmPmv@Dmmx<` oo^oodDppDdqdqiG 6tFG=໻t &`jjX!qqD*@kkoEiiN`m`m=Ehhh 6tFG g`!!*d!d!G$!$! /!!I l!l!0!!,o 6tFGȗ g`!!*!!G!! /L!L!I !!0d!d! 6tFG g`4!4!*!!GD!D! /!!I !!0!!=f 6tFG `Bz6%6%# 7%7%`9%9% `8%`8%h1Qx 6tFG`Bz`&&# &&` <&<&@ &&h1q|B 6tFGF\.z`(.&(.&# 0&0&` d1&d1&@ 2&2&Pg@<1f"J= s](g &$f&& qE{7N)7N(>J=f&&'`X&&l&&!@&&m7oPG`Ro`*Ro(]༽ 5 QQ6pQ8Q /@QQD@Q`"M ++yXc jDzɱ ڮ,ڮͱ8Nɱ<-;,F }+ }h r@ `V@ /<`tk F@x]@, x]h]!OpoQ!m @Zn F K F^@x], x]h!e@ ` a+@o! J HDF^x]- x]hG D-D` !  H 4@H o%7@,% @I9F . hNdC @O@nB gC #@C `*Vp{5G[ɱYF FuDD@DD @xtDtDuDDDDh9@HDHD<4P7T $0a `/zZX2ɱyBɱNɱɱ$ H˱4O@8 \SF[0 h>_ @ 8 ` _  M  `! ]\! @ ;>F@9 z0 z h ?"OW`EO 6`V O`6XE KF}@; z@1 z h ?"O/EO 6`V O`6`XE *lru.Cache[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*internal.Entry[go.shape.string,go.shape.struct { Outbound github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound; HijackAddress net.IP }]ӣ<F @ d 3 dh]!OpoQ!4 p_@p>. F J*func(context.Context, string, *govultr.DatabaseAdvancedOptions) (*govultr.DatabaseAdvancedOptions, []govultr.AvailableOption, *http.Response, error)*func(bbr.Bandwidth, bool, bbr.roundTripCount, congestion.PacketNumber, congestion.PacketNumber, time.Time, congestion.ByteCount) congestion.ByteCount*internal.LruList[go.shape.string,go.shape.struct { Outbound github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound; HijackAddress net.IP }]*map.bucket[netip.AddrPort]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*func(time.Time, []congestion.AckedPacketInfo, []congestion.LostPacketInfo, bbr.Bandwidth, bbr.Bandwidth, bbr.roundTripCount) bbr.congestionEventSample*tree.Node[go.shape.struct { Start github.com/apernet/quic-go/internal/protocol.ByteCount; End github.com/apernet/quic-go/internal/protocol.ByteCount }]$$8` `7LɱUѱQ˱ /ɱ &`] \H8@l]\ΠF5 7N87NA=f8&&'`&&p'(& /'&!@'8&[xxFG7N87Nn`ƻf&&'`4&$&X&H& /p&&!@&&|PxFGi`7N@97Nn`ƻfP&(&'`&&&& /&&!@&x&"q9tFG9S`%XXJ! ~hh88Q!:*.P@ Q: QL|` ( H ̱ s0|-4-4U-4-4 m?x Q ; QL|` ( H !|.4p.4U.4.4D p` Q; QL|` ( Hp9ɱ -ɱ|X/4H/4U|/4l/4.G,`<L ̱6 ̱6 ̱ ̱ - ̱ @WV /WV~FK = HS P%L !伖@7_쾖H] F)=dPEb8>=2b>t cp@?fAAO`BB*simplelru.LRU[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]$$e&g> ̱111 )/ ̱< *internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }*internal.LruList[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error)@@pi Bp˱j׳˱q*˱˱}@ P@( ͱ0޸4,΄P[@4K@CKp̱}hɱɱ ̱ ̱^#̱ hhH$4KdG@ KCKp ͱ$ͱ(ͱͱͱ 1۩ͱ(>۩ͱ0l/ͱ1,,ƺ !rD p  s @j ʯ@x2 U$v ~(t,G; ^`^ ʰ E pީ /)ɱW q,U`nͱp8ͱq( 'kq !͍@\ҵEҵp07\@Ķލy9'ʱ 8ʱ"+ͱ$HD\!^I5`F5p{ ̱ 89 ̱`{@`8:<ͱD]ͱE HH,RoGRop;o sSͱ S 89ͱSͱ9˱ 9ZF RoGRo@]༽ `˱ tS9a5 HQQ /TQQ401鋜!xVRo@HRoptp`˱ ̱ o ͱɱɱ$d7ɱ,LL=!RoHRop sAS``(9 ̱04p<'@D9 ~H,,Y!W@qIp:T`ܯq`دⓩ3@8p =e$U @(@8^|("Gw Jwp`>@ê@#@| ~fɱ,޻`"4 s84(?t<!-JpwЫ ˱ݯɱZɱ 0ZɱYɱĬɱ$`˱,Ԯ`˱0T&@`Kp@ ̱ \`x(/@ LP `f`te`,,q=O`쐯LpX:kͱ(`2 ̱O= ̱ ^=ͱ$Nh@3(\Xқ-" HLHp3``$̱HΖ̱LT)̱Pٖ`T䖩@X@XXtIG @MpʱY`˱`˱`˱ `ʱ `ʱ`uʪ`˱T8 /GH@W|MW|punY`˱(晩ʱ,ʱ.wYʱ0P?`ʱ2Y`ʱ3X?ͱ4@<d+|`#w횳N p" úؚ ˱+CJɱ rںͱ(Һ,Pɱ8L@!7)#}x] Ox]pR& sCF@ֺ  G$ s(C@0C<]ͱH6FEO pV]!OsiC opoQ!X@R(O#@ ^u`P^upwAö \u$0q<@[HFuZ GZ QpD: ̱A`ʱY ̱/ ̱P; ̱"`D<$qQqp*a#\ɱ ܼ 5 ̱ q Ϫ,8XTfd0-` G@R Gp=2W4!D<0A`˱Do`˱HरLLͱT$uX Gtz@Rp& H`ʱ`ʱ~z`ʱ\`ʱ8z`˱'`˱Bz`˱ 8 ʉ {!Sp& ɱɱ<`˱$W`˱(b)`˱,=`˱0B`˱4xp&t$dB TBp8`$ ( 8]ͱD{H(BT4(tf !Tp~Ĭɱgݫɱɱ{ɱr1 ̱ Bɱ$€`ͱ,0`ͱ0<8J !dF@`Up ̱êɱBɱ xɱݫɱaɱ$~Ĭɱ,ݫɱ4lh $Vp ̱êɱtɱ ɱІͱpɱ ̬ɱ(I U0QS d)aVp ɱêɱtɱݫ)ɱHІͱPBgTA"|XF @W p>W  8 c` X I@  ԟ@ @X u  @ ` ,,fQ$@Wp ̱"1ɱ%êɱ tɱ^r ̱r ̱ `@3$^ά(LH$+e $/Xp ɱ)ɱ ̱xɱ$ɱ"1ɱ$Dzɱ,`B40$V%7 $ Yp ɱ)ɱ~ĬɱҪ ̱ ̱Dzɱ  ̱(Z ̱,40r0%E YpMXɱCɱ @g_}$ͱ(_ɱ,,,09s<%`Zp'ɱ". ̱ z# ̱], ̱_ ̱*)(@(<, d%[JpF"`VD ̱~` ]% ̱DԿm`Կ( ̱4 ̱8.G  [Jp`ͱ,ͱ#ͱ.ͱ~ͱ,ͱ~ͱ ͱT")@ @\Jp  F"`ͩͱD ̱,`˱,`˱ r JN7 \JpV%`Oت`˱aت =`ʱ!ʱB`ʱʱF@< z] z pX8` ?"OmEO 6`V O`6XE <c/ ]) ]ӳ ^] pR8I Z0 ˱(%ͱ00$ͱ8vͱ9s,  #^# p0x`zM(R- "@kaͱV,ͱ乫˱P@f#?#`b`_bpȀ`ʱUH@N꣪@wժ@w84!<HDD^w%ex`xpE ͱK  ɱ F( ̱4 8, <C$F%[#` #pg h ~fS uSiL@h i,h 8/x ,,cOӬ@apX:kͱ(2 ̱O= ̱ ^=ͱ$Nh@3(ӧ4GZ,a,pD: ̱A`ʱY ̱/ ̱P; ̱"gG2$bDQ@qɱ6 ̱ ̱ > ̱%R@~R6R~R /R|Rn=.GVMh cYpͯͱݪͱ.ҩͱFͱޯͱf=ͱﯪͱͱzT*gicYpEO X8@pE͹,O˹Hzιdmι\ι, \$$i<&nd`ddp G`"7 a\acҩ`&}  6r*SdedpU@T*U`PG s `˱(> ν,3ߪ`XXk\&Uqdedp`G@Tө˱ө˱ԃ෻ރ෻,c@c`IP T\lsFW@s0o@f 0o p{a4,c 8 ~ b P "t %8-P@qlG2`+f)y@qɱ6 ̱ ̱ > ̱%@!SS6@"SS /#SHSՅ',xgxp^ ̱.Ͻ7N2 ̱$`̱Y .`ʱxFG@  hl)DPm\iv@Dmjx<` o$l^oidDpkDdqli*[]*internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]44FE8#h 璯`iph?˱Y ̱ s #Bb~mͱ, ͱ-U044i o8#k(璯jph?˱Y ̱ s #D ~mͱ, ͱ-U0*struct { F uintptr; X0 *interface {}; X1 *bool; X2 *go.shape.interface { Error() string }; X3 *func() go.shape.interface { Error() string }; X4 *[3]uintptr }*struct { F uintptr; X0 *zap.Logger; X1 *certmagic.Config; X2 string; X3 certmagic.Certificate; X4 func(); X5 bool; X6 func() (certmagic.Certificate, error) }*[8]*internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*[]bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*interface { RegisterEnum(protoreflect.EnumType) error; RegisterExtension(protoreflect.ExtensionType) error; RegisterMessage(protoreflect.MessageType) error }*atomic.Pointer[internal/concurrent.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]] 6tFG%+@>CI\+\+ /x+x+p0++++x0e++I[ m 6tFG>CI|)|) /))p0t)t)))x0e@)@)Ikټ 6tFG_K@l#h$P 6tFG/K] ~M0/ ~{@?/@UDD 6tFGK ~ ~U ~$ ~$$$LLa ~h 6tFG˹ ЊPt^t^%$^$^ @^^؄ul^l^"m^^ /^^b*^^p>p7CpCpTm ~|7p|7pt? 6tFGiTr %`X9yX9y !`,>y,>y%`?y?y`:y:y&`dAydAy%`7y7y` !ʇʇʇʇe@ HƇHƇXˇXˇoˇˇ̇̇J ȇȇ7 6tFG(UVi ~ ^ ^د]د]J ^ ^@1 ~( ^( ^Q!]] ~>[$J 6tFG/& @\@\P]]%\\\\\\Q!@ P\P\=&I;h 6tFG(7Nf&&'`p&p&&& /&&!@&&0 & &Ό&&(Ťq 6tFG 7Nf&&'`'',',' /&&!@''0 &&Όg 6tFG`7Nf&&'`&&h&h& /&&!@&&0 &&Ό 6tFGtҵ` D` DDD*t$'D$'D R !D!DP%DP%Dp #D #D&($D($D\y 6tFGG ҵ=&AABR@dAdAdAdA@AA4`|A|A`AA4#Z 6tFGuARo `II5 [4( "| @HdɱVɱU@T `G6̱ ?"$ͱ0N@4A- 6tFG>cc c ;c c >X@* Xc Xc `b b 0d 0d .! c c (c (c  Zl 6tFG?JcLf Lf ;f f >X  e e d d 4g 4g .!d d \e \e $JM 6tFG.jc Ph Ph ; h h >X* h h g g  h h .! g g  g g / 6tFG>jJck k ;xk xk >X` j j `Li Li k k .!i i j j 8 6tFG@1z z >X pz pz @z z @z z .!8z 8z kTz Tz z z /#: 6tFG .@*`\\M ~[`J! ~@@ /((ʳ% 6tFG+x]5f5f0 ~3f3ffx5fx5f ~d4fd4fK ~4f4fl* ~3f3fZ ~5f5f 6tFG`Qq4y;EE;EE>y L УEУE`0E0E`EEHy E ERy L HEHEyvK 6tFGs``  / @||>+`2H 6tFG@͵`  / \\,,@@@>+`29}i) 6tFG͵`   /   \\  @0 0 >+`2` ` b 6tFGF0ε`  / llHH@\\>+`2` 6tFG`ε`  /<< xx@ >+`2ll¿r 6tFG&Hε`  / 00@dd>+`2`. 6tFG/``  / @>+`2 6tFG5H ϵ` XX /hh  @||>+`2Mڊ 6tFGZ0ϵ` TT /dd @>+`2,(Į l$  !d]ɱ'ɱɱLf`̱0`̱`̱ 0ɱ${00DY s  !dɱUɱɱ!ɱ@ Lf`̱(0`̱,+`C) 6tFGntdzZLR ՕՕ8S R ʕʕ2 00{ S PPq!`S $ܕ$ܕY@S C 6tFGsܵHB @ @ >@W 8 PB W `` @ 00rM 6tFG-> ``8 dgdg ` pcpc hh kk^ua ll@` @e@e 6tFGj4 Q`R3R3|-4-4 /hM3hM3U<-4<-4< R3R3,J` N3 N3ޟ 6tFG: Q@pg3pg3`To3To3|.4.4 /i3i3U.4.4 @o3@o3,J`i3i3^} 6tFG`2 Q`H3H3|/4/4 /|3|3U4/44/4 ~ 4343,J`33!U 6tFG3=0M !fWfWAO\dW\dW]8bW8bW 6tFG"@H9,h[,h[7w[w[6[[`P[P[@[[4~[[C 6tFG շJH9`kt`kt7@ptptX! Vttv` htht+@jtjt /xtxtUPktPkt00 cp%Jd_ ̱{ ̱ԿF" ̱?* S(X! W`gu#t.J 6tFGJ z 8z8zTzTztztzbJ(z(z /zz-`tztz! zz 6tFG7a 5@s wbwb.(ubub@(tbtb@oLqbLqb;Q ~LbLb`n_q 6tFGx%*llO@xlxl @,l,l /ll 0&l&lb*(l(l>+`(l(l^d 6tFGe_xAb=&RN1}kkTkTkfG 6tFGw `-&`X!D*@o@/7.Nxx=@/hhO) 6tFG$,1RR 2RR 2RR6RRe\R\R1RR ~ 6tFG@c-F%&J! ~]Y 6tFGd YPEb(~(~2b~~H0`~~ c~~f~~O`~~|m~~O 6tFG˹Y"0p~0p~H0`m~m~ al~l~#]$m~$m~fl~l~O`(n~(n~|m8n~8n~u 6tFG̹Y"v~v~H0`s~s~ br~r~#@br~r~fq~q~O`,t~,t~|ml>X!|IID*@LILIo`8B8B;`.LL7. I I=` D D 6tFGǺo V00X!|D*@o`;`.7.АА=`ЋЋ` 6tFG9  &`$$X!D*@o`B||7.@@N=`Bzz=2 6tFG@gx_!B / /s P PJ! ~h.h.Q!@1@1H88cGGc99&^ 6tFGW`lX/ ~ZZ /LXLX YY(]]Gbb]] )8c8c*func(*internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]])P 4 6tFG] # ~``Z``IC``l`l`J! ``6@`@`@ ``zf 6tFG`] # ~````Z@"`"`IC@!`!`@ ` `J!@  ` `6t#`t#`@@ ``*func() *internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*simplelru.EvictCallback[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*func() *internal.LruList[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*[]bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]N5GW@ɱYF 2r u@7yy @x# u-5GWɱYF LTu , ,@l,l,7,, @xp,p,# ,,u,,)F7ԫ` 7x!s1 gK   g`Q!pK 7FW@7ԫ 7x"@7 "@ X >7 P*@7 nv@7 7 xvA 7`b`>@ ` mH <f_ Qಽ QX|` ( H ̱ ɱs0|064 64UT64D64]nPdF? dd(*c .R߄eiS߄`O@iS`T߄`U߄*bbr.WindowedFilter[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*map[string]*internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]] VGG;fԩ X!d/- (/ -D*@/ԧ- @8/- //L-FL- X0G*(*` *|ͱ֩ͱ!ͱͱ!ͱ!ͱͱ!ͱ80ͱX!UhGmK K|Ṉf̱̱Ẕ f̱#ৰr 4hT)f//pK෽ K|! ̱Z$`ʱP`ʱʱa$`˱M α ΰ α̱h$>88 \ m@$Њ Њ| zݩͱpͱ nP Cɱݩ6m@$" ̱,%604Yr;9tFG˹rЊ`Њn`AP^^%@^@^ @^^؄u^^"m`^`^ /|^|^X r  L|Qͱ̱ɱ ̱hɱNn]\ /̾]4\]\$$^!^ҵຽ ҵ|ʱ8 ̱8 ̱\' ̱ ذZ$ ̱/लZ@ذw h`L,G(!6ҵ ҵ|A7=l j'yq'^LQ dXp3\F;9'6 5` 5|2e F' ̱\R˱``{h^ ̱j n<GRo RoLP#ͱU F"`8`˱po`˱5 tQDI /(QpIIXXoF$!d`Roཽ Ro|~u`ǻj ~42 ~8 s<=DL]ͱPX:گThh7PX"5 +y +y|ɱ`9葩ɱ C @Y@7@$$ s(@Ƽ08;`dPP,r{xp"M` ` |V%@;ɱH;`˱ -U(;0TJ8lJ@f@H0v"uG:(`h h|/84N W`ֱ ̱w" ̱ jͱ$× ̱(>G,ԗʱ.(JFt`#? ?|uLw) ̱W`~)`˱J`˱ tͱ$>?ͱ%H=ͱ&80*EP"A |`w  $= (=,W`ʱ0`ʱ1ʱ2F"`˱444J(#Aw`½ w|% ~Cɱ:ͱ P>@AX>@Ae@`߱$`> (^*0 \.Gq ý |5`ʱNO`ʱWO`ʱ`ʱ]%`ʱk`ʱ#"`ʱU`ʱF"`˱D$# ý x]|H@gѾ 8$ͱ,é@w-$`Bx CTT.#Ex]Ľ x]|)E E0xx$!,`.4 ΪͱLh@EPm9tFG?x]`Žx]"ټ:k:k0[*;k;kF `DZVӷ-ת`˽ |'=O * ``; ̱"6 ̱ ~x ̱$ ̱(:̩,>~8<4w<$@: ̽ z |`ڶ ̱ ` ̱`a ̱A ̱:ɱ(تɱ0 ̱8{T\*%c3a̽ a |ẫ{j 4HP#@XIͱ`T ̱d怩 h87U|S*%jͽ Y|XEJbɱX /-ϹϹ4VӹPҹlb448&-ld`ν d|@9HG@ҩ& b ҩ`ҩ$ҩ (/' ,ҩ 0L \X7:0o Ͻ 0o |%; ̱N. (ۤ0c8]`˱@PnDHp,G 8tϽ 8t|D: ̱ ̱ ̱A`ʱP@ ̱"`j.ͱ,Gm)`,н |e:ʱ˱@@*@2 ̱ nũ`˱$xͱ(*struct { F uintptr; X0 *[]uint8; X1 protoreflect.FieldDescriptor; X2 *error; X3 proto.MarshalOptions; X4 protoreflect.FieldDescriptor; X5 protoreflect.FieldDescriptor }*bbr.WindowedFilter[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*func(*concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]) *concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]*struct { value []uint8; multiline bool; flow_plain_allowed bool; block_plain_allowed bool; single_quoted_allowed bool; block_allowed bool; style yaml.yaml_scalar_style_t } !kӎ`ǫ Խ@lɱlɱ9ɱ0ɱll1J* tFG0>@H< ~| ~Jni ~& ~hI ~h}cF%x]սx]B XB NdC @O@nB gC #@C iC *FSx]`ֽx]B XB Nd `#@D SD ݬ@nB gC #@C - ~;I ~_F@ ׽V]!OsiC opoQ!6F~9 z׽ z ?"(-O  EO >6`V O`6XE Fg@7 zؽ z ?"<OEO 6`V O`6Oz XE h9.rFH`ٽ{aj,c$ 8 ~ _ Ac@ P "r %8$Vc%-Pk8F[z ڽz S@i @ @x ei ~fSSLi i,j 44?{I(&\ڽYpTɱU> ˱ ˱T ˱ ˱ & #$&,D&6 ;}*map.bucket[string]*internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*func(*concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]) *concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]*func(time.Time, protocol.PacketNumber, protocol.PacketNumber, []ackhandler.StreamFrame, []ackhandler.Frame, protocol.EncryptionLevel, protocol.ECN, protocol.ByteCount, bool)}= 6tFGXm5*% D*@p p J! ~  d d N$ $ Q! d  6tFGCeS+S+I0U+0U+ /LU+LU+p0++xX+xX+x0e++Id 6tFG'Ce++I++ /++p0`9+`9+++x0e,:+,:+IEB 6tFG Cc@ @(@( (( ' 'l'l'f'', f 6tFG@~ !pppps(o(o*ppppolplpppQ!<p<p%՟ 6tFGW4@ !VpVpWpWpsQpQp*YpYpHZpHZpo[p[p ]p ]pQ!^p^p 6tFGq !ܠoܠoHoHos|o|o*dodooooooooQ!PoPo 6tFG` s,3l]l]P]] o]o] @]]`tn]tn] /P]P]b*b]b];3`$Aw 6tFG5[ҵ!]D]D@hDhD@ ]D]DQZDZDdDdDg`hDhD %XDXDfDfD48+@RoRo4!@:X9]@ R QLfoQLpo,r$; $ 3; $ $ ϔϔ D۔D۔J\Ŕ\ŔYG 6tFG { $; $ 3; $ ,,  $ \\ bb Z Zf [[ hjhj88T"~; @+ydwɱ딬ɱĬ ̱Ŭɱٮɱ[@ڮ$; 0 !& '! 6tFG~t !s++* oQ!\\C[ 6tFG<` i ~F F p" ~\D \D J`,J ,J J ~XE XE JG G gD D @1 ~I I E E 8 6tFG@ ;` ` @    ( ( g  V4 4 ,+ 6tFGpNssk`\\ e ~! N:ܚܚ!{ 6tFGu ##X/ ## C#C#X!D#D# 8#8#`/T#T#.Y`##` ܴ#ܴ#h 6tFGn %X5-X5-D*@.-.-J! ~P.-P.-H5-H5-7-7-N1-1-Q!h5-h5-d09-09-0 6tFG0>ԽH< ~| ~ni ~& ~ ~hq|c 6tFGn`H<x x dW Ҿx x  ~Ö{>1ݴ 6tFGi>%""D*@4"4"J! ~""H"H"t"t"N""Q!""d\"\": 6tFG`<`d2d2Bu,2,2N`22`22 /`2`2UD2D2¿- Lu % 6tFGxP<`6262Bu9292N` 82 82`(-2(-2 /3232U3232¿`# D52D52LuU܍ 6tFG`<`22BuT2T2N`22`11 /22U|2|2¿- Luz 6tFG<`11Bu11N`P1P1`D1D1 /11U11¿ . Lum 6tFG<`11Bu11N`D1D1`0101 /11U11¿`. Lu|6. 6tFG<`|1|1But1t1N`11`11 /x1x1U\1\1¿. Luc 6tFGN=@<`-1-1Bu0101N`P/1P/1`L)1L)1 /+1+1U+1+1¿. LuU` 6tFG+<`00Bu`1`1N`00`,0,0 /00Ud0d0¿ / LuIG 6tFGh^uwB> K!.GL4JB ̱# ̱k ̱1Hu$uuPuuu"@uuš0ung 6tFGCX .@ijZw̓̓M ~䑆䑆[`J! ~ /xx7 6tFG? Žx]:k:k0[*;k;k][dgdg@ggF =k=k % ~>k>k]3/P 6tFGƵݧ== D=D=n==q  == & >>  3  ==V2 6tFG|q*yEE!EEUK TETEq EEK EEmXEE`EE@ EEsz 6tFGA 5  /88` غغ?L 88 >+ M 2 ԮԮT 6tFG5  / ` ?L ̈̈ PP>+ M 2 zG 6tFG5 44 /l\l\` XX?L `` >+ M 2 ; & 6tFGG`5 HH /` dd?L (( >+ M 2 `% 6tFGyɵ5 \\ /SS` ?L  >+ M 2 PP( 6tFGy@5 pp /hՍhՍ` PP?L  00>+ M 2 hhkx 6tFGy5  /` ƏƏ?L || >+ M 2 LLFVF; 6tFGy5  /<ˍ<ˍ` ȏȏ?L 00 >+ M 2 00$ 6tFG5 ԂԂ /<<` h̏h̏?L čč >+ M 2 HÎHÎظc 6tFG5 肏肏 /UU` ͏͏?L  PP>+ M 2 \ǎ\ǎ6 6tFG 5  /ЍЍ` ΏΏ?L pҍpҍ  >+ M 2 8Ȏ8Ȏ 6tFG`5  /xx` xЏxЏ?L tt >+ M 2 lˎlˎWk;B 6tFG5 88 /||` ҏҏ?L XX >+ M 2 ,Ў,Ў 6tFG$z 5 tt /΍΍` ՏՏ?L  "">+ M 2 ؎؎ 6tFG5  /ɍɍ` ֏֏?L $$ H#H#>+ M 2 ََf 6tFGࣷ5  /ʍʍ` ׏׏?L  $%$%>+ M 2 ێێ 6tFG.z@5  /P͍P͍` ؏؏?L $$ %%>+ M 2 H܎H܎l 6tFG5 ăă /ċċ` ُُ?L  $'$'>+ M 2 ݎݎB:[ 6tFG5 ؃؃ /UU` ۏۏ?L @@ ))>+ M 2 ߎߎ&vx 6tFGLz 5 샏샏 /` 8܏8܏?L ԕԕ X*X*>+ M 2 ttb@ 6tFG= 5 HH /HH` ?L DD >+ M 2 XX 6tFG`˵5  /ߌߌ` ޏޏ?L mm P.P.>+ M 2 ||㦦 6tFGG5  /̤̤` ߏߏ?L 44 00>+ M 2 00 6tFGH5 (( /^^` ?L ll 33>+ M 2 8 6tFG\5 PP /` ?L  T8T8>+ M 2 H 6tFG`z5 dd /čč` ?L șș ::>+ M 2 #' 6tFGjz5 xx /xƍxƍ` ?L \\ ;;>+ M 2  6tFGtzR5  /xx` hh?L ܚܚ t=t=>+ M 2 [ 6tFG\5  /ȍȍ` pp?L \\ xCxC>+ M 2 ' 6tFG\5  /VV` ||?L $$ 8E8E>+ M 2 {l`% 6tFG\5 ȄȄ /ZZ` ?L  FF>+ M 2 ?R 6tFG\`5 ܄܄ /YY` ?L  FF>+ M 2 . 6tFG\5  /\W\W` ?L  GG>+ M 2  6tFG5  /XX` ?L TT xHxH>+ M 2 hh 6tFG] 5  /$Y$Y` ?L ll II>+ M 2 s+ 6tFG ]5 ,, /X[X[` ?L 88 JJ>+ M 2  -\ 6tFG`5 @@ /XX` ?L  \L\L>+ M 2 -\ 6tFGz5 TT /` ?L 䢏䢏 PP>+ M 2 `[ 6tFG5 hh /ύύ` ll?L dd DRDR>+ M 2  6tFG*ষ5 || /` pp?L  RR>+ M 2 欳 6tFG]@5  /__` @@?L  SS>+ M 2 RBU( 6tFG5  /` DD?L tt TT>+ M 2 || H 6tFG^5  /ȘȘ` HH?L  tUtU>+ M 2 XX/ 6tFG_5  /ȯȯ` ?L << $\$\>+ M 2 ]t@4 6tFGi5  /\T\T` ?L ̦̦ ``>+ M 2 4"4"A% 6tFGz ̵5  /ss` ?L (t(t TaTa>+ M 2 ##1V 6tFGˠ`5  /@Ѝ@Ѝ` ?L XX bb>+ M 2 L%L%u#9 6tFGz 5 DD /``` ?L << dd>+ M 2 ''g 6tFG1]5 XX /88` ?L  dd>+ M 2 ''\!"# 6tFGt`5  /HH` ?L  gg>+ M 2 ++m 6tFG:]5  /papa`   ?L  jj>+ M 2 d/d/ 6 6tFGL]5  /^^`  ?L ȭȭ ss>+ M 2 l:l:ԞB? 6tFG S5  /\,\,` ?L  XX>+ M 2 xmxm~ 6tFG {@S5  /|b|b` TT?L  >+ M 2 dIdIX=^ 6tFG{5  /` ?L 88 >+ M 2 QQ` 6tFG{`5  /xx` ?L 찏찏 >+ M 2 QQ+ M 2 VVeB 6tFG]5 \\ /` ?L xx ܎܎>+ M 2 p[p[6h 6tFG!5 pp /tt` ?L  >+ M 2 D_D_ 6tFGS5  /̱̱` 88?L  88>+ M 2 ``^ 6tFG({੷5  /(e(e` ?L pp 00>+ M 2 ww? 6tFG2{@5 ԇԇ /̍̍` dd?L $$ >+ M 2 wwvC 6tFG5 臏臏 /΍΍` < < ?L  TT>+ M 2 TyTys 6tFG<{5  /䷍䷍` @!@!?L 00 ((>+ M 2 0z0z 6tFGF{5  /]]` T"T"?L  ઎઎>+ M 2 D}D}T 6tFG;5 $$ /ӍӍ` X#X#?L HH >+ M 2 ~ ~-v 6tFGۡ~J@e @ ``>3 ȼȼ`躗躗`J HH@DD``1 6tFGԴݵ>@Z 8 || Z Y XBZ @@ @` 00Hl 6tFGHB` 44 W@a tt>a H|H|8 PB xx a @ 00@ }}HMD 6tFG#@HB 8Ø8Ø>d 8 PB ĘĘ e || 00!`" tt@` ll`H 6tFG?`|h pp\\ttwtt$NLk #N((v 6tFGa Q`3333|@1313|+4+4 /x/3x/3U,4,4< d/3d/3,J`p03p03,$H#0 Q@0 Qd|` ( H ̱ |ͱgm6 |`-4P-4U-4t-4 6tFG0 Q`H3H3|C3C3|`-4`-4 /=3=3U-4-4< C3C3,J`=3=3B/! Q1 Qd|` ( H ̱ s0@/|@/| 04/4U004 04i 6tFG Q`$W3$W3|x64x64C`OT3T3__OT3T3 /XU3XU3U6464 W3W3,J`tU3tU300 6tFG]q% h` h`X7b`b`h7c`c`%`nbb|ībīb(| 6tFG`0)ee|-)$e$eELeLes|e|e0)*)3s 6tFG' ` n`> _ ~w 6tFG ` g pp  dd1 PP7w <<o <<~@XXզ87bbDA 6tFG ܪcܪc @c@cnccq  cc & ܴcܴc  3  ccMg 6tFG˹  l zz m zz*zz {{4zzFg`{{&zz@zzH 6tFGY h}h}?"Pi}Pi}O|i}|i}g}g}6`4i}4i}V h}h}O`i}i}XE di}di}zO 6tFGιY&$~$~"@Ā~Ā~H0`}~}~ @d{~{~#dh|~h|~f{~{~O` ~~ ~~|m~~~~gMw 6tFGV d%`ll4c<<U!<<!   =c|m ~HH 6tFG7ν0o - P3bP3ba n0b0b ~80b80bJ! ~t/bt/bJ ;b;bG.@ @g@T U 6tFG6`e!ccccscc*ccA4 `ȻOɱ7 \r` /}+ 6tFG l5l5U@ 66X/ 77( <8<8 99`/p:p:.Y`;;` = =Ti2?%@Ge4 `ȻOɱ7 \r` /  6tFG`[t &`pkpkX!qqD*@lloD@j@j;@pp`) xoxoNlnln=D /.ND 6tFG* @ֺ # ~kkJ($k$k  kkf`k`krkkhmtktkrmkk ~ 6tFGc ֺ # ~kkJ(pkpk  kkfkkrkkhmkkrmkk ~*func(*concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]], *concurrent.node[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]) bool*bbr.RingBuffer[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]]*struct { F uintptr; X0 *http3.connection; X1 func(http3.StreamType, quic.ConnectionTracingID, quic.ReceiveStream, error) bool; X2 *atomic.Bool; X3 *atomic.Bool; X4 *atomic.Bool }*func(*concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]], *concurrent.entry[net/netip.addrDetail,internal/weak.Pointer[net/netip.addrDetail]]) bool0(G@%F H ̱Q ̱Q Q#Q>QRQlQ X`$^9'I`*`G *>  !|*o Cͱ|ʫͱ}Nͱ~eͱeͱ*֩LL\?}DC H C s  ` ୯u @$r (,+< H|FGKHK(W#@yB#I#~"@hhZLP#((( `IXG 3`@ b"˱˱MŰ$P]4]]P]Q!@ 8]l]ddic s` ҵ`J ҵ`ɱ # 4 û`,E8`D5ŻP07@]X=\H@'ߓ!b\ҵ K ҵHʱ 8ʱn`ʱ2'ʱglt` 4`ʱ,0V<DDP!`5K 5Cɱ}"ɱɱVͱ$w"(@T4ͱ<9ͱ=R`@((g  RoL Ro 2aNͱ ͱ s:ͱ /ͱ!ͱ"p ~$XT )\"fy`M +yDzɱ >Ŭڮ+(ٮ+,E0!4ɱ@^ŬɱHNɱP 38< N <0sͱ:sͱͱUͱ[1V1 ̱ Ds ̱\ͱͱ`N(4uQ @##X/ ## #,#`/ܹ#X#.Y`#d#` d##00I2|#x]O x]FKé˱̪`F֫%, ",$%(,TT"1#Ux]`P x]X@ sֺ}@ * s$&x,@8p</@DZ ~H87UL<<uY@#`Cx] Q x]R& svxI J /ͱ@-@V s$Ƃ,87U4 xJ GOQq(F:!,EE)& (EEs EhE1 hEE lE EFF84(k l~`FR & ʱ`ʱA`ʱC]`˱ǩ`˱`˱ Aʱ$ɱ(۫ɱ0@<U @$!`S & ~ɱ˱v+ʱ$U]ʱ&P`ɱ(Aʱ0 !ʱ2zʱ4c ɱ8@< D$@& T & ~ɱ`˱ǩ`˱ ʱ$ !ʱ&Wʱ(`ɱ,zʱ4c ɱ8HDCi  $T  ɱ-Ӫ`ͱDzɱ ̱xɱ)ɱ pSɱ("1ɱ0ɱ8ɱ@@8:b$U  ɱ ̱wɱ  ̱t ̱Ҫ ̱ ̱ m$Rx@0 c4HDNP $i`V  ̱ɱwɱ Rɱ#ɱӪɱ$ɱ, ̱4ɱ8N2ɱ@ddv s Ǘ W Ǘ`ɱ #04 û0,E8`D5ŻP07@X=\H<||X%6+תW `:̩>~ y ! B,x58, D, ʱE, ʱF<8fu%n~`X H`F"N z{ -`  ̱( ̱, ̱0ɱ4L(F]L&ĕod`Y d&@TRҩ`$428"c˱<+c ̱DͱHҩͱI`.GGT= Z B @u@ @@@@,( @@D`D@````ɣ#GG:%Z @u@ @@@@,( @@D`D@````p8xHG@읳[ t @u@ @@@ ( @@0`0`p```mxHG:@&읳`\ @u@ @@@ ( @@0`0`p``/x|F$. ].(%ة$Fgz`(.&,&# 0&h/&` d1&0&@ 2&2&PgDDڊ{P! @5] dCɱ}"ɱɱVͱ$w"(@T4ͱ<9ͱ=R`@*struct { F uintptr; X0 *concurrent.HashTrieMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { internal/weak.u unsafe.Pointer }]; X1 *[62]uintptr }*struct { pairs_data []yaml.yaml_node_pair_t; pairs_start *yaml.yaml_node_pair_t; pairs_end *yaml.yaml_node_pair_t; pairs_top *yaml.yaml_node_pair_t; style yaml.yaml_mapping_style_t })tFGoK `KḎ@l#hq^9tFG@Ro`RoK8 jIjIpQQP9x ~QQ9! 9tFGac._!ADDs00J! ~||Q!<<fjy tFG*DlN tlklf\l1Tk1lkkr$lNk\ mU̟Fxx] cx]B XB NdC @O`oF @nB gC #@C iC *F@6 zc z # !. f`!#@f bJWaf`nf'" "N'`"@g"U"gǬF˹@Kada a@pEG Ν ,kps YQhQp| g ~8-P*struct { Code int "json:\"code\""; Message string "json:\"message\""; ErrorChain []struct { Code int "json:\"code\""; Message string "json:\"message\"" } "json:\"error_chain,omitempty\"" }*[]struct { Code int "json:\"code\""; Message string "json:\"message\""; ErrorChain []struct { Code int "json:\"code\""; Message string "json:\"message\"" } "json:\"error_chain,omitempty\"" }M 6tFG;` X!d/d/ (/(/D*@// @8/8/ ///N--b*--F=`--,$2"*nl#g @~} ̱ Q`x(/`D e;hH`g^KK` n 6tFG`_C ! !s*oQ!BI 6tFG`rK M ~aaM ~H`H`" ~[[[[i\\M@x3@(_(_@XTP4GQ@D Kj K犩˱j˱"˱˱ک˱ ک˱(˱0j˱8j˱@˱H~]˱PX1m4G ~ `k K ˱J˱:˱ک˱ک˱ ˱(]˱0˱8j˱@g˱H˱Pޓ 6tFG*D bN ttkf1TT1kr$$N\\HD2aHm m 2r 7ɱ7ɱ7ɱɱQɱ$mͱ,⴩ͱ-mɱ0mɱ8ީɱ@\TB!4oҵn ҵi" s!Oʱ/ Z@w$>ְ,J <'RD&`L4Pm 6tFGq༼Ro II5 tQtQI`LILIWIIII /QQ: ~v ~,Q,Q 6tFGB"Ro " ~8N8N ~NN~ ~HNHNpE  (N(N$p N N3\>N\>N'ȑNȑN.pČNČNG 6tFGd}Ro  :@NNxNxNGS \N\N؄uNN4N4NNN NNp@NNo 6tFGW@I ؄u22]]G WWL@ 00:VVh|l|laaep1p1HD.hm`r LT7ɱ7ɱ$7ɱɱQɱ$mͱ,⴩ͱ-mɱ0mɱ8ީɱ@O 6tFGpz+ $; $ 3; $  {{ $ TT  l lB;x^x^%cc ZZ@4|"` t `˱m ɱ{ ɱ  p@r'$r (;l,r s4/ͱ<Ѐ 6tFGŐL f@``2 xx؄uDD@||;ngunuHHbuģģu<Ǥ<Ǥvu4( zQwQ  # #X/ #h# 8##`/T#б#.Y`#ܲ#` ܴ#(#K 6tFG.i@X ! Nd@L L s\ \ dž@B@!i! +$h w )̱u̱`˱)ֱ =`ʱ `ʱ) X!=/s ױs`ױi 6tFG~  `\\) :||W  N00@) \\ H H LLCw# `y ɱɱ%ɱ!`uɱ Xͱ(ɱ,Vɱ46ͱ<Pɱ@iܩ Hv 6tFGD\@ ҙ)dv  @)7777 ~017017,,%5#| { BmͱNͱ Zͱ ɪͱ >ͱ q> Xɱz~ͱ$+@( 6tFG` .@44?<<?ԩԩ:C M ~[` J! ~ / 6tFGNnԼ .@̡̡sZ((nntt `袆袆M ~[`J! ~TT /<<uPA 6tFGNx]  *gg]`*ggT`G $g$gJ,G ggT ~gg [tgtg0g0g^gg^,ggTN 6tFG`c !Jx ~59 / $o$oToTo o oDnDnA@ooƤ 6tFG"ڼ'~ %D*@J! ~88$$PPNėėQ! xb俇俇$ 6tFGr  5 ƊƊ /NJNJ` NJNJ?L ɊɊ ɊɊj >+ M 2 ɊɊ G @ |ʱoͱA ̱>ͱVͱ KǪͱ (ͱ ͱ hͱ ]Ǫͱh+ ̱D@aAYH"b  Hɱ(]ʱW@] h;߽I@@@@$S @,ǩ4P8sͱ@PP$!  ̱VO@3]ɱͱ ̱ ɱpɱ!@/$Ҫ(O4O@O@3L@8)$J  ɱ ̱t ̱ Ҫ ̱̂ ̱a ̱`ͱwɱ ̱(Mɱ, c4@8a$G  ɱB ̱DDɱ ̱t ̱Ҫ ̱̂ ̱ a ̱$`ͱ(wɱ, c488j_֜`%N ת @&PhI` N@Tx@Tvͱ$̩ͱ% ̱(̩ ̱,̩ ̱0K i4 {*` J `˱7Կ`ʱ`ʱ,ʱ``ʱny`ʱ~y`ʱ`˱ͱy/T 6tFG])]] __ $s_s_`__J!j~_~_v<_<_C|~_|~_$l_l_2qX_X_@ 4t_4t_y 6tFGlw]q  l`l` @m`@m`P $m`$m`E l`l`Rk\m`\m`P`4r`4r`{`r`r` m`m`_ (n`(n`r 6tFGyb < ```3aa'aaj4(b4(bQa (b(btata>+``L,t%9 a a ܀ H@(#48<5` DͱEQͱFi#ͱGQͱHWC,_@f @z7 ,`ʱ@ %, ̱M౻@ ̱v}@%DzDDQL%~~rH HZ$#N`PF ̱yɱb ̱,l ̱0wb˱40@@v<ov@e-V 6tFG,- &`  X!D*@o/<<;@hh7.`) 88N=/1 6tFG@Y bd~~PE@^d~d~2e~~nd~~H0`<~<~ ^~~f~~O`~~|m~~aDN 6tFGY bd~~PE@^P~P~2e ~ ~ndx~x~H0`~~ ^Ѝ~Ѝ~f~~O` ~ ~|m~~L8iH&od@ djc0>b!ߪb(34T8U<nͱ@eD~ͱH='ͱI`ʱJj 6tFGd <#O  gbJ``f̬̬ 䳃䳃hhhg ಃಃdT/ &9 9`G@bc@b$* ̱87 ̱<V ̱@G ̱D !Hө ̱LG@bPdTӲ8&` `Gfcf$* ̱87 ̱<V ̱@G ̱D !Hө ̱LGfP}U 6tFG. &`X!``D*@o B}};@7. `) ЈЈN= B8{8{S 6tFG %<_<_D*@WWJ! ~`_`_L_L_u` ^ _ I@_ sY Q I ! ^ I Nu`! ?^@ F@\zzx x E@  S@i @ @x ei ~fSSLi i,j HFl ddV]!OsopoQ!4 T_#p_@#p>. F J*go.shape.struct { SequenceNumber uint64; ConnectionID github.com/apernet/quic-go/internal/protocol.ConnectionID; StatelessResetToken github.com/apernet/quic-go/internal/protocol.StatelessResetToken }>GFp@Ns畩ask`\ e ~D! @N:ܚP!l~n9tFGC@} W<&b`d eer ee/b`d `e`e| ee[`d W$ h`d e$ +C9tFG}`W<&b`d eer ee/b`d PePe| |e|e[`d W$ h`d e$ BF?ࣾ(  l54U@ 63X/ 77( <8X2 9D9`/p:1.Y`; ;` =X<l4GO@Aqeqe8@!7J> /.*interface { FindDescriptorByName(protoreflect.FullName) (protoreflect.Descriptor, error); FindFileByPath(string) (protoreflect.FileDescriptor, error); RegisterFile(protoreflect.FileDescriptor) error }d`dC` CI@f /ͱ$,@(@@0b8fP(1 TGJX[`\Hש ɱ`84ov|\{ K@ Kh3`̱li`̱ αhʱ /`˱"`vi #`̱#`̱ #F$#F, E4Q1F~U Zٺ` F`J3Y3 '4f @~   'Ah3$8+>aYҵ ҵ8 I ̱ n԰QͱQ@n@Q 0ͱQHGͱ D@.lXD".੾+ypwɱ.`ɱDzɱGɱE ͔ɱ$ԫɱ,ޯ j4+"+",tt#" ~%ɱ!Īɱ`˱{˱ɱmɱ$ ˱,˱4yɱ<ɱDj L~g `(S`Bx] x]$ ͱD‫˱Hn˱P+@wX\>Bpkt/֫`˱xG֫`˱|_֫@w>@PD+9L%"@  r,` ɱ!ɱ`Dɱy,@ %` ;$ɱ0ɱ8ɱ@ ̱H> ̱L AF8 z` z /-V ia?"OEO X6`V O`6 `KXE 0FLű@,!, ~QrWD+Q@rfD+:rN-+r3+@CF Qg ~T*~oXP^%O^ ^`>  ̱ ̱ b ̱@wZ$`̱ . ̱, ƹ0b`ʱ<-Q@FLxp &i YEO /zI`I ҩ qݪͱ,hEͱ-U 0~@]Xe`ؽ``O*hbp@@hY2P&Eodా dTU@Tҩ ʃ@TUD֩@Te$U@T(0K'@4h8v<XTR8X&>id d`˱ s`G@T ` n(g',U 4! ˱<ɱ@ ɱHqɱPtt2n"  ` d~%ɱ!Īɱ`˱{˱ɱmɱ$ ˱,˱4yɱ<ɱDj L~g `XX# x] x]R&`~ĩ kS`J-J 8E˱$p˱,ĩ 48 <ͱD /H܂LpPXX~)#. `x]` x]R&`~ĩ kSJ-J 8E˱$p˱,ĩ 48 <ͱD/H܂LpPXX> # x]@ x]R&`~ĩ kSL-J 8E˱$p˱,ĩ 48 <ͱD1H܂LpPXX܈# x] x]R&`~ĩ kSL-J 8E˱$p˱,ĩ 48 <ͱD 3H܂LpP-& 6tFG .wl2l2$#$#Dd?\!\!qDDXX*Nd|*|*] 6tFGGC !**d*d*s*******o****Q!**!**!**mo 6tFGn[ 1Y1x1@1r 6tFG  `0^&0^&$f_&_&YJ`&`&bJa&a&D*@a&a& @b&b&c&c& /d&d&N%%b*0%0% [0W4@ 4WŻS`ʱY&ͱ !Vp@VpWp\Wp*YpxXpHZpYpo[p[p ]pl\pQ!^p]p 6tFG  !ׇׇ؇؇e@ ڇڇۇۇa+@͇͇ox݇x݇Z@͇͇<߇<߇͇͇J 44Jd!.ҵ@ҵd8 18 !Oʱ,d 0`DPDQDqTDRD 6tFG6`ҵ !@@u5@@;p@p@2H@H@:@@@@ @ @L@L@@@tuƄ 6tFG`}Ro pMMMMxMMϒ'MM tMtMڒ$M$M MMfJMM\lh\t*x"`w྾wd@@Q(<CHI൴T[ɱXpTͱ`ɱdJ(`BagT Cb: CDg Ea\ 6tFGeżw f(P  [` ~ ; oI ~[ ~ƓƓ; ~@ʓ@ʓSB 6tFGN  @#@#X/ ##F#F#X!TL#TL# ##`/ܹ#ܹ#;@4L#4L#.Y`##` d#d#`) N#N#O2 6tFGҨ@˼  L,"L,"X/ B"B" '"'"`/%"%".Y`O"O"` lM"lM"."."&`* 8*"8*"g@D"@D"j%"%" 6tFGG= @ @  nT T q  h h   =  " H1, ,   ] 6tFG  %f-f-̎m-m-D*@ _- _-J! ~te-te-|f-|f-,i-,i-N b- b-Q!f-f-dj-j-ztn-n-ޗ 6tFG.j1 `y y ; 4y 4y >X* x x * x x x x 0x 0x  `y `y .! Lx Lx k hx hx  y y l 6tFGw@N .@<<|ZsZnn䚆䚆XX`M ~[`((J! ~ėė /? l 6tFGn`µh Vkk]kk!pkpkOlklksXkXklklkoPkPkظkظkpokkQ!kkћ 6tFGx] !UkUk8Vk8Vke@ WkWk`,iiXkXkodZkdZk[k[kN iiJ D]kD]kii0$YzO| @x]Ǿx]dPJ /f87U E ͱ,ͪͱ-!,@k?k`,Ak@koCkBkN HEkdDk VQ 6tFG`Ǿx] !,@k,@k h h`,AkAk*hhoCkCkvCP}>_!@>>sP>P>J! ~x}>x}>d}>d}>>>Q!T>T>=&F ~~>~>\ ~}>}>T&v 6tFGz@ʵ 5  /bbE+ cc` (ˏ(ˏ?L DdDd >+ M \2 ttd~ 6tFG\ 5 `` /E+ ԊԊ` ԏԏ?L  ||>+ M \2 ԎԎI 6tFGz˵ 5 $$ /jjE+ PkPk` |я|я?L ll >+ M \2 X̎X̎~> 6tFG6 Ƚ S+ HH5 ̅̅(  /` DD?L tt VV>+ M 2 D+ M 2 EEF 6tFG` 5 O 4#4# /8/`##` ?L  >+ M 2 ii2 6tFG 5 ll /̞ Aʊʊ` H A?L  gg>+ M 2 **| 6tFGb cO xuxu vv{Q zzB DD R ||@ H}H}o ޅ| + P[ 6tFG=O.z f^z LOZX!Zgnz [OZvvHEh8v 6tFG>|஻b ^`n``< ``|`|`#`'``8`3````=`'``J! ~``^|n0`0`Z % 6tFG+mz #tRctRc|qQcQcS4RcRc#JScSck ~PTcPTc}×W*$ xӾxdi `Oɱ%̱ -@v$F ̱? J*+l8/m8/m 83m83m 5m5mo8m8m:m:m0&m0&mtb] 6tFGr; ~ ~`$%FF0 ` 6tFG:@ ,`GTFF@F@FJ ClFlFs`U@`$[ 6tFG @  H9   7lll0>Q 6tFGZa, %PjPj_!/sssPpPpJ! ~xjxjdjdjrrQ!TmTm=&F ~kk\ ~jjG7 6tFGعd #`HÃHà ]#],,bJȃȃfWa] ă ă  ȃ ȃN'|Ń|Ń^$ƒ$ƒɃɃIt* 6tFGl X/ ~'d&D*@c ~55 /55c77N0 6tFGDWȖ SW ~2`>`ddp ޟޟ8H ~ ~ y ~o`00=`N 6tFGDW.  **SW ~''2`<.<.>`//p &&8H ~)) ~))y ~h(h(o`**=`|,|,l{} 6tFGDWg `qqSW ~oo2`vv>`wwp mm8H ~pp ~HqHqy ~,p,po`XrXr=`@t@t*struct { Success bool "json:\"success\""; Error struct { Code int "json:\"code\""; Type string "json:\"type\"" } "json:\"error\""; EABKID string "json:\"eab_kid\""; EABHMACKey string "json:\"eab_hmac_key\"" }*func(*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]) *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*func(*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]) *cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]{! 6tFG1@Ӻ] @$`$`# ~#`#`J(D*`D*`g&@x%`x%`  *`*`f*`*`6T&`T&`hm'`'`rm)`)` ~5 6tFG)DӺ] 0`0`# ~\/`\/`J(6`6`g&D1`D1`  6`6`fP6`P6`6 2` 2`hm@h3`h3`rml5`l5` ~>Z 6tFG @x] Nd HkHk`/kkCH kk/kknH HkHkS@hkhkSkkJ ~6g ~}`:O 6tFG. x] Nd  k k`/ k kCI H kH k 0 k kn@I k kS@ k kS k kJ ~6g ~*list.List[go.shape.struct { SequenceNumber uint64; ConnectionID github.com/apernet/quic-go/internal/protocol.ConnectionID; StatelessResetToken github.com/apernet/quic-go/internal/protocol.StatelessResetToken }] ``(4@ʱ`0^&L%$f_&%YJ`&%bJa&%D*@a&% @b& %c&% /d&%00h #_`E@X@L s[[[% @N(O\boaocoboo eoXdoxfoeopogo0go*list.Element[go.shape.struct { SequenceNumber uint64; ConnectionID github.com/apernet/quic-go/internal/protocol.ConnectionID; StatelessResetToken github.com/apernet/quic-go/internal/protocol.StatelessResetToken }]TH#| \Oɱ :kɱ zɱɱ$ ɱ, 4w`87<ͱHͱIF ̱L٭ ̱P6`mC .f `z,y,$f{,8{,YJ},|,bJD,~,D*@,, @L,,I4,d]+0,ă, /D,,(ߧ /G*4K K"`˱A`ʱG`ʱ"`ʱL`ʱ" ̱P2`̱ H̱[̱ẖA-̱٩̱ ̱$40\`K KE@3"`ʱH3ͱL`˱˱ P3˱M>  ̱(,NiE0bv 4GC K KƊ˱j˱4˱j˱氩˱ ˱(.]˱0˱8(˱@9 Hъ˱h>]˱pN] xdd0!7ҵ` ҵA7=yy j'q'^oRͱoͱͱFͱM d T1d`<<cHp!rRo@ Rop ̱$v`˱7`˱7`˱ `˱ͱ}@ ˱  ˱$Bԯ(@,"0' 4PPʀ!w|Ro Roh/ɱdͱ6˱!ͱ$ɾ(5 4R 8ͱ<8@ ͱH¹دL T(f WmǼ5FD mLr>Tm\ͱlͱmg@p<xݩ ; A@*59tFG~@x &/ `) tt:WN@)  HD6w#/x] x]=+Tث˱ a˱x@$`+(R& s,W4-`8W-<- .@#ͱD KXL$`HLWŻ(]ʱǩ Psɱ!wxv xw*d ,2J,2JNd 1J1J'`8J8J6J6Jf(J(Js*J*JQ!,.J,.J ~^d2J2J&J&JN 6tFG}<6$ f\ \ s̍ ̍ 1 @ @ k` e J!`   N  : JH H C ` 6tFG^j`? " ~U' ~tWLL@@ u@R@ԅV 6tFGA e* \`0`0`|0|0Ho00'P0P0e`00J! ~0~0~0~0Q!0000Ë  00700:g 6tFG?` @ TT @@H9   ȘȘ7l>hh044A6` 6tFG~`0  9 dgdg: lhlh'@: iiejjkk 0l0l`ll /mm8>pnpn@> o o0< oo馃 6tFG`1  9 pp: qq'@: ssettuu uu`|v|v /pwpw8>xx@>xx0< xyxy*S 6tFG`Z8 \GG`GGHoLGLG'GGe`GGJ! (G(GGGQ!pGpGGGË  GG7GG 6tFG` >_ ==@ GG8 BB` @N@N _ p?p? OOM II lDlD`! R R]\! (K(K@ `A`A9+a 6tFG `\ \c|\c|~z\ Xd|Xd|jO!Eb(4l  ? 6tFGbJ`b TRnTaTaaa /aaa aalaaM#nHaHan|n(a(a9aaOaa@a@a a aXC 6tFGI$ i ~eep" ~eeJ`eeJ ~eeJpepe gee@1 ~\e\e"-]\W4c^ 6tFGSg \xġxġr`HšHš\š\šlơlơSơơȡȡ /ɡɡS S.G 6tFG SVSVnhvVhvVhbVhbVwVwVTmVmVzHVVHVV" PVPVF# ~ή RVRVCh 6tFGY  11?"<2<2O22@3@3/\4\4EO 446`p5p5V 55O`x6x66`66XE p7p7NH5~ 6tFG>id f`ll"f z!llrag ((΁ ~ u' ~|m' ~ 6tFG΂@ ddidtt ~y ~s ~)``k ނ`||)`   6tFG΂ RRiUUdSS ~8S8Sy ~\Q\Qs ~RR)`WW`UUkPTPTނ`XX)`VVt 6tFGv@`  $$8 =@((6# V% ĽĽ7ll2J|m ~I] 6tFGxb] Z @ .`.`nP,`P,`0,`0,`w  .` .`P,`,`F+`+`,`,`7`@ l-`l-`R,`,`Z ~n1 6tFG պ@A % ~|)k|)k @*k*k /)k)kaZ'Q@w@@BTxFGn[ (D˱H˱1Yx1@140CdK`KK α> 5` lḺuL α α̱ α s#̱$/(h α,툩ͱ02ͱ1C٩ͱ288϶4~\9KKJC99 α ٩˱٩˱p3`˱ iͱ$Kͱ%Lʱ&`19(i9,i90A{4ppc@qKK EJC"` 04ͱ pͱͱͱlC$˱X?ਰ`i dh`ltl<7 ] r 6mUݩ@<7@$7ɱk`˱I˱ q ( 4 ͱ@#ީͱAo D P \ htt" n  /8"ީ@3ǰ` :nF8ީF@ ̱H` ̱L5 ̱P̯T@X/ͱ\jQ`M`LL b{!Ro6ɱ ̱'ɱ  ̱ ̱5 D 6˱(ɾ0!ͱ<ͱ=R @RnDeHd\R._"!` "Roɱ!ɱp9ͱɱx9ɱR $ɱ89 ̱@9ͱDoͱEoұHͱLɱPoXX<to!BoRo#Ro 1Żfɱpe2$a(,rɱ098pJ@ sH ͱP ɵOh+m~W|$W|* ̱Y "yT +&©2©ͱ>©;B s_ s m`Ӽ{`Ӽͱtd?d#:- x]%x]@wuD+T`F C ׼( ׼,!0L<9D$L9D׼TdU`Xk\׫ ̱pY};F.px]&x]B XB NdC @O`oF @nB gC #@C iC *@DM o`hdi$Dc'~̬ɱLaɱ]ɱ!ɱ@/ wɱ$ɱ,TͲɱ4P<SH4@3TI@3X ̱\|ɱ`\\ԝ$}$@(~̬ɱ]ɱo ̱n U@$Ҏ$($4n@38Wı@3<ɱ@r%Hy@/T$@/XldB$)wЫɱmɱ~̬ɱ]ɱĬɱ dɱ(dɱ0o8 ̱DnHnLm@3PҎ$Tı%`S~ * *J `˱%Կ7Կ`ʱ`ʱF"`˱'`ʱ8`˱ͩ`ʱpʱͩʱͩʱͩʱ6YF6 z+ z /-,c\ VX8` ?"zOpEEO 6`V O`6 m`Oz XE tt%mz,mz ϩQR& sj (Q0 8x@d4H.} Lڪ`0xh87Ul*go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }*struct { Strict bool "mapstructure:\"strict\""; IPv4 []string "mapstructure:\"ipv4\""; IPv6 []string "mapstructure:\"ipv6\""; IPv4Exclude []string "mapstructure:\"ipv4Exclude\""; IPv6Exclude []string "mapstructure:\"ipv6Exclude\"" }*go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.902903003faf34a055924cbe1de57446bb60c6dcbdda00962fff07e2be322cb9 }*[]go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.902903003faf34a055924cbe1de57446bb60c6dcbdda00962fff07e2be322cb9 }9<6xFG~ 0  9 dgd: lhD'@: iejk 0l`l /m8>pnt@> o00< o)HxFG 1  9 p: q'@: sP et u ud`|v  /pw 8>x@>x0< xy @<P@ (% Q2 Q|` ( H(ͱ Cͱ ^ͱͱx'˱0<˱Rͱ ʩ ͱ(-ɱ8|/4/4U4/4$/4l 6tFGYcC 0@+@+Ҭ++l+l+!++++++oT+T+++0(+(+"++3\TliXZ x C4CJ1 T" ̱J@`f ̱$1ͱ(ͱ)1,8M" @J`˱T$,ͱX1ͱYJͱZjfͱ[,ʶXG[@y K5KSrh`˱QL ˱e ˱C٩`˱ k`˱2`˱q`˱cL`˱h`˱ ˱$2`ر(w ر)*׈`ʱ+@ 6tFGt8`Ro GKGK' ~EKEKZlEKlEK5IKIK VKVKo(8K(8Kp>Kp>KQ!RKRK dJKdJK7TSKTSK ~$VK$VK!SKSK_,+|v sRo7Ro 4LnX8îVͱ$QQ5 QDQI`Q8QWQQQQ /QQ: ~v ~QpQHH{th!~Ro8RoX9n;`? U7 J o0 ̱$ͱ(Vͱ) ͱ*~d˱,b˱4 s<ɑ`Dwag 6tFG  }Ro Jx ~DHDH rHrH  pHpH1 XHXH7  @H@Ho Hu α αV α α M α αXd ک e۩̱ 2`ʱ$INͱ%P`ʱ&Y`ʱ'H4̱(r۩̱, 6tFG?* |q\|q\  Xs\Xs\>X  s\s\r\r\tr\tr\q\q\O@(u\(u\.!Pt\Pt\ /v\v\q\q\t\t\ 0u\u\9Q 6tFG>j`* w\w\` y\y\>X` y\y\`y\y\`x\x\`Dw\Dw\O@P{\P{\.!xz\xz\ /|\|\x\x\z\z\ 0|\|\zSSE 6tFG>* m\m\@* \n\\n\>X@* n\n\`(n\(n\`m\m\`lm\lm\O@,o\,o\.!n\n\ /p\p\m\m\n\n\ 0o\o\֞>X 6tFGS`x] $,cf,cfE pbfpbfSpfpf! ~\of\of qfqf ~qfqf ~rfrfw@pfpf$ df dfhfhf++ ~,lf,lf~ 6tFGPx] G X hX hD-hhD`  h h! !h!h H hh4@H ( h( ho%%h%h7hh@8h8h,%hh @(h(hx ~hhLL (#Do;-84 o0 ̱ +Ϫ$ĩ˱0ũ˱8pͱ@/ͱAh:ͱBqͱC$pͱD87 H 6tFG_ V@n@n]+ M A`2 00r# 6tFGz̵ 5 ІІ ȌȌ /ttr @u@u8/ O 8ό8ό`  ?L uu |u|u>+ M A`2 d<d< 6tFG` !ww x xsW B<<qHO *W  !!8  c`  X   I@  \\ԟ@ ))@X L'L'u  @ ` <<W 6tFGJ?t ^ VV.@ YY D]D]f 8`8`f ,c,cy@ @p@p LmLml iiJ llw f fK` 661UUtlQ$s ǗLǗHʱͱTͱߩʱɱ|Uͱiɱ ջ (~a`4/t@L_XPd@1hӿu 6tFGq!x !hvhvuuvvi0v0v? vv*XvXvvvovvvv@v@vn@? uuN> vvS 6tFGe@ҿ~ !#F#Fs !F !FJ!f IF IF ~;F;FF ~7F7F ~\bdAFdAF$ ~+F+F DDFDDF(@F(@FQ ~FFP$FP$F| 6tFGp   x"x"U@ }"}"X/ "" ("("`/"".Y`x~"x~"` " "`}"}"@`X|"X|"ń*$ 6tFG @  xu"xu"U@ r"r"X/ t"t" (v"(v"`/v"v".Y`xs"xs"` t" t"`r"r"@`Xq"Xq"ń*lSd 6tFG   o"o"U@ (m"(m"X/ Xo"Xo" p"p"`/@q"@q".Y`m"m"` n"n"`l"l"@`k"k"ń*,h 6tFG   z"z"U@ (x"(x"X/ Xz"Xz" {"{"`/@|"@|".Y`x"x"` y"y"`w"w"@`v"v"ń**func(*internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]) acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]^b|'`T Њج ͱՆͱͱMYLwYɱ `a=xy+GD&$^+'^t7^`FSU @Zٺ` F```J3Y3 '4f W@r~   'Ah3u<(@ VwЫɱYɱlYɱɱͱ ͱ! ̱$ìͱ(ܬɱ,$kɱ4 <iI PYvdYԮ s*acl.compiledRule[go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }]*go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket }\\E!wY w"ͱTDɱ r@BͱTrϮ(4:`<OfDTǻL7@$T`uX\x-|z፽9tFG Z8 08\GG`GGHo4G4G'dGdGe`pGpGJ! GGGGQ!GGGGË  4G4G7`G`G0tFO[ J| -*"ɱF" ̱ #" ̱#Կ ̱$ ̱(_ ̱,f@X!Iӣ /*[]acl.compiledRule[go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }]*bbr.RingBuffer[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.902903003faf34a055924cbe1de57446bb60c6dcbdda00962fff07e2be322cb9 }]*func(string, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]) *internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]%,dhC_C @WŻ["Jͱ]ͱ! !s*oQ!Hh/G'G`N% O% O5 ˱%% ˱,% ˱3% ˱5 ˱ 5 ˱$:% ˱(O ˱,O ˱05 ˱45 ˱8k ˱<A% ˱@5 ˱Dd`?/r UaɱZɱɱɱNɱ ֊ɱ(ɱ0ͱ8@ɱ<Dx~HٳLX@P~TҰX+ɱ\d`!se ҵbҵHʱͱTͱߩʱɱ|Uͱɱջ ~a`(/t4@_LߩͱXP\$ͱ`"bTTs')#`~cb@]jc@zͱ .`Mͫ˱ ͱ.q@ M$7 (R& s,gu4[@ݜ@7H[ NLד@cP@@}` dV/G\@P\  ~ q ~qtWu @$ ~(Ϫ<,Ъ<0/ ~4 ~8=@<L@)]$ ($x@eT[ ̱pA ̱xAɱ\ɱ n^(\@ͭ<+ ̱@"+ͱD!ͱE)+ͱFAͱG0+ͱH7+ͱIͱJT0RVp$sBfBɱ`]@ϭ  ̱t ̱x5ɱ$,ǩ ˱8`˱<+ ̱@{ ̱DtͱHI ̱L]ͱPfMFJg` >@ >T 8 ` J` U U sU V @V 7  `  V V {` V` ` @B ɟU % @ |l6m% ǗhǗ&3ͱ !Oʱnͱߩʱ>˱x8ͱ( ,18mDSP^a`\{ɱh&˱p8`˱x|T%5תi:̩>~ yO * nx`;$0<HTpD`Vl !xH~ͱ֦ͱ,C.s* jJ `˱DʱDʱ`˱`˱%Կ7Կ`ʱ`ʱ.`ʱpʱͩʱͩʱͩʱͱ) kJ `˱`˱ͩʱͩʱ%Կ7ԿDʱDʱ.`ʱ`ʱ`ʱpʱͩʱ`˱ͱ*acl.compiledRuleSetImpl[go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }] 6tFGC ![*[*\f*\f*(]*(]*sW*W**l]*l]*]*]*a+@Dc*Dc*o_*_*Z@d*d*ha*ha*Q!Y*Y*Q ++Q/ 6tFG ! e@  a+@XXo Z@88$$J ||< ~xxsQ ~DnԊȚ 6tFG4mҵ i ~PDPDJDD@1 ~lDlDeRt?t?Rh?h?Sq?q?8 ~ ~a@wLp?Lp?>[S 6tFG Ro u8?`p@X` d d 8`  @   W5@ h h  N'" " .!| |    ~% % M¼ ~$ $ ,(#Ewd@; ^˱ټ J$Eͱ(V|4o3o]5o 5o!6o(6oO7oD7o9o`8oo:o9o;o8;o . 6tFGͷǗ  ) )i`$)$)V V 3L)L)#K`((.v**`++µ x,x,`))`h-h-^(*(*~at)t)((Q: 6tFG_੻ ##&`X!0C##.Y0;$0;$s##|?$?$$##ѠP#P#`C\#\#d,A 6tFG(a (@c@c})\(# ~Y 6tFG=a {a4tlbtlb,cpbpb ,kb,kb|pb|pbpbpb8 ~lblb b mbmbAc@ nbnbP DmbDmb"t kbkb%HobHob8obob-P@qTjbTjb!fQ 6tFGCࡾ &b`d leler ee/b`d ee| 8e8e0E@eeE@0e0e*eeee[`d W$ h`d e$ 1 6tFG`  @j TT&`X!88 C6ll^@j <<0B ppsj 008C@j ȰȰ$$$ ,, 6tFG  j \"\"&`X!,, C@PP6``^j D#D#0B $ $@ddsk $$8C@##j ""$Y 6tFG  @k &`X! Cuu6܇܇^@k ЎЎ 1``B@ sk 8CDD@k \\$6K 6tFG  k &`TTX!|| C@Hh Hh 6~~^k `1||B @sl ܀܀8C@TTk ll$r(< 6tFG ^ ! ~rr.Grri ~"Qrr#$r$r@\r\rJ@1 ~ ~>[,N 6tFGgY H0`XJ}XJ}   ?"  O4 4 H H /DJ}DJ}EO I}I}6`PPV llO`6`J}J}XE Tt}t}DS9 6tFGϽ8t %_!@As||J! ~̗̗HHLTTQ! `=&F\ ~LL^l3 6tFG5WȺ6 &` ~||J!6|( ~|| } }t } }(@'@7@||2}}x}}*func(*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]], *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]])!F@SXn ŎQ@w335N@@8bnln vnQ@Ў C ێuQQ@n3@*func(string, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound], time.Time) *internal.Entry[string,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]~&ɱo ɱy5 6 w ]0 `BLy`6ͱ ͱ t`{t{yz@,,1ɱ 7w? ਼ y7T|ͱd˱x8ͱ( ,ฮ8mDSP^a`\{ɱh&˱p8`˱xp3|5L(#@v` ɱêɱI ̱xɱ Iɱ(y 0C Dܬ XЫ`blĬ|%ê`ݬ`DzɱZzͱwɱ"ݬph #D\z&* -*   4* Pv ;*  Zv X`$阩 @ H`P`Tx5ɱXZ$ ̱`dh(} x]x]xo[ͱp@- x[ ~[@]07jWK @w(ĩ@w=qWTͱ\!O@N`eE@d;%hh@EpN`t87U|#D<)~r 6 ̱ QRƩ  (ڪ <坩 PЪ ̱dZթhCl\x8^Ʃ`ȻЪЪV`_`*struct { F uintptr; X0 *udpnat.Service[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]; X1 *context.Context; X2 *udpnat.conn; X3 metadata.Metadata; X4 go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }; X5 *[11]uintptr }.A2FGMY )p~?"@*d~<*O@+~+~EO ,~6`t-T~V -D~O`|.86.(Ot/~z 0~XE 0t~h91~ƍC 6tFG.wZZ>>?<<bd.Xb/JJ&4*4*Xp'p'*TTlFlF:! 6tFG< \/\/Y@ T/T/`//` 0/0/X!//8/ ..Y`..MT.T.Blp.p.p`IP.P.9q2 6tFGK#  ~Xi ~. ~ ~X3bi#  #@`3@03 ~K 6tFG6 5HoH988 ~! ~`4848ʐ88288R88q)6 ~ʻ 6tFGS@^euu uu ~uu? xuxu?PuPuYuu?uu?uubJuuI,u,u /uu4Z`uu=Ztutu.LuLu5 6tFG>`x] '[XhXhhh4h4hϜF hhF `h`hF hhSThhhhhh.oththhhs? 6tFGD`x] !^k^k_k_ke@ `k`k` bkbk`,,/j,/j(dk(dka+@tektekofkfk,hk,hkikik! jkjkN D2D2C ~`22|t2t2`22^&3&3|Tu 6tFG Z0 $U$U@%U%UfC ~>C ~` $U $U|` ~(U(UF55U5UZ58U8Uk*G 6tFG/ @r,!X!XpDDM ~<X<Xz~XXC<X<X ~dXdX ~N0*X0*XXX>+XXXX4#X#Xf~&X&X6s 6tFGN`,KXKX7X7X 5X5Xz~= AXAXNvXvXN8X8Xv$XX MXMXW 6tFG o  hhS@i @ \\@x ei TT~fSppSLi i,j Jo 6tFGV`Ag ĝĝh -~ȿȿfS违违 uSؿؿiWSL@h ǝ ǝi,h ƝƝ8/x TÝTÝ6T 6tFG*S*S@4?S4?S`(S(S`)S)Srt:St:S~`08S08S(5S5S(X5SX5S 6tFG$g 44h $$-~00fS PP uS@@ippWS``L@h LLi,h 448/x ̹ 6tFG=ͺ # 躛躛f   $ 7`$ ll+ԳԳf䱛䱛 $ ( ~7  `$ p;TTh92<@  ~h 6tFGh i # ~yyY`yy8dydy*`yy= $y$y dydy*C yym TyTyN'  y y.!yy{@= yyYBa ~]F!@U@Xn ŎQ@w335N@@8bnln vnQ@Ў C ێuQQ@n_!h` 3@5GpɱYF Ro uPLPL_!LL@LL @xLLuLLh9@LLLLQ! tLtL@ MMa@xG 1MM!pMpMpp\zt#jx]6@Bw@n`@éK T˱(ȫ˱0^˱8T˱@ƮCH$˱LƬ˱T@\ʱdͱf;ͱgzͱh@Ȳl L*bJbnҬ~|@ ٪`ʱ(ͱ) ,Ҫ 4ڪ <n`@D#ڪ@GLr@wP}J@we|SB˱e\* R0o0o 1`0x$U.:(R-@!,%;0 ͱ8 < .D#.LlnͱTo٪X?`B˱hpnx(h@E*go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }*[]go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }DQ 6tFG,`Ϳ `,R&,R&$fS&S&T&T&fT&T&U&U&bJHW&HW&D*@W&W& @X&X&p1Y&Y&Zg p[&p[& /p\&p\&N0%0%b*l%l%Kx1Ż 6tFGk g``1WWT]T] /h]h]KWWXXg|X|XR WWg HVHV1Kg^ g 7 6tFG\`K#  ~Xi ~XX. ~   ~X3bi#  tt#@`3@03 ~7,'K࿿K5̱$@F @ @ ENͱmͱsͱy`˱ ̱$`(˱\̱d`h˱dd0l!Ro Ro`?`˱` = ~˱E8˱$,9_4" <Dͱ@UͱAO ͱBUD+ULpTS \> `x5k#jӫ`¿% ~{ͱ8~ཱུCɱ:ͱP>` @@Y@$X>` 0@@4g@@/LeP@ ̱\@ܱ``> duͱlp@t 6tFGuV`x]VPhPhshhohhpohh>pm 0h0hi ~phph@F hh# h h^#hh#,Ϳ (4@?ة`ʱ`,R&,%$fS&%T&x%fT&%U&%bJHW&%D*@W&% @X&\%p1Y&%Zg p[&% /p\& &Kx1*struct { ID string "json:\"id\""; Name string "json:\"name\""; Price int "json:\"price\""; Currency string "json:\"currency\""; Frequency string "json:\"frequency\""; LegacyID string "json:\"legacy_id\""; IsSubscribed bool "json:\"is_subscribed\""; CanSubscribe bool "json:\"can_subscribe\"" }``Љ54 p@HпN 6ɱH(6ͱ 06ͱ *Oͱ3Oͱ86ͱo ̱ͱu ̱<3 ̱$]̱(ܩ,ܩ8RͱDܩ`H(ܩͱTk ̱XO%1\ll<!wRo@ѿRod@Sb@]nq < ͱSͱ`˱`˱7`˱ 7`˱$ Wͱ(@,@4@<-@D@L@ !P! uT&9 <`k@jh B?1e`N~ҿ~2W] aJb˱ S`˱@`̱DH0gMD@MHc L d@,h; ̱l-ͱpt F|L@ڴP@ڴSb ̱ ̱*func(go.shape.string, go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }) HPGI``ʱCx  ,i)X!@ ,tv)M,f)0,,Pb)4m,b),`d)4,]),`)|,_)C+ ,\) @,q),\k) /T,m)`,th)M`H,g)^@tx)/q 6tFGml2r ԞyԞyd y ymn&mD*@u&|&yymִ[ /b ҵ # ~#@ >X` 8`@ W5@  N'.! 4P>P> ~U'aNb ~]Rx>x>9 6tFGm rLTX,X,d,,m,,n&,,m,,D*@,,u& ,,4,4,|&,,m0,0,ִ4,4,[,, /,,N,,q`,,P`--UQ 6tFG7"@7 R>R>7 L?RL?R @R@RP*@7 @R@Rnv@7 hARhARBRBR7 BRBRxvA XCRXCR) 8DR8DR7`DRDRb`ERER>@ 8FR8FR` FRFR!@ GRGRb 6tFG`V4=o4=o]X>oX>o!|?o|?oO@o@osWnWn[n[niC AoAo8Co8CoXnXnDoDooFoFo|Go|GopoHoHoQ!JoJo}Edx 6tFG}F KEE` EE0E0Eg@EE@EEEEvtDtDF@ D Dq<EE` EEpy ~ E E8E8EFdDdDV E EB/ E EN 6tFGQ`c^  !6v6vghjvhjv1jvjvkvkv /kvkvKxlvxlvHmvHmvgnvnvR nvnvg dpvdpvu^u  4 6tFG>b@Ǘ # ~#@ >X` 8`@ W5@  N'.! 4`` ~U'aNb ~]R;KO 6tFG mz a ~pcpc#4mcmc# rc rc|@tc@tc|scsc}rcrcTb fcfcS4xcxc#Jk ~} :X 6tFG!mz  #\c\c#pwcpwc4`c4`c|]c]c*qXcXc|qwcwcJ!cccc}pXcpXcS4\xc\xc#Jk ~}( t(>`+ 4ĩFW<E !`ee|ee&b`d eer e4e/b`d $ee| heeeeo8eeee[`d W$ h`d e$ \k 6tFG! Kw K`h_ D} 3-Eq_CC_ ^  , 6tFGϭ.(͠(͠ `ܠ`ܠS@i ӠӠ@ l֠l֠@x <ڠ<ڠe͠͠i xҠxҠˠˠ~ˠˠfSpˠpˠP̠P̠S̠̠Li ߠߠi,j tޠtޠhFpFʠʠc 6tFGYH0`Hg}Hg} ?"(-f}f}O  g} g} 4g}4g}EO Tf}Tf}>g}g}6`V O`g}g}6g}g}XE XXT\~\~u 6tFG9`2RR@RR`RR`аRаR1dRdRrRR~`xRxR(RR(@@VDbx@Llx@Pf T^p`ϻhL T)! ~̬ɱLaɱ ̱ Fɱ-OɱVO@3$]ɱ(0ͱ ̱< ɱ@pɱHm@3PɱT!ɱ\ɱdlñ@3lҪpO|OO@3먱N)c  Laɱ]ɱ!@/Ҫ ̱ ͱ ̱$ ɱ(VO@30xݳ@34ݳ82޳D̕@3PT`O@3lOpO|)ɱA@3pɱͲɱ*internal.LruList[go.shape.string,go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]*[]*internal.Entry[go.shape.string,go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]*[8]*internal.Entry[go.shape.string,go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]SxFG 7"@7 R|:R>7 L?R4R @R4;RP*@7 @R5Rnv@7 hAR6RBR4R7 BRp6RxvA XCR 7R) 8DR,@ 8FR8R` FR9R!@ GR;RUlF6 z` z z ~U  e  8?"xE6-FOhEP` E Z `O/ EO 6`V O`6 !XE dfB 6tFGIԿCx  , ,X!@ , ,M,,0,,,,4m,,,,4,4,,,|,|,C+ , , @,,,, /T,T,`,,M`H,H,b*t)t)^@v 6tFGKL 3#| ~ ~0i ~  ~:i (3 #@03 ~ ~ll83 ~DiTB 6tFG``t%`77x78787P`77F"77>6 7 7&`x7x770707P`77077%`7770707O`77dv 77 T6T6@@7@7> 77`>p7p7`M 6tFGnl Zb\b\]\]\c\c\_\_\@^\^\rp`\p`\~La\La\&`d\d\d\d\ ~h\h\ftd\td\J! ~0e\0e\ /d\d\# ~xh\xh\Q!@e\@e\df\df\7Pg\Pg\[ * 6tFG?W|!xwxw w w %0w0w\:w\:wT$/w$/w4DwDw\~w\~wmLwLwmewewAHwHwwwmYwYwm440<`@sF 6tFGeI^ 44.u l&l&I l#l#@d $$>u` 0000^ 11_ I@_ 55 ++sY 99 77Q HHI ! h(h(^ 33I !!Nu`! --?^@ <<(=/ 6tFG^# {ajO`O`,c$lP`lP` ._._0<`-_-_a/_/_vT 6tFG$x%2l2l5 f d3ld3lP e 1l1l !<6l<6l f 6l6lGS,.l.l3l3l~ f 4l4l 1l1l@ <2l<2l5l5l f 5l5lw.l.lإ@w/l/l=&t d7ld7l@ 9l9l* 6tFG"` `m {{0b \ @/{@/{ 4{4{m P#{P#{_m ({({>7{7{TB{B{ G{G{0={0={49{9{x 5xD{xD{, J{J{T`5(?{(?{&`{{#{{ { {p|{|{*simplelru.EvictCallback[go.shape.string,go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]{3'/Hҵ ҵnʱ 8ߩʱ(`ʱ*1ͱ+ͱ,ͱ-G0@tͱ<{ɱ@SHʱT8`WXͱhѼʱjlVtx 5ͱ85(x]x]R& s˱dU=$tpM(x@08np@@VDثͱL-ͱMͱNB[ͱOVͱP뛩ͱQ~pT`@d @hf l^p`ϻ\'(H` x]x]R& s˱dU=$tpM(x@08np@@VDثͱL-ͱMͱNB[ͱOVͱP뛩ͱQ~pT`@d @hf l^p`ϻ(ES(_ x]@x]R& s˱dU=$tpM(x@08np@@VDثͱL-ͱMͱNB[ͱOVͱP뛩ͱQ~pT`@d @hf l^p`ϻfW|Qc^ ( Bghjvjv1jvjvkvjv /kv,kvKxlv8lvHmvlvgnvmvR nv,nvg dpvovu^u  '/HǗǗʱ 8ߩʱ(`ʱ*1ͱ+ͱ,ͱ-G0@tͱ<{ɱ@SHʱT8ηXͱhѼʱjl8x5 ͱRɩ?; (O` `J Lf ̱5 ̱]% ̱U`ʱ  ̱ ̱`̱-`̱ ̱ N`Ϳ$5`Ϳ< ̱T!aɱX*aɱ` ̱h ̱l Cͱp,ϴt-ϴx3a ̱| д /% 79tFG!C`3u@^>@ % c@G /bèzԨF!*interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error); FindMessageByName(protoreflect.FullName) (protoreflect.MessageType, error); FindMessageByURL(string) (protoreflect.MessageType, error) }DF= z`"" z z ~U  . e  8?"xE6-FOhEP` E Z `O/ EO 6`V O`6 !XE dU!FGM=Y/-~V| ~ !~ia!d~?"("~O" ~,#~#~EO D$~X$T~6`\%~V %P~&<~O`'4~6 '$~` (~K(~XE 4)~*map[go.shape.string]*internal.Entry[go.shape.string,go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]*go.shape.struct { encoding/json.name string; encoding/json.nameBytes []uint8; encoding/json.nameNonEsc string; encoding/json.nameEscHTML string; encoding/json.tag bool; encoding/json.index []int; encoding/json.typ reflect.Type; encoding/json.omitEmpty bool; encoding/json.quoted bool; encoding/json.encoder encoding/json.encoderFunc }*func(*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn], *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]) *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]G 6tFG[eCc@  f01D)D)S*S* ( (((­((J=+=+Jp+p+f<+<+.[>+>+, fN) 6tFGm`Њ/& t^t^ ^ ^P7ؗ^ؗ^%|^|^ !@^@^%^^^^%^^@ ^^ &@^@^&p^p^6&(^(^^^^^@4^4^ ^ ^# (^(^=&@||t!`HRo%Ro$2"9-@o`˱`˱ 8$0FQ4I`˱@, DLͱXͱY폪@/\`˱`zoͱdCͱe`Hhb`lptox/h|!GRo@'Ro$ɱGS@ͱW@]@@@ S @(}@0c ̱8a <@@8p DMHZ@L P T7uXo d slӍ t`x`|79bb(`pw(w$ɱ:ɱX(ɱ:ɱ:ͱ @z$~yͱ(ͱ)ɱ, ̱4Nf ̱8`P< Dj@HfɱP^f X %\7@$x07|^`9_(ɱ:ͱ ( 6tFG` H9<<><<zm=m=<<f==$#=$#=rY=Y=6H<H<A.=.=  7= 7=)p4=p4=Q8C=8C=L,R=,R=]=]=G8<8<Udy=dy=Q==~ = =3(|(CgW|`+W|$ɱq  k`˱ :ͱ$ ͱ%ͱ&o ( 4 @ LʪXʪd©`p©`|*.m>m˪ V© ̱Nm ̱7M*ͱ腳)(F-,$ɱ ̱W@] jGS@zͱc ̱ .`M$.q@(M,}@0ZK87 <R&`@ӍMX/ͱ\x=`hx=ltǜJxaϪ@3ɱ?h 6tFG(F,!nn_nn@ 8n8nK&nn7F@6nnFF6dndn>q6nnLpnnnn. ~nn ~nnһ64n4ni2nn ~ 6tFG.r߼3p !\G\GL GG*ȚGȚG 4G4G>rGG74G4G ܚGܚG~/  G GQ!PGPG0y=GGGGG'G~GGGG%LGLG`G`GGGt 6tFGz  i iHhh5 00Z+ + M 2 8&8&h4)7`3c^@2c^$ɱɱ +(B 0B 8ȩ@@HL~^@HP T=X`(1hB@l#tJM1 X`u)`w8& 6tFG72c^ u@AvAv^8Wv8Wv>@L>vL>v "v "v %"v"v lIvlIvc@GBvBv0Fv0Fv /vv <7v<7vUs:v:v6@v@v"vvC^TvTv@|1v1v%8v8v߂(EG15J$좩˱˱`˱`˱~˱ ~˱(˱0 ˱8˱@6ͩ˱Hx˱Pg ˱X˱`\N˱hu ˱py˱x<˱M˱ ˱ ˱y˱ ˱ ˱Ms*y `6J$ ` ̱9! ̱`Կ,Կ ̱* ̱~ͱ (ͱ/ͱEͱEͱaͱyͱyͱ-ͱ4ͱͱ9 ̱' ̱ ̱a ̱~ ̱n(EGG37J$좩˱˱`˱`˱~˱ ~˱(˱0 ˱8˱@6ͩ˱Hx˱Pg ˱X˱`\N˱hu ˱py˱x<˱M˱ ˱ ˱y˱ ˱ ˱Ԯ 6tFG( z /-ԏzԏzVzz  z zia(z(z?" tdtdQ^LF 6tFGா^' Q!bSS<` ~C ~LSLS#lSlSS ~SS6PSPShShS# ~DSDSS ~F`SS>SSF`SSSS+ 6tFG@rd# !EE.FF fDGDG`!HH#@fHH IIbJIIWafJJ`LKLKnfKK'" "LL[`LMLMN'`"NNJ! ~NN@g(O(O"OOU"pPpPgQQQQ` 6tFG 0o p@LLbLLb{a48@b8@b,cAbAb >b>bt@bt@b@b@b8 ~$Ab$Ab b CbCb. ~NbNbP PBbPBb"t p?bp?b%0Mb0Mb8LPbLPb-P@q>b>b6V4c Hb HbE&ObObcuvF>HT%%H8$<RWvN`rl>! ' *' ` fh/ ( Ht1)<` ; N> V@ /<`tk q휠Fu"V%%81 >X (@ { n 8 >` |` z` 0 = X TY |@ + 2@Y |Y $^  v[@ Y [ -^ Y ԟ  ߟ@ &2  Z t [ @@ $ j  ` I nzl'YoǫW<lɱܩ ౽j௮γɱ(ڳɱ0泩ɱ8xȻ@ɱD^CLEͱ^ 1ͱ07llP6`  &P^ͱ^`ǯ87 {`o'^RoYRo<V ! q`ǻ ;Ż(pe0a480:˱<'ٯDS گHS@LSͱP:ͱQ˱TF@\8@`8: dK`x s|x ̱/@:ͱH:ͱ`گH)  ZJ< ``˱`˱ͩ`˱&7`˱kN`˱zN`˱N`˱ت`˱ɱo`˱`˱`˱`˱ت`˱4a`˱Ia`˱^a`˱.y`˱V%`˱`˱F"`˱`ʱ`ʱ`˱Md*da\a <|KGڪK|K^Ҭͱ Q6ͱ ,ͱ!$#I,ڪG88HDOPϩfXI``0xx`˱|a` Z ̱n- _ͱϩO+Th@E87UI 6tFGҵ ~_?_?_!\(?\(?+4 DD:4 HDHDtB?B?D?D?AG?G?I4DDX4HDHDa  J?J? ~.?.?Gg4I?I?k]E?E?v4r'?'?4?4?a?a?dX 6tFGXRos P PP:LaPLaP8 PPqLPLP" TPTPx ~PP PPqTPTP(qPPPPR ~hPhP2q ~PP_ 4P4P >g&@>> >>0@K > >@K 8 >8 >f>>+@9>>@9D>D>>>=@>@>rm9 > >h>h>69>>2>>79>>2J@K |m ~@92i 6tFG_fFFrFFz_"LFFY\ ~FFOFF_FF#@~ ~iFFaFF1LFF  F F# ~CFF 6tFGy&]&7,8q,8qV:q:q 9)q)qcppqqppspp&pp%dpdppp#d ~ ^0q0q 86q86q<9q9qq &,q,qP4 g 6tFG d# !ll.(( f`!|Ņ|Ņ#@f88 ԵԵbJƅƅWafpp`ppnf?'" "ppN'`"@g"0ƅ0ƅU"LLg Å Å ?N@9超超x\ 6tFG?@ &` ~J!6|( ~t(@'@7@2!S>z`ʲ=E 6tFG4 7k7kg&7k7k @7k7k0D 2k2kD 3k3kf7k7k+ $|,k|,k $ .k .k/k/k=\1k\1krm`$4k4k+k+k6`$5k5k2l+kl+k7$T6kT6k2JD |m ~ $2*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error)~b'6nRooRoHh/ɱؿ'ɱ  ̱ ̱5 D R(6˱,ɾ4!ͱ@7ɱD`Lo`P(7TR X*ɱ\ִɱdel(1 po{tRɱx=R+Ő`'^c@RoqRoH;on#SDͱ#ͱ6ͱ s5  ,$ w(U7 4) ͱ8,S˱<d7˱D0 ̱LʐͱPNͱQjIͱRoT `5S`d>S` s7`nc  >{ͷ.|@Qdrd|# !E@.F fDG`!H#@fH0 IbJIWafJ(`LKnfK'" "L4[`LMN'`"N J! ~N0@g(OX"OU"pPgQȎQHF#t((P[ ؇` ` >@ >\ @ @ 2` 8 ` ` ` ` J` @\ \ U 5\ sU V 7 ] @ |` "| [` R@]  {` V` ` @B ɟ 6^] ] % @ 8FG`Y/-7,c80\ 9V9X8`8:p :?"X; z;`OX<0<p=,pE>EO  ?@6`?V 8@O`@6 8Am`AOHBz BXE pCk%q! D(4_vH ̱H ̱I ̱ɱ xi ̱i ̱i ̱]ɱ Ӯ ̱(PY ̱, ̱0 ̱4ɱ87ɱ@lYɱHԮ`̱Pì`̱TY`̱Xìɱ\U ̱d,Ԯ ̱hc ̱lܬ ̱p@I ̱ts ̱xPԮ ̱|K ̱ɱ-H 6tFG H$vN p4`HH\\VkN ((NPPll/ /``fNLLtt`k@  *  jk HH|Ś: 6tFG'H$vN p4`VkN N/ /``fN`k@*jk Ai 6tFGO`$h=h=|=|=vN ==p4`====|>|>Vk>>N >>N????/ @@/@@@@`\@\@`@@f@@N@@AA`kAA@AA*AAjk AAp 6tFGj$vN p4`VkN N/ /``fN`k@*jk g 6tFGm#W| B (w(w(wwJ@< ww!wwJBȭwȭwsww0w0wQ!ЯwЯw7ww3`w`wV4w4wb `?,w,w*ww6w x x@w x x  ~xxnxxxxzxxY׃c 6tFGx]0F (Qi(QiUiUi!SiSi0DRiDRipipi",Ti,TihihixixitEiidVidVi!z '7o Naz)! B (8 z 4z (ͱhEͱ /-ԏzHzVzdz  zzia(zz?">EO  ? ?6`??V 8@8@O`@@6 8A8Am`AAOHBHBz BBXE pCpC*func(context.Context, context.CancelCauseFunc, quic.sendConn, quic.connRunner, protocol.ConnectionID, *protocol.ConnectionID, protocol.ConnectionID, protocol.ConnectionID, protocol.ConnectionID, quic.ConnectionIDGenerator, protocol.StatelessResetToken, *quic.Config, *tls.Config, *handshake.TokenGenerator, bool, *logging.ConnectionTracer, utils.Logger, protocol.Version) quic.quicConn``l\KK``/̱ 2̱>\:ʱ2ʱŶʱ˱ Ez(z,*z0h`˱42`˱86ʱ<P2>"?h`ʱ@׶ͱAʱBẖD!̱H٩ELh8P@(T[ \ z@+Gyҵ`ҵ`nʱ 8`(4bɱ@1ͱH LXͱd4hw`t`ͱG@tͱ4Sͱ]`8ຮ͏ͱn4 Vt@@Un#p  ĩ`ս=+T87 ͞ͱ[Ծx s kS M(x,Ϊ@0g@4K`<B $o $oXB (&o|%o@'o&o@)o(o@l*o)onB +o +ogC #-oh,o@C P.o-oiC /o/o*0ol0o,2o1o`3o2o p;2)G@ ǗǗ`ʱ 8`(4bɱ@1ͱH0LXͱd4hw0t0ͱG@tͱ4Sͱ]`82͏ͱn42ͱ:@1+N@ @J`  ̱E ̱` ̱ȣ ̱ͩ ̱ ̱!` N`` ̱Ly Ω ̱! ̱] ̱` ̱Ω ̱n ̱j`tE@3y ̱N ̱N =+! ̱ZY|*+@Nű`q'ִ # ,ͱ:˱ :˱( 0AD2 LK TQ\˱d˱laAt"A|$ ̱A$AѫV⫪V0xh@E87U!O@N,/. 6tFG^cpRo NNGNN' ~0N0NZNN5ONON9 @N@Ne`NNo|N|NNNQ!0N0N o=o!|?o>oO@o@oiC Ao4Ao8CoBoDoCooFoPEo|GoFopoHo8HoQ!Jo\Io}E / 6tFG` z`M 5 LLÅ̊*M !! @JJr ## / ӊӊ`@ΊΊ` ӏӏ?L  hh>+ M r# iY2 ююq 6tFGʵ z`M dd5 Atete*M ee @ffr 4g4g /gg thth`@ii` ɏɏ?L 8j8j >+ M r# iY2 7 6tFGVz˵ z`M mm5 <<ALnLn*M nn @totor p p /pp LqLq`@rr` PP?L ss @5@5>+ M r# iY2 ,,+J 6tFG/Nr,vYvYDM ~KYKY ~LYLY,Y,Y= P_YP_Yx: ~D0}Y0}Y ~JYJYwYwY~gYgYBROYOYMYMYLYLY ~YY,`0Y0YDiYiYR`mYmY[``Y`Y,{Y{Y,yYyYV 6tFG`.z>zZvv$fvvfvv]`vvbJvv6vv @vvZgZvv0 [vvvv /vv`vvb*TvTv'vvdZNzZ2Z Z.OZZZ;.G!`d.`ʱo`ʱ`ʱ`ʱ ,`ʱZ$`w"ʱKw K`h_ D} 3-Eq_CC_ ^ i 6tFG2? ºd# !. f```!HH#@f \\bJ?P̅P̅Wafxx`nf?ģģ'" "N'`"HH@g",,?l̅l̅U"00gtt ?N@9PP 6tFG @i@dPP8H ~`p ||SCPP ~y ~tts ~,,`,˞,˞`HH`PH``H`TTk@ ~LL@`̞̞)`\\``dp hh  6tFG  [ [i]]d[[8H ~gg q ]]S@Edgdg ~PePey ~YYs ~ZZ`33``c`cHH`papaPH`__`H`eekH\H\ ~`h`hff`,5,5)`XdXd`hbhb`x`x`d`q ^^`rd 6tFG @A 8@kkf&%k%k '$k$k '8%k8%k% ~xkxk8`'0!k0!k\'X kX kZkkJ( (k (k '#k#k1"k"k (k(k@@`'\'k\'kg'&k&kf#k#k( (#k#kw(k(k}kkkHkHk /@(k@(kqp"kp"kh9@!k!k3?jDZ (c@K &` ~J!6|( ~t(@'@7@2y!,QS`>czPHU`nʲcM|)`c@ l~̬ɱLaɱ]ɱ!ɱҪ  ̱,"ɱ0ͱ ̱8 ɱ<ͲɱDɱLնɱTrɱ\-OɱdVO@3lS@3pxݳ@3tݳx̕@3O@3OT)ɱx@3pɱɱm@3먱AW+WǗǗlʱ B`(.44ͱ@ɱDͱL[ͱMͱN#0P4\ȣͱh#Kl;0x^ឬͱAK[0`H6@23ͱr|PK2FɩB4@ )62`Jl?" ̱k ̱D ̱ɱ 1 =F" `˱$ ̱( ̱,e 0y,ɱ8ͩ1@` ̱D ̱H, ̱L@1PpɱT$Ǵ\{` ̱d` ̱h ̱l ̱pNͩ`˱tZͩ`˱xfͩ`˱|?,`˱,.7|obL z z @! α α˱̧zwz&`z{zezP}zX!fzPz)XzyztzwzzPmzbJDz0mz #دzz`#zzE#@zpz`O`z ~z /hzzz-`zxzx`L5"@xuzyqz(< 6tFGDUॵ @̇]̇]Zd]d]ٺ`]] ܎]܎]F`]]``H]H]J3]]Y3|]|] ܔ]ܔ]h]h]'<]<]4]]f ]]t]t]W@]@]@]]r]]~ ,],] ]] ]]'X]X]A]]h3 ] ]PA| 6tFG:-$x]G zZv@v$fvvfv|v]`v,vbJvv6vHv @vvZgZvv0 [vvvv /vܾv`vxv'vvdvZTvNzZ2Z v Zv.OZvZvvB2? 6tFG;C!,,,,,,,,,,D-,D-,s|-,|-,e@ ))@ Ԗ)Ԗ)* ))*$.,$.,\.,\.,a+@ /, /,o/,/,Z@L0,L0,0,0,))Q!1,1, t)t)J ))5 ))e@ ))J ) )Q 42,42,e ̯)̯),J ))w!K 6tFGH$vN p4`VkN Ni/ /`f>`k@*jk Ja 6tFGpB $o$oXB (&o(&oNdC lmlm@'o'oO@m@m@)o@)o@l*ol*onB +o+ogC #-o-o@C P.oP.oiC /o/o`mm*0o0o,2o,2o`3o`3oVp,m,mlmlmXmXmp8m8m}HmHm ~|m|mmm|m|mC3 6tFG ۵` >@ >T ȖȖ8 ͖͖` J` U ɖɖU @і@іsU V ӖӖ@V pՖpՖ7 ܖܖ ΖΖ` `ז`ז $ږ$ږV V xx{` hhV` xx` XX@B hޖhޖɟU hh % ߖߖ@ ˖˖Q 6tFGEYL@?TT(D } 0D TT>+TT}H,LTT8DTTJ_@ O,Vbw 4 6tFG!HBu@^>@s8E@E % c@G / b&@èzԨF!||L~%IEH ۲ `٪  7.r@r@` P&$*@۲(J۲,|@l0P۲4|ܲ8~9l<.ϩ`@:ϩlD/&H} L mPFϩ@mTGXRϩ '\#``٪md! ~hmlŤ@p! ~t%ux% 6tFG}m `e`e*tHeHem TeTed ee  xexe6d eeK+ lele;@tee ees$ee&b`d \e\er ee/b`d ee| (e(eEteeRtdedeQuԍeԍe(@heheY@ee[`d W$ h`d e$ Fx`x 47˱k f@llllu l@lX!vTl`lR lpl,*lDlx'4ll*lll¥+LlllY@*dldl /(lxlill0<`lؕl<plj -'*$ol%P1G @Y !ͱOͱOͱTR\ \e|`{yO 0f|@{! ] g|@{ \0h|G|Z$ BR{!(|Sp|> |z '7{0|o$H| L|0O|NaR|z?|)I|!U|gtFGN@< &FL@2`N}`w `F@tWk@>`CJ! ~Z /@xF?>X}Lvs^? 6tFG8Q`C!^,^,҆_,_,N`,`,a,a,b,b,Tc,Tc,sd,d,e`e,e,*f,f,g,g,@h,h,$j,$j,hk,hk,݆@l,l,Z@m,m,a+@n,n,o p, p,Z@Pq,Pq,r,r,Pt,Pt,Q!v,v,e`Q Pw,Pw,,Jw 6tFGrp`C!D,D,҆ E, E,N,F,,F,DG,DG,H,H,H,H,sJ,J,*J,J,K,K,@ M, M,\N,\N,O,O,݆@P,P,Z@Q,Q,a+@S,S,oDT,DT,Z@U,U,V,V,X,X,Q! p*p*`k** @++*++jk D+D+~(h 6tFG`e*\t0t0`D0D0X9 00'00@9 Ԣ0Ԣ0s 0 0k`T0T0g 00e`ԧ0ԧ0v9 0 0 e\0\0 00  ܬ0ܬ0N00:00Q!00H0H0Ë  l0l0700J00- ~T#0n|* 6tFG`ʽ< T TLL@z H,LxrTxrTK@DTTHD`@ _8}T8}Tw@~T@~T ~$T$TwyTyT JLĠTĠT>+TTPDdTdTLTTlHa 6tFGqʿ]  ~____Q"_____"$__`__m" ~__ `# __{"^ ܖ_ܖ_9__"q 0_0_Ș_Ș_w)j____DG؇_؇_$̉_̉_2q__$p_p_.{$T_T_8$__>{$8_8_Pؙ_ؙ_N{$P__&ԡ_ԡ_1?< 6tFGN< &L@2`N}`w @tWk@>`CJ! ~Z /@x?>X}Lv%G9 6tFGO]H`&$y$yyyg&0y0y @xyxy0 yy yyP0y0yf`y`y+@dxdx@xxxx=DxDxP y yhm y yrmyyxx6PyPy2TxTx7yy|1y|1y2J|m ~@2u 6tFGWjbH`& 4*y4*y`)y)yg&`@)y@)y )y)y0< "y"y< $y$yP/y/yfp)yp)y+tytyyyyy=T!yT!yP -y-yhm +y+yrm&y&yyy6`'y`'y2dydy7@'y'y/y/y2J|m ~2$'@]ҵ !!ҵei 7>` s 6@$(հ,+Q0굩4ɱ@ HjL ͱP`T#ͱ`ɫͱa @bJ8 4ߩࣲʱʱ itͱ4`ұ hհR&`J`` '@tRo!!Ro=^ #`Ŷ`˱SHS9ͱdh:ͱeiuh(@tqx@'@(@^e@{9_˱T#SDvx˱b9@q9ͱͱtͱͱY ͱp:`ʱͱ!ͱS p)tl)i!! ɱ)ɱ%êɱC ̱ ̱ ̱ 5 ̱$xɱ(Wɱ0ɱ8"[ɱ@DzɱH"1ɱPtɱX^ͬɱ`ٛ߭hӪɱlLPɱtӪɱ|'"ɱӪɱ~ɱuPɱXɱS4@3I@3 ̱|ɱTͲɱECL)ۡ+!!86H^ؿ葩ɱQ^@))hB Q `g(Z^G0R8W@,|UHx9`˻PXQJ`@Hhvspxȩ/*I`JS `*CQpBQȩ˻6|xBoJI`̻*3% 6tFGI G*ȊȊ-!Q!7܌܌YdI<<֫I""e  o$$$$IIeddfePP\\TTz  ~TT+  eD`c5 6tFGR+C!|9,|9,҆Ƞ+Ƞ+Np+p+:,:,:,:,s:,:,e@ ++ ++  ++*t;,t;,;,;,a+@\<,\<,o<,<,Z@=,=,,>,,>,++Q!>,>,@ ++J ++ ++e d+d+J  p+p+Q ?,?,e@ ++,J ++  6tFG`C!%,%,҆D+D+N++ &, &,&,&,P(+P(+s&,&,e`++*|',|',',',@D#+D#+H+H+$+$+݆@!+!+Z@&+&+a+@d(,d(,o(,(,Z@),),4*,4*,++Q!*,*,J++e`:+:+Q +,+,,J8<+8<+I+ 6tFGG'Ro!NN_|N|N@ OOzNNK&NNBp` HOHOvOOLp4N4NcNNvNN} `O`Og vLOLOcPS ~ O O ~OO YI I OO7@ O@ O>0: 6tFGwѿRoJx ~xKxK59 KK XKXK/  KK5 \zK\zKxq! 0{K0{KNeKKS@ KK2!LLF!= Ȓ =  ~LL} ~#8>8?D9xKxKK KK`p@yKyK '*k 6tFG@RoJx ~QQ59 QQ 8Q8Q/  QQ5 xq! NeS@ 2!F!= Ȓ =  ~} ~#8>8?D9K `p@ '!0RJ 6tFG5 `+yz$ % 䎈䎈`% <<;@ ` xx`% llZM% ppQ  ĻĻr%  & йй&` `& r% X X &  ;` ll;``^@sˈˈ$Uӈӈ'ňň_   $llɔtt} 6tFG-gx &&x d'd'E@ ''\8)8))) **S@i ++@ ,,@x --e..i //r`000011~t2t2fSL3L3$4$4S44L6L6 /77Li (8(8i,j 0909S S.< 6tFGn<5$\tF tF `4E 4E &`D D `F `F  hJ hJ fDF DF V V sLU LU k`W W g Z Z e`hM hM e\X \X  D] D] J! ~lG lG /lE lE g F F N|Z |Z :Y Y Q!K K R R Ë  S S 7``p PP)`)`88Wq ğğ΄ ~tt8H ~@H  ~ddy ~o`  H ~ddH ~00=` | ~W ~ККW  ~ ~TT sn( `##d_ ̱© ̱#" 5 NԿԿj(k`4Lf ̱85 ̱<]% ̱@U ̱D ̱HF" ̱LY1P?T*\Sd* ̱lk ̱p; ̱t ̱x? ̱|Tw ̱G ̱? ̱ ̱^w ̱hw ̱rw ̱? ̱|w ̱w ̱Yɱ˪ ̱;tFG8Q`CC(膩`/5J !^,^,҆_,_,N`,$`,a,0a,b,Tb,Tc,b,sd,c,e`e,8e,*f,f,g,f,@h,\h,$j,xi,hk,j,݆@l,l,Z@m,m,a+@n,8n,o p,\o,Z@Pq,p,r,q,Pt,Hs,Q!v,\u,e`Q Pw,v,,J}ctFGrp@CC(~/5J !D,C,҆ E,D,N,F,E,DG,F,H,G,H,LH,sJ,hI,*J,J,K,0K,@ M,L,\N,M,O, O,݆@P,8P,Z@Q,TQ,a+@S,pR,oDT,S,Z@U,T,V,V,X,W,Q!8?D9K `p@ 'ao,9tFG`5J !prpr҆qrqrNrrrrsrsrurururursvrvre`wrwr*@yr@yryryr@{r{r4|r4|r}r}r݆@~r~rZ@rra+@rrorrZ@|r|rrrrrQ!rrJlrlr`; ` rr*go.shape.interface { CancelRead(github.com/apernet/quic-go/internal/qerr.StreamErrorCode); Read([]uint8) (int, error); SetReadDeadline(time.Time) error; StreamID() github.com/apernet/quic-go/internal/protocol.StreamID; github.com/apernet/quic-go.closeForShutdown(error); github.com/apernet/quic-go.handleResetStreamFrame(*github.com/apernet/quic-go/internal/wire.ResetStreamFrame) error; github.com/apernet/quic-go.handleStreamFrame(*github.com/apernet/quic-go/internal/wire.StreamFrame) error }@ 6tFG/JRo8`DPDP_!OOJx ~PP p Pp P QQOORPP9 !`e`e|e|ei ~ e ep" ~eeJ`8e8eJ ~\e\e HseHsee@u ee&b`d eer ee/b`d $e$e| heheeeo8e8eeeJ\e\e gee@1 ~LeLeB HueHueJu ȷeȷe"-][`d W$ h`d e$ \ 4%g-g4b ٽ ٽx &Ix d'4JE@ 'J\8)|()G *0KS@i +PX@ ,J@x -Me.Hi /4\r`000I1h1~t2GfSL30H$4GS4@IL65 /77Li (8X]i,j 09p_S S.ᮜ 6tFG{) hҝhҝd՝՝8H ~|ѝ|ѝSC՝՝@Hѝѝ ~,ѝ,ѝy ~ԝԝs ~ ՝ ՝ d`~`4ӝ4ӝHH`<ܝ<ܝPH```kTT ~4ԝ4ԝҝҝ^```ٝٝV ~םםCW ~ ~ ~D֝D֝` ~*bbr.entry[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]*[]bbr.entry[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]aC()@Ǘ6&&Ǘei@0 7e>``UsU 6U$(H,+Q0굩4]e@ɱD`LjP ͱT?ͱUwͱVlgɱX/ͱ``d#ͱpɫͱq @rJ@R 4@ղߩղʱʱ0Eͱitͱ4` R&`J11:ɩ@1`9p( ` g 8g(b- x ʡ,{x ˡkE@ ̡o\Ρ(Ρ ϡyS@i xѡС@ 0ҡm@x Pӡor`ԡԡԡԡdաԡp֡աSס֡h١ء /ڡ8ڡLi ۡDۡi,j dݡܡ@ rF ޡޡ~\v-@x pS S.F,ߡ*quic.incomingStreamsMap[go.shape.interface { CancelRead(github.com/apernet/quic-go/internal/qerr.StreamErrorCode); Read([]uint8) (int, error); SetReadDeadline(time.Time) error; StreamID() github.com/apernet/quic-go/internal/protocol.StreamID; github.com/apernet/quic-go.closeForShutdown(error); github.com/apernet/quic-go.handleResetStreamFrame(*github.com/apernet/quic-go/internal/wire.ResetStreamFrame) error; github.com/apernet/quic-go.handleStreamFrame(*github.com/apernet/quic-go/internal/wire.StreamFrame) error }]*func(protocol.StreamNum) go.shape.interface { CancelRead(github.com/apernet/quic-go/internal/qerr.StreamErrorCode); Read([]uint8) (int, error); SetReadDeadline(time.Time) error; StreamID() github.com/apernet/quic-go/internal/protocol.StreamID; github.com/apernet/quic-go.closeForShutdown(error); github.com/apernet/quic-go.handleResetStreamFrame(*github.com/apernet/quic-go/internal/wire.ResetStreamFrame) error; github.com/apernet/quic-go.handleStreamFrame(*github.com/apernet/quic-go/internal/wire.StreamFrame) error }*bbr.WindowedFilter[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]*quic.incomingStreamEntry[go.shape.interface { CancelRead(github.com/apernet/quic-go/internal/qerr.StreamErrorCode); Read([]uint8) (int, error); SetReadDeadline(time.Time) error; StreamID() github.com/apernet/quic-go/internal/protocol.StreamID; github.com/apernet/quic-go.closeForShutdown(error); github.com/apernet/quic-go.handleResetStreamFrame(*github.com/apernet/quic-go/internal/wire.ResetStreamFrame) error; github.com/apernet/quic-go.handleStreamFrame(*github.com/apernet/quic-go/internal/wire.StreamFrame) error }]*[]quic.incomingStreamEntry[go.shape.interface { CancelRead(github.com/apernet/quic-go/internal/qerr.StreamErrorCode); Read([]uint8) (int, error); SetReadDeadline(time.Time) error; StreamID() github.com/apernet/quic-go/internal/protocol.StreamID; github.com/apernet/quic-go.closeForShutdown(error); github.com/apernet/quic-go.handleResetStreamFrame(*github.com/apernet/quic-go/internal/wire.ResetStreamFrame) error; github.com/apernet/quic-go.handleStreamFrame(*github.com/apernet/quic-go/internal/wire.StreamFrame) error }]*[8]quic.incomingStreamEntry[go.shape.interface { CancelRead(github.com/apernet/quic-go/internal/qerr.StreamErrorCode); Read([]uint8) (int, error); SetReadDeadline(time.Time) error; StreamID() github.com/apernet/quic-go/internal/protocol.StreamID; github.com/apernet/quic-go.closeForShutdown(error); github.com/apernet/quic-go.handleResetStreamFrame(*github.com/apernet/quic-go/internal/wire.ResetStreamFrame) error; github.com/apernet/quic-go.handleStreamFrame(*github.com/apernet/quic-go/internal/wire.StreamFrame) error }]e 6tFGK5\T9T9`T9T9&`T9T9U9U9 U9U9fV9V9V9V9sW9W9k` Y9 Y9g Z9Z9e`T[9T[9 e[9[9  \9\9J! ~`]9`]9 /x]9x]9g D^9D^9N<_9<_9:_9_9Q!|`9|`9$a9$a9Ë  a9a97Lb9Lb9Jb9b9r! *oBRl7l75 77uI` 6tFG%Ro"dIdIo@III 4I4Ib ~II` IIz` \I\I  II/ I IeII II6@ IIIIb tItI6` PIPI6IIII  II@I@Io0I0Io ~II6,I,Iv  ȟIȟIʷ`<I '/ !RoJ''Ro`: sHͱPq  `S`c' s$( s(Zq0d s8 @`DQH (@dͫ`hשlc@pdtS@xb@]|J@|ͱ ͱ ̱J ̱s ̱@ʣ@ᣫ@a  ͫ˱ ̱e ̱7u` ͱͱ9"tP 6tFG@:,z@>z|H;z;z,EKzKzqM 6tFG[a (b(ba@p,c,ccc`'`b`bccEG ccΝ ,dcdckp'c'cs bbYQbb|PbPbhQH+cH+cpcc| bbX5cX5cg ~3c3c8'c'c-P4&c4&c|b|b ccLd4cd4cdbbF:bbb#kk@))c)c@)& ~bb 6tFG~g x ,,x @ @ E@ l l \``   S@i @ @x ei r```~fS88SPP /Li , , i,j ""@ F %%-@x S S.F0&0&WI 6tFGnd z** **~++U ++ ,,,,e ,, 4-4---@.@.8..@/@/?"//@0@0xE006-D1D1F11OD2D2hE22PH3H3` 44E 44Z 55`O55 6 6/ <7<7EO 776`T8T8V 88O`\9\96 !99XE T:T:d:: 6tFG6 C!!T(T(s((d(d(o ( (((Q!\(\(0((edžBJ((**W((Z\*\*_D*D*C((e@ ((p+ l(l(+ ((J ((m` l(l({ ((#J@ve@((Q d+d+e <(<(+ ((+ ((,J (( (( ((𥊢 6tFG6@oRo! bMbM MM_!@tSMtSMORMRMH6 aMaMR`M`M aM aMo MMǑ@xXMXMdgMgMґȣMȣMf`,M,Mݑ@xԳMԳM77@x,M,M_M_MRfMfMuMMupMpM4`M4`M@\RM\RMQ! kMkM* DlMDlMuMM`hM`hM>co`F7pMpM6MMPvMM!lMlM=9 6tFG`(w! ܩܩy<<sL X>X>C(` @r : ll ^ ??T :@xɐɐJrTr<<@x4488 : ЯЯʐʐ;3ԐԐ\\L@dd&#@@ ``y||^rTT:#@xŐŐy ǐǐM } ۥ@xXƐXƐN#(Ȑ(ȐY 6tFG~~H!,99+8:8:P9P9D99899Et9t999N99@F,99HF99S*Seb99R99Xl9l9 B:B:~3:3:_+:+:X::6:6:\4:4:~ ::lp:p:Ь(:(:H:::: ~h :h :99e99e 9 9E99$d%:d%:)F t)`u,, ,`ͱ. ̱J4 ̱ܳ ̱  ̱ ̱J ̱!`ͱv ̱ ñ ̱$ ̱( ̱,``ͱ0Ӎ ̱4ɱ8I/ ̱@#@3D` ̱HSɱLTɱTQ ̱\O ̱`4 ̱d, ̱h ̱la( ̱p ̱t` ̱x ̱|0T ̱4 ̱ ̱`T ̱ ̱ ̱Tɱ/ɱT ̱5 ̱:ݳɱ!xɱTɱ ̱Z ̱4 6tFGYx]" VJkJk] Kk Kk!iiOKkKksKkKkԻiԻiotLktLk$Mk$MkpopipiQ!MkMk>p ~m iii ~@F ii#NkNk^#@OkOk#OkOk{#Z n F &'&'&''''2)')'>K\+'\+'t''XeX.'X.'iN(ib(>>S"'"' % ' 'r-'-'ati''o'' Uc   4@6Sn x _!@4OPH6 ОRL衖o lǑ@x\Ȥdґf`ݑ@xH77@xD8ܭR0udЯuhxܵQ! * \9S fG5f;%`[~5,XX7\+`-ת..8! .`ɱx ̱ M ̱7Nɱ ( Ǵ4 8'@ ̱LLͱP8T^̩ ̱`9 ̱dp~ ̱hj̩lx ̱x y|2 ̱ };M ̱귫ͱ`ͱv̩ ̱p@; ̱M ̱禪ͱD ̱7`66ͱ  <J6 "  xD`<$,<0nx`;<&P<Hz~-T] 6tFG/ Ro$ QQ QQ_!@4Q4QOQQH6 0Q0QRQQQQo QQǑ@x̋Q̋QdQQґQQf` Q Qݑ@xlQlQ77@xQQQQRQQuԖQԖQuܙQܙQQQ@ОQОQQ! QQ* QQu >co`F7q OO6Pv!aF 6tFGOK$V""m=+`^h(O ~4&`nh|=t`|-#|-#(#(#M/#/#v f@0#@0#  +# +#n&#&# t&@` `t V ==""<t2#t2#=0#0# ~6#6#Y 6tFGrG %'$z$ % `% ;@ ` `% ZM% Q  r%  & &` `& r% A<<&  ;` αRR^r@^wwG섉섉ϝLLK  !`o`oG?28_8_G00%ԕ+.ת//D! .`ɱM MM 8^̩ ̱(j̩,x ̱8 y<ͱ@( ̱D̩ ̱HWͱL̩P"TxD=X8 >d5 ̱p7`tnx`;D ̱v̩ ̱! ͱתͱͱ6ͱ[ ̱pA ̱̩ͱˢͱ̩ͱBͱO ̱\x~@yi@0תDͱ /ͱ!@``>$x ̱(z~-,Ms 6tFGOa$Vm=+`^h(O ~4&`nh|=t`Mv fPP 00n t&@` `t V ==<= ~J 6tFG@Y$"zQ}Q} W}W}~pW}pW}U V}V} TW}TW}lZ}lZ}e tX}tX}H0`Y}Y} V}V}Q}Q}8DS}DS}R}R}?"S}S}xET}T}6-T}T}FS}S}OhES}S}PQ}Q}` Q}Q}E  U} U}Z U}U}`OX}X}/ Q}Q}EO Q}Q}6`V O`xx6 !\Z}\Z}XE dpR}pR}T $~ $~`7~7~_  6tFGSdd$.ۄۄeiۄۄ`O@i܄܄* ``ل`ل`ۄۄW@@i`] X v ~g ~ ń ńڕ``{00ӂӂq ixxȄȄ((BR ] XXllv$\((Y')io`\@\ X˃X˃>ڃڃx̃x̃sx 6tFG]I`o*%s(( e)) ~88! h,h,:++!**0 oI`*]]xI<<``*ff0||I! @RXX77II`**I(p(p"rr` 0 ~x@x@(0 D?D?liliYII>eg6U ^V%Աқhқӛӛsԛԛ@ ֛T՛uA ؛֛` (ڛTٛV Xܛۛ*ݛݛޛ(ޛa+@ߛo`Z@8(" L- # Q!(! H|A  j PJE`; { Ɣ ~U   {  N \d3 6tFGc~t %!ққӛӛsԛԛe 00@ ֛֛uA ؛ ؛` (ڛ(ڛV XܛXܛ*ݛݛޛޛa+@o``Z@(" LL- # Q!! HHA J j JE`; { Ɣ ~U   {  N @ 6tFG`ݵ%%1 $Y$Y>X T0T0(@ dd{ GGn L;L;8 55>` k k|` KKz` AA0 WW= `` X 11TY \\|@ ff+ II2@Y SS|Y <7<7$^ H=H= ..v[@ ll Y qq[ bb-^ EEY MMԟ ++ QQߟ@ ,9,9&2 [ [ ^^Z OOt UU[ s s@@ 33$ nnj  hh` p?p?I \C\Ck.\ 6tFG % xx ʦ@DD_!@OH6 RLLo Ǒ@x\\dґf`ݑ@x77@xDD88R00udd_FFuhh;`-DDxx ||B|BQ! * J,J,J9S fG5f;%`[~5,0u 6tFGgӹY%!z<]}<]} b}b}~b}b}U Ta}Ta} b}b}e b}b}H0`c}c} `}`}d]}d]}8`_}`_}D_}D_}?"d`}d`}xE`}`}6-`}`}F `} `}OhEt`}t`}P]}]}` P]}P]}E `}`}Z `}`}`OLc}Lc}/ (]}(]}EO `\}`\}6`  V <<O`Xd}Xd}6 !Hd}Hd}XE d^}^}|mTC~C~`<}<} U}} 6tFGnYRo&KK!`K`K4L4LKK KK9 ~KKLpTKTKV%`KK. LL ~KK9 KKu ~KKb ~KK8K SLSL7 ~hKhK  ~9p)Lp)L~e !*!*@ **J ))f  P)P)w ))f * *f **` ()()V **l  **w * * d$*d$*fT(T(Z~,((((bmL(L(n .*.*z 5*5*t(t(  x&*x&* <*<*))1x(x( N*N*@ hM*hM* I*I*f` K*K*` **f f  L*L*  f;''h(h('`?Ro33Rotr;ŻYS@bS=9`H$@(֯, ׯ0 `ׯ4Ҹׯ8޸ׯ<@9_HpeP7ɱT긩 \9:dͱlͱmſͱnZͱo쐪 ̱pI ̱t׿`˱x7`˱|鿪`˱`˱`˱`˱ `˱kS& îu ˱ ˱q`˱I ̱ ͱ9ͱͱ~pͱIͱͱ97UKUc5 ޼ u((ru!/Ro`Ro!dSnh$ #`Ŷ= 0 s QpQ QlQ_!@4QQOQĄQH6 0Q@QRQ$QQXQo Q܉QǑ@x̋Q8QdQdQґQQf` QQݑ@xlQQ77@xQ$QQPQRQQuԖQ@QuܙQlQQPQ@ОQQQ! QQ* Q\Qu>co`F76Pv!^Ʋ 6tFG>g' ``x x E@ DD\88 S@i X/ @ @x ,,eTTi XXr`hh ```/ll~fS.Y`` S00 /Li  i,j @ F -@x S S.F44rs9tFG'`}&! $     vN   p4` rt t @l l   Vk N x x N      /  / @$ $ `  fܫ ܫ N  Ԧ Ԧ Htp p 1)  x x <  0 0 V  `kL L @ /ԡ ԡ *P P jk  <` ] QLNtk X< +n{]ӳ44] 0x`z%`0R- `a`~{ ^{$c,h˱4]٪<"ઽDE@H Po٪dlctc|ͱ"ͱͱΩΩͱ~ͱͱ{˱8 ̱{ v ͱ$k˱ ͱ{ cͱͱ ͹ͱ 9 6tFG("((" <<"```!@s1 ^K` HHgK    4"4"##od%d%''|(|())8+8+g`,,Q!(.(.pK //7<1<1J22:`" "," 1 !eyK GK!,Jִ 6tFG9@ߵ(([ ؇` pߗpߗ` >@ >\ dd ,,@ P P @ 2` 8 ƗƗ` `  ` ` J` @\ ——\ U ؗؗ5\ ڗڗsU V  7 ̗̗] @ LȗLȗ|` "| 88[` ܗܗR@]  DD {` ӗӗV` ,՗,՗` ї ї@B ͗͗ɟ ϗϗ6^] <ח<ח] % ʗʗ@ ėėzۭ 6tFGU($!ܢeܢem ee*teem 0e0ed ee  ee6d ____WH_H_Kx h_h_TI,_,_7$)__p__c __)$"kR__c Xt|%>g g'(7(  `x x $E@ D8\8| S@i 8X/ @ <@x ,0eTi Xr`hX |``/l~\fSP.Y`` PS0d /Li 菡i,j @ F D-@x S S.F4Z 6tFGA ½w*$d/0d/0/0/0 |00|00v8 ;0;0*X@ /0/0u 9090(@ ,90,90Ax0x0R t80t80 @ 7070}8 H;0H;0 `4R04R0 1010x'@ 2020u h20h20(>@ ,10,10x<H0H0/0/0)8/08/0\0\0> 00u&`O0O00>TQ0TQ0y@ ~!0!0@ 00 00 / 7070. <60<60X x:0x:0-@ @40@400< 5050O 4040X 30308 P<0P<0 *00l00 ~-0-0*C0C0vE0E0\@ D0D0X`6 B0B0* ~D0D00tFG_ ((膩0 "4 4" 5,5"`6H6!8t7@p98D: :s ;h:1 h<;^K` = =e`?l>gK \@? AA BPBDCo,FXEGGDIH`JILJg`M MQ!NLNpK LPO7RQ:`" "," 1 !eyK GK!,JwtFG((~0 "(" <"``!@Ls1 8^K` HgK  <  4"!#"od%$'<&|('))8+ *g`,X,Q!(.-pK /.7<1<0J2H2:`" "," 1 !eyK GK!,JKq$'C K88K#EP٩̱]٩̱ 3`34)`}E$c̱8ṉ<y̱@ẖDL$ αHL`˱P˱T \˱`:h;MͱiTکͱj.ͱk]ͱlͱmͱnͱoyͱp. qͱrzjͱs ʱt.ͱujͱvaک`ʱw.˱x˱M`=`˱jj̱j̱S$̱˱̱ M̱M̱M9M`3 α"`˱°IM6#/˱bg 6tFG~iH+#$ܢܢ~~<uuRWdxdxvN`rddl>! \\' *' 44` HH00  fh/ ( ||Httt1)ęę$$<` pp; nnN> PqPqrrttV@~~ /}}<`hh]kk[W QL8)`  HLNtk *U 6tFG2@,$ft3&t3&t4&t4& 5&5&K`6&6&17&7&YJ`8&8&9&9&1X:&X:&;&;&MX<&X<&00=&0=&4m?&?&?&?&@&@&A&A&tB&tB&C+LC&LC&bJD&D&EE&E&D*@F&F& @G&G&`H&H&0  J&J&`|K&|K& /L&L&^[M&M&"`xN&xN&N%%b*P%P%dgP&P&PQ&PQ&χڇ(Kx11K :K8<"L`j 6tFGUU`d,%B>7XX$.ҧ @@ݧ 7Xc8$$@8&8,,8j944@9V9@@VV9v:HH@:R:PP:;XX)@;;``F;x'<hh@<R<pp)!'<7 /=XX@=@>=``=>hh0<@>>pp>?xxsU   N ^ ! 2 !.2@*(> -$ft3&Д%t4&,% 5&%K`6&%17& TuTu?LuLusԠuԠuЛ@ luluk`uug@9 ܟuܟue`uu uu> uun ,u,uK ~7ʅʅ$.8Dž8Džҧ ,ȅ,ȅݧ DžDž7ȅȅXc8ȅȅ@8ȅȅ&8DʅDʅ8TʅTʅj9dʅdʅ@9ʅʅV9ʅʅVV9ɅɅv:ɅɅ@:ɅɅR:ɅɅ:ɅɅ;ʅʅ)@;ȅȅ;ɅɅF;ɅɅx'<$Ʌ$Ʌ@<4Ʌ4ɅR<DɅDɅ) Dž Dž!'<ʅʅ7˅˅ /ʅʅ=$ʅ$ʅ@=4ʅ4ʅ@>=TɅTɅ=dɅdɅ>tɅtɅ0<@>ɅɅ>ɅɅ>ɅɅ?tʅtʅsU   N ^ ! 2 ((> -jx]>>x]:U@wo@wo, ̱0+T4!O@N807j<;@Hé ֽPC`BXWּ\0x`OU` d`dhpdU`x9}|,U Dɱo:x@L8`@`ɻDF׫C ׼ ׼e ׼yU@h̪@̓u@=í@ԁB,@ yͱ,ͱͱ,ͱ*Dͱ#ͱUͱg@ 7׫ 45_ Ho \ép"t6ͱI@9D׼o s`*ɱh@E87U lT{*^@ƫAAɱO>%ɱ Oɱ(ɱ0Oɱ8@H L`PJTƫɱ`VɱhiܩpHɱtu໰|[6໰O໰O໰ ln໰>0e`Z$666M0 \0ɱk0@ɱl໰vܩ@ɱɱɱl ˌ  ࢵ( o)ͱ-I0=<(l D`1@P ̱T3 ̱X ̱\ͱ`6ͱaz0ͱbͱcͱdͱeͱfͱgR ̱h=.+` /)4˱˱|{O % L  L6 \% \YJ`D  D4 X! H0@xe,s@Ot% 6`%e D*@O@ @ 6%`, $6 /`@LgHl~(@kpO$O <`,`$ iDܛ~D` `6XM 6tFG`Yw2_` ii uu ,o,o qqW >`  ` 00N` ؓ ԷԷ.f LL>f DD: Z ! ddW,r}x` q` p(p( f,ǒ,ǒu:++x䭒䭒88P5P5hyHHHH:L=L=` LlLlT -/ : HH8,8,:r XX:<<ILppE, , ۑۑ`:`:~첒첒|&|&  b 6tFGs`fB2'` g;g;0B`R ;;qR ;;;;]P ܺ;ܺ;P ;;H Q ;;0`Q ;;>Q ;;``Q D;D;Q $;$;P ;;: DD;D;`D\;\;`D|;|;@x,;,;x;x;0@;;;;D@;@; D;;Ht;t;^ ~h;h; @\;\;(`;;D;; ,;,;E\z;\z; @;@;^t R ;; ܔ;ܔ; \;\; X;X; `R ;;l* Q ;; /g;g; `z;z;pz;pz;b*;;t;t;P;;[x-;x-; ^f(#;(#;h1D;D;am;m;4,r;,r;t;t;@:@:؅ 6tFG3-L ~xQUxQUH9TT8@8U8U6`Y jUjURUU@RtmUtmURɱ0$ ˱7$ ˱߉ ˱4jͱLͱ کͱꉩ ʱ>$ͱzMͱJͱoͱ>jVͱ`ʱHj˱O ˱.b6U`M`}`M -ک `˱``˱d!`h}:p,`:ک`Rj α. ̱o ϱw٩`˱\j`}#M@;7̱Ḇfj n`3̱3̱z.Hpj 8 MM˱@ ̱HX૰Lżs 6tFGt?8/0 !LL* 44P=\\X=@00`=`tt)`PP)uu&`M?   ) h= 44VĐĐWt||s@@be@ \? k? ((W ̨̨`   44 ,,ll؅؅ohhnj`   v( $P` z? 00 Lp@1$$Q!HHt ? dd? $$<J   p= + (=hhDMt0= ~tn ~G ~xx*func(go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }, go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }) int֎ 6tFG ;-{O % LL LL6 \\% \\YJ`DD  DD44X! H0@xeh\\s@O%6``%e D*@O@ @6%`,,  $6 /``@@gHH~((kppNHH 0b*  OO ``6\\ iD~D` 6`6O ~O*struct { pragma.NoUnkeyedLiterals; Flags uint64; Size func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }) struct { pragma.NoUnkeyedLiterals; Size int }; Marshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error); Unmarshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error); Merge func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }; CheckInitialized func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error) }*func() *struct { pragma.NoUnkeyedLiterals; Flags uint64; Size func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }) struct { pragma.NoUnkeyedLiterals; Size int }; Marshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error); Unmarshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error); Merge func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }; CheckInitialized func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error) } 6tFG(ҵ>!D@D@NP@P@@*@*@؏@@(@(@k?k?KRpn?pn?`0@0@s$@$@*Hl?Hl?l?l?oHm?Hm?m?m?Y`<2@<2@Q! ? ?w@w@@@E@@2@,@,@#??t @@"@@GUAUAU@@YH,?,?@@RІ@І@3Z@Z@_??t.b@@w0nC0nCU@nDnDI ~@kDkD` ~8lD8lDU`oDoDnHtD C C*5L?L?95??@4?4?¶U@ď?ď?f@?? ? ?w??CCCCMDD=6 ? ?@@!??,D?D?t????+:x 6tFG s?@3Xn \\Ŏ\\Q@\\w3l\l\3l\l\5\\N\\\\@T\T\@8*]*]bn+]+]ln  +] +]vnl\l\Q@,],]Ў @\@\C H\H\ێu]]Q]]Qp,]p,]H-]H-]@,],]]]n-]-] .] .] @]]Z ] ]ٺ`|]|] 4/]4/]F`.].]``$]$]J30]0]Y3/]/] |0]|0]<1]<1]'0]0]4]]f 1]1]H]H]W|]|]@]]rT&]T&]3T"]T"]~ 1]1] 2]2] X2]X2]'(](]A3]3]h3l3]l3]_!3]3]h` P6]P6]3@\\F ~h8@0A]0A]3]]u$F]$F]=& 5] 5]F ~y\\ ~\\@`O]O]3@ L] L]pe ~aR]R]z 6tFG`RoAp^Jp^J'^J^JP9`\^J\^J6@@_J@_J@xeJeJ'8@ V ~XlJXlJJJppcJpcJvKvKc9TJTJ ~KK`J`J_ K KJJIJJ8XJXJ LKLK K K ~nJnJ ~ ~0 ~JJ JJJJ68JJdHJHJJJAxJxJJJdxJxJ@@J@JRJJ'JdJdJ ~hJhJ*JJ]J]J7ȧJȧJ`K`K ~TJTJc K K% `lJlJCXKXK' ~pJpJ3 &``J`JtJJ ~JJ ~pgKpgK"\_J\_Jr ~mJmJ.d`HJHJ'XwJJַJJLkJLkJJJA LKLK2JJ§I 6tFGdLB3Xn ]]Ŏ]]Q@]]w3H]H]3]]5]]N]]]]@<]<]@8h]h]bn]]ln ]]vn]]Q@]]Ў T]T]C ]]ێu]]Q ] ]Q`]`]]]@]]]]n]]]] @D]D]ZX]X]ٺ`d]d] ]]F`]]``X]X]J3l]l]Y3]] ]]]]']]4]]f ]]]]W]]@8]8]r\]\]3]]~ ]] ]] ]]']]A]]h3]]_!x]x]h` T^T^3@x^x^F ~h8@}3u=&F ~y ~@`3@pe ~a_/ 6tFG QB `3`35 0303u&" 03030`33 ~33C ~^_;``3`3I<3<3Kd3d3 ~33_$4$433`,3,3`! >x3x3C3333 `H3H3}33_}}*C _C&},)_C)s3s30}$2_ ;_W33D_` 4 4>+ ~33e33  ~334433s:}<3<3M_ 44`33V_l3l36334 ~`44`44`0303B<3<3C4444-`33)z9tFGdCLB3ߩ ;Xn ]]ŎT]T]Q@]]w3]]3]]54]4]N`]`]]]@]]@8]]bn]]ln ,],]vnX]X]Q@]]Ў ]]C ]]ێuH]H]Qt]t]Q]]]]@]]<]<]nh]h]]] @]]Z]]ٺ`]] ]]F`0]0]``]]J3]]Y3]]  ] ],],]'8]8]4D]D]f P]P]\]\]W]]@]]r]]3]]~ X]X] \]\] `]`]'d]d]Ap]p]h3t]t]_!$\$\h` Ȅ\Ȅ\3@8^8^F ~h8@}3u=&F ~y ~@`3@pe ~a_\\QP 6tFGXs vNsD;`% XX;`% ee<`% ii<% zzs% , , @aa1""&`E`<`J`% @@<`*  T#T#  R H0`||O * ((h((s@x'$$2VsT & ^^O@pp @Y`% ((.`% @F@F;V`% \\^`% s% PPchvv `% xnxn<ttm`%   <`* e`& DDr`%  w & __@LLHH(<` `c`cDV`s88s PP XXXxXx / | |`% -PyPy""0<` 0||b*|`% rr~##MV ) * 88`% RR`% SS|`% UU:g(( ؕ4xFz)`dAUAALCɱ Hh> ɱɱ 5 `X ~ ~1`C Q ~5Q`k` (9 A`AklJ-A[5 O*p@5p@5x<C5C5x>u&E5E5X`X ~ȘQ5Q5 ~1`C Q ~5Q`k`  PC4C4(9 A` ~AklJ-A[_@SP\P 9DO`m % N_[1,^_ \\j1u`y1@1@q1@@%<[<[n_9 ~SF1`[[~_<6\<6\X+\X+\1\5\\5\14\4\H7 [[[[l[l[[[1h.\h.\@x[[.eP@x\\1u1 ~H[H[@x8\8\~[[Z[[3[[sh[h[\\PES $ 6tFGNi|HeM LL&`  V||Zf*tll<s̸̸<V88# ~! ~DDrW` W  X! ``!`  @(  * DD) $$?"` ?>)ttbJ6$$f4t` ppW<<>t h/`  Ht((; N> PP  W@,,! #``@@'`%W<<s`< ~ 88Rt8<LL5 ` 88@.WTT7W ~#)( <` `` /,,@W IW Upp-`@@@]>44\t`3`  < ~| ~ni ~& ~ ~ ~Nh*)=ftL`pt O.|NiuH|HeM4  αԽ LLTM&`N T VV|hTZXfd4*tl <s̸<TV8(# ~! ~Dr7W` W l2 X! `;!` 4 @(  ؤ* DȦ)L $?"` L0?>)tbJ6$f4t` pW<<>t h/` ( dHt$(; N> Ph TW@,! #`$`@ 9'\V`@%W<s`< 4~ 8RtL8<pL`,5 ` 8@.WT7W ~#)( (<` `h  /, @W IW Up$-`@@]>4\t/`lO3dW`  0h< ~| ~ni ~& ~ ~M ~Nh*)R=`ftLp `ptҦ 6tFG^|b L6L62l`66.366055^767655nl`4545l5l5X5X5N^B6B6 ~66> ~66D ~8 68 6_ ~ 6 68686R7676?6?6> =6 =6^^@ 66щ`l6l6 66`h6h6LS 6 63663`66hS 66S`@6@6 66 662626n^6666l5l5? F6 F6 h5h5 556 T6T6`TR6TR6xF6xF6%``6`6xl`x 6x 6!6!6`!6!6766O`66S [6[60 660 ~66 ~(H6(H6 t5t5l7676O@5@5r@<5<5557 55`55Sؿ5ؿ5~^55$@p5p5p5p5@о5о5% h5h57 `5`5 ̸5̸5!`55@l5l5f@T5T5^@55l 55%5555/55X5X5055P#6#6=`66z\6\6;h6h6$5$5K55&55 ~66 ~66 P`H5H5l557@x55R 5 5W 66*s 66) `6`6(q 66^g6g6755%X5X5 755>q ,46,46Hhc6hc6Tq ~T6T6^P6P6P ~\5\5(7 ~D ~V6V6/o 6tFGj ¿!X ~1~1ڿ X1X1`1111{1{1<|1<|10H1H1 00)/ 00 ` 1` 10 $ 1$ 1  1 1@@0 8 18 1*X@ 00ju0 00 110 11k 11:1 11tu 11˗0 11 (1(11 11X V1V1"/ "1"1= "1"1~u/ 1 1֗@ 8!18!1u '1'1@1 |(1|(1@ 7171k1 X81X81 L51L51v1 l61l61(@ d&1d&12 '1'1Lz1Lz1l1l1VV 4141u@2 11 11@2 H1H1K <1<12 \1\1@ 1153 11R 11u@3 `1`1 11.@3 \1\1\ P1P13 p1p1 @ H1H1B4 11JP / 00 0 1 1.k  11O  11u11. `%1`%1`0 441441. 11m0 $1$1`. D1D1~0 8181)`# `(2`(2u 1 T2T2"`1 p>2p>2\1 L2L2@7D1D1u1 11l . 11=@ 2 D1D1l- 11L@`2 2 23X2 222 22>1>1. [2[2>k ' g2g2>_ ' @w2@w2Nk 3 ̄2̄2`3 223 T2T2\P- L2L293 22D 4 22O`4 4242u4 224 22A1A1dl`A1`A1 0+20+2= O2O24 dY2dY2u 6 L*2L*2 С1С1 |1|1) 11>@6 11u 116 x1x1)@ 11>6 |1|1F 11v7 h1h1[@ \1\1^k@7 |1|1u |1|1 7 11x'@ P1P1 >7 11R ` 2` 28 $2$2j@  2 2nk@8 8 28 2u 118 11@ 2 2)8 22NX 22v9 h2h2@9 <1<1 v d"2d"2#9 (#2(#2  2 29 @ <1<1WX: 11x<C1C1~k@ I1I1^`M1M1(@ K1 K1(|1(|1){1{1u&`11v 5 @1@10>11y@ ~@W1@W1@ @N1@N1@ T1T111;1;1 ?1?1\D1\D1 / ^2^2 k2k2@: k2k2k@ h2h2: i2i2`X: _2_2 z2z2!@: d{2d{2k@ Xx2Xx2˜: xy2xy2 2 2@ 2 2k; 2 2  22@; 22/; 22k@ ܅2܅2Ә; 22k 22< 22 d2d2f)@< x2x2. \2\2j< ]2]2-@ 228> 2 2iX< 229 22v= |2|2@> 22rX@= |2|2D@ |2|2= 220< 22{X= P2P2O 8282> 22) 8282H>@> 22v@ 22Z> 22)> D2D2e 2 2? 22= 22@@? 22X D2D2(v? 22`5 `|1`|1@ $~1$~1*? |1|1 *hB1hB1l@1@1*11F1F11>1>1% p11K`1`1@11Ph1h1* ~11sW^qr]:txid2., ; %!i))(tvrRuUeEaAlLsS01bBoOxX+-nNiIfFpPup??ip53->._: |0|1M [("")) ) @s Pn=][} ] > +25\x\a\b\f\n\r\t\v\u\UnsusmsPMAMpmam00µTZgteq__--[]to%v""%sts80TE//./])iv{}"::% ,W/..h2%wteTe%T ">OKca*.EC%x%ph30b0x0X0oOUCNST=# (LlLtLuMnCcCfCoCsLmLoMcMeNdNlNoPcPdPePfPiPoPsScSkSmSoZlZpZsYi}}NSMX" os%X+1%f%d%%%qjsorgeleltne] ${ lo~.\\\"ToA4V1V6V2V3V5A3INCSCHHSDHDSKXLPMBMDMFMGMRPXRPRTTA z=" "" m %tif{{/**/\d\'͏$1=: `#; # ;\;\#:= :| ''# [[, !! `!<<>&^+=-=*=/=%=&=|=^=&&||++==!=<=>=go msgudpsniuriTUNtcp443ymltlsaclurlB/sbpsRSADSAURInil01_cgodnsftpssh::1set): PWDfinptrobjgc %: gp *(in n= - NaN P m= MPC=], < end > andnew...]: ???pc= G125625nanSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUTCµsμs") } top -zsh%s hclenvinikeytun///%25ip:%+v'"'ACKGETGet../agevia200404://1000 ,h1TXTtxtPUT853MD4MD5SETEOFintmap�HanLaoMroNkoVaiTTLSOAPTRSRVOPTdupnet lennot" arg%#vb2bKEMexpVia.js?*[If-204206304400500‍‌ANYechPGPOIDAPLAVCCAACDSDLVEIDGIDHIPKEYL32L64LOCNIDNXTSIGSPFUIDX25:0x%0X qr aa tc rd ra ad cd\# macMAC %q() = | for""" inf]] 1.1----0b-0oTAG allanytapgtpifbvrfsitvtigrecanEndbgpmrtntkrip @ %#xackAnyu00103503*/*302403421425getOp(: ` (?:\x{delLZSADDSUBKey'''atmx25pppbifashneg#%djeqjgtjlejgejlttxataxINT<<=>>=&^=varoptreqrepb2sinfowarntimejsonobfsaddrnameyaml:443acmePOSThostquicKB/sMB/sGB/sKbpsMbpsGbpsarchshashatruemap[eEpPicmpigmpftpshttppop3smtp) = dial readfile on pipebindunixwaitseek/tmpHOMEopenstatsynclinkallgallprootitabsbrkidledead is LEAFbase of <==GOGC] = s + ,r2= pc=none+Inf-Inf: p=cas1cas2cas3cas4cas5cas6 at m= sp= sp: lr: fp= gp= mp=) m=3125AtoiquitJuneJuly as hour in /etctrimrpad%s%s %v helpbool", "bashfish:%d tomlproppathargs\u00INFOWARNnull'\''IdleOpenHost<>1080DATAPINGHEADEtag0x%xdateetagfromvaryDateconngzip%x Gonep256.keyhashsans127.ocsp.crttypeAAAAipv6LinkConninithookusertcp4tcp6udp4udp6%08XAuthasn1tag:md5int8uintchanfunccallkindArgsCall != shaAhomChamKawiLisuMiaoModiNewaThaiTotoshashashashabitsNameTypePreftextPort--%sintshtml* %sOsFsFullautoHPKE --From.css.gif.htm.jpg.mjs.pdf.png.svg.xmlxn--SHA1NONEalpnportPKIXSPKIIPIXIPGPATMAAXFRCERTGPOSISDNIXFRNSECNULLNoneRKEYSVCBTKEYTLSATSIG-tlsTYPE%+v %+vcodePWD=PATHelsewith<%s> := listspancasevoid(?:)NodeFile.exe %s -inf...`%TAG.inf.nanTrueTRUENull.NaN.NAN.Inf.INFYAMLslowfast{%s}downvlanvethbondDOWNipipvti6xfrmsitebirdbootdhcpisisospfxorpenumlazyweakechoBoolTime!BUGlinepostflagcap -> fail(?P<%s%dX448certzlibzstdX509*%#vBOOLdrop[]%sax25dlcisliprosehdlclapbfradskipfddiirdafcppfcalfcplXXX_LMQHor xjneqIMAGCHARgotoPathKindEnumdef=0000%02xsharedebugerror%s:%dlevellinuxcountemailbytesspeedECDSAfalse(nil)ErrorsvqxXfileshttpsimap2imap3imapspop3shostsCNAMEwriteroute : close (at no IPchdirmkdirchmodchowngetwdpipe2lstatdefersweeptestRtestWexecWhchanexecRschedsudogtimergscanmheaptracepanicsleepgcing MB, stack got= ... max=scav ptr ] = (trap:init ms, r0 r1 r2 r3 r4 r5 r6 r7 r8 r9 r10 r11 r12 r13 r14 r15 r16 r17 r18 r19 r20 r21 r22 r23 r24 r25 r26 r27 r28 r29 r30 r31 pc link lo hi fault and tab= top=[...], fp:1562578125denyMarchAprilmonthLocal [P] [L]%s %sSliceArraypropsaliaspathsvaluesocksparsexxxxx/auth"NaN"fatalDEBUGERRORPANICFATALtls: Earlyarray&"':***@%d %sRangerange:path%s %q%s=%sHTTP/Allow:httpFound.jsonuserschain%s_%srenewlocks.locknamescache%v %vPATCHcleartokenHS256RS256ES256ES384ES512titleestabStateSHA-1P-256P-384P-521P-224int16int32int64uint8slicefunc(kind=GreekAdlamBamumBatakBuhidDograKhmerLatinLimbuNushuOghamOriyaOsageRunicTakriTamilClassRetryfcntlInts:Ptrs:floatuintsbools[=%s]test.ValueipNetbreak.eEpPindexprintTRACE -%s for ,end PlainRegexlocalmuxer.avif.html.jpeg.wasm.webputf-8%s*%dtext/Realmbad norderauthzQUERYED448OtherISPKIAFSDBCSYNCDHCIDDNAMEEUI48EUI64HINFOHTTPSMAILAMAILBMINFONAPTRNINFONSEC3RRSIGSSHFPUINFOCLASSdns: udp: %d %d (%s)scopestatebasicBasic%s/%slabel%s-%sblockinputstylestart%s.%s.test%s%s --- .%09dline !!str!!seq!!map%YAML-.infFalseFALSE+.inf+.Inf+.INF-.Inf-.INF!!int%s %sdummyvxlanipoibownergroupGuardFloodencapEnd.XEnd.TEnd.Sbabeleigrpgatedzebrafieldctype0-RTT1-RTTInt64Group\u202%s%+dmatchrune commaspaceIDENTFLOATCOMMA%d:%dFlushTableFloattablegob: not etherchaosatalkcslipslip6rsrvdadapthwx25ddcmpltalkhippifcfb0fcfb1fcfb2fcfb3fcfb4fcfb5fcfb6fcfb7fcfb8fcfb9EntryStartadd xsub xmul xdiv xmod xand xxor xlsh xrsh xja %dret aEd448COLONconstNamesIsMapOneofEnumsInput\%03oname=enum=json=weak=oneofclientserverloggerfwmarktls.calistenremotedarwinreqURLconfigstderrmethodnotext%.2f%%urgent%s[%d], not StringFormat[]byte' for stringnetdnsdomaingophertelnetreturn.local.onionndots:sendtoip+netsocketspliceacceptwritevno '/'readatTMPDIRrenameremovewaitidsysmontimersefenceselectSIGEMTscalarGOROOTmipsleobject next= jobs=status goid sweep B -> % util alloc free span= prev= list=, i = code= addr=], sp= m->p= p->m=SCHED curg= ctxt: min= max= bad ts(...) m=nil base 390625hangupkilledallow/proc/errno SundayMondayFridayAugustminutesecond fi%%-%dsError: [LP]tfvarsdotenv$HOME/callerBasic udphopCauses"+Inf""-Inf"\ufffddpanicDPANIC0x%04XX25519%w%.0wtls13 numberClosedactiveclosedsocks5CANCELGOAWAYPADDEDCookie

bytes=cookieexpectoriginschemeExpectstreamPragma.
:httpssocks Locked

%s.
dns-01_truncrenew_obtainissuerforcedreason_plus_DELETEAcceptdetaildirectrejectStream-----
STREETuint16uint32uint64structchan<-<-chan ValueCommonArabicBrahmiCarianChakmaCopticGothicHangulHatranHebrewKaithiKhojkiLepchaLycianLydianRejangSyriacTai_LeTangsaTangutTeluguThaanaWanchoYezidiheaderAnswerLengthWeightTargetcmd/goipMaskprintf'"&<>\u%04X3:04PM%w: %ssquash%v=%v

    	geoip:heightsecret--%s
Server%s: %wSHA256GOST94SHA384SHA512IQUERYSTATUSNOTIFYUPDATERSAMD5NOTIMPBADSIGBADKEYBADALGACPKIXDNSKEYNIMLOCSMIMEATALINKUNSPECZONEMDnil rr, id: ZONE: \\\044\\\0920.%02d%.2fm %.0fm %0.16x%0.16XbearerBearervpc_idiso_idreboot/v2/osexec: definescriptexportlayout%s=%s
\u%04xtoml: yaml: !!bool!!nullonlink802.1qbackupalwaysbetterfollowlayer2stableunspecdevicebridgetuntapipvlanipvtapACTIVEBACKUPgenevegretapip6tnlip6greGw: %sinlineEnd.B6End.BMEnd.ASEnd.AMnh4 %snh6 %siif %diif %soif %doif %sin: %skernelstatic%s:%d proto2proto3Proto2Proto3sint32sint64doublesyntaxpackedjstypeECT(1)ECT(0)Uint64empty rune1 brotlipsk_keNUMBERSTRINGLBRACKLBRACEPERIODRBRACKRBRACEASSIGNtoken(%s: %s[%d]%seetherpronetarcnetcslip6ip/ddppimregeconetfcfb10fcfb11fcfb12%v: %v.protold #%dor #%dimportswitchIsWeakSyntaxNumberIsListMapKeyFieldsOneofsValuesOutputGoTypevarintUnknownversionconsolewindowsandroidreqAddrdisabledns-santls.keyzerosslacme.caduckdnsgodaddydefaulttcp-tlscommand%.2f %schannelEd25519MD5-RSAserial:(PANIC=booleanbdoUxXvintegercomplexfloat32float64runningopenbsdsuccessoptionsrecvmsgsendmsgconnectlookup writeto::ffff:no port (trap writeatchtimessymlinkforcegcallocmWcpuprofallocmRunknowngctraceIO waitsyscallwaitingforevernetworkUNKNOWN:events, goid= s=nil
 (scan  MB in pacer: % CPU ( zombie, j0 = head = ,errno=panic:  nmsys= locks= dying= allocsGODEBUGSignal signal  m->g0= pad1=  pad2=  text= minpc= 	value= (scan)	types : type 19531259765625abortedstoppedTuesdayJanuaryOctober-070000Z070000, time.[flags]ignoredinvalidCONNECTUpgradecapitalISO8601RFC3339iso8601rfc3339Verbose%sErrornil keytls3desderivedInitialnumber Trailersocks5hHEADERSRefererCookie2expiresmax-age; Path=
flags= len=%d:method:scheme:status (conn) %v=%v,refererrefreshtrailerchunkedname %qupgradehttp://OPTIONSnosniffCreatedIM UsedHTTP/1.privatemailto:http-01accountattemptelapsedmanagedrenewalissuersED25519storagersa2048rsa4096ed25519rsa8192timeoutexpiredrevokedcontentBearer verbosedomains&limit=pendingheaders, url: Alt-Svc/onlineSHA-224SHA-256SHA-384SHA-512numeric2.5.4.62.5.4.32.5.4.52.5.4.72.5.4.82.5.4.9uintptrSwapperChanDirbucket( using , type=closure Value>ConvertAvestanBengaliBrailleCypriotDeseretElbasanElymaicGranthaHanunooKannadaMakasarMandaicMarchenMultaniMyanmarOsmanyaSharadaShavianSiddhamSinhalaSogdianSoyomboTagalogTibetanTirhutaanswersaccept4Floats:os/execruntimestrings[="%s"]ipSliceprintlnLOG: nsuµmhUsage: , need ,start suffix:closingbalanceHPKE-v1eae_prkExpiresSubject%03d %sutf-8''charsetproblem[%s] %wbad keyRSASHA1BlockedNOERRORFORMERRREFUSEDYXRRSETNXRRSETNOTAUTHNOTZONEBADTIMEBADMODEBADNAMEdohpathIACPKIXCDNSKEYcreatedmoduluspublishbad offQUERY: NOTIMPL$ORIGIN%16.16x%12.12x%s/haltdns_sec/v2/isoRefusedquic ivquic hp{{end}} actionoperandDEFAULTBOM: %vcomment := :=fnrt%s%s%s !!merge!!float (with 802.1adfailure802.3adgenerictestingdormantmacvlanmacvtapbareudptunnel6HairpinDst: %dDst: %sVia: %sSrc: %snowhereEnd.DX2End.DX6End.DX4End.DT6End.DT4out: %smroutedmap keyfixed32fixed64messagepackageserviceeditiontargets(empty)Not-ECT%s (%s) %s %#vquic kuFloat64!BADKEYalt-svcpurposeInstAltInstNopalt -> nop -> any -> requestOpenPGPDEFLATEdkp_prkILLEGALCOMMENTHEREDOCillegalInvalidCommentInteger%s %s; ieee802rawhdlcnetlinkproto: ldx #%dld [%d]ld #lenld #nlald #cpuadd #%dsub #%dmul #%ddiv #%dmod #%dand #%dxor #%dlsh #%drsh #%dret #%d%s: %s PackageDefaultMessageImportsMethodsbad loghysteriainsecureHysteriaplatformtls.certacl.filepassworduserpasshttps://filenameprogressSHA1-RSADSA-SHA1x509sha1DNS nameGoString01234567beEfFgGvnetedns0[::1]:53loopbackcontinueunixgramtimeout:trust-adshutdownrecvfromfile+netinvalid address raw-readsendfilereadfromsignal: truncatereadlinkunlinkatopenfdatscavengepollDesctraceBufdeadlockraceFinipanicnilcgocheckrunnable procid is not pointer, errno=BAD RANK status unknown(trigger= npages= nalloc= nfreed=) errno=runtime.[signal reflect.GODEBUG= newval= mcount= bytes, ----- stack=[ minLC= maxpc= stack=[ minutes status= etypes 48828125infinitystrconv.parsing ParseIntno anodeEMT trap/uid_map/gid_mapThursdaySaturdayFebruaryNovemberDecembertime.UTC%!Month(_filedir_%s() { [flags]%s %v=%vintSlicepositionTrailersPANIC=%vtlskyberCurveID(tls echDOWNGRDDOWNGRDhttp/1.1finishedexporterfont/ttffont/otfhijackedNO_ERRORPRIORITYSETTINGSLocationhttponlysamesite; SecureHTTP/1.0If-MatchIf-Range data=%q incr=%v ping=%qif-matchlocationbad_flowprioritybad_pathHTTP/2.0Trailer:trailers%s_%s_%soverlapsdisjointboundaryHTTP/1.1no-cachePROPFINDidentityhttp/1.0ContinueAcceptedConflict[^\w@.-]subjectsfc00::/7lock_keycert_key%s/%s/%ssso-key instancerejected%s|%s|%s/trafficReq-AddrTX-BytesRX-BytesLifetimeMD5+SHA1SHA3-224SHA3-256SHA3-384SHA3-512nil Pooloptionalexplicitdefault:2.5.4.102.5.4.112.5.4.17FuncTypestruct {ArmenianBalineseBopomofoBugineseCherokeeCyrillicDuployanEthiopicGeorgianGujaratiGurmukhiHiraganaJavaneseKatakanaKayah_LiLinear_ALinear_BMahajaniOl_ChikiPhags_PaTagbanwaTai_ThamTai_VietTifinaghUgariticVithkuqiClassANYQuestionPrioritygo/typesnet/httpgo/buildbytesHexdurationurlqueryCRITICAL/dev/tungeosite:elementsROOT ** GET_0RTT (local)HTTP/3.0\.pN\d+_distinct --%s %s: %s Receivedus-asciiif-rangeNO_PROXYno_proxybad timeECC-GOSTINDIRECTCensoredFilteredSERVFAILNXDOMAINYXDOMAINBADTRUNCipv4hintipv6hintAMTRELAYIPSECKEYReservedNSAP-PTRactivatePrime1: Prime2: flags:; ; EDE: ; ESU: %s: (%s)PREREQ: UPDATE: ANSWER: $INCLUDEbad inst%s %s:%dusername%s/start%s/plans/v2/vpcs/v2/vpc2quic keytemplate%.10q...{{else}}%s:%d:%dtextarearequired\\([^$])Duration2006-1-2!!binarylayer3+4layer2+3encap2+3encap3+4datagramredirectmode(%d)LearningProxyArpuniversetable %dxmit: %sdnroutededitionsrepeatedOptionalRequiredRepeatedsfixed32sfixed64BoolKindEnumKindKind(%d)extendeefeaturesreserved15:04:05draft-29gQUIC %d[%d, %d]photurisfunctionno-storetext/cssbytes=0-prefetchMessagesInstFailInstRune[:word:]opPseudobracketsnumberedunixnanocert_req1609Dot2%s %s %sKeyValueDateTimemetricomieee1394proto: %d to %d_UNKNOWNprotobufXXX_weakNum(%#q)dst mathquic-go1recvmmsgsendmmsgld M[%d]ldb [%d]ldh [%d]ld #typeld #poffld #nlanld #markld #randst M[%d]%s %s,%dKyber512Kyber768SigEd448IsPublicFullNameJSONNameIsPackedMapValueExtendeeServicesIsClosedzigzag32zigzag6400000000Ping modespeedtestobfs.typepinSHA256hysteria2ParseBoolinterfaceping modeconnectedlog-levellog levelacme.typeauth.typeTCP errorsessionIDUDP errordata-sizeuse-bytesuploadingd.nx != 0Proc-Type method: (MISSING)%!(EXTRA 01234567_broadcastmulticastfiles,dnsdns,filesipv6-icmplocalhostip6.arpa.attempts:no-reloadraw-writemissing ] parsing fork/execcontinuedRemoveAlltimerSendpollCacheprofBlockstackpoolhchanLeafwbufSpansGC (idle)mSpanDeadinittracescavtracepanicwaitchan sendpreemptedcoroutinesignal 32signal 33signal 34signal 35signal 36signal 37signal 38signal 39signal 40signal 41signal 42signal 43signal 44signal 45signal 46signal 47signal 48signal 49signal 50signal 51signal 52signal 53signal 54signal 55signal 56signal 57signal 58signal 59signal 60signal 61signal 62signal 63signal 64signal 65signal 66signal 67signal 68signal 69signal 70signal 71signal 72signal 73signal 74signal 75signal 76signal 77signal 78signal 79signal 80signal 81signal 82signal 83signal 84signal 85signal 86signal 87signal 88signal 89signal 90signal 91signal 92signal 93signal 94signal 95signal 96signal 97signal 98signal 99copystack ms cpu, (forced) wbuf1.n= wbuf2.n= s.limit= s.state= B work ( B exp.) marked unmarked in use) , size = , tail = newosprocrecover: not in [ctxt != 0, oldval=, newval= threads=: status= blocked= lockedg=atomicor8 runtime= sigcode= m->curg=(unknown)traceback} stack=[ gp.goid= lockedm=244140625ParseUintinterruptbus errorWednesdaySeptember-07:00:00Z07:00:00localtimetwo_word_help for tun-stack%s %q: %sempty urlgeoip.datundefinedLevel(%d)LEVEL(%d)tlsrsakex%s %x %x Handshake of type omitemptyimage/bmpimage/gifimage/pngvideo/avifont/woff; Domain=[%v = %d]data_flowauthoritywebsocketnet/http.HTTP/1.1 HTTP/1.0 value for arg %d: %w2006-01-02add route resolvectl/data/userRootDomainlocal addrbase_noncemultipart- --%s-- Content-IdMessage-Idimage/avifHTTP_PROXYhttp_proxyFeatureID(PRIVATEDNSPRIVATEOIDProhibitedNSEC3PARAMOPENPGPKEYdns: privatekey, status: at line: hmac-sha1._%s._%s.%sgrant_typeoauth2: %q%s/%s/ipv4%s/%s/ipv6%s/%s/halt%s/%s/vpcs%s/%s/vpc2/v2/blocksread_write%s/%s/forknetwork_id/v2/iso/%scluster_id%s/convertName errorquicv2 keydefinitionunusedKeysObjectListObjectType%s%s = %s stream endbalance-rrGOING_DOWNGOING_BACKNewDst: %sWeight: %dSYS_WRITEVSyntax(%d)Sint32KindUint32KindSint64KindUint64KindDoubleKindStringKinddependencyoneof_declgo_packagedeprecatedinput_typeMinRTT: %secho reply!PANIC: %v(no stack)early-datasameorigin[:^alnum:][:^alpha:][:^ascii:][:^blank:][:^cntrl:][:^digit:][:^graph:][:^lower:][:^print:][:^punct:][:^space:][:^upper:][:xdigit:]rune token_typeexpires_inocsp_multipsk_dhe_keauthz_dataArrayTable_reserved1infinibandieee802.11%v See %v UnknownX%XUNKNOWN_%dweakFieldsAlpha(%#q)ld #hatypeld #rxhashjneq %s,%djset %s,%dEnumRangesHasDefaultExtensionsIsMapEntrywrong sizeClient modeServer modeclient mode  HTTP closedconfig fileletsencryptserver modeTCP requestUDP requestskip-uploaddownloadinginvalid oidCERTIFICATE%!(BADPREC)bad verb '%0123456789_submissionsnil contextsetnonblocki/o timeoutraw-control/dev/stdout/dev/stderrunreachableassistQueuenetpollInitreflectOffsglobalAllocmSpanManualstart traceclobberfreegccheckmarkscheddetailunspecifiedcgocall nil s.nelems= of size ) returned runtime: p ms clock, nBSSRoots=runtime: P exp.) for minTrigger=GOMEMLIMIT=bad m value, elemsize= freeindex= span.list=not reached, npages = , a123456=[ p->status= in status idleprocs= gcwaiting= schedtick= timerslen= mallocing=bad timedivfloat64nan1float64nan2float64nan3float32nan1float32nan2float32nan3GOTRACEBACK) at entry+ (targetpc= , plugin: runtime: g : frame.sp=created by 30517578125bad addressfile existsbroken pipebad messagealarm clocktime: file _filedir -dstringArraystringSlicegeosite.datmust be set[%dm%sRFC3339Nanorfc3339nano.WithCancel.WithValue(tls10servertls: alert(local errorc e traffictraffic updApplicationPRIVATE KEYMarshalJSONMarshalTexthttp-serverhttp2serverhttp2clientENABLE_PUSHEND_HEADERSpartitionedCookie.Path; Max-Age=0/index.html ErrCode=%v, settings:retry-afterstream_idleack_mysterybad_connectmoreGeneralTTL expiredEarly HintsBad RequestBad Gatewayacme_clienttls-alpn-01identifiersretrying_incert_failedstorage_keyserver_namedistributednum_choicesocsp_statusthis_updatenext_updateremote_portmaintenancecertificate%s/zones?%sduckdns.orgdeactivatedHTTP %d: %sstatus_codeRetry-After,"nonce":%qsubproblemsLast-ActiveSHA-512/224SHA-512/256BLAKE2s-256BLAKE2b-256BLAKE2b-384BLAKE2b-512generalizedapplicationshort writebad argSizemethodargs(reflect.SetDives_AkuruMedefaidrinNag_MundariNandinagariNew_Tai_LueOld_PersianOld_SogdianPau_Cin_HauSignWritingWarang_CitiClassHESIODauthoritiesadditionalsgocachehashgocachetestarchive/tarcrypto/x509archive/zipbytesBase64 -%s, --%s%d.%d.%d.%dstringToIntcall of nil02 Jan 2006parse errorfinal tokenread packetunset rule left child:remote-addrH3_NO_ERRORH3_ID_ERRORpsk_id_hashIn-Reply-ToReturn-PathHTTPS_PROXYhttps_proxymissing CSRid mismatchcoefficientExponent1: Exponent2: flags: do; ; SUBNET: ; COOKIE: ; EXPIRE: ;; opcode: AUTHORITY: device_code/v2/account/v2/backups%s/%s/start%s/%s/usage%s/%s/users/v2/domainsdescription/v2/regionsinstance_id%s/%s/nodes bytes ... invalid KEMexpected :=empty field{{template array tablemapping endyYnNtTfFoO~!!timestampbalance-xorbalance-tlbbalance-albnot-presentIfindex: %dFixed32KindFixed64KindMessageKindnested_typeoneof_indexallow_aliasoutput_typejson_formatdeclarationInstCaptureInstRuneAny[:^xdigit:] wbuf2= gcscandone runtime: gp= found at *( s.elemsize= B (∆goal , cons/mark maxTrigger= pages/byte s.sweepgen= allocCount timer_deletens} value: {}, want {r1= [recovered]bad recoveryGOTRACEBACK=bad g statusentersyscallwirep: p->m=) p->status=releasep: m= sysmonwait= preemptoff=cas64 failed m->gsignal=-byte limit runtime: sp=abi mismatchout of rangewrong timers152587890625762939453125illegal seekinvalid slothost is downchild exitedI/O possible_ACTIVE_HELPthis commandversion for Subcommand 'reading filecapitalColorcontext.TODOtlsunsafeekmclose notifyremote errorc hs traffics hs trafficc ap traffics ap traffic PRIVATE KEYhttpmuxgo121image/x-iconPUSH_PROMISECONTINUATIONCookie.Valuecontent-typemax-forwardshttp2debug=1http2debug=2push_promisedata_on_idleheaders_evendup_trailers100-continuerecv_goaway_moreSpecificstatus code Multi-StatusNot ModifiedUnauthorizedI'm a teapotNot Extendedproxyconnectregistrationmax_durationFileStorage:client_hellocert_managercertificates.compromisedstorage_path/v1/domains/Replay-Noncehttp requestunauthorizeddial error: invalid baseSERIALNUMBERshort buffer has no name has no typereflect.CopyCypro_MinoanMeetei_MayekPahawh_HmongSora_SompengSyloti_NagriRCodeSuccessRCodeRefusednot pollableinvalid pathgotypesaliasrandautoseedfloat32Slicefloat64Sliceinvalid kindmapstructureLittleEndianwrite packet/dev/net/tununset rule6 Hysteria-UDPempty packetGSO disabledright child:http3-serveridle timeout/dev/urandomMime-VersionX-ImforwardsX-Powered-ByMax-Forwards (sensitive)max_attemptsauthz_statusbad key sizeStale AnswerDNSSEC BogusNSEC MissingCached ErrorInvalid DataPrivateKey: ; PADDING: bad rdlength MsgHdrADDITIONAL: bad SVCB keyhmac-sha224.hmac-sha256.hmac-sha384.hmac-sha512.unmarshal %sredirect_uri%s/%s/reboot/v2/registry%s/plan/list%s/%s/dbs/%s%s/%s/alerts%s/%s/dnssecinstance_ids%s/%s/config%s/%s/attach%s/%s/detach/v2/ssh-keysFormat error{{continue}}block clausecaller errorstream startdocument endsequence endtail commentnot a number' in struct family errorBondMode(%d)LacpRate(%d)ProxyArpWiFizero IPRangeSfixed32KindSfixed64Kindmessage_typejava_packageoptimize_forswift_prefixruby_packagedebug_redactdouble_valuestring_valueverificationis_extensionPhase: DRAINToken: %#x, Doing 0-RTT.EventNoEventbad kind: %sunknown nameInstAltMatchunexpected )altmatch -> anynotnl -> access_tokenuncompressedParseLiteralunknown type = struct { ieee802.15.4FieldOptionsOneofOptionsprotobuf_keyprotobuf_valldb [x + %d]ldh [x + %d]ld #vlan_tciillegal charFieldNumbersnot extendedShow version.bindInterfacequic.sockoptsobfs-passwordSOCKS5 servername is emptyTUN listeningTUN TCP errorTUN UDP erroracme.dns.nameempty domainsresolver.typeauth.passwordauth.userpassauth.http.urlskip-downloadSHA256-RSAPSSSHA384-RSAPSSSHA512-RSAPSStrailing dataSSL_CERT_FILEemail addresslame referral/etc/servicesinvalid port stop signal: wakeableSleepprofMemActiveprofMemFuturetraceStackTabexecRInternaltestRInternalGC sweep waitSIGQUIT: quitSIGKILL: killout of memory is nil, not value method bad map state span.base()=bad flushGen , not pointer != sweepgen MB globals, work.nproc= work.nwait= nStackRoots= flushedWork double unlock s.spanclass= MB) workers=min too large-byte block (runtime: val=runtime: seq= failed with timer_settimefatal error: idlethreads= syscalltick=load64 failedxadd64 failedxchg64 failedmp.g0 stack [nil stackbase} sched={pc:, gp->status= pluginpath= : unknown pc called from runtime: pid=3814697265625invalid base level 3 resetexchange fulltimer expiredsrmount errorpower failure/etc/zoneinfoparsing time out of range in duration is too large_activeHelp_ __start_%s() missing Levelbind-protocol in host namesni guard: %wnot supportedtlsmaxrsasizeaccess denieduser canceledPKCS1WithSHA1ECDSAWithSHA1key expansionmaster secretCLIENT_RANDOMSTREAM_CLOSEDCONNECT_ERRORWINDOW_UPDATEAuthorization; PartitionedCache-ControlLast-ModifiedContent-RangeAccept-RangesIf-None-Match403 Forbiddeninvalid range[FrameHeader accept-rangesauthorizationcache-controlcontent-rangeif-none-matchlast-modifiedunknown timersend_too_muchempty patternFQDN too longsocks connectReset ContentLoop Detectedfield name %q%v %w (ca=%s)removing_hashstapling OCSP172.16.0.0/12lock acquiredcert_obtainedXDG_DATA_HOMEcipher_suitesAppendRecordsDeleteRecordsAuthenticatorresolve error/dump/streamsunimplementedempty integerunsupported: invalid ASN.1dalTLDpSugct? relative to Gunjala_GondiMasaram_GondiMende_KikakuiOld_Hungarianname too longgocacheverifyinstallgoroothtml/templateUsage of %s: durationSlice (default %q) (default %s)stringToInt64encoding/json (default %v)cleanup rulesdefault-routeTUNSETOFFLOADbad socksaddrHysteria-Authtree is empty right child:no children |shared_secretimage/svg+xmlgzip, deflatecpu features:bad algorithmbad signatureForged AnswerNot SupportedNetwork Errorin-addr.arpa.Coefficient: MBZ: 0x%04x, unknown classaccess_deniedexpired_tokenresponse_typerefresh_tokenbaremetal_ids/v2/blocks/%s/v2/databases%s/%s/backups%s/%s/restore%s/%s/records/v2/firewallsgovultr/3.6.4/v2/instances%s/%s/ipv4/%s/v2/snapshotsunexpected %sdefine clauseempty commanddecodedFields%\(([^)]+)\)scannot set %spremature EOFmissing tablemissing fieldmapping startinput error: write error: active-backuplack of bytesEnd.B6.Encapsunknown valuereserved_namedefault_valuephp_namespaceINVALID_TOKENpto (Initial)remove failedtime exceeded1; mode=blockinvalid UTF-8client_secret[DEBUG] %s %sKyber768-X448ParseListTypeLocalDateTimegetTypeInfo: MethodOptionsXXX_sizecacheunknownFields for message short messageshort addressld #vlan_tpidjset %s,%d,%dIsPlaceholderReservedNamesunsupported dk must be oddquic.sockopts.transport.typebandwidth.downTCP forwardingUDP forwardingfailed to run TUN TCP closedTUN UDP closed/etc/hysteria/unsupported CAsniff.tcpPortssniff.udpPortsoutbounds.nameoutbounds.type/etc/ssl/certsinternal error.in-addr.arpa.single-request/proc/net/igmp/etc/protocolsunknown mode: prefix length not an ip:portinvalid Prefix (core dumped)/proc/self/exeuserArenaStateGC (dedicated)read mem statsasynctimerchangcstoptheworldprofstackdepthtraceallocfreeGC assist waitfinalizer waitsync.Cond.WaitSIGABRT: aborts.allocCount= key size wrongruntime: mmap(nil elem type! to finalizer GC worker initruntime: full=runtime: want=MB; allocated bad restart PC, called from -thread limit stopm spinning nmidlelocked= needspinning=randinit twicestore64 failedmemprofileratesemaRoot queuebad allocCountbad span statestack overflow untyped args out of range no module data in goroutine runtime: seq1=runtime: goid=invalid syntax1907348632812595367431640625no such deviceis a directorytext file busyfile too largetoo many linkslevel 3 haltedlevel 2 haltedprotocol errortoo many userswindow changedtime.Location(: extra text: /etc/localtimetrimRightSpacehelp [command]stringToStringBasic realm=%qinvalid format.WithoutCancel.WithDeadline(bad record MACContent-LengthMAX_FRAME_SIZEPROTOCOL_ERRORINTERNAL_ERRORREFUSED_STREAM; SameSite=Laxbytes %d-%d/%dERR_UNKNOWN_%daccept-charsetcontent-lengthfirst_settingsping_on_streamtrailers_bogusread_frame_eof{$} not at endempty wildcardinvalid methodparsing %q: %wunknown error unknown code: Not Acceptable %s at: %s inserting_hashcache_capacitynew_expiration192.168.0.0/16acquiring lockcert_obtainingreleasing lock[%s] Renew: %wstatus unknownacmez (%s; %s)UDPIdleTimeoutdata truncatedzero parameterunexpected EOFunsafe.Pointer on zero Valuereflect.Value.unknown methodRCodeNameErrorResourceHeaderunreachable: mime/multipartlen of type %senable offloadinvalid offsetHysteria-CC-RX0-RTT rejectedH3_FRAME_ERRORH3 error (%#x)quic-go HTTP/3Accept-CharsetDkim-Signatureneed more dataREQUEST_METHODchallenge_typeACME challengeEC PRIVATE KEYDSA-NSEC3-SHA1DNSKEY MissingRRSIGs Missingpublicexponent ; KEEPALIVE: ; LOCAL OPT: , timeout %dms20060102150405\.+*?()|[]{}^$/v2/backups/%s%s/%s/upgrades/v2/registriesexpiry_seconds%s/region/list%s/%s/users/%s/v2/iso-public ... omitting Server failureinvalid packetunknown node: missing quotesObjectItem: %s%04d-%02d-%02d%02d:%02d:%02ddocument startsequence startLink not foundsegs %d [ %s ]reserved_rangefield_presencePhase: STARTUPNO_VIABLE_PATHpacing limitedmax-age=604800InstEmptyWidthinvalid headerrequest failedtypes mismatchKyber1024-X448Raw Public Keyexplicit_primeexplicit_char2expected 'inf'expected 'nan'protobuf errorMessageOptionsServiceOptionsinvalid kind: protobuf_oneofXXX_OneofFuncsXXX_extensionsinvalid optionld #vlan_availhttptest.serveillegal char: ReservedRangesSpeed test modeTUN TCP requestTUN UDP request$HOME/.hysteriaacme.dns.configgandi_api_tokennamedotcom_uservultr_api_tokenempty auth typeempty proxy urlmasquerade.typefailed to servehttps://%s:%d%sspeed test modeupload completex509usepoliciesmissing address/proc/net/igmp6unknown networknegative offsetcopy_file_rangeallocmRInternalGC (fractional)write heap dumpasyncpreemptoffforce gc (idle)sync.Mutex.Lockruntime.Goschedmalloc deadlockruntime error: elem size wrong with GC prog scan missed a gmisaligned maskruntime: min = runtime: inUse=runtime: max = requested skip=bad panic stackrecovery failedmorestack on g0stopm holding pstartm: m has ppreempt SPWRITEmissing mcache?ms: gomaxprocs=randinit missed] morebuf={pc:: no frame (sp=runtime: frame ts set in timertraceback stuckruntime.gopanic476837158203125no such processnot a directoryadvertise errornetwork is downno medium foundkey has expiredbad system call: cannot parse ,M3.2.0,M11.1.0flags+=("-%s") no-descriptionskey is an aliasUDP not enabledx509keypairleafrecord overflowbad certificatePKCS1WithSHA256PKCS1WithSHA384PKCS1WithSHA512ClientAuthType(client finishedserver finishedunknown versionHalfClosedLocalapplication/pdfapplication/oggfont/collectionapplication/zip; SameSite=Nonenegative updateaccept-encodingaccept-languagex-forwarded-fortrailers_pseudobad_path_methodAccept-Encodingrecv_rststream_multipart/mixedIdempotency-KeyPartial ContentRequest TimeoutLength RequiredNot ImplementedGateway Timeoutunexpected typebad trailer keywrite error: %wX-Forwarded-For[%s] Obtain: %wcert_cache_fillempty authz urlHTTP %d %s - %sidentifier_typeresolve error: Hooked-Req-Addrconnect error: is unavailableinvalid boolean0601021504Z0700non-minimal tagunknown Go typeBelowExactAboveinvalid integerinvalid argSizeHanifi_RohingyaPsalter_Pahlavireflectlite.Setinvalid pointerjstmpllitinterptarinsecurepathzipinsecurepath not a functionJan _2 15:04:05invalid paddingInvalid Versionsocket open: %ssocket bind: %snet-tcp-dial-%snet-udp-dial-%snothing to packIgnoring Retry.ECN unsupported#multipartfilesAccept-Language/etc/mime.types()<>@,;:\"/[]?=bad private keyECDSAP256SHA256ECDSAP384SHA384no-default-alpnprivateexponentunknown RR type/v2/bare-metals%s/%s/bandwidth%s/%s/user-data%s/%s/reinstall%s/%s/migration%s/%s/neighbors/v2/marketplace/v2/plans-metal/v2/ssh-keys/%sNot implementedunclosed actionno dot in fieldtemplate clause^([\t\f ]+)(.*)impossible dateAddRange(%v-%v)invalid IPRangeinvalid kind %vCardinality(%d)weak_dependencyextension_rangeproto3_optionalunverified_lazyfeature_supportutf8_validationaggregate_valueedition_removedPhase: PROBE_BW0-RTT Protectedpto (Handshake)timestamp replyGroup: bad kindmax-age=2592000x-frame-options/proc/self/auxv%s (status: %d)wrong seed sizeKyber512-X25519Kyber768-X25519upn_domain_hintEOF token foundParseObjectListParseObjectItemParseObjectTypeexpected 'true'google.protobufextensionFieldsfractional bytedata/check mathinvalid addressContainingOneofRequiredNumbersExtensionRangesunsupported eta0123456789abcdefSOCKS5 TCP errorSOCKS5 UDP errornamedotcom_tokenunsupported modeoutbounds.directclient connectedSkip upload testupdate availableexpected integerexpected newlinehostLookupOrder=/etc/resolv.confnon-IPv4 addressnon-IPv6 addressunknown network no colon on lineinvalid ip:port invalid AddrPortinteger overflowgcshrinkstackofftracefpunwindoffGC scavenge waitGC worker (idle)page trace flushSIGNONE: no trap out of bounds [/gc/gogc:percent, not a functiongc: unswept span KiB work (bg), mheap.sweepgen=runtime: nelems=workbuf is emptymSpanList.removemSpanList.insertbad special kindbad summary dataruntime: addr = runtime: base = runtime: head = already; errno= runtime stack: invalid g statusGOTRACEBACK=nonecastogscanstatusbad g transitionschedule: in cgoreflect mismatch untyped locals missing stackmapbad symbol tablenon-Go function not in ranges: sigaction failed23841857910156250123456789ABCDEFinvalid argumentinvalid exchangeobject is remotemessage too longremote I/O errorno route to hoststopped (signal)time: bad [0-9]*__completeNoDesc commands=() open sink %q: %wProxy-Connectionunsupported unitcontext canceledno renegotiationSignatureScheme(after object keyHalfClosedRemoteapplication/wasmSETTINGS_TIMEOUTFRAME_SIZE_ERROR*http2.TransportWww-Authenticatehttp: nil Cookie Content-Encodingcontent-encodingcontent-languagecontent-locationwww-authenticatenil *http.Serverinvalid settingssetting_win_sizestream_went_downover_max_streamsproxy-connectionread_frame_otherat offset %d: %w%s %s HTTP/1.1 User-Agent: %s unexpected type unknown locationhost unreachableAlready ReportedMultiple ChoicesPayment RequiredUpgrade RequiredContent-Length: X-Forwarded-Hostacme.zerossl.comunable to unlock_acme-challenge.challenge_tokensapplication/json/records?offset=Duplicate Recordauthorization %sresponse_headers, problem %q: %sHost unreachableprotocol error: length too largelen(x) != len(z)invalid rune %#Udivision by zeroIV for ECDSA CTRRel: can't make reflect.MakeFunc: value of type Imperial_AramaicMeroitic_CursiveZanabazar_Squareinvalid dns nameRCodeFormatErrorunpacking headerGODEBUG: value "no such flag -%vtemplate: %s: %sunknown node: %s%s overflows intbinary.BigEndianHysteria-Padding-> Sending RetryH3_MESSAGE_ERRORH3_CONNECT_ERRORhandling requestquoted-printable()<>@,;:\"/[]?= short response: Content-Languageinvalid encodingchallenge failedPublicExponent: dns: bad netmaskdns: bad addressunbalanced braceregexp: Compile(/v2/applications%s/%s/records/%s/v2/firewalls/%s%s/%s/iso/attach%s/%s/iso/detach%s/%s/node-pools/v2/reserved-ips/v2/snapshots/%sexec: no command[bisect-match 0xunclosed commentunexpected tokenextra charactersunknown event %dduplicated key 'lower-layer-downVlanProtocol(%d)BondAdSelect(%d)AddPrefix(%v/%v)source_code_infocc_enable_arenascsharp_namespacephp_class_prefixclient_streamingserver_streamingedition_defaultsmessage_encodingidentifier_valueleading_commentsunknown type: %TPhase: PROBE_RTTFINAL_SIZE_ERRORKEY_UPDATE_ERRORCRYPTO_ERROR %#xToken: (empty), unexpected writebad time type %Tno dynamic tablemax-age=31536000x-xss-protectionInstRuneAnyNotNL^\x00-\x{10FFFF}retrying requestEd448-Dilithium3ChaCha20Poly1305derive key errorParseObjectValueexpected 'false'ieee802.11/prismgoogle/protobuf/EnumValueOptionsXXX_unrecognizedmust be positiveldx 4*([%d]&0xf)-httptest.serve= for polynomial shouldn't happeninvalid decodingCheck for updatesHTTP proxy serverno mode specifiedroute.ipv4Excluderoute.ipv6ExcludeSOCKS5 TCP closedSOCKS5 UDP closedfailed to connectHYSTERIA_ACME_DIRduckdns_api_tokengodaddy_api_tokennamedotcom_serverresolver.tcp.addrresolver.udp.addrresolver.tls.addrdownload complete/etc/ssl/cert.peminvalid BMPStringinvalid IA5String0123456789ABCDEFX0123456789abcdefxreflect.Value.Intillegal hex digitcan't scan type: pidfd_send_signalgoroutine profileAllThreadsSyscallGC assist markingselect (no cases)sync.RWMutex.Lockwait for GC cycletrace proc statusSIGINT: interruptSIGBUS: bus errorSIGCONT: continuesync.(*Cond).Wait: missing method notetsleepg on g0bad TinySizeClasskey align too bigruntime: pointer g already scannedmark - bad statusscanobject n == 0swept cached spanmarkBits overflowruntime: summary[runtime: level = , p.searchAddr = futexwakeup addr=, 0, {interval: {ns}}, nil) errno=results: got {r1=runtime/internal/thread exhaustionlocked m0 woke upentersyscallblock spinningthreads=gp.waiting != nilunknown caller pcstack: frame={sp:runtime: nameOff runtime: typeOff runtime: textOff 1192092895507812559604644775390625invalid bit size exec format errorpermission deniedno data availableunknown error 141unknown error 142stale file handlewrong medium typecorrupt zip file fractional secondCOBRA_ACTIVE_HELP flags+=("--%s%s [command-line]Transfer-Encodingrename failed: %wdecryption failedhandshake failureillegal parametermissing extensionunrecognized namein string literalseeker can't seekinvalid stream IDHEADER_TABLE_SIZECOMPRESSION_ERRORENHANCE_YOUR_CALMHTTP_1_1_REQUIRED; SameSite=StrictIf-Modified-Sinceframe_ping_lengthtruncated headersif-modified-sincetransfer-encodingx-forwarded-protobogus greeting %qreset_idle_streaminvalid method %qmissing form bodyX-Idempotency-Keyhttp: nil handlerMoved PermanentlyFailed DependencyToo Many RequestsX-Forwarded-Prototext/event-stream Email address: removing_subjectsload_if_necessarycert_ocsp_revoked^https://.+\.com$session is closedconnection closedinteger too large060102150405Z0700%%!%c(big.Int=%s)unknown type kind has invalid namereflect: call of reflect.Value.Capreflect.Value.Lenreflect: New(nil)Old_North_ArabianOld_South_Arabian from a write of multipartmaxpartswinreadlinkvolume (DEPRECATED: %s)too many segmentsbatch read packetinvalid IP lengthdeadline exceededH3_INTERNAL_ERRORH3_EXCESSIVE_LOADH3_SETTINGS_ERRORH3_DATAGRAM_ERRORmessage too largesolving challengebad key algorithmSignature ExpiredNot AuthoritativePrivateExponent: ; UPDATE LEASE: , timeout omitted%s/%s/vpcs/attach%s/%s/vpc2/detach%s/%s/vpc2/attach%s/%s/maintenance%s/%s/vpcs/detach os/exec.Command(exec: killing Cmdexec: not startednot a QUIC packetbad character %#U%s at position %dLink %s not foundxmit headroom: %dmarshaling %s: %vpublic_dependencyobjc_class_prefixtrailing_commentsidempotency_levelQUIC_GO_LOG_LEVELAPPLICATION_ERRORUnknown EventKindinvalid conn typeparameter problemgzip, deflate, br^.*\._Ctype_char$missing closing )missing closing ]error_descriptionheartbeat_requestuser_mapping_dataunknown type: %T illegal characternon-hex characterincomplete numberinvalid characternextId too large:Wrong socket typeinvalid range: %vXXX_OneofWrappersqr: too much data--httptest.serve=ContainingMessageIsStreamingClientIsStreamingServerwrong scalar sizeGenerate share URICheck for updates.100.100.100.101/30SOCKS5 TCP requestSOCKS5 UDP requestHTTP CONNECT errorTCP redirect errorHYSTERIA_LOG_LEVELempty http addressoutbounds.http.urlinvalid port unionempty auth commandmasquerade requestSkip download testupload test failedx509negativeserial/etc/pki/tls/certscannot be negativereflect.Value.Uintunexpected newlineserver misbehavinginvalid IP address/etc/nsswitch.confinvalid criteria: unable to parse IPnetip.ParsePrefix(adaptivestackstartdontfreezetheworldtraceadvanceperiodtracebackancestorsgarbage collectionsync.RWMutex.RLockGC worker (active)stopping the worldwait until GC endssystem page size (elem align too big but memory size /gc/pauses:seconds because dotdotdotruntime: npages = invalid skip valueruntime: range = {index out of rangeruntime: gp: gp=runtime: getg: g=forEachP: not done in async preempt instruction bytes:mp.gsignal stack [bad manualFreeListruntime: textAddr frames elided... , locked to threadvalue out of range298023223876953125input/output errorno child processesidentifier removedno locks availableRFS specific errormultihop attemptedfile name too longstreams pipe errorconnection refusedoperation canceledsegmentation fault: day out of rangeTime.MarshalJSON: Time.MarshalText: unknown time zone appendIfNotPresentmay not contain %qProxy-Authenticatefailed to send: %winvalid character context.Backgroundunexpected messageexport restrictionexceeded max depthin numeric literalhttp: blank cookiereceived from peerhttp: no such fileapplication/x-gzipFLOW_CONTROL_ERROR404 page not foundframe_goaway_shortproxy-authenticateUNKNOWN_SETTING_%dconnection is idleunexpected type %Ttrailers_not_endedGo-http-client/2.0Go-http-client/1.1Temporary RedirectPermanent RedirectMethod Not AllowedExpectation Failedbad Content-Lengthfield value for %qresponse write: %vresponse flush: %vinserting_subjectsissuer %d (%s): %vtls-alpn challengeattempt %d: %s: %wmust be at least 8Connection refusednon-minimal lengthtruncated sequencesequence truncatednegative bit indexreflect.Value.Callreflect.Value.Elemreflect.Value.Sendreflect.Value.Typereflect: Zero(nil)Caucasian_AlbanianRCodeServerFailureuse of closed fileunknown flag: --%slen of nil pointerfield is not validflag %q contains =flag redefined: %sbufio: buffer fullsocket connect: %sbatch write packetinvalid pool indexempty GeoSite name<- Received Retry:unsupported KDF idunsupported KEM iddecoding error: %vcleaning up solverchallenge acceptedsignature requiredbad authenticationbad extended rcodeno signature foundno secrets definedRSASHA1-NSEC3-SHA1private-key-formatuse tcp keep-alive ;; ZONE SECTION: overflow packing aauthorization_code%s/%s/repositories%s/%s/read-replica%s/%s/ipv6/reverse%s/%s/ipv4/reverse/v2/load-balancers/v2/object-storage%s/%s/nodes/attach%s/%s/nodes/detach unknown type: %T empty key name: %sempty section nameexpansion too deepunhandled part: %stag:yaml.org,2002:XmitHashPolicy(%d)RemoveRange(%v-%v)positive_int_valuenegative_int_valueedition_introducededition_deprecatedHYSTERIA_BBR_DEBUGCONNECTION_REFUSEDSTREAM_LIMIT_ERRORSTREAM_STATE_ERRORPROTOCOL_VIOLATIONAEAD_LIMIT_REACHED (frame type: %#x)unknown frame typefailed to read RTTinvalid connectionget, post, options^(.+)\[([0-9]+)\]$[^\x00-\x{10FFFF}]performing requestheartbeat_responseUnknown token: %+vunquote %s err: %sneed a \n after \rduplicate name: %qqr: internal errorEd25519-Dilithium2wrong input lengthn must be positivefdControlUnixSocketconnected to serverHTTP CONNECT closedTCP redirect closedHYSTERIA_LOG_FORMATempty outbound nameresolver.https.addrempty auth passwordempty auth userpassempty auth http urlmasquerade.file.dirclient disconnectedshow URI as QR codespeed test completeno update availablex509: malformed OIDx509: trailing datax509: unknown errorreflect.Value.IsNilreflect.Value.Floatbad unicode format parsenetlinkmessagecriterion too short too large for IPv4 too large for IPv6GC mark terminationSIGTRAP: trace trapwait for debug callcgocall unavailablepanicwrap: no ( in panicwrap: no ) in called using nil *unknown wait reasonnotesleep not on g0GC work not flushedunaligned sysUnused/gc/scan/heap:bytes/gc/heap/goal:bytes/gc/heap/live:bytesbad kind in runfinqmarkroot: bad indexnwait > work.nprocs, gp->atomicstatus=marking free object KiB work (eager), [controller reset]mspan.sweep: state=sysMemStat overflowbad sequence numberpanic during mallocpanic holding locksmissing deferreturnunexpected gp.parampanic during panic , g->atomicstatus=unexpected g status_cgo_setenv missingbad runtime·mstartm not found in allmstopm holding lockssemaRoot rotateLeftbad notifyList sizeruntime: preempt g0runtime: pcdata is unsupported version14901161193847656257450580596923828125bad file descriptortoo many open filesdevice not a streamdirectory not emptydisk quota exceededillegal instructionstopped (tty input)/proc/self/uid_map/proc/self/gid_mapbad value for field/usr/lib/locale/TZ/time: unknown unit commands+=(%q) Proxy-Authorizationinvalid URL escape missing ']' in host%v write error: %v revoked certificateexpired certificateunknown certificateunknown cipher typeafter array elementhttp: Server closedINITIAL_WINDOW_SIZEINADEQUATE_SECURITYIf-Unmodified-Sinceframe_data_stream_0 (%d bytes omitted)content-dispositionif-unmodified-sinceproxy-authorizationerr must be non-nilTLS version too lowflow_on_data_lengthheaders_half_closedvalue for header %qhost/path missing /multipart/form-dataContent-Length: 0 non-nil leaf fieldsinvalid header namenetwork unreachableSwitching ProtocolsPrecondition FailedMisdirected RequestService UnavailableConnection: close invalid Trailer key already registeredunknown status codeapi.letsencrypt.orgcached_managed_certtrying issuer %d/%dtls_get_certificateobtain_if_necessaryrequest failed: %worder took too long (%s_identifier=%s)RequestHook enabledinvalid status codeNetwork unreachableconnection closed: unknown hash value sync.Cond is copiedunknown Go type: %vnegative coordinate20060102150405Z0700skip this directory2006-01-02 15:04:05reflect.Value.Bytesreflect.Value.Fieldreflect.Value.Indexreflect.Value.Slicereflect.Value.Clear are not comparableCanadian_AboriginalKhitan_Small_Scriptzero length segmentRCodeNotImplementedmultipartmaxheadersfile already existsfile does not existfile already closedbad flag syntax: %s2006-01-02T15:04:0502 Jan 06 15:04 MSTJan _2 15:04:05.000binary.LittleEndianpacket is too shortempty domain suffixClosing connection.quic: server closedQUIC_GO_DISABLE_GSOQUIC_GO_DISABLE_ECNH3_FRAME_UNEXPECTEDH3_MISSING_SETTINGSH3_REQUEST_REJECTEDH3_VERSION_FALLBACKhttp: panic servingunsupported AEAD idContent-Dispositionmime: no media typeevictCount overflowNo Zone Key Bit Setno private key seenAPL prefix too longAPL length too longextra closing brace%02d %02d %0.3f %s invalid port %s: %vunexpected InstFail/v2/billing/history%s/%s/repository/%s%s/%s/node-pools/%s/v2/startup-scriptsexec: canceling Cmdmodulus must be oddunclosed left parenunknown branch typetemplate: %s:%d: %sunexpected %s in %s%s: unknown type %Tunsupported type %swhile parsing a tagBondArpValidate(%d)BondFailOverMac(%d)RemovePrefix(%v/%v)descriptor mismatchjava_multiple_filescc_generic_servicespy_generic_servicesdeprecation_warninginvalid perspectiveinvalid sample sizetoken too short: %drouter solicitationextended echo replytiming-allow-originP256Kyber768Draft00 "(),/:;<=>?@[]\{}array is incompleteieee802.11/radiotapinvalid nil pointerExtensionRangeArrayfield %v is invalidunknown JumpTest %villegal char escapegoogle.protobuf.AnyHTTP CONNECT requestTCP forwarding errorUDP forwarding errorTCP redirect connectdisable-update-checkdisable update checkcloudflare_api_tokeninvalid IPv4 addressinvalid IPv6 addressempty socks5 addressempty file directorymasquerade.proxy.urlempty string contentdownloading databasedownload test failedupload test completechecking for updatesx509usefallbackrootsgetCert can't be nilinvalid UTF-8 stringx509: malformed spkitype not a pointer: invalid DNS responseunrecognized addressunexpected network: missing IPv6 addressunexpected characternegative Prefix bitsfloating point errorGC sweep terminationResetDebugLog (test)chan send (nil chan)flushing proc cachesSIGALRM: alarm clockSIGTERM: terminationmalloc during signalclose of nil channelnotetsleep not on g0bad system page size to unallocated span/gc/scan/stack:bytes/gc/scan/total:bytes/gc/heap/frees:bytes/gc/gomemlimit:bytesp mcache not flushed markroot jobs done pacer: assist ratio=workbuf is not emptybad use of bucket.mpbad use of bucket.bpruntime: double waitpreempt off reason: forcegc: phase errorgopark: bad g statusgo of nil func valueselectgo: bad wakeupsemaRoot rotateRightreflect.makeFuncStubtrace: out of memorywirep: already in go37252902984619140625invalid request codebad font file formatis a named type fileconnection timed outkey has been revokedurgent I/O conditionstopped (tty output)time: invalid number/usr/share/zoneinfo/ noun_aliases=() last_command=%q DebugFlags called onBASH_COMP_DEBUG_FILEunknown PSK identitycertificate requiredjson: Unmarshal(nil)json: Unmarshal(nil json: error calling pad length too largehttp2: stream closedhttplaxcontentlengthMAX_HEADER_LIST_SIZE%s connection error: %sframe_settings_mod_6No space found in %qsettings_big_or_dupsURL must have a hostconn_close_lost_pingassigned stream ID 0read_frame_too_largeinvalid use of queuebad wildcard name %qhttp: POST too largeHTTP/%d.%d %03d %s invalid header valueunknown address typeRequest URI Too LongUnprocessable EntityInsufficient Storagecertificate is emptyrenewing certificate%s: file info is nilchoosing certificateencoding payload: %vcreating request: %wh3=":%d"; ma=2592000no address availableasn1: syntax error: number has no digitsinvalid integer typeinvalid write resultSeek: invalid whenceSeek: invalid offsetreflect: cannot use returned zero Valuereflect.Value.IsZeroreflect.Value.Methodreflect.Value.SetIntreflect.Value.Slice3Egyptian_HieroglyphsMeroitic_Hieroglyphsif/with can't use %vnil is not a commanderror calling %s: %windex of untyped nilindex of nil pointerslice of untyped nilflag: help requestedno route to interneterror at line %d: %slistener already setSetting DF for IPv4.Setting DF for IPv6.H3_REQUEST_CANCELLEDmissing status field%s=":%d"; ma=2592000unsupported suite IDsha3: Sum after Readform-data; name="%s"gzip: invalid headerheader line too longno identifiers foundno solver configuredbad OCSP signature: DNSSEC Indeterminate ;; ANSWER SECTION: ;; UPDATE SECTION: overflow unpacking aoverflow packing hexoverflow packing opt/v2/billing/invoices/v2/blocks/%s/attach/v2/blocks/%s/detach%s/%s/firewall-rules%s/apps/%s/variables/v2/private-networkshttps://%s/dns-queryKEM is not supportedKDF is not supportedmodulus must be >= 0integer overflow: %qmissing value for %sunclosed section: %sunknown property: %smalformed expressionexpected digit (0-9)invalid map key: %#vunknown scalar styleinvalid parser statewhile parsing a nodewhile scanning a tag/sys/class/net/%s/%sinvalid MPLS RTA_DSTjava_outer_classnameuninterpreted_option[BBRSender] [%s] %s FRAME_ENCODING_ERRORDropping 0-RTT keys.EventDiscard0RTTKeysquic-go token sourcerouter advertisementLogValue panicked %s^.*\._Ctype_uint8_t$expression too largeinvalid repeat count[invalid char class]peer_allowed_to_sendunknown bool value: invalid field numberWARNING: %v See %v invalid map key typeqr: invalid pad sizeunknown JumpTest %#villegal octal number^[[:space:]]*%s\r*\zTCP transparent proxyUDP transparent proxyTCP forwarding closedUDP forwarding closedunsupported SNI guardunsupported ACME typeoutbounds.direct.modeoutbounds.socks5.addrunsupported auth typeserver up and runninginvalid NumericStringx509: invalid versionunsupported operationreflect.Value.Complexsingle-request-reopenparsenetlinkrouteattrIPv4 address too longunexpected slice sizenegative shift amountsystem goroutine waitconcurrent map writes/gc/heap/allocs:bytesruntime: work.nwait= previous allocCount=, levelBits[level] = runtime: searchIdx = defer on system stackpanic on system stackasync stack too large_cgo_unsetenv missingstartm: m is spinningstartlockedm: m has pfindrunnable: wrong ppreempt at unknown pcreleasep: invalid argcheckdead: runnable gruntime: newstack at runtime: newstack sp=runtime: confused by pcHeader.textStart= timer data corruption186264514923095703125931322574615478515625block device requiredread-only file systempackage not installedlink has been severedstate not recoverabletrace/breakpoint trapuser defined signal 1user defined signal 2virtual timer expired/proc/self/setgroupstime zone offset hour_%s_root_command() { Did you mean this? failed to connect: %wfailed to receive: %wkey is not comparabledecompression failureunsupported extensionX25519Kyber768Draft00after top-level valuein string escape codefeature not supportedhttp: nil Request.URLUNKNOWN_FRAME_TYPE_%dframe_ping_has_streamover_max_streams_racetoo_many_early_resetsRoundTrip failure: %vUnhandled Setting: %vnet/http: nil Contexttoo many Host headershttp: invalid patternSunMonTueWedThuFriSatmalformed Host header%03d status code %d unknown address type command not supportedPrecondition RequiredInternal Server Errorhttp: proxy error: %vgetting directory: %wno certificate chainscached_unmanaged_certobtaining certificateunknown PEM header %qqueueing renewal taskadvancing OCSP staplemissing directory URLapplication/jose+jsonBandwidthConfig.MaxTxBandwidthConfig.MaxRxinvalid outbound modeCommand not supportedoutbound %s not foundsequence tag mismatchset bit is not 0 or 1unknown ABI part kind of unexported methodunexpected value stepreflect.Value.SetZeroreflect.Value.Pointerreflect.Value.SetUintAnatolian_HieroglyphsInscriptional_Pahlavibad type in compare: pflag: help requested%s flag redefined: %s02 Jan 06 15:04 -0700record on line %d: %vflag %q begins with -bufio: negative countcause on an nil errorip: unknown version: interface not found: duplicate stream dataConnection %s closed.misrouted packet: %#vtoo many open streamserror handling streamerror writing requestH3_INCOMPLETE_REQUESTduplicate setting: %dmessage limit reachedunknown OCSP status: buffer size too smallStale NXDOMAIN Answeroverflow packing aaaaoverflow packing nsecoverflow packing SVCBauthorization_pending%s/%s/version-upgradehttps://api.vultr.com%s/%s/backup-schedule%s/%s/ipv6/reverse/%s/v2/object-storage/%sexec: already startedAEAD is not supporteddecryption failed: %winvalid scalar lengthbad number syntax: %qundefined variable %qunknown config formatunhandled kv part: %sinvalid emitter stateexpected STREAM-STARTexpected DOCUMENT-ENDcannot marshal type: write handler not setBondArpAllTargets(%d)unknown SEG6 Type: %dno hyphen in range %qjava_generic_servicesHYSTERIA_BRUTAL_DEBUGinvalid varint lengthinvalid ECN value: %dinvalid reserved bitsunknown ECN state: %dinvalid send mode: %dEventWriteInitialDataEventReceivedReadKeysDropping key phase %dextended echo requestinvalid named capturecannot handle type %Tcontext not supportedno object keys found!invalid character %#Uexpected character %cmessage_set_extensionExtensionRangeOptionsmismatching field: %vinvalid QR version %dinvalid option lengthinvalid header lengthfinished without errorTCP redirect listeningTCP forwarding connectUDP forwarding connectinvalid config: %s: %sempty cert or key pathempty resolver addressmasquerade.listenHTTPSdownload test completeperforming upload test/etc/ssl/ca-bundle.pemx509: malformed issuerreflectlite.Value.Type0123456789aAbBcCdDeEfFexpected quoted stringmissing ']' in addressinvalid address familyoperation was canceledIPv4 address too shortmultiple :: in addressbad bits after slash: integer divide by zeroCountPagesInUse (test)ReadMetricsSlow (test)trace reader (blocked)trace goroutine statusSIGTSTP: keyboard stopsend on closed channelgetenv before env initinterface conversion: freeIndex is not validoldoverflow is not nils.freeindex > s.nelemsbad sweepgen in refillspan has no free spaceruntime: out of memory/gc/scan/globals:bytes/gc/heap/frees:objectsruntime: work.nwait = runtime:scanstack: gp=scanstack - bad statusheadTailIndex overflowruntime.main not on m0set_crosscall2 missingbad g->status in readywirep: invalid p stateassembly checks failed received during fork stack not a power of 2minpc or maxpc invalidnon-Go function at pc=4656612873077392578125argument list too longcannot allocate memoryremote address changedprotocol not availableprotocol not supportedaddress already in usenetwork is unreachable/lib/time/zoneinfo.zipHelp about any commandunrecognized level: %qmust be at least 16384unknown field type: %verror decoding messageinappropriate fallbackTLS_AES_128_GCM_SHA256TLS_AES_256_GCM_SHA384ECDSAWithP256AndSHA256ECDSAWithP384AndSHA384ECDSAWithP521AndSHA512 into Go struct field json: unknown field %qhttp2: frame too largewrite on closed bufferbody closed by handlerapplication/postscriptDEBUG_HTTP2_GOROUTINESMAX_CONCURRENT_STREAMSframe_data_pad_too_bigaccess-control-max-ageinvalid Trailer key %qinvalid HTTP header %sunexpected empty hpackmalformed HTTP requestmalformed HTTP versionX-Content-Type-OptionsUnsupported Media Typecreating lock file: %v/v4/domains/%s/records<(.+?)>;\s*rel="(.+?)"encoding inner JWS: %vperforming request: %wmust be at least 65536zero length BIT STRINGInt.Scan: invalid verbinvalid number base %dinternal inconsistencyoverflowing coordinateunexpected method stepreflect.Value.MapIndexreflect.MapIter.SetKeyreflect.Value.SetFloat to array with length Inscriptional_ParthianNyiakeng_Puachue_Hmongreflectlite.Value.Elemskipping Question Nameskipping Question Typeexit hook invoked exitflag %q does not existfailed to parse IP: %qundefined variable: %sindex out of range: %dJan _2 15:04:05.000000wrong number of fieldsipv4: fragment droppedinvalid address lengthinvalid padding lengthinvalid message lengthinvalid conn id lengthwrite on closed streamhttp3: nil Request.URLsha3: Write after Read/usr/share/mime/globs2/etc/apache/mime.typesgzip: invalid checksumhpack: string too longheader field %q = %q%sidna: invalid label %qcreating new order: %wUnknown hash algorithmbad OCSP response typeinvalid responder nameconn has no connectionNo Reachable Authorityunrecognized address: overflow packing uint8 ;; QUESTION SECTION: overflow unpacking txtoverflow unpacking hexoverflow unpacking optnsec bits out of orderextra APL address bitsport cannot be < 0: %d%s/%s/connection-pools%s/%s/advanced-options/v2/firewalls/%s/rules%s/%s/private-networks%s/%s/forwarding-rulesunexpected right parenexpected end; found %sparenthesized pipelineapplication/javascriptunknown slice type: %T0123456789abcdefABCDEFexpected a : separatortoml: cannot write: %wmode %s segs %d [ %s ]java_string_check_utf8php_metadata_namespaceSetMaxDatagramSize: %dCRYPTO_BUFFER_EXCEEDEDpto (Application Data)Dropping Initial keys.EventHandshakeCompletex-content-type-optionsunexpected length codeerror parsing regexp: oneof type already setunknown parent type %TXXX_InternalExtensionsnon-numeric string %#qillegal UTF-8 encodingcomment not terminatedheredoc not terminatedliteral not terminatedinvalid UTF-8 detectedVerify that 1 < w < 32server address is emptylisten address is emptySOCKS5 server listeningremote address is emptyempty DNS provider nameduckdns_override_domaindo not show URI as text/etc/pki/tls/cacert.peminvalid PrintableStringx509: malformed UTCTimex509: invalid key usagex509: malformed versionreflectlite.Value.IsNil0123456789aAbBcCdDeEfF_unexpected address typemissing port in addressindex out of range [%x]ReadMemStatsSlow (test)runtimecontentionstackschan receive (nil chan)garbage collection scanSIGSYS: bad system callSIGIO: i/o now possiblemakechan: bad alignmentclose of closed channelunlock of unlocked lock) must be a power of 2 system huge page size (runtime: s.allocCount= s.allocCount > s.nelems/gc/heap/allocs:objectsmissing type in runfinqruntime: internal errorwork.nwait > work.nprocleft over markroot jobsgcDrain phase incorrectMB during sweep; swept bad profile stack countruntime: eventfd failedruntime: netpoll failedpanic during preemptoffnanotime returning zeroschedule: holding locksinternal/runtime/atomicprocresize: invalid argmisuse of profBuf.writeunexpected signal valuespan has no free stacksstack growth after forkshrinkstack at bad timereflect.methodValueCall23283064365386962890625operation not permittedinterrupted system calldevice or resource busyno space left on deviceoperation not supportedprofiling timer expiredCPU time limit exceededtime zone offset minutetime zone offset secondtime: invalid duration trimTrailingWhitespaces noun_aliases+=(%q) command_aliases=() ShellCompDirectiveErrorUnknown help topic %#q checking if file existsprotocol already in usemissing protocol schemeinvalid URI for requestunsupported certificateno application protocolech accept confirmationCLIENT_TRAFFIC_SECRET_0SERVER_TRAFFIC_SECRET_0tls: invalid PSK binderQUICEncryptionLevel(%v)json: cannot unmarshal into Go value of type unexpected map key typehttp2: handler panickedhttp: request too largenet/http: abort Handlertext/xml; charset=utf-8Error reading directoryunknown error code 0x%xframe_goaway_has_streamframe_headers_pad_shortframe_rststream_bad_leninvalid HTTP trailer %snet/http context value unknown relationship %qmalformed HTTP responsemulti wildcard not lastnon-zero reserved fieldnetwork not implementedcommand not implementedVariant Also Negotiatesaccessing lock file: %vmaking OCSP request: %v%s/zones/%s/dns_recordshttps://api.godaddy.comsigning EAB content: %wprovisioning client: %wHTTP request failed: %dbytes.Buffer: too largeasn1: structure error: truncated tag or lengthreflect.Value.Interfacereflect.Value.NumMethodtoo many pointers (>10)segment length too longunpacking Question.Nameunpacking Question.Typeskipping Question Class", missing CPU support exit hook invoked panictemplate %q not definedcannot assign nil to %sexpected bool; found %serror decoding '%s': %sget file descriptor: %sunsupported domain typeunknown packet type: %stoo short connection IDpeer sent too much dataunknown error code: %#x:protocol must be emptyinvalid status code: %wmultipart: NextPart: %winvalid response code: /etc/apache2/mime.typestext/css; charset=utf-8varint integer overflowfinalizing order %s: %wdone waiting for solverauthorization finalizedSignature Not Yet Validoverflow packing uint16overflow packing uint32 ; LONG LIVED QUERIES: ; DS HASH UNDERSTOOD: dns: bad address family ;; AUTHORITY SECTION: overflow unpacking aaaaoverflowing header sizeoverflow packing uint64overflow packing base32overflow packing base64overflow unpacking SVCBrecord type not SRV: %s/v2/billing/invoices/%s/v2/kubernetes/clusters/v2/kubernetes/versions%s/%s/firewall-rules/%sexec: Stdin already setapplication/dns-messageunsupported version: %xP224 point not on curveP256 point not on curveP384 point not on curveP521 point not on curveinvalid scalar encodingpattern bits too long: 0123456789abcdefABCDEF_function %q not definedmissing required key %sinvalid unicode literalunsupported encoding %vproperties: Line %d: %scircular reference in: unknown character widthwhile scanning an aliasBondPrimaryReselect(%d)Family: %d, Address: %smessage_set_wire_formatrepeated_field_encoding[BrutalSender] [%s] %s unknown packet type: %dinvalid first ACK rangetoken must not be emptyEventWriteHandshakeDataunknown cipher suite %dPeer updated keys to %ddestination unreachablecalled from %s (%s:%d) (rest of stack elided) content-security-policyflate: internal error: invalid escape sequenceunknown empty width argexpected value, not eofbad %s slice length: %dmultiple files named %qmismatching cardinalityunsupported edition: %vinvalid Message.Get on invalid Message.Set on unknown connection typeinvalid scratch slot %dunknown accessor: %v.%s%v has unknown kind: %vobfs.salamander.passwordTCP forwarding listeningUDP forwarding listeningunsupported DNS providerperforming download testHTTP reverse proxy errorx509: malformed validityaddress string too shorttracecheckstackownershiphash of unhashable type cannot open standard fdsspan has no free objectsruntime: found obj at *(/cgo/go-to-c-calls:calls/gc/heap/objects:objects/sched/latencies:secondsqueuefinalizer during GCupdate during transitionruntime: markroot index can't scan our own stackgcDrainN phase incorrectpageAlloc: out of memoryruntime: p.searchAddr = range partially overlapsruntime: epollctl failedstack trace unavailable runtime: mp.lockedInt = runqsteal: runq overflowdouble traceGCSweepStartbad use of trace.seqlock116415321826934814453125582076609134674072265625level 2 not synchronizedlink number out of rangeout of streams resourcesfunction not implementedconnection reset by peerstructure needs cleaningfloating point exceptionfile size limit exceededRawSockaddrAny too small/usr/share/lib/zoneinfo/While parsing config: %smust start with a letterfailed to set fwmark: %wfailed to control fd: %werror decrypting messagecertificate unobtainableTLS_RSA_WITH_RC4_128_SHAtls: server rejected ECHjson: unsupported type: Mon Jan _2 15:04:05 2006text/html; charset=utf-8unexpected buffer len=%vinvalid pseudo-header %qframe_headers_prio_shortinvalid request :path %qread_frame_conn_error_%sstream %d already openedapplication/octet-streamConnContext returned nilRequest Entity Too Largehttp: nil Request.Headercreating ACME client: %vdecoding private key: %vgetting ACME account: %vfinal attempt; giving upcertificate has no namesdeleting private key: %vunsupported key type: %Tunknown private key typeNS %s returned %s for %sapplication/ocsp-requestgot errors: HTTP %d: %+vauthorization failed: %wapplication/problem+jsonpolling order status: %wunknown request type: %dreflect.StructOf: field reflect.MapIter.SetValuereflect.Value.SetComplexreflect.Value.UnsafeAddrresource length too longunpacking Question.Classexpected float; found %s2006-01-02T15:04:05-07002006-01-02 15:04:05Z0700unable to parse date: %sresult must be a pointer%s: unsupported type: %screate vectorised writerbuild IPv4 route addressbuild IPv6 route addressempty GeoIP country codeinvalid CIDR address: %squic: tls.Config not setinvalid QUIC version: %serror parsing packet: %sDATAGRAM frame too largeAdding connection ID %s.unknown encryption levelError parsing packet: %sduplicate control streamH3_STREAM_CREATION_ERRORMalformed Content-Lengthcould not write trailersignoring invalid trailerhttp3: invalid method %qinvalid argument to Intnidna: disallowed rune %Uvalidating authorizationinvalid responder id tag ;; ADDITIONAL SECTION: overflow unpacking uint8%s/%s/docker-credentials%s/%s/available-upgradesexec: Stdout already setexec: Stderr already setinvalid pattern syntax: streamSafe was not reset(\$)(\{?([A-Z0-9_]+)\}?)text/plain;charset=utf-8ErrorHandler should exitduplicate %TAG directiveread handler must be setexceeded max depth of %dwhile scanning an anchorMore than one link foundrange %v to %v not validnot a long header packetnegative bytes_in_flightunknown cypher suite: %dDropping Handshake keys.keys updated too quicklyValue kind is %s, not %spublic, max-age=31536000expected Base to be zerochacha20: wrong key sizeGODEBUG sys/cpu: value "", required CPU feature flate: maxBits too largepeer_not_allowed_to_sendhpke: invalid HPKE suiteexpected: STRING got: %sneed a character after \encodeArray: nil elementinvalid field number: %dmismatching enum lengthsunknown instruction: %#ved448: bad seed length: expected '/' for commentempty DNS provider configoutbounds.direct.bindIPv4outbounds.direct.bindIPv6unsupported outbound typeunsupported resolver typemasquerade.string.contentx509: invalid RDNSequencex509: invalid RSA modulusx509: malformed extensionx509: malformed signature2006-01-02T15:04:05Z07:00no hex data for %x stringno answer from DNS serverinvalid network interfaceno such network interfaceno suitable address foundunexpected '[' in addressunexpected ']' in addressIPv4 field has value >255/proc/sys/kernel/hostnamegoroutine profile cleanupchansend: spurious wakeup when attempting to open runtime·lock: lock countbad system huge page sizearena already initialized to unused region of spanunaligned sysNoHugePageOS/sched/gomaxprocs:threadsremaining pointer buffersruntime: epollwait on fd slice bounds out of range_cgo_thread_start missingallgadd: bad status Gidleruntime: program exceeds startm: p has runnable gsstoplockedm: not runnablereleasep: invalid p statecheckdead: no p for timercheckdead: no m for timerunexpected fault address missing stack in newstackbad status in shrinkstackmissing traceGCSweepStart2910383045673370361328125no such file or directoryno such device or addressinvalid cross-device linkresource deadlock avoidedsocket type not supportedno buffer space availableoperation now in progressunknown command %q for %q aliashash[%q]=%q ' does not support flag 'ShellCompDirectiveNoSpaceShellCompDirectiveDefaultno encoder name specifiednet/url: invalid userinfoQUICConfig.MaxIdleTimeoutcontext deadline exceededtls: protocol is shutdownjson: Unexpected key typereflect.Value.OverflowIntjson: unsupported value: not at beginning of valuehttp: invalid cookie namehttp2: Request.URI is niltext/plain; charset=utf-8http: invalid Cookie.Name500 Internal Server Errorhttp2: Framer %p: read %vframe_data_pad_byte_shortframe_settings_has_streamframe_headers_zero_streamframe_headers_pad_too_bigframe_priority_bad_lengthhttp2: invalid header: %vstrict-transport-securityhttp2: unsupported schemeread_frame_unexpected_eof{...} wildcard not at endhttp: invalid Host headerHTTP/1.1 100 Continue port number out of range invalid username/passwordreading email address: %v()[]{}<> "\!@#$%^&|;'+=no certificates availableobtaining new certificateserved key authenticationcreating OCSP request: %vreading OCSP response: %vparsing OCSP response: %v/v4/domains/%s/records/%srolling key on server: %wreading response body: %wno IPv4 address availableno IPv6 address availableinvalid protocol/port: %sunknown Go type for sliceexplicit tag has no childinvalid object identifierecdsa: invalid public keyreflect: Bits of nil Typereflect.StructOf: field "reflect.Value.SetMapIndexinconsistent poll.fdMutexGODEBUG: can not enable "can't evaluate command %qexpected string; found %scan't print %s of type %s2006-01-02 15:04:05Z07:002006-01-02 15:04:05 -0700Jan _2 15:04:05.000000000%d error(s) decoding: %s'%s' has invalid keys: %s'%s' has unset fields: %smissing interface addressipv4: udp: invalid packetipv6: udp: invalid packetGeoSite name %s not foundunexpected frame type: %sDestroying connection: %sBUG: invalid send mode %ddatagram support disabledconnection already existswrite on closed stream %dH3_GENERAL_PROTOCOL_ERRORH3_CLOSED_CRITICAL_STREAMunknown pseudo header: %scould not flush to streamhttp3: nil Request.Headerblake2b: invalid key sizeincorrect public key typeContent-Transfer-Encodingtrying to solve challengeocsp: error from server: overflow unpacking uint16overflow unpacking uint32overflow unpacking uint64overflow unpacking base32overflow unpacking base64overflow packing anything%s/%s/connection-pools/%s/v2/firewalls/%s/rules/%d%s/%s/forwarding-rules/%sillegal number syntax: %q_html_template_urlescaper(?i)<(script|/script|!--)section %q does not existhour cannot be greater 23unable to parse float: %w2006-1-2 15:4:5.999999999while parsing a flow nodedid not find expected keyinvalid Unicode characterdid not find expected '!'required field %v not setleading_detached_commentsTRANSPORT_PARAMETER_ERRORCONNECTION_ID_LIMIT_ERRORnot a short header packetECN capability confirmed.Skipping packet number %d updated RTT: %s (σ: %s)slog: level string %q: %wupgrade-insecure-requestsunexpected type byte: %#x^.*\._Ctype_unsignedchar$unexpected HTTP status %swrong size for public keywrong size for ciphertextansiX962_compressed_primeansiX962_compressed_char2HPKE_KEM_P256_HKDF_SHA256HPKE_KEM_P384_HKDF_SHA384HPKE_KEM_P521_HKDF_SHA512HPKE_KEM_X448_HKDF_SHA512windows new line expectedcheckId: %d should be %d bootstrap type wrong id: cb27e3aa (May 26th, 2020)google/protobuf/api.protoinvalid Message.Clear on got %v, want *struct kindinvalid oneof descriptor ed448: bad hash algorithmgf256: invalid generator blake2s: invalid key sizeunsupported transport typeunsupported log level: %s x509: malformed parametersx509: malformed extensionsreflect.Value.CanInterfaceinteger overflow on token cannot marshal DNS messagetoo many colons in addressSRV header name is invalidunclosed criterion bracketcriterion lacks equal signAs4 called on IPv6 addressprefix length out of rangeall goroutines stack traceSIGSTOP: stop, unblockableGC background sweeper waitnotewakeup - double wakeuppersistentalloc: size == 0/gc/cycles/total:gc-cyclesnegative idle mark workersuse of invalid sweepLockerruntime: bad span s.state=forEachP: P did not run fnwakep: negative nmspinningstartlockedm: locked to meinittask with no functionscorrupted semaphore ticketout of memory (stackalloc)shrinking stack in libcallruntime: pcHeader: magic= invalid use of gostartcalltraceRegion: out of memory1455191522836685180664062572759576141834259033203125no message of desired typeno CSI structure availableinvalid request descriptorname not unique on networkrequired key not available: day-of-year out of range flags_completion+=(:) must_have_one_flag=() must_have_one_noun=() Unsupported Config Type %qmust specify logging levelmalformed request body: %vmux-listen: %s[%s]: %s: %vsocket closed unexpectedlyinvalid port %q after hostintegrity check failed: %wunexpected status code: %dQUICConfig.KeepAlivePeriodmust be between 2s and 60sbad certificate hash valueECDSA verification failurereflect.Value.OverflowUintencountered a cycle via %shttp: invalid cookie valueread from empty dataBuffernet/http: request canceledstopped after 10 redirectsduplicate pseudo-header %qhttp2: Framer %p: wrote %vframe_windowupdate_bad_lenframe_priority_zero_streaminternal error: bad Writerhttp2: invalid Host headerduplicate wildcard name %qliterals differ: %q and %qmalformed HTTP status codeaddress type not supportedHTTP Version Not SupportedreadLoopPeekFailLocked: %wgenerating private key: %vcertificate already cachedadded certificate to cachedeleting metadata file: %v%s/zones/%s/dns_records/%s%s/zones/%s/dns_records?%sLiveDNS returned a %v (%v)final order is invalid: %wAddress type not supportedbase 128 integer too largetruncated base 128 integerasn1: invalid UTF-8 stringnon sequence tagged as setecdsa: invalid private keyed25519: bad seed length: cryptobyte: internal errorempty buffer in CopyBuffer using unaddressable valueunknown ABI parameter kind using zero Value argumentreflect.Value.MethodByNamesegment prefix is reservedflag needs an argument: %sinvalid value; expected %sexpected integer; found %sexpected complex; found %stoo many slice indexes: %dnon-function %s of type %snon-comparable type %s: %v2006-01-02 15:04:05 -07:00bare " in non-quoted-fieldbinary.Read: invalid type unknown session with port buffer overflow: capacity Removing connection ID %s.receiving datagrams failedinvalid content length: %whttp3: invalid Host headerhandling connection failedinvalid argument to Int63ninvalid argument to Int31nblake2b: invalid hash size/etc/httpd/conf/mime.typesid (%v) <= evictCount (%v)malformed chunked encodingdeactivating authorizationinvalid responder key hashUnsupported DS Digest Type ; NSEC3 HASH UNDERSTOOD: ;; PREREQUISITE SECTION: overflow unpacking NSEC(3) ;; TSIG PSEUDOSECTION: ; %s/%s/promote-read-replica%s/%s/ipv4/reverse/defaultnot supported cipher suiteunterminated quoted stringunexpected . after term %q_html_template_attrescaper_html_template_htmlescapertemplate escaped correctlyinvalid date-time timezoneunknown line break settingfound undefined tag handlewhile parsing a block nodeinvalid character sequencewhile scanning a directiveApplication error %#x (%s), StatelessResetToken: %#x, MaxDatagramFrameSize: %d^([^\[]*)\[([^\]]+)\](.*)$chacha20: wrong nonce sizechacha20: counter overflowcertificate is not trustedwrong size for private keyinline table is incompleteEncodeSEG6Srh: No Segmentsgoogle.golang.org/genprotogoogle/protobuf/type.protoinvalid source register %vinvalid target register %villegal hexadecimal numberzero-length heredoc anchorindexes outside (%v,%v,%v)failed to initialize clientHTTP proxy server listeningTCP transparent proxy errorUDP transparent proxy errorunsupported log format: %s must set either tls or acmeunsupported masquerade typefailed to initialize serverfailed to download databasefailed to check for updatesunsupported string type: %vx509: malformed certificatecurrent time %s is after %scryptobyte: length overflowcryptobyte: invalid OID: %vx509: no SerialNumber givencgo stub: cgo not availableIPv6 field has value >=2^16As4 called on IP zero valueos: unsupported signal typeos: process not initializedPageCachePagesLeaked (test)SIGILL: illegal instructionSIGXCPU: cpu limit exceededmakechan: size out of rangeG waiting list is corruptedruntime·unlock: lock countprogToPointerMask: overflow/gc/cycles/forced:gc-cycles/memory/classes/other:bytes/memory/classes/total:bytesfailed to set sweep barrierwork.nwait was > work.nproc not in stack roots range [allocated pages below zero?address not a stack addressmspan.sweep: bad span stateinvalid profile bucket typeruntime: corrupted polldescruntime: netpollinit failedruntime: asyncPreemptStack=runtime: thread ID overflowstopTheWorld: holding locksgcstopm: not waiting for gcruntime: checkdead: nmidle=runtime: checkdead: find g runlock of unlocked rwmutexsignal received during forksigsend: inconsistent statemakeslice: len out of rangemakeslice: cap out of rangegrowslice: len out of rangestack size not a power of 2timer when must be positive: unexpected return pc for 363797880709171295166015625channel number out of rangefile locking deadlock errorcommunication error on sendnot a XENIX named type filekey was rejected by serviceunknown command %q for %q%s flags_completion+=(%q) Run '%v --help' for usage. ShellCompDirectiveKeepOrderadding path to search pathsno sink found for scheme %qcan't parse %q as a URL: %vfailed to stat key file: %wmust be between 4s and 120sinsufficient security levelCurveP256CurveP384CurveP521tls: short read from Rand: hrr ech accept confirmationreflect.Value.OverflowFloatafter object key:value pairnet/http: use last responsehttpservecontentkeepheadersinvalid dependent stream IDhttp2: response body closednet/http: request completedhttp: invalid Cookie.DomainDATA frame with stream ID 0frame_rststream_zero_streamframe_pushpromise_pad_shortaccess-control-allow-originhttp2: server read frame %vignoring invalid trailer %qinvalid WriteHeader code %vadd DATA on non-open streamnet/http: invalid method %qnet/http: invalid header %sunsupported protocol schemeuser must agree to CA terms%s: caching certificate: %vloading managed certificateloading renewed certificate/.well-known/acme-challengeno OCSP stapling for %v: %vunsupported record type: %sCan't find such a DNS valuebase64-decoding MAC key: %wauthorization took too longmust be between 2s and 600sdevice name cannot be emptyboringcrypto: not availableinvalid ASN.1 from SignASN1crypto/rsa: invalid moduluscipher: incorrect length IVreflect.Value.UnsafePointer is not assignable to type reflectlite.Value.Interfacereflectlite.Value.NumMethodabi.NewName: tag too long: failed to parse IP mask: %qinvalid type for comparisonrange can't iterate over %vmap has no entry for key %qcan't index item of type %scan't slice item of type %sinvalid boolean flag %s: %vflag needs an argument: -%sipv4: udp: fragment droppedSIOCETHTOOL ETHTOOL_GTXCSUMSIOCETHTOOL ETHTOOL_STXCSUMunexpected encryption level<- Received Initial packet.http3: invalid response: %winvalid HTTP header name %qaccepting stream failed: %winvalid argument to Shufflehkdf: entropy limit reachedhttp chunk length too largeauthorization already validoverflow unpacking anythingunrecognized address familyoverflow packing APL prefixdns: empty question section/v2/object-storage/clusters/v2/regions/%s/availabilityNewInitialProtectionKey: %winvalid P224 point encodinginvalid P256 point encodinginvalid P384 point encodinginvalid P521 point encodinginput overflows the modulusNAF digits must fit in int8 in action started at %s:%d{{break}} outside {{range}}too many declarations in %snot a pointer to struct: %sfloat cannot end with a dottag value must not be emptyinvalid leading UTF-8 octetincomplete UTF-16 characterexpected low surrogate areawhile scanning a simple keycould not find expected ':'while increasing flow levelunknown MPLS Encap Type: %dlwt bpf SetProg: invalid fd{Largest: %d, Smallest: %d}invalid packet number spaceInvalid cipher suite id: %dinvalid argument to Uint64nexpression nests too deeplyerror reading response bodyHPKE_KEM_X25519_HKDF_SHA256expected key but found noneunterminated literal string%v %v is already registeredmismatching message lengthsinvalid Message.Mutable on %v: assigning invalid valuenon-alphanumeric string %#qinvalid load byte length %ded448: bad context length: numbers cannot start with 0gf256: invalid polynomial: ed25519: bad hash algorithmunsupported on this platformunsupported obfuscation typefailed to read client configTCP transparent proxy closedUDP transparent proxy closedfailed to load client configcannot set both tls and acmemasquerade.string.statusCodefailed to read server configfailed to load server configx509: invalid RSA public keyx509: invalid DSA public keyx509: invalid DSA parametersx509: negative serial numberx509: unknown elliptic curvecurrent time %s is before %serrors: target cannot be niloverflow on character value cannot unmarshal DNS message/proc/sys/net/core/somaxconnos: process already finishedos: process already releasedSIGHUP: terminal line hangupSIGWINCH: window size changeGC mark assist wait for workcomparing uncomparable type notewakeup - double wakeup (region exceeds uintptr rangeneed padding in bucket (key)/gc/heap/frees-by-size:bytes/gc/heap/tiny/allocs:objects/sched/goroutines:goroutinesgcBgMarkWorker: mode not setmspan.sweep: m is not lockedfound pointer to free objectmheap.freeSpanLocked - span fatal: morestack on gsignal runtime: casgstatus: oldval=gcstopm: negative nmspinningfindrunnable: netpoll with psave on system g not allowednewproc1: newg missing stacknewproc1: new g is not GdeadFixedStack is not power-of-2missing stack in shrinkstack args stack map entries for invalid runtime symbol tableruntime: no module data for [originating from goroutine traceRegion: alloc too large18189894035458564758300781259094947017729282379150390625protocol driver not attachedfile descriptor in bad statedestination address requiredunsupported compression for flag_parsing_disabled=1 ShellCompDirectiveNoFileCompShellCompDirectiveFilterDirssearching for config in path%q is not a valid scheme: %vIgnored key without a value..hysteria-geoloader.dlpart.*https://api.hy2.io/v1/updatecan't unmarshal a nil *Level2006-01-02T15:04:05.000Z0700tls: malformed ECHConfigListEd25519 verification failureTLS_CHACHA20_POLY1305_SHA256TLS_RSA_WITH_AES_128_CBC_SHATLS_RSA_WITH_AES_256_CBC_SHAjson: Unmarshal(non-pointer !#$%&()*+-./:;<=>?@[]^_{|}~ unexpected end of JSON inputhttp2: client conn is closedtext/plain; charset=utf-16betext/plain; charset=utf-16leapplication/x-rar-compressedhttp: invalid Cookie.Expiresinvalid header field name %qhttp2: header list too largeaccess-control-allow-headersaccess-control-allow-methodsforgetting unknown stream idhttp2: Transport received %shttp: request body too largeunsupported protocol versionmissing required Host headerunexpected protocol version general SOCKS server failureTransfer-Encoding: chunked invalid empty Content-Lengthnet/http: invalid trailer %shttp: no Host in request URL%s: renewing certificate: %wprivate key not found for %sconverting '%s' to ASCII: %vmatched certificate in cache/.well-known/acme-challenge/panic: active locking: %v %sencoding old private key: %vSOCKS5 authentication failedmust provide a positive sizebytes: negative Repeat countasn1: string not valid UTF-8big: misuse of expNNWindowednegative n for ProbablyPrimecrypto/rsa: decryption errorpending ASN.1 child too longreflect.MakeSlice: len > capreflect: In of non-func typereflect: Key of non-map typeabi.NewName: name too long: %q is not a defined functionnil pointer evaluating %s.%sinvalid slice index: %d > %dMon Jan _2 15:04:05 MST 2006cannot parse '%s' as int: %s%#x doesn't fit into 62 bitsRemoving 0-RTT queue for %s.Setting up connection failedquic-go/http3 context value multipart: message too largemultipart: boundary is emptymalformed MIME header line: /usr/local/share/mime/globs2invalid byte in chunk lengthinvalid proxy address %q: %vpresenting for challenge: %wUnsupported DNSKEY Algorithmdns: svcbalpn: empty alpn-id%s/%s/node-pools/%s/nodes/%serror parsing public key: %spacket is too short: %d < %d_html_template_rcdataescaper_html_template_urlnormalizerminutes cannot be greater 59seconds cannot be greater 60expected %s event but got %sincompatible %YAML directivetag handle must not be emptytag handle must end with '!'tag prefix must not be emptywhile parsing a flow mappinginvalid trailing UTF-8 octetfound unknown directive nameyaml: unmarshal errors: %slwt bpf SetProg:invalid modefailed to encode RTA_VIA: %vinvalid To IP %q in range %qexceeded max recursion depthcannot encode %d in %d bytesinvalid Connection ID length, ECT0: %d, ECT1: %d, CE: %dhpke: invalid KEM identifierhpke: invalid KEM public keyinvalid P224Element encodinginvalid P256Element encodinginvalid P384Element encodinginvalid P521Element encodingexpected newline but got %#Uinvalid character in commentcan't happen: encode type %sgob: cannot encode nil valueWrong Seq nr %d, expected %dmismatching end group markermissing Go struct field for invalid Message.NewField on failed to parse client config2001::ffff:ffff:ffff:fff1/126TCP transparent proxy connectUDP transparent proxy connectHYSTERIA_DISABLE_UPDATE_CHECKfailed to parse server configfailed to serve traffic statsx509: unsupported time formatx509: cannot parse URI %q: %sx509: malformed serial numberx509: cannot parse dnsName %qsyntax error scanning booleanmismatched local address typeunknown IP protocol specifiedSIGPIPE: write to broken pipeSIGPWR: power failure restartneed padding in bucket (elem)runtime: mmap: access denied /cpu/classes/idle:cpu-seconds/cpu/classes/user:cpu-seconds/gc/heap/allocs-by-size:bytes/gc/stack/starting-size:bytesgc done but gcphase != _GCoffruntime: p.gcMarkWorkerMode= scanobject of a noscan objectruntime: marking free object addspecial on invalid pointerruntime: summary max pages = runtime: levelShift[level] = doRecordGoroutineProfile gp1=runtime: eventfd failed with runtime: sudog with non-nil centersyscall inconsistent bp entersyscall inconsistent sp gfput: bad status (not Gdead)LockOSThread nesting overflowsemacquire not on the G stackruntime: split stack overflowstring concatenation too longinvalid function symbol tabletrace: reading after shutdownruntime: traceback stuck. pc=tried to trace dead goroutineruntime: impossible type kind45474735088646411895751953125too many open files in systemnumerical result out of rangemachine is not on the networkprotocol family not supportedno XENIX semaphores availableoperation already in progressTime.UnmarshalBinary: no data two_word_flags+=("--%s") must_have_one_noun+=(%q) Eq called on unsupported typeCommand %q is deprecated, %s required flag(s) "%s" not setsearching for config in pathsinvalid type %T for bandwidthPSK must be at least %d bytesunknown certificate authorityTLS_RSA_WITH_3DES_EDE_CBC_SHAtls: too many ignored recordstls: invalid NextProtos valuetls: invalid server key sharetls: invalid client key sharetls: invalid session encodinghttp: '=' not found in cookiewrite on uninitialized bufferhttp2: client conn not usableMon, 02 Jan 2006 15:04:05 GMTapplication/vnd.ms-fontobjecthttp: idle connection timeoutMon, 02 Jan 2006 15:04:05 MSTMon, 02-Jan-2006 15:04:05 MSTinternal error: took too muchframe_pushpromise_zero_streamframe_pushpromise_pad_too_bigaccess-control-expose-headersaccess-control-request-methodmethod %q must be GET or HEADhttp2: client connection lostHTTP/1.1 %d %s: %s%s%d %s: %shttp: panic serving %v: %v %sNon-Authoritative InformationProxy Authentication RequiredUnavailable For Legal Reasonsdup idle pconn %p in freelistcould not save account %v: %vreplaced certificate in cachereloading managed certificate%s: obtaining certificate: %w[%s] Renew: saving assets: %vdeleting certificate file: %vrenewing managed certificatesno URL to issuing certificateHTTP request failed; retryingunrecognized order status: %sQUICConfig.MaxIncomingStreamsinteger not minimally-encodedzero length OBJECT IDENTIFIER20060102150405.999999999Z0700pkcs12: odd-length BMP stringcrypto/rsa: invalid exponentscrypto/aes: invalid key size crypto/des: invalid key size io: read/write on closed pipereflect: Key of non-map type reflect: In of non-func type reflect.Value.OverflowComplex cannot be converted to type reflect: Out of non-func typenil data; no entry for key %qcannot 3-index slice a stringunable to cast negative valueinvalid decode hook signaturecannot parse '%s' as uint: %scannot parse '%s' as bool: %s'%s' expected a map, got '%s'bufio.Scanner: token too longpadding contained in alphabetbind forwarder to interface: invalid ip header version: %dtcp header len is invalid: %dinvalid syntax at line %d: %sSwitching to QUIC version %s.GSO failed when sending to %snumOutStandingFrames negativeChanging connection ID to %s.Setting DF for IPv4 and IPv6.missing QUIC Datagram supportinvalid quarter stream id: %winvalid header field name: %qhttp3: no Host in request URLblake2b: XOF length too largecrypto/rc4: invalid key size mlkem768: invalid seed lengthmime: invalid boundary lengthmime: invalid media parametertoo many compression pointersoverflow unpacking APL prefix/v2/billing/invoices/%d/items%s/%s/users/%s/access-control%s/%s/private-networks/attach%s/%s/private-networks/detach/v2/snapshots/create-from-urlexec: Wait was already called%s: map must have string keysmissing closing key quote: %sinvalid timezone offset hoursfloat cannot start with a dotcannot assign boolean to a %talias value must not be emptywhile parsing a block mappingwhile parsing a flow sequenceunexpected low surrogate areacannot decode %s `%s` as a %swhile increasing indent leveldid not find the expected '>'did not find expected tag URIwhile scanning a block scalarwhile parsing a quoted scalarwhile scanning a plain scalarlwt bpf decode: lack of bytesBUG: internal error (unknown)descriptor mismatch: %v != %vjava_generate_equals_and_hashtext too long to encode as QRRetrySourceConnectionID: %s, newly acked packets (%d): %ddidn't drop initial correctlyrest when unpacking token: %dpoly1305: unexpected overflowinvalid character class rangeoauth2: cannot parse json: %vstopped after \d+ redirects\zhpke: invalid KEM private keyarray cannot start with commainvalid escaped character %#Utoml: table %s already existsgob: encoder: message too bigfile %q is already registerednon-contiguous repeated fieldmismatching extension lengthsinvalid type: got %v, want %v%T does not implement Marshalfield %v has invalid type: %vunexpect encryption level: %sblake2s: XOF length too largesyntax error (line %d:%d): %vfailed to parse CA certificatecannot bind both IP and devicex509: invalid ECDSA parametersx509: SAN dNSName is malformedx509: malformed issuerUniqueIDinvalid network interface nametrailing garbage after addresscalled entry on non-entry nodeSIGUSR1: user-defined signal 1SIGUSR2: user-defined signal 2SIGVTALRM: virtual alarm clockSIGPROF: profiling alarm clock runtime: cgocallback with sp= (types from different scopes)failed to get system page sizeassignment to entry in nil mapruntime: found in object at *( in prepareForSweep; sweepgen /cpu/classes/total:cpu-seconds/gc/cycles/automatic:gc-cycles/sched/pauses/total/gc:seconds/sync/mutex/wait/total:seconds/godebug/non-default-behavior/runtime: epollctl failed with panic called with nil argumentcheckdead: inconsistent countsrunqputslow: queue is not fullruntime: bad pointer in frame invalid pointer found on stack locals stack map entries for abi mismatch detected between runtime: impossible type kind unsafe.Slice: len out of range227373675443232059478759765625strings: negative Repeat countinappropriate ioctl for devicesocket operation on non-socketprotocol wrong type for socketmemory page has hardware erroryear outside of range [0,9999] must_have_one_flag+=("--%s has_completion_function=1 command_aliases+=(%q) Config File %q Not Found in %qMultiple errors without a key.failed to create tun stack: %wprotocol version not supportedTLS_ECDHE_RSA_WITH_RC4_128_SHAlooking for beginning of valuein exponent of numeric literalMonday, 02-Jan-06 15:04:05 MSThttp: named cookie not presentnegative content size computedstream error: stream ID %d; %vframe_settings_ack_with_lengthillegal window increment valueHEADERS frame with stream ID 0frame_continuation_zero_streamhttp2: decoded hpack field %+vrunning on the wrong goroutineaccess-control-request-headershttp2: panic serving %v: %v %spersistConn was already in LRUremoved certificate from cache[%s] Obtain: saving assets: %vdeleting test key from storagedeleting site asset folder: %vno certificate resources founddecoding lockfile contents: %wOCSP response needs refreshingattempting certificate renewalgetting issuer certificate: %vreading issuer certificate: %vparsing issuer certificate: %vexpected 1 zone, got %d for %sgot error status: HTTP %d: %+vhttps://www.duckdns.org/update/v4/domains/%s/records?page=%dSOCKS5 request failed: %s (%d)sync: inconsistent mutex statesync: unlock of unlocked mutexasn1: cannot marshal nil valuesquare root of negative numbercrypto/rsa: verification errorreflect: Elem of invalid type reflect: Out of non-func type reflect: unexpected GC programMapIter.Key called before Nextreflect: Len of non-array typeGODEBUG: unknown cpu feature "Mon Jan 02 15:04:05 -0700 2006cannot parse '%s' as float: %sGot NegotiationReply: %#v %#v build local socket address: %sipv4: tcp: session not found: ipv6: tcp: session not found: package to include not found: package to exclude not found: negative packetBuffer refCountpacketBuffer refCount not zerounexpected PATH_RESPONSE frametoo many gaps in received dataquic: ConnContext returned nilError sending Retry packet: %sduplicate QPACK encoder streamduplicate QPACK decoder streamhttp3: reserved frame type: %dsubtle.XORBytes: dst too shortmultipart/form-data; boundary=missing validateFirstLine functext/javascript; charset=utf-8mime: duplicate parameter nameurn:ietf:params:acme:error:dnsurn:ietf:params:acme:error:tlstrailing data in OCSP responseunsupported critical extensiondomain must be fully qualifiedoverflow unpacking APL addressendpoint missing DeviceAuthURLoauth2: cannot auth device: %vunterminated raw quoted string{{continue}} outside {{range}}transform: short source buffer(\\)?(\$)(\{?([A-Z0-9_]+)?\}?)line `%s` doesn't match format%s: unknown type for string %Tfloat cannot be assigned to %sunknown anchor '%s' referencedtag handle must start with '!'anchor value must not be emptyfound duplicate %TAG directivewhile parsing a %TAG directivedid not find URI escaped octetwhile scanning a quoted scalarfound unexpected end of streamfound unknown escape characterinvalid From IP %q in range %qApplication error %#x (%s): %soauth2: cannot fetch token: %v[ERR] %s %s request failed: %vEncapsulate is not implementedKey() is not supported on a %smissing keyKind string mappingunaddressable value of type %stype %s has no exported fieldsattempt to register empty nameoverlapping ranges: %v with %vtype mismatch: got %T, want %vinvalid character %q in stringTCP transparent proxy listeningUDP transparent proxy listeninga certificate cache is requiredx509: malformed GeneralizedTimecrypto/ecdh: invalid public keyx509: invalid basic constraintsx509: malformed tbs certificatex509: malformed subjectUniqueIDinvalid elliptic key public keyx509: certificate is valid for encoding/hex: invalid byte: %#Ufmt: unknown base; can't happeninvalid network interface indexsotypeToNet unknown socket typezone must be a non-empty stringpattern contains path separatorslice bounds out of range [:%x]slice bounds out of range [%x:]SIGSEGV: segmentation violationinternal error - misuse of itab) not in usable address space: runtime: cannot allocate memorycheckmark found unmarked object/memory/classes/heap/free:bytes/memory/classes/os-stacks:bytespacer: sweep done at heap size non in-use span in unswept listcasgstatus: bad incoming valuesresetspinning: not a spinning mruntime: profBuf already closedfatal: bad g in signal handler signal_recv: inconsistent stateruntime: split stack overflow: ...additional frames elided... unsafe.String: len out of range11368683772161602973937988281255684341886080801486968994140625.lib section in a.out corruptedcannot assign requested addressmalformed time zone informationtime: missing unit in duration # ex: ts=4 sw=4 et filetype=sh ShellCompDirectiveFilterFileExtdisable completion descriptionstrying to resolve absolute pathOnly GET and PUT are supported.address family not IPv4 or IPv6failed to bind to interface: %wtls: no certificates configuredbad certificate status responseencrypted client hello requiredtls: unsupported public key: %TTLS_RSA_WITH_AES_128_CBC_SHA256TLS_RSA_WITH_AES_128_GCM_SHA256TLS_RSA_WITH_AES_256_GCM_SHA384failed to parse certificate: %wTLS: sequence number wraparoundCLIENT_HANDSHAKE_TRAFFIC_SECRETSERVER_HANDSHAKE_TRAFFIC_SECRETtls: failed to sign handshake: json: invalid number literal %qin literal true (expecting 'r')in literal true (expecting 'u')in literal true (expecting 'e')in literal null (expecting 'u')in literal null (expecting 'l')expected colon after object keymultipart/byteranges; boundary=http2: connection error: %v: %vframe_headers_prio_weight_shortPRIORITY frame with stream ID 0too many authentication methodsRequested Range Not SatisfiableRequest Header Fields Too LargeNetwork Authentication Requiredtoo many transfer encodings: %qnet/http: TLS handshake timeoutunable to acquire lock '%s': %vissuer %d (%s) is not a Revokerno certificates found in bundleloaded certificate from storageforcefully renewing certificateexpected one record, got %d: %vunexpected status code: HTTP %dJSON-decoding response body: %w{"e":"%s","kty":"RSA","n":"%s"}UDP not supported by HTTP proxybindIP4 must be an IPv4 addressbindIP6 must be an IPv6 addressapplication/json; charset=utf-8crypto/rsa: invalid prime value cannot produce iter.Seq[Value]reflect: Len of non-array type reflect.MakeSlice: negative lenreflect.MakeSlice: negative capreflect: NumIn of non-func typeinvalid return from write: got missing argument for comparisonrange over send-only channel %vvalue has type %s; should be %sMon, 02 Jan 2006 15:04:05 -0700Sent NegotiationReply: %#v %#v unsupported virtio GSO type: %dGeoIP country code %s not foundreceived a HANDSHAKE_DONE frameunexpected encryption level: %scannot use GSO with a basicConncannot use ECN with a basicConnhttp3: parsing frame failed: %whttp3: ConnContext returned nilaccount status is not valid: %sgetting authorization at %s: %wdns: reading random id failed: overflow unpacking domain namesunrecognized APL address familydns: svcbalpn: alpn-id too longmergeRuneSets odd length []runeunterminated character constantline `%s` has an unset variableinvalid timezone offset minutescouldn't parse octal number: %wcannot store a table in a slice2006-1-2T15:4:5.999999999Z07:002006-1-2t15:4:5.999999999Z07:00found duplicate %YAML directiveincomplete UTF-8 octet sequencewhile scanning a %TAG directivefield %v contains invalid UTF-8cannot reset invalid %v messageno_standard_descriptor_accessorclient sent a preferred_address Ignoring all packets below %d.didn't drop handshake correctlysession ticket keys unavailablenot implemented on linux/mipslettl=%d src=%v dst=%v ifindex=%dreflect.Value has no flag fieldhpke: invalid KEM shared secretheredoc doesn't contain newlinetabwriter: panic during %s (%v)windows new line should be \r\ncannot call BytesRange with niltoml: key %s is already definedencodeReflectValue: nil elementGot short response from netlinkcannot parse reserved wire typeinvalid Go type %v for field %v%T does not implement Unmarshaled25519: bad context length: %vx: %v y: %v z: %v ta: %v tb: %vfailed to initialize logger: %s https://acme.zerossl.com/v2/DV90unsupported protocol scheme "%s"/etc/pki/tls/certs/ca-bundle.crtx509: unsupported elliptic curvex509: invalid constraint value: x509: malformed subjectPublicKeyx509: invalid private key lengthx509: cannot parse rfc822Name %qx509: ECDSA verification failurex509: unknown extended key usageinvalid policy object identifierx509: unknown SignatureAlgorithmgo package net: addrLookupOrder(go package net: hostLookupOrder(unexpected character, want colonpidStatus called in invalid modeslice bounds out of range [::%x]slice bounds out of range [:%x:]slice bounds out of range [%x::]SIGFPE: floating-point exceptionSIGTTOU: background write to tty (types from different packages)end outside usable address spaceGCProg for type that isn't largeruntime: fixalloc size too largeinvalid limiter event type foundscanstack: goroutine not stoppedscavenger state is already wiredsweep increased allocation countremovespecial on invalid pointergetWeakHandle on invalid pointerruntime: root level max pages = _cgo_pthread_key_created missingruntime: sudog with non-nil elemruntime: sudog with non-nil nextruntime: sudog with non-nil prevruntime: mcall function returnednon-Go code disabled sigaltstackruntime: newstack called from g=runtime: stack split at bad timepanic while printing panic value28421709430404007434844970703125resource temporarily unavailablenumerical argument out of domainsoftware caused connection abort: day-of-year does not match day flags_with_completion+=(%q) __%s_handle_subdirs_in_dir_flag must_have_one_flag+=("-%s") failed to create unix socket: %wTLS_ECDHE_ECDSA_WITH_RC4_128_SHAchacha20poly1305: bad key lengthtls: unknown Renegotiation valuetls: NextProtos values too largetls: Start called more than oncetls: failed to parse private keyin literal false (expecting 'a')in literal false (expecting 'l')in literal false (expecting 's')in literal false (expecting 'e')invalid range: failed to overlapframe_windowupdate_zero_inc_connaccess-control-allow-credentialshttp2: server ignoring frame: %vread limit of %d bytes exhaustedwaiting on internal rate limitercertificate renewed successfullycould not determine the zone: %wfell back to default certificate[ERROR] key auth HTTP server: %vone usage of each socket addresspanic: http solver server: %v %spanic: certificate worker: %v %sapi returned unexpected responsesync: Unlock of unlocked RWMutexsync: negative WaitGroup counterinteger is not minimally encodedcannot represent time as UTCTimecrypto/ecdh: invalid private keyecdsa: internal error: r is zeroecdsa: internal error: s is zeroed25519: bad public key length: crypto/aes: input not full blockcrypto/des: input not full blockreflect: NumIn of non-func type reflect.MapOf: invalid key type MapIter.Value called before Nextreflect.Value.Grow: negative lenreflect: NumOut of non-func typeuse of closed network connection" not supported for cpu option "unable to parse %s as net.IPMaskbufio: invalid use of UnreadBytebufio: invalid use of UnreadRunebufio: tried to fill full buffervalue doesn't fit into 62 bits: can't determine encryption levelRetiring connection ID %s in %s.peer attempted to open stream %dblake2b: write to XOF after readmime: invalid boundary characterunexpected multi-line response: mime: expected token after slash ; DNSSEC ALGORITHM UNDERSTOOD: string exceeded 255 bytes in txtunable to assemble crypto framesinput overflows the modulus sizemalformed character constant: %sreadPythonMultilines: parsing %qValue %d for key %s out of rangedate time should have a timezonecouldn't parse binary number: %wwhile parsing a block collectiondid not find expected ',' or ']'did not find expected ',' or '}'found incompatible YAML documentincomplete UTF-16 surrogate pairwhile scanning a %YAML directivedid not find expected whitespacemultiple ,inline maps in struct invalid packet number length: %dinvalid connection ID length: %dnon-sequential packet number use lost packet %d (time threshold)unexpected read encryption levelEventReceivedTransportParametersEventRestoredTransportParameterschacha20: invalid buffer overlapABCDEFGHIJKLMNOPQRSTUVWXYZ2345670123456789ABCDEFGHIJKLMNOPQRSTUVexpected: IDENT | STRING got: %sunimplemented Value for type: %sbasic string not terminated by "bootstrap type already present: variable length integer overflowgoogle/protobuf/field_mask.protogoogle/protobuf/descriptor.protoexceeded maximum recursion depthweak message %v is not linked in%v already implements proto.Enumfield %v has invalid nil pointersha3: write to sponge after readunexpected null character (0x00)could not parse value for %v: %qgf256: invalid check byte lengthSigEd25519 no Ed25519 collisionsblake2s: write to XOF after readinvalid escape code %q in stringuse this URI to share your serverapplication/x-www-form-urlencodedx509: invalid RSA public exponentx509: SAN rfc822Name is malformedx509: invalid extended key usagesgo package net: confVal.netCgo = release of handle with refcount 0slice bounds out of range [%x:%y]SIGCHLD: child status has changedSIGTTIN: background read from ttySIGXFSZ: file size limit exceededbase outside usable address spaceruntime: memory allocated by OS [misrounded allocation in sysAllocconcurrent map read and map write/cpu/classes/gc/pause:cpu-seconds/cpu/classes/gc/total:cpu-seconds/gc/limiter/last-enabled:gc-cycle/memory/classes/heap/stacks:bytes/memory/classes/heap/unused:bytes/sched/pauses/stopping/gc:seconds/sched/pauses/total/other:secondsmin must be a non-zero power of 2runtime: failed mSpanList.insert runtime: epollcreate failed with runtime: morestack on g0, stack [runtime: castogscanstatus oldval=stoplockedm: inconsistent lockingfindrunnable: negative nmspinningfreeing stack not in a stack spanstackalloc not on scheduler stackruntime: goroutine stack exceeds runtime: text offset out of rangetimer period must be non-negativetoo many concurrent timer firingsruntime: name offset out of rangeruntime: type offset out of range142108547152020037174224853515625710542735760100185871124267578125too many levels of symbolic linksCalled Execute() on a nil Commandattempting to read in config fileno encoder registered for name %qQUICConfig.MaxStreamReceiveWindowbytes.Buffer.Grow: negative counttls: failed to write to key log: tls: invalid server finished hashtls: invalid client finished hashtls: unexpected ServerKeyExchangetls: unknown public key algorithmpseudo header field after regularhttp2: recursive push not allowedhttp: invalid Read on closed Bodynet/http: skip alternate protocolhttp: CloseIdleConnections calledhttp: invalid or unsafe file pathhttp: error reading directory: %vinvalid header field value for %qpad size larger than data payloadframe_pushpromise_promiseid_shorthttp2: invalid pseudo headers: %vhttp: multiple registrations for invalid concurrent Body.Read callconnection not allowed by rulesetinvalid username/password versionunsupported transfer encoding: %qcertificate obtained successfullyencoding certificate metadata: %vdecoding certificate metadata: %vno certificate available for '%s'cleaning up embedded provider: %vchecking authorization status: %wapplication/pem-certificate-chainno IPv4 or IPv6 address availablecrypto: requested hash function #bytes.Reader.Seek: invalid whencesync: RUnlock of unlocked RWMutexindefinite length found (not DER)struct contains unexported fieldsSigEd25519 no Ed25519 collisionsSigEd25519 no Ed25519 collisionsed25519: bad private key length: crypto/aes: output not full blockcrypto/des: output not full blockskip everything and stop the walkreflect: slice index out of rangereflect: NumOut of non-func type of method on nil interface valuereflect: Field index out of rangereflect: array index out of rangereflect.Value.Equal: invalid Kind to pointer to array with length too many Answers to pack (>65535)waiting for unsupported file typeGODEBUG: no value specified for "unaligned 64-bit atomic operationflag accessed but not defined: %sunknown shorthand flag: %q in -%sflag needs an argument: %q in -%s%s must be formatted as key=valueincompatible types for comparisoncannot index slice/array with nil'%s' expected type '%s', got '%s'decoder not found for this formatinvalid value %q for flag -%s: %vNo compatible QUIC version found.Closing connection with error: %ssendQueue.Send would have blockedGOAWAY frame: inconsistent lengthinvalid request pseudo header: %sinvalid TE header field value: %qpeer sent an unexpected frame: %Tmlkem768: invalid encoding lengthempty hex number for chunk lengthsolving challenges: %w (order=%s)unsupported issuer hash algorithmdns: bad MatchingType or Selectoroverflow packing uint64 as uint48overflow unpacking signed messageoauth2: Transport's Source is nilscalar has high bit set illegallykey-value delimiter not found: %sinvalid timezone offset charactercouldn't parse decimal number: %wnumber cannot end with underscoreanchor '%s' value contains itselfexpected nothing after STREAM-ENDwhile scanning for the next tokeninvalid zero-length connection IDreceived ACK for an unsent packetunexpected write encryption levelerror creating new AES cipher: %sGODEBUG sys/cpu: can not enable "leafCounts[maxBits][maxBits] != nregexp: unhandled case in compileoauth2: cannot parse response: %vslice offset larger than int (%d)no support for proto1 weak fieldsinvalid SetUnknown on nil Messagebuf must be of size PublicKeySizecould not format value for %v: %vno support for proto1 MessageSetsfailed to serve masquerade HTTP(S)/etc/ssl/certs/ca-certificates.crtadding nil Certificate to CertPoolx509: unknown public key algorithmx509: invalid certificate policies%s %q is excluded by constraint %qx509: Ed25519 verification failurex509: unhandled critical extensionslice bounds out of range [:%x:%y]slice bounds out of range [%x:%y:]SIGURG: urgent condition on socketruntime: standard file descriptor out of memory allocating allArenas/memory/classes/heap/objects:bytesruntime.SetFinalizer: cannot pass too many pages allocated in chunk?mspan.ensureSwept: m is not lockedruntime: netpollBreak write failedforEachP: sched.safePointWait != 0schedule: spinning with local workentersyscallblock inconsistent bp entersyscallblock inconsistent sp runtime: g is running but p is notinvalid timer channel: no capacity3552713678800500929355621337890625too many references: cannot splice: day-of-year does not match monthcobra_annotation_flag_set_by_cobraCommand can't be a child of itselffailed to create tun interface: %wexpected an RSA public key, got %TTLS_ECDHE_RSA_WITH_AES_128_CBC_SHATLS_ECDHE_RSA_WITH_AES_256_CBC_SHAconnection doesn't support Ed25519tls: malformed key_share extensionTLS 1.3, server CertificateVerifyTLS 1.3, client CertificateVerifyfailed to construct HKDF label: %sin \u hexadecimal character escapeexpected comma after array elementtimeout waiting for client prefacehttp2: aborting request body writehttp: connection has been hijackedhttp: persistConn.readLoop exitinghttp: read on closed response bodystream error: stream ID %d; %v; %vframe_settings_window_size_too_bigframe_windowupdate_zero_inc_streamnewWriterAndRequestNoBody(%+v): %v%s matches the same requests as %shttp: MultipartReader called twicehttp: invalid Content-Length of %qBaseContext returned a nil contextunsupported authentication method looking up account with server: %vDo you agree to the terms? (y/n): certificate should not be obtainedrenewing and reloading certificatelooking up info for HTTP challengemaxEvents cannot be less than zerochecking DNS propagation of %q: %wfetching new nonce from server: %wserver rejected upload request: %sbytes: Join output length overflowinvalid padding bits in BIT STRINGcrypto/rsa: missing public moduluscrypto/aes: invalid buffer overlapcrypto/des: invalid buffer overlapreflect: Method index out of rangereflect: ChanDir of non-chan type reflect: Field of non-struct type reflect: Field index out of boundsreflect.FuncOf: too many argumentsreflect.StructOf: duplicate field " is anonymous but has PkgPath setreflect: string index out of rangereflect: recv on send-only channelreflect: send on recv-only channelreflect.Value.Grow: slice overflowFlag --%s has been deprecated, %s can't evaluate field %s in type %scan't handle %s for arg of type %svalue is nil; should be of type %scannot squash non-struct type '%s'flag provided but not defined: -%sillegal base64 data at input byte set socket option: SO_NONBLOCK: %sparsing socket control message: %sError sending CONNECTION_CLOSE: %sRestoring Transport Parameters: %sProcessed Transport Parameters: %smissing retry_source_connection_idListening for %s connections on %sheader field is not lower-case: %sinvalid response pseudo header: %sDATA frame received after trailerscrypto/rc4: invalid buffer overlapempty NSEC(3) block in type bitmaprepeated SVCB keys are not allowedsigner name doesn't match key name%s/%s/delete-with-linked-resourcesexecutable file not found in $PATH%s: unsupported type to struct: %s%s: %s asked for 'key', impossiblehandleValue not implemented for %sdid not find expected node contentinvalid length of a UTF-8 sequencecontrol characters are not allowedchacha20: wrong HChaCha20 key sizeGODEBUG sys/cpu: can not disable "illegal base32 data at input byte invalid nested repetition operatorinvalid or unsupported Perl syntaxEncodeSEG6Encap: No Segment in srhbad tag in lazy extension decodingmismatching field: got %v, want %vseed must be of length KeySeedSizess must be of length SharedKeySizept must be of length PlaintextSizebuf must be of size PrivateKeySizetraffic stats server up and runningx509: malformed extension OID fieldx509: wrong Ed25519 public key sizex509: invalid authority info accessx509: failed to marshal curve OID: encoding/hex: odd length hex stringunsigned integer overflow on token os/signal: Notify using nil channelpersistentalloc: align is too large/memory/classes/heap/released:bytesgreyobject: obj not pointer-alignedmismatched begin/end of activeSweepmheap.freeSpanLocked - invalid freefailed to get or create weak handleattempt to clear non-empty span setruntime: close polldesc w/o unblockruntime: inconsistent read deadlinefindrunnable: netpoll with spinningpidleput: P has non-empty run queuetraceback did not unwind completely1776356839400250464677810668945312588817841970012523233890533447265625ryuFtoaFixed32 called with prec > 9strings.Reader.Seek: invalid whencenetwork dropped connection on resettransport endpoint is not connected2006-01-02T15:04:05.999999999Z07:00non-positive interval for NewTicker__%[1]s_handle_go_custom_completioncobra_annotation_mutually_exclusivemissing EncodeTime in EncoderConfigfailed to stat certificate file: %wunsupported signature algorithm: %vTLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHAtls: too many non-advancing recordstls: server selected an invalid PSKtls: invalid Kyber server key sharetls: invalid Kyber client key sharetls: invalid or missing PSK bindershttp: server closed idle connectionCONTINUATION frame with stream ID 0Prohibited TLS 1.2 Cipher Suite: %xhttp2: server: client %v said hellohttp2: server processing setting %vWrite called after Handler finishedcertificate for '%s' is not managedpresenting with embedded solver: %vdirectory missing newNonce endpointurn:ietf:params:acme:error:badNonceserver rejected our nonce; retryingtraffic logger requested disconnectsuperfluous leading zeros in length'_' must separate successive digitsbigmod: modulus is smaller than natcrypto/md5: invalid hash state sizeisReflexive called on non-key type " is unexported but missing PkgPathreflect.MakeSlice of non-slice typetoo many Questions to pack (>65535)file type does not support deadlineinvalid argument %q for %q flag: %vexpected unsigned integer; found %snon-comparable types %s: %v, %s: %v%s: unsupported type for squash: %sGot Reply: %#v %#v %#v %#v %#v %#v set socket option: SO_REUSEADDR: %sip header version: %d, GSO type: %dclose called for canceled stream %dcrypto/blake2b: cannot marshal MACsmlkem768: crypto/rand Read failed: mlkem768: invalid ciphertext lengthform-data; name="%s"; filename="%s"mime: bogus characters after %%: %qhpack: invalid Huffman-encoded datadynamic table size update too largeoverflow unpacking uint64 as uint48dns: TSIG not last RR in additionalonly standard queries are supportedtruncated messages aren't supportedP224 point is the point at infinityP256 point is the point at infinityP384 point is the point at infinityP521 point is the point at infinityrange can only initialize variablestransform: short destination buffer%s: unknown kind to decode into: %s%s: not an object type for map (%T)nanoseconds need at least one digitnumber cannot start with underscoretoml: cannot encode a nil interfaceshould not be called with empty keynumber %f does not fit in a float32must set the input source only oncedid not find expected '-' indicatorfound extremely long version numberfound unexpected document indicatorWrong sender portid %d, expected %dtimeout: no recent network activity %s &wire.NewTokenFrame{Token: %#x}%d exceeds the maximum stream countclient sent a stateless_reset_tokendidn't expect ECN to be unsupported0-RTT not allowed. Rejecting 0-RTT.unknown session ticket revision: %dmax-age=31536000; includesubdomainschacha20: output smaller than inputflate: corrupt input before offset %s %s giving up after %d attempt(s)basic strings cannot have new linesfile %q has a name conflict over %vfound wrong type: got %v, want enumstring field contains invalid UTF-8%v already implements proto.Messagect must be of length CiphertextSizebuf must be of length PublicKeySizeunimplemented HCLToken for type: %scrypto/blake2s: cannot marshal MACsdelimiters may only be "{}" or "<>"x509: zero or negative DSA parameterx509: invalid CRL distribution pointx509: invalid subject key identifierx509: malformed algorithm identifierx509: invalid X25519 private key: %vx509: serial number must be positivesyntax error scanning complex numberpidDeactivate called in invalid modelfstack node allocated from the heap) is larger than maximum page size (key size not a multiple of key alignruntime: invalid typeBitsBulkBarrieruncaching span but s.allocCount == 0/memory/classes/metadata/other:bytes/sched/pauses/stopping/other:secondsuser arena span is on the wrong listruntime: marked free object in span runtime: unblock on closing polldescruntime: inconsistent write deadlineruntime: netpoll: eventfd ready for runtime: sudog with non-nil waitlinkruntime: mcall called on m->g0 stackfatal: recursive switchToCrashStack startm: P required for spinning=true) is not Grunnable or Gscanrunnable runtime: bad notifyList size - sync=signal arrived during cgo execution accessed data from freed user arena runtime: wrong goroutine in newstackruntime: invalid pc-encoded table f=444089209850062616169452667236328125ryuFtoaFixed64 called with prec > 180123456789abcdefghijklmnopqrstuvwxyzstrings.Builder.Grow: negative countstrings: Join output length overflowaccessing a corrupted shared libraryTime.UnmarshalBinary: invalid length__%s_handle_filename_extension_flag Completion ended with directive: %s could not discover absolute path: %w%s is not supported on this platforminvalid semicolon separator in queryexpected an ECDSA public key, got %TTLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHATLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHAtls: keys must have at least one keyunsupported SSLv2 handshake receivedtls: server did not send a key sharejson: encoding error for type %q: %qhttp: no Location header in responsehttp: unexpected EOF reading trailerhttp: invalid byte %q in Cookie.Path LastStreamID=%v ErrCode=%v Debug=%qhttp2: server rejecting conn: %v, %sHeader called after Handler finishedRoundTrip retrying after failure: %vJanFebMarAprMayJunJulAugSepOctNovDecno acceptable authentication methodsHijack failed on protocol switch: %v%s: insecure CA URL (HTTPS required)unexpected response code '%s' for %s%s: could not make path relative: %vcustom certificate selection resultsmaintaining newly-loaded certificateusing externally-managed certificatepanic: tls-alpn solver server: %v %shttps://api.cloudflare.com/client/v4computing account JWK thumbprint: %vserver rejected download request: %sbytes: Repeat output length overflowbytes.Reader.ReadAt: negative offsetbytes.Reader.Seek: negative positionIA5String contains invalid characterno assembly implementation availablecrypto/cipher: input not full blocksmethod ABI and value ABI don't alignreflect.Value.Equal: values of type crypto/sha1: invalid hash state sizecrypto/sha512: invalid hash functionreflect: NumField of non-struct typeexceeded maximum template depth (%v)%s is not a method but has argumentsinternal error: associate not commonunable to cast %#v of type %T to intcannot parse '%s', %d overflows uintcannot parse '%s', %f overflows uintinvalid boolean value %q for -%s: %vGot NegotiationRequest: %#v %#v %#v Sent Reply: %#v %#v %#v %#v %#v %#v build destination socket address: %sDestroying connection with error: %sDropping Version Negotiation packet.Increased send buffer size to %d kiBreading stream type on stream failedcould not read quarter stream id: %wcrypto/rand: argument to Int is <= 0mime: SetBoundary called after writemalformed MIME header initial line: waiting for solver before continuinginitiating challenge with server: %wPrivate-key-format: v1.3 Algorithm: address and mask lengths don't matchoverflowing unpacking signed message%s/%s/node-pools/%s/nodes/%s/recyclepacket with long header is too smalledwards25519: invalid point encodinginvalid pattern syntax (+ after -): %s: cannot decode into interface: %Ttoml: cannot encode value of type %smust set the output target only onceunknown problem parsing YAML contentdocument contains excessive aliasingdid not find expected did not find expected version numberlabel must begin with interface nameinvalid IPRanges during Ranges mergecannot merge into invalid %v messagestream data overflows maximum offsetmissing initial_source_connection_idInstalled 0-RTT Read keys (using %s)Installed 1-RTT Read keys (using %s)chacha20: wrong HChaCha20 nonce size[DEBUG] %s: retrying in %s (%d left)HPKE_KEM_X25519_KYBER768_HKDF_SHA256range length is larger than capacityError converting to netlink sockaddrgoogle/protobuf/source_context.proto%v: MessageSet with no unknown fieldbuf must be of length PrivateKeySizeinvalid characters in heredoc anchored25519: bad context length: %v > %vinvalid hex escape code %q in stringTUN is not supported on this platformmust specify one and only one addressmasquerade HTTP server up and runningx509: malformed extension value fieldx509: RSA key missing NULL parametersx509: invalid CRL distribution pointsx509: unsupported private key versionx509: invalid Ed25519 private key: %vcrypto/ecdh: invalid private key sizex509: unsupported public key type: %Teach group must have 4 or less digitsruntime: allocation size out of range) is smaller than minimum page size (/cpu/classes/gc/mark/idle:cpu-secondssetprofilebucket: profile already setfailed to reserve page summary memory_cgo_notify_runtime_init_done missingfatal: concurrent switchToCrashStack startTheWorld: inconsistent mp->nextpruntime: unexpected SPWRITE function all goroutines are asleep - deadlock!2220446049250313080847263336181640625value too large for defined data typecannot exec a shared library directlyoperation not possible due to RF-killtimezone hour outside of range [0,23]QUICConfig.InitialStreamReceiveWindowQUICConfig.MaxConnectionReceiveWindowcannot create context from nil parentcrypto: Size of unknown hash functiontls: unsupported certificate key (%T)TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256tls: failed to verify certificate: %sbytes.Buffer: truncation out of rangehttp: invalid byte %q in Cookie.Valueunexpected CONTINUATION for stream %dhttp2: Transport sending health checkhttp2: Transport health check successRoundTrip on uninitialized ClientConnhttp2: server encoding header %q = %qhttp: TLS handshake error from %s: %vcould not save account to storage: %vaccount pre-registration callback: %vdone waiting on internal rate limiterunable to parse PEM certificate chaincertificate already exists in storagecould not get certificate from issuerserved key authentication certificatedefault certificate selection resultsrenewing certificate on-demand failedpanic: tls-alpn solver handler: %v %sexplicitly tagged member didn't matchcrypto/rsa: public exponent too smallsubtle: slices have different lengthscrypto/rsa: unsupported hash functionbigmod: internal error: shrinking natgodebug: unexpected IncNonDefault of out does not point to an integer typecipher: message authentication failedcrypto/cipher: invalid buffer overlapcrypto/cipher: incorrect GCM tag sizereflect: Bits of non-arithmetic Type reflect: NumField of non-struct type reflect: IsVariadic of non-func type reflect: OverflowInt of non-int type needKeyUpdate called on non-key type reflect: funcLayout of non-func type reflect.Value.Bytes of non-byte slicereflect.Value.Bytes of non-byte arrayreflect.Value.Bytes of non-rune slicemethod ABI and value ABI do not alignreflect.Value.Convert: value of type too many Authorities to pack (>65535)too many Additionals to pack (>65535)%q is an incomplete or empty templatedereference of nil pointer of type %scannot index slice/array with type %sunable to cast %#v of type %T to Timeunable to cast %#v of type %T to boolunable to cast %#v of type %T to uintparse error on line %d, column %d: %vvariable value type must be a pointerSent NegotiationRequest: %#v %#v %#v Got Request: %#v %#v %#v %#v %#v %#v set socket option: IP_TRANSPARENT: %sgVisor is not supported in this fork.allocator Put() incorrect buffer sizePeer closed connection with error: %sError sending INVALID_TOKEN error: %sError sending Version Negotiation: %speer attempted to open send stream %dTemporary error reading from conn: %wuse of http3.Server without TLSConfigaccepting bidirectional stream failedinvalid header field value for %s: %qopening the control stream failed: %wchacha20poly1305: plaintext too largemlkem768: invalid polynomial encodingwaiting for solver %T to be ready: %wurn:ietf:params:acme:error:connectionNSEC(3) block too long in type bitmapdns: svcbalpn: alpn array overflowing/v2/object-storage/%s/regenerate-keysexec: StdinPipe after process startedencountered unexpected frame type: %dbisect.Hash: unexpected argument typecomment ends before closing delimiterunrecognized character in action: %#Ucouldn't parse hexadecimal number: %wcannot have underscore after exponentcannot store TOML string into a Go %sexpected DOCUMENT-START or STREAM-ENDcannot parse invalid wire-format data%s not allowed at encryption level %sInstalled 0-RTT Write keys (using %s)Installed 1-RTT Write keys (using %s)unexpected write encryption level: %sPeer confirmed key update to phase %dInitiating key update to key phase %d[ERR] error reading response body: %vinvalid character at start of key: %cliteral strings cannot have new linestype not registered for interface: %sgob NewTypeObject can't handle type: GOLANG_PROTOBUF_REGISTRATION_CONFLICTdilithium: cannot sign hashed messageshow QR code for server config sharingno certificate matches the pinned hashfailed to send ZeroSSL EAB request: %wmasquerade HTTPS server up and runningcrypto/sha256: invalid hash state sizex509: invalid subject alternative namex509: invalid authority key identifierx509: empty name constraints extensionx509: failed to parse EC private key: x509: cannot validate certificate for IPv4 field has octet with leading zerosyscall: readInt with unsupported sizeindex out of range [%x] with length %ymakechan: invalid channel element typeunreachable method called. linker bug?concurrent map iteration and map writeelem size not a multiple of elem aligngcBgMarkWorker: blackening not enabledcannot read stack of running goroutineruntime: blocked read on free polldescruntime: sudog with non-false isSelectarg size to reflect.call more than 1GBv could not fit in traceBytesPerNumber1110223024625156540423631668090820312555511151231257827021181583404541015625strings.Reader.ReadAt: negative offsetstrings.Reader.Seek: negative positionstrings: Repeat output length overflowcan not access a needed shared librarynon-positive interval for Ticker.Resettime: missing Location in call to Date%s is not a valid port number or rangetls: invalid ClientKeyExchange messagetls: invalid ServerKeyExchange messageexpected an Ed25519 public key, got %Tinternal error: unknown signature typetls: server selected unsupported grouptls: unsupported signing key type (%T)tls: early_data without pre_shared_keytls: client sent unexpected early datatls: failed to sign ECDHE parameters: tls: server selected unsupported curvetls: missing ServerKeyExchange messagetls: internal error: unsupported curveafter decimal point in numeric literalfailed to parse Location header %q: %vhttp2: server connection from %v on %phttp: Accept error: %v; retrying in %vregistering account %v with server: %wTLS handshake aborted by event handlerhandshake aborted by event handler: %wsuccessfully stapled new OCSP responsepanic: ring buffer rate limiter: %v %sunable to find the main domain for: %sinternal error: unknown string type %dasn1: Unmarshal recipient value is nilreflect: bad size computation in MapOfreflect.typeptrdata: unexpected type, reflect: close of receive-only channelreflect: Method on nil interface valuecrypto/sha512: invalid hash state sizeinsufficient data for base length typetemplate: %s: executing %q at <%s>: %scan't give argument to non-function %sindirection through explicit nil in %sevalEmptyInterface: nil (can't happen)unable to cast %#v of type %T to int64unable to cast %#v of type %T to []intresult must be addressable (a pointer)error decoding json.Number into %s: %sflag %s set at %s before being definedSent Request: %#v %#v %#v %#v %#v %#v Could not determine native endianness.accepting unidirectional stream failedunexpected size for SETTINGS frame: %dhttp3: unsupported protocol scheme: %schacha20poly1305: ciphertext too largemime: expected slash after first tokenexec: StdoutPipe after process startedexec: StderrPipe after process startedinvalid P224 compressed point encodinginvalid P256 compressed point encodinginvalid P384 compressed point encodinginvalid P521 compressed point encoding%s: not an object type for struct (%T)readPythonMultilines: matched %d partserror creating new key: empty key nameextra bytes at the end of the timezonecannot have underscore before exponenttoml: number %d does not fit in an intline %d: cannot unmarshal %s%s into %sline %d: field %s not found in type %sdid not find expected could not find expected directive namefound an incorrect leading UTF-8 octetinvalid headroom size. range is 0 - %dunexpected additional overlap scenariono support for message_set_wire_format%v: unable to resolve extension %v: %vdeprecated_legacy_json_field_conflictstype mismatch: cannot convert %v to %sinvalid connection ID length: %d bytes lost packet %d (reordering threshold)negative number of outstanding packetsCryptoSetup: keys were already droppedReceived 0-RTT read key for the clientfailed to read session ticket revisionGODEBUG sys/cpu: unknown cpu feature "nested object expected: LBRACE got: %sobject expected closing RBRACE got: %sKind.String() not implemented for '%d'found wrong type: got %v, want messagename reference must be fully qualifiedinvalid field: no encoder for %v %v %vcannot encode %d bits into %d-bit codeinvalid octal escape code %q in stringfailed getting EAB credentials: HTTP %dcannot set both acl.file and acl.inlineData size for download and upload testsx509: invalid subject alternative namesx509: invalid NameConstraints extensionx509: failed to parse URI constraint %qx509: failed to marshal private key: %vmath/big: buffer too small to fit valuex509: unknown EC private key version %d because it doesn't contain any IP SANsx509: invalid elliptic curve public keyx509: signing with MD5 is not supportedx509: trailing data after X.509 SubjectIPv4 field must have at least one digitmismatched count during itab table copyout of memory allocating heap arena map/cpu/classes/gc/mark/assist:cpu-seconds/cpu/classes/scavenge/total:cpu-seconds/memory/classes/profiling/buckets:bytesmspan.sweep: bad span state after sweepruntime: blocked write on free polldescsuspendG from non-preemptible goroutineruntime: casfrom_Gscanstatus failed gp=stack growth not allowed in system calltraceback: unexpected SPWRITE function traceRegion: alloc with concurrent drop277555756156289135105907917022705078125transport endpoint is already connectedSetctty set but Ctty not valid in childsyscall.releaseForkLock: negative count2006-01-02 15:04:05.999999999 -0700 MSTcobra_annotation_bash_completion_custom local_nonpersistent_flags+=("-%s") cobra_annotation_required_if_others_sethop interval must be at least 5 secondstls: unsupported certificate curve (%s)TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256tls: internal error: wrong nonce lengthno mutually supported protocol versionschain is not signed by an acceptable CAhttp: putIdleConn: keep alives disabledusername/password authentication failedcache full; evicting random certificateconverting identifier '%s' to ASCII: %vno certificate matching TLS ClientHellono OCSP server specified in certificateadding temporary record for zone %q: %wtags don't match (%d vs %+v) %+v %s @%dasn1: Unmarshal recipient value is nil ecdsa: unsupported curve by crypto/ecdhecdsa: public key point is the infinityed25519: bad Ed25519ph context length: crypto/rsa: invalid options for Decryptcipher: incorrect tag size given to GCM cannot produce iter.Seq2[Value, Value]reflect: OverflowUint of non-uint type reflect.MakeMapWithSize of non-map typeunable to cast %#v of type %T to uint64unable to cast %#v of type %T to uint32unable to cast %#v of type %T to stringextraneous or missing " in quoted-fieldcsv: invalid field or comment delimiterGot UserPassNegotiationReply: %#v %#v set socket option: IPV6_TRANSPARENT: %sdropped unexpected encryption level: %sIncreased receive buffer size to %d kiBError sending Stateless Reset to %s: %scrypto/blake2b: invalid hash state sizehpke: LabeledExpand failed unexpectedlymlkem768: invalid encryption key lengthmultipart: can't write to finished partinvalid indexed representation index %dvalidations succeeded; finalizing orderno certificate chains offered by serverurn:ietf:params:acme:error:unauthorizedbad signature on embedded certificate: ;; OPT PSEUDOSECTION: ; EDNS: version comment length insufficient for parsingexec: environment variable contains NULcannot add shadow to another shadow keymissing closing key quote from %q to %qcannot store inline table in Go type %stoml: number %d does not fit in an int8cannot decode node with unknown kind %dunknown problem generating YAML contentcannot marshal invalid UTF-8 data as %scannot encode node with unknown kind %dfound an incorrect trailing UTF-8 octetdid not find expected hexdecimal numberSEG6_LOCAL_NH4 has invalid IPv4 addressEither Dst.IP, Src.IP or Gw must be set %s &wire.MaxDataFrame{MaximumData: %d} Setting ACK timer to max ack delay: %sUnmarshalling session ticket failed: %sReceived 0-RTT write key for the servermissing argument to repetition operatortrailing backslash at end of expression%s %s giving up after %d attempt(s): %wunexpected token while parsing list: %sExpected object, got unknown token: %+vgob: cannot encode nil pointer of type can't represent recursive pointer type google.golang.org/genproto/protobuf/apigoogle.golang.org/protobuf/types/known/%v: MessageSet with no extensions fieldinvalid value: merging into nil messagecrypto/blake2s: invalid hash state sizefailed to creare ZeroSSL EAB request: %wx509: malformed extension critical fieldx509: cannot parse IP address of length %s %q is not permitted by any constrainterrors: target must be a non-nil pointertime: Stop called on uninitialized TimerIPv6 zones cannot be present in a prefixinvalid span in heapArena for user arenabulkBarrierPreWrite: unaligned argumentsruntime: typeBitsBulkBarrier with type refill of span with free space remaining/cpu/classes/scavenge/assist:cpu-secondsruntime.SetFinalizer: first argument is failed to acquire lock to reset capacitymarkWorkerStop: unknown mark worker modecannot free workbufs when work.full != 0runtime: out of memory: cannot allocate runtime: netpollBreak write failed with stopTheWorld: broken CPU time accountingglobal runq empty with non-zero runqsizemust be able to track idle limiter eventgoroutine stack size is not a power of 213877787807814456755295395851135253906256938893903907228377647697925567626953125ryuFtoaFixed32 called with negative precaddress family not supported by protocolports not allowed with file URLs: got %vclient doesn't support certificate curveoversized record received with length %dtls: received empty certificates messagetls: client didn't provide a certificatehttp2: timeout awaiting response headersFrame accessor called on non-owned Frameinternal error: expecting non-nil streamrequest header %q is not valid in HTTP/2http2: Transport encoding header %q = %qprotocol error: headers after END_STREAMwriteData(stream=%d, p=%d, endStream=%v)host contains '{' (missing initial '/'?)bad wildcard segment (must end with '}')unrecognized or unsupported key type: %surn:ietf:params:acme:error:orderNotReadyauthentication error, HTTP status code: NumericString contains invalid charactercannot represent time as GeneralizedTimeed25519: bad Ed25519ctx context length: crypto/rsa: input must be hashed messagersa: internal error: inconsistent lengthcrypto/cipher: output smaller than inputcrypto/cipher: message too large for GCMreflect: FieldByName of non-struct type reflect: bad layout computation in MapOfreflect.Value.Call: call of nil functionreflect.Value.Call: wrong argument countattempted to copy pointer to FP registerMapIter.Key called on exhausted iteratorreflect.Value.SetBytes of non-byte slicereflect.Value.setRunes of non-rune sliceunable to cast %#v of type %T to float64Sent UserPassNegotiationReply: %#v %#v reading original destination address: %sDropping (potentially) duplicate packet.received NEW_TOKEN frame from the clientpeer attempted to open receive stream %dfailed to determine send buffer size: %wActivating reading of ECN bits for IPv4.Activating reading of ECN bits for IPv6.http3: invalid http header field name %qchacha20poly1305: invalid buffer overlapmultipart: unexpected line in Next(): %qmalformed MIME header: missing colon: %qevictOldest(%v) on table with %v entriesoverflowing NSEC(3) block in type bitmapedwards25519: use of uninitialized Pointfloat can have at most one decimal pointtoml: number %d does not fit in an int32toml: number %d does not fit in an int16line %d: field %s already set in type %sunsupported flag %q in tag %q of type %sreceived a stateless reset with token %xclient sent a retry_source_connection_idCannot drop keys for encryption level %sflow controller reset after reading datamismatching version. Got %d, expected %d0-RTT was rejected. Dropping 0-RTT keys.Installed Handshake Read keys (using %s)time.Time year outside of range [0,9999]quotedprintable: invalid hex byte 0x%02xeddilithium4: cannot sign hashed messageunicode point needs %d character, not %dtoml: key %s should be a table, not a %sfound wrong type: got %v, want extensionmessage %T is neither a v1 or v2 Messageinvalid type: no encoder for %v %v %v/%veddilithium2: cannot sign hashed messageSignature does not fit in that bytesliceinvalid Unicode escape code %q in stringreceived signal, shutting down gracefullyx509: cannot parse URI %q: invalid domaincolon must be followed by more charactersunexpected call to os.Exit(0) during test closed, unable to open /dev/null, errno=runtime: typeBitsBulkBarrier without type/memory/classes/metadata/mspan/free:bytesruntime.SetFinalizer: second argument is gcSweep being done but phase is not GCoffobjects added out of order or overlappingmheap.freeSpanLocked - invalid stack freemheap.freeSpanLocked - invalid span stateattempted to add zero-sized address rangeruntime: blocked read on closing polldescstopTheWorld: not stopped (stopwait != 0) received on thread with no signal stack 34694469519536141888238489627838134765625strconv: illegal AppendInt/FormatInt basetime: Reset called on uninitialized Timertime: missing Location in call to Time.InTime.UnmarshalBinary: unsupported version help [path to command] for full details.Generate the autocompletion script for %snet/url: invalid control character in URLQUICConfig.InitialConnectionReceiveWindowtls: internal error: unsupported key (%T)tls: handshake has not yet been performedinvalid value length: expected %d, got %dtls: unsupported decryption key type (%T)tls: failed to parse client certificate: tls: internal error: failed to clone hashtls: internal error: unknown cipher suitetls: no supported elliptic curves offeredtls: internal error: empty verified chainwriteEndsStream called on nil writeFramerinvariant; can't close stream in state %vhttp2: server ignoring unknown setting %vCloseNotify called after Handler finishedWriteHeader called after Handler finishedhttp2: no cached connection was availablehttp2: Transport health check failure: %vhttp2: invalid Upgrade request header: %qtransport got GOAWAY with error code = %vmaking TLS-ALPN challenge certificate: %vcould not decode name.com's response: %wserver does not support newAuthz endpointunrecognized Content-Type from server: %s{"crv":"%s","kty":"EC","x":"%s","y":"%s"}bytes.Buffer.WriteTo: invalid Write countbytes.Reader.WriteTo: invalid Write countasn1: internal error in parseTagAndLengthcrypto/md5: invalid hash state identifierreflect: FieldByIndex of non-struct type reflect: OverflowFloat of non-float type can't call pointer on a non-pointer Valuereflect.Value.Addr of unaddressable valueMapIter.Next called on exhausted iteratorsync/atomic: swap of nil value into Valuetrying to get %s value of flag of type %swrong type for value; expected %s; got %sunable to cast %#v of type %T to Durationunable to cast %#v of type %T to []stringInvalid Version of Username Password Authconvert file descriptor to connection: %sset socket option: IP_RECVORIGDSTADDR: %sunable to obtain original destination: %sread len %d overflows bufs element len %dDropping a packet with an unknown versionSetting DF failed for both IPv4 and IPv6.http3: no cached connection was availablecontradicting content lengths (%s and %s)idna: internal error in punycode encodingurn:ietf:params:acme:error:serverInternaldns: length mismatch, want 0/2 but got %dout of order NSEC(3) block in type bitmapHTTPS server returned with non-OK code %dexpecting colon between hours and minutesfound an indentation indicator equal to 0crypto/tls bug: why more than one ticket?Installed Handshake Write keys (using %s)unexpected Retry integrity tag length: %dexpected Required Insert Count to be zeroreflect.Value flag field has changed kindGODEBUG sys/cpu: no value specified for """" not allowed in multiline basic stringtoml: expected %s to be a table, not a %sgoogle.golang.org/genproto/protobuf/ptypemismatching message name: got %v, want %vinvalid Message.WhichOneof descriptor on seed must be of length EncryptionSeedSizex509: %q cannot be encoded as an IA5Stringx509: RSA modulus is not a positive numberpersistentalloc: align is not a power of 2out of memory allocating checkmarks bitmap/cpu/classes/gc/mark/dedicated:cpu-seconds/memory/classes/metadata/mcache/free:bytes/memory/classes/metadata/mspan/inuse:bytesnon-empty mark queue after concurrent marksweep: tried to preserve a user arena spanruntime: blocked write on closing polldescunexpected state passed to panicrangestateacquireSudog: found s.elem != nil in cachefatal error: cgo callback before cgo call on a locked thread with no template threadunexpected signal during runtime execution received but handler not on signal stack traceStopReadCPU called with trace enabledattempted to trace a bad status for a proc173472347597680709441192448139190673828125867361737988403547205962240695953369140625time: Reset called on uninitialized TickerTime.MarshalBinary: unexpected zone offsetUnable to find a command for arguments: %vError while parsing flags from args %v: %s%s?cver=%s&plat=%s&arch=%s&chan=%s&side=%stls: private key does not match public keylooking for beginning of object key stringmix of request and response pseudo headersPRIORITY frame payload size was %d; want 5Failed to parse goroutine ID out of %q: %vhttp2: server connection error from %v: %vpromised request headers cannot include %qbad wildcard segment (must start with '{')http: multipart handled by MultipartReaderhttp: ContentLength=%d with Body length %dcould not decode account's private key: %vstarted background certificate maintenancestopped background certificate maintenancecould not determine zone for domain %q: %vPrintableString contains invalid characterreflect: negative length passed to ArrayOfreflect: Call with too few input argumentsmismatch between ABI description and typesMapIter.Value called on exhausted iteratorreflect: cannot convert slice with length crypto/sha1: invalid hash state identifierinsufficient data for resource body lengthsync/atomic: store of nil value into Valuedeprecated message for flag %q must be setinternal error: no fields in evalChainNodefunction name %q is not a valid identifierdecoder already registered for this formatencoder already registered for this formatenable offload: check IFF_VNET_HDR enabledclosing connection in order to recreate itSwitching destination connection ID to: %sError occurred handling initial packet: %sError sending CONNECTION_REFUSED error: %stried to delete unknown outgoing stream %dtried to delete unknown incoming stream %dhttp: too many 1xx informational responsesinvalid value for SETTINGS_H3_DATAGRAM: %dexpected first frame to be a HEADERS framehttp3: failed to read response headers: %winvalid HTTP header value %q for header %qinternal error: call to runtimeSource.Seedpoly1305: write to MAC after Sum or Verifymlkem768: invalid encapsulation key lengthdomain name exceeded %d wire-format octetsSVCB keys not in strictly increasing orderdns: svcbipv6hint: expected ipv6, got ipv4gave up after %d attempts, last error : %sgave up after %d attempts, last error: %#verror parsing data source: unknown type %qleading zero not allowed on decimal numbercannot have underscore after decimal pointinvalid array: want %d elements but got %dIncorrect element type in vf info list: %ddecoding failed: address family %d unknownmissing original_destination_connection_idreceived duplicate transport parameter %#xSending ACK because the ACK timer expired.packet %d not found in sent packet historycrypto/tls bug: where's my session ticket?quotedprintable: invalid bytes after =: %qKeyValue should have at least two childrenarray elements must be separated by commasgob: encoded unsigned integer out of rangecrypto: requested unavailable XOF functionheredoc expected second '<', didn't see itx509: failed to parse dnsName constraint %qx509: invalid X25519 private key parametersruntime: opened unexpected file descriptor /memory/classes/metadata/mcache/inuse:bytesruntime.SetFinalizer: first argument is nilruntime.SetFinalizer: finalizer already setgcBgMarkWorker: unexpected gcMarkWorkerModenon in-use span found with specials bit setgrew heap, but no adequate free space foundroot level max pages doesn't fit in summaryruntime: releaseSudog with non-nil gp.paramunknown runnable goroutine during bootstrapruntime: casfrom_Gscanstatus bad oldval gp=runtime:stoplockedm: lockedg (atomicstatus=methodValueCallFrameObjs is not in a modulemult64bitPow10: power of 10 is out of rangeinterrupted system call should be restarted local_nonpersistent_flags+=("--%[1]s") TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256tls: received unexpected key update messagetls: server did not select an ALPN protocoltls: server sent unrequested session tickettls: received malformed key_share extensiontls: invalid early data for QUIC connectiontls: client's Finished message is incorrecttls: handshake data received at wrong leveltls: SendSessionTicket called on the clientno multipart boundary param in Content-Typenet/http: timeout awaiting response headerstimeout waiting for SETTINGS frames from %vhttp2: server closing client connection: %vhttp2: unexpected ALPN protocol %q; want %qTransport: unhandled response frame type %Thttp2: too many 1xx informational responsesError enabling Transport HTTP/2 support: %vunable to write OCSP staple file for %v: %vhttps://api.gandi.net/v5/livedns/domains/%scould not encode form data for request: %wresponse had invalid Retry-After header: %sorder pending, authorizations remaining: %vexplicit time type given to non-time membermultiple Read calls return no data or errorreflect: nil type passed to Type.Implementsreflect: CallSlice of non-variadic functionreflect: Call with too many input argumentsFlag shorthand -%s has been deprecated, %s invalid string being converted to IPNet: %s%s is an unexported field of struct type %swrong number of args for %s: want %d got %dwrong number of args for %s: got %d want %dbufio: tried to rewind past start of bufferset socket option: IPV6_RECVORIGDSTADDR: %sstream %d canceled by %s with error code %dfailed to determine receive buffer size: %wHEADERS frame too large: %d bytes (max: %d)chunked encoding contains too much non-dataoauth2: cannot fetch token: %v Response: %sexec: WaitDelay expired before I/O completeedwards25519: invalid point encoding lengthnon executable command in pipeline stage %dreadPythonMultilines: end of value, got: %qexpecting colon between minutes and secondscannot have underscore before decimal pointtoml: type %s is not supported as a map keytoml: decoding pointer target cannot be nilextra characters at the end of a local time!!binary value contains invalid base64 datafound character that cannot start any tokendid not find expected comment or line breakfound unexpected non-alphabetical characterfound invalid Unicode character escape coderefusing to Unmarshal into non-zero IPRangetimeout: handshake did not complete in time %s &wire.DataBlockedFrame{MaximumData: %d}sent packet with unexpected ECN marking: %s''' not allowed in multiline literal stringfile %q has a package name conflict over %vfailed decoding ZeroSSL EAB API response: %wcrypto/sha256: invalid hash state identifierx509: invalid RDNSequence: invalid attributex509: invalid Ed25519 private key parametersx509: invalid Ed25519 private key length: %dx509: internal error: cannot parse domain %qcrypto/x509: error fetching intermediate: %wx509: failed to unmarshal raw CSR Attributesuse of WriteTo with pre-connected connectionspan on userArena.faultList has invalid sizeout of memory allocating heap arena metadataruntime: cannot remap pages in address space/cpu/classes/scavenge/background:cpu-secondsruntime: unexpected metric registration for gcmarknewobject called while doing checkmarkactive sweepers found at start of mark phaseno P available, write barriers are forbiddencannot trace user goroutine on its own stackunsafe.Slice: ptr is nil and len is not zeromult128bitPow10: power of 10 is out of range local_nonpersistent_flags+=("--%[1]s=") %v Logger.check error: failed to get caller fragments not allowed with file URLs: got %vfailed to send fd to control unix socket: %wtls: server's Finished message was incorrecttls: server sent an incorrect legacy versiontls: unexpected ECH extension in serverHellotls: SendSessionTicket called multiple timestls: StoreSessionTicket called on the serverhttp: putIdleConn: too many idle connectionshttp: attempting to traverse a non-directoryconnection exceeded flow control window sizehttp2: could not negotiate protocol mutuallyhttp2: invalid Connection request header: %qhttp: Request.ContentLength=%d with nil Bodyunexpectedly found more than 1 record for %vretrieving next certificate in chain: %s: %wunsupported SOCKS5 authentication method: %ded25519: bad Ed25519ph message hash length: cipher: NewGCM requires 128-bit block cipherreflect: call of MakeFunc with non-Func typereflect: FieldByNameFunc of non-struct type reflect: funcLayout with interface receiver using value obtained using unexported fieldreflect: function created by MakeFunc using reflect: Value.SetIterKey called before Nextreflect: slice length out of range in SetLencrypto/sha512: invalid hash state identifierinsufficient data for calculated length typeencoding alphabet contains newline characterencoding alphabet includes duplicate symbolsError parsing Version Negotiation packet: %sactivating ECN failed for both IPv4 and IPv6http3: server didn't enable Extended CONNECThttp3: received pseudo header in trailer: %shttp3: failed to decode response headers: %wmultipart: expecting a new Part; got line %qmime: unexpected content after media subtypeurn:ietf:params:oauth:grant-type:device_codetemplate: multiple definition of template %qneed at least one digit after fraction pointyaml internal error: please report the issueneither tag nor implicit flags are specifiedmapping keys are not allowed in this contextdid not find expected digit or '.' characterdecoding failed: buffer too small (%d bytes)PTO timer in unexpected encryption level: %smax-age=31536000; includesubdomains; preloadoauth2: server response missing access_tokenquery: Values() expects struct input. Got %vmultiline basic string not terminated by """this should not be a top level node type: %s%s previously from: %q currently from: %qseed must be of length EncapsulationSeedSizex509: IP constraint contained invalid mask %xx509: certificate signed by unknown authorityhandleTransientAcquire called in invalid modehandleTransientRelease called in invalid modefinal release of handle without processStatustransitioning GC to the same state as before?produced a trigger greater than the heap goaltried to run scavenger from another goroutineruntime: failed mSpanList.remove span.npages=exitsyscall: syscall frame is no longer validunsafe.String: ptr is nil and len is not zerocannot send after transport endpoint shutdownrequires at least %d arg(s), only received %dsink factory already registered for scheme %qIgnored key-value pairs with non-string keys.context: internal error: missing cancel errorTLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256tls: internal error: unexpected renegotiationtls: no server certificates in client sessiontls: failed to find any PEM data in key inputjson.RawMessage: UnmarshalJSON on nil pointerhttp: putIdleConn: connection is in bad statehttp: no Client.Transport or DefaultTransportinvalid request :path %q from URL.Opaque = %qunbuffered done channel passed in for type %Thttp: multipart handled by ParseMultipartFormHTTP/1.1 %d %s%sUnsupported transfer encodingnet/http: internal error: connCount underflowclient tried to switch to invalid protocol %qcould not determine authoritative nameserverscertificate has no names; removing from cachecertificate expires soon; queuing for renewaloverride disables querying OCSP responder: %v[ERROR] TLS-ALPN challenge server: accept: %vinvalid url scheme, expecting https:// prefixzero length explicit tag was not an asn1.Flagmath/big: cannot unmarshal %q into a *big.Intcrypto/rsa: message too long for RSA key sizereflect: OverflowComplex of non-complex type reflect: nil type passed to Type.AssignableToreflect: internal error: invalid method indexparsing/packing of this section has completed%q shorthand is more than one ASCII characterbufio.Scanner: Read returned impossible countretired connection ID %d (highest issued: %d)Dropping packet with version %x. Expected %x.connection BUG: couldn't pack %s probe packetreceived HTTP/3 frame on bidirectional streamcrypto/blake2b: invalid hash state identifierno response matching the supplied certificatew must be at least 2 by the definition of NAFfloat integer part cannot have leading zeroesDisabling ECN. All testing packets were lost.AuthDecapsulate is not supported for this KEMAuthEncapsulate is not supported for this KEMExpected object value, got unknown token: %+vescape sequence is invalid Unicode code pointdetected mutation on the default bytes for %vdecode failure in lazy extension decoding: %v0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ $%*+-./:crypto/blake2s: invalid hash state identifierhttps://acme-v02.api.letsencrypt.org/directoryx509: failed to unmarshal elliptic curve pointx509: failed to parse rfc822Name constraint %qx509: malformed signature algorithm identifierx509: unknown curve while marshaling to PKCS#8x509: invalid elliptic curve private key valuehandlePersistentRelease called in invalid modeslice bounds out of range [:%x] with length %ypanicwrap: unexpected string after type name: memory reservation exceeds address space limittried to park scavenger from another goroutinereleased less than one physical page of memory (bad use of unsafe.Pointer? try -d=checkptr) sysGrow bounds not aligned to pallocChunkBytesruntime: failed to create new OS thread (have runtime: panic before malloc heap initialized stopTheWorld: not stopped (status != _Pgcstop)runtime: name offset base pointer out of rangeruntime: type offset base pointer out of rangeruntime: text offset base pointer out of rangeboth Setctty and Foreground set in SysProcAttrTime.UnmarshalJSON: input is not a JSON stringERROR: unexpected ShellCompDirective value: %dcan't register a sink factory for empty stringfirst path segment in URL cannot contain colon%v Unsafe CheckedEntry re-use near Entry %+v. PSSWithSHA256PSSWithSHA384PSSWithSHA512Ed25519tls: server chose an unconfigured cipher suitetls: failed to parse certificate from server: tls: server did not echo the legacy session IDtls: server accepted 0-RTT with the wrong ALPNtls: received new session ticket from a clientrequest Content-Type isn't multipart/form-dataGOAWAY close timer fired; closing conn from %vinternal error: cannot create stream with id 0http2: Transport creating client conn %p to %vprotocol error: received DATA after END_STREAMclient sent an HTTP request to an HTTPS servernet/http: internal error: misuse of tryDelivernet/http: too many 1xx informational responsesbackend tried to switch to invalid protocol %q%s: caching certificate after obtaining it: %vcould not find the start of authority for %s%stimed out waiting to obtain certificate for %sunexpected state: %s - order already finalizedbytes.Reader.UnreadByte: at beginning of slicebytes.Reader.UnreadRune: at beginning of slicemath/big: mismatched montgomery number lengthsed25519: internal error: setting scalar failedcipher.NewCTR: IV length must equal block sizereflect: nil type passed to Type.ConvertibleToreflect.Struct: fields with different PkgPath reflect.StructOf: illegal embedded field type returned value obtained from unexported fieldreflect: Value.SetIterValue called before Nextreflect: slice capacity out of range in SetCapreflect.Value.Slice: slice index out of boundsinvalid string being converted to Bytes: %s %scrypto/rand: prime size must be at least 2-bitOCSP response contains bad number of responsesdns: svcbipv4hint: expected ipv4, hint is ipv6dns: svcbipv6hint: expected ipv6, hint is ipv4edwards25519: invalid field element input sizemapping values are not allowed in this contextdid not find expected whitespace or line breaklwt bpf decode: failed parsing route attributeerror while reading transport parameter %d: %sTransport parameters changed. Rejecting 0-RTT.multiline literal string not terminated by '''google.golang.org/genproto/protobuf/field_maskUse bytes per second instead of bits per secondx509: malformed public key algorithm identifierx509: internal error: IP SAN %x failed to parse (temporarily override with GODEBUG=x509sha1=1)unexpected error wrapping poll.ErrFileClosing: slice bounds out of range [::%x] with length %yP has cached GC work at end of mark terminationfailed to acquire lock to start a GC transitionfinishGCTransition called without starting one?tried to sleep scavenger from another goroutineracy sudog adjustment due to parking on channelfunction symbol table not sorted by PC offset: attempted to trace a bad status for a goroutineattempting to link in too many shared librariescobra_annotation_bash_completion_subdirs_in_dirfirst record does not look like a TLS handshaketls: handshake did not verify certificate chaintls: incorrect renegotiation extension contentstls: server selected unadvertised ALPN protocoltls: internal error: pskBinders length mismatchtls: server selected TLS 1.3 in a renegotiationtls: malformed encrypted client hello extensiontls: server sent two HelloRetryRequest messageshttp: server gave HTTP response to HTTPS clientflow control update exceeds maximum window sizewr.done != nil for write100ContinueHeadersFrame1xx informational response with END_STREAM flagprotocol error: received DATA on a HEAD request[FrameWriteRequest stream=%d, ch=%v, writer=%v]missing config pointer (must use NewACMEIssuer)opening distributed challenge token file %s: %vunable to delete stale lockfile; deadlocked: %wtimed out waiting for certificate renewal of %sasn1: Unmarshal recipient value is non-pointer explicit string type given to non-string memberreflect.Value.Bytes of unaddressable byte arrayreflect: CallSlice with too few input argumentsregister-based return value has stack componentreflect.Value.Slice3: slice index out of boundsreflect.Value.UnsafeAddr of unaddressable valuebufio: reader returned negative count from Read^(\w+)\s*\(([^,]+)(?:,([^,]+))?(?:,([^,]+))?\)$Queueing packet (%d bytes) for later decryption:path, :authority and :method must not be emptychacha20poly1305: message authentication failedthe message the server sent us isn't a responsefloat decimal point must be preceded by a digitfloat decimal point must be followed by a digittoml: encoding a nil interface is not supportedfound a tab character that violates indentationAckFrame: ACK frame contains invalid ACK rangesCanceling loss detection timer. No PTO needed..Not doing 0-RTT. Has sealer: %t, has params: %tthe session ticket has more bytes than expectedinvalid string length %d: exceeds input size %dmap field %v cannot be set with read-only valuex509: X25519 key encoded with illegal parametersx509: SAN uniformResourceIdentifier is malformedx509: IP constraint contained value of length %dx509: internal error: cannot parse constraint %qx509: internal error: URI SAN %q failed to parsex509: only RSA, ECDSA and Ed25519 keys supportedx509: only CAs are allowed to specify MaxPathLenx509: failed to serialise extensions attribute: slice bounds out of range [:%x] with capacity %yruntime: cannot map pages in arena address spaceruntime: malformed profBuf buffer - invalid sizeattempt to trace invalid or unsupported P statusstrconv: illegal AppendFloat/FormatFloat bitSizenot enough significant bits after mult64bitPow10group id '%s' is not defined for subcommand '%s'tls: CloseWrite called before handshake completeunable to generate random session ticket key: %vfailed to parse certificate #%d in the chain: %wtls: no supported symmetric ciphersuites for ECHtls: CurvePreferences includes unsupported curvetls: Config MinVersion must be at least TLS 1.13internal error: should have a body in this statenet/http: Hijack called after ServeHTTP finishedcertificate appears to have been renewed already[ERROR] TLS-ALPN challenge server: handshake: %vcould not decode the response from name.com: %wserver set unrecognized authorization status: %sretrieving alternate certificate chain at %s: %w%-8s %-12s %12s %8s %12s %12s %12s %12s %-16s %sInt.GobDecode: encoding version %d not supportedcrypto/rsa: input must be hashed with given hashout points to big.Int, but defaultValue does notreflect: CallSlice with too many input argumentsparsing/packing of this type isn't available yetinvalid string being converted to IP address: %s'%s' needs a map with string keys, has '%s' keysbufio: writer returned negative count from Writelength of packet (%d) < virtioNetHdr.hdrLen (%d)connection BUG: unspecified error type (msg: %s)cannote remove connection, connection is unknownTracking %d connection IDs and %d reset tokens. Activating reading of packet info bits for IPv4.Activating reading of packet info bits for IPv6.peer tried to open stream %d (current limit: %d)additional HEADERS frame received after trailersmalformed SRV value; expected: ' 'dates are expected to have the format YYYY-MM-DDextra characters at the end of a local date timetoml: negative number %d does not fit in an uintreceived %d bytes on stream %d, allowed %d byteserror while trying to parse list within list: %sinvalid Mutable on field with non-composite typefield %v has invalid type: got %v, want map kindlist field %v cannot be set with read-only valueinvalid status code (must be 200-599, except 233)/etc/pki/ca-trust/extracted/pem/tls-ca-bundle.pemx509: invalid RDNSequence: invalid attribute typex509: Ed25519 key encoded with illegal parametersx509: private key contains zero or negative valuex509: private key contains zero or negative primex509: signature returned by signer is invalid: %wthe :: must expand to at least one field of zerosslice bounds out of range [::%x] with capacity %yinvalid memory address or nil pointer dereferencepanicwrap: unexpected string after package name: s.allocCount != s.nelems && freeIndex == s.nelemsruntime.reflect_makemap: unsupported map key typesweeper left outstanding across sweep generationsfully empty unfreed span set block found in resetcasgstatus: waiting for Gwaiting but is Grunnablenot enough significant bits after mult128bitPow10strings.Reader.UnreadByte: at beginning of stringstrings.Reader.UnreadRune: at beginning of stringstrings.Reader.WriteTo: invalid WriteString countinvalid or incomplete multibyte or wide character# bash completion for %-36s -*- shell-script -*- # fish completion for %-36s -*- shell-script -*- crypto/tls: ExportKeyingMaterial context too longtls: server advertised unrequested ALPN extensiontls: server sent a cookie in a normal ServerHellotls: client offered only unsupported versions: %xtls: client using inappropriate protocol fallbacktls: client illegally modified second ClientHellohttp2: request body closed due to handler exitinghttp: wrote more than the declared Content-Length (Client.Timeout exceeded while awaiting headers)http: partitioned cookies must be set with Secureunexpected Peek failure reading buffered byte: %vnet/http: Transport.Dial hook returned (nil, nil)%s: reloading renewed certificate into memory: %vrenewing certificate aborted by event handler: %wdecoding challenge token file %s (corrupted?): %vfailed to decode PEM block containing private keynot configured for on-demand certificate issuancesubject name does not qualify for certificate: %scould not remove compromised private key from useecdsa: internal error: truncated hash is too longcrypto/elliptic: internal error: invalid encodingreflect.Value.Slice: slice of unaddressable arrayputPacketBuffer called with packet of wrong size!Dropping long header packet of type %s (%d bytes)Activating reading of ECN bits for IPv4 and IPv6.error parsing connection ID on packet from %s: %stried to delete incoming stream %d multiple timeshttp3: invalid duplicate use of SendRequestHeaderhttp3: expected first frame to be a HEADERS framechacha20poly1305: bad nonce length passed to Sealchacha20poly1305: bad nonce length passed to Opendatetime separator is expected to be T or a spacetoml: negative number %d does not fit in an uint8lwt bpf decode: failed parsing attribute. err: %vclient sent an original_destination_connection_idVersion Negotiation packet has empty version listDisabling ECN. ECN counts decreased unexpectedly.received packet with unknown encryption level: %sPeer doesn't await address validation any longer.Congestion limited: bytes in flight %d, window %dexpected character %c but the document ended heresubslice address (%d) is before data address (%d)gob: registering duplicate types for %q: %s != %sgob: registering duplicate names for %s: %q != %qhttps://api.zerossl.com/acme/eab-credentials-emailx509: missing ASN.1 contents; use ParseCertificatex509: invalid RDNSequence: invalid attribute valuex509: RSA public exponent is not a positive numberx509: unknown key type while marshaling PKCS#8: %Tcryptobyte: attempted write while child is pendingmallocgc called with gcphase == _GCmarkterminationrecursive call during initialization - linker skewattempt to execute system stack code on user stackcobra_annotation_bash_completion_one_required_flagtls: received unexpected CertificateStatus messagetls: invalid signature by the server certificate: tls: invalid signature by the client certificate: tls: client offered TLS version older than TLS 1.3net/http: cannot rewind body after connection losshttp: putIdleConn: CloseIdleConnections was calledgot CONTINUATION for stream %d; expected stream %dhttp: suspiciously long trailer after chunked bodynet/http: Transport failed to read from server: %vnet/http: HTTP/1.x transport connection broken: %wobtaining certificate aborted by event handler: %wunknown key type; only RSA and ECDSA are supportedinvalid hijack address (must be an IP address): %scrypto/elliptic: nistec rejected normalized scalarcrypto/cipher: incorrect nonce length given to GCMreflect.Value.Slice3: slice of unaddressable array%s has arguments but cannot be invoked as functionfunction %s has %d return values; should be 1 or 2Not adding connection ID %s, as it already exists.http3: HEADERS frame too large: %d bytes (max: %d)chacha20: SetCounter attempted to rollback counterdns: svcbport: port length is not exactly 2 octetsoauth2: token expired and refresh token is not setedwards25519: invalid SetUniformBytes input lengthcannot add shadow to auto-increment or boolean keytoml: negative number %d does not fit in an uint64toml: negative number %d does not fit in an uint32toml: negative number %d does not fit in an uint16^[-+]?[0-9][0-9_]*(?::[0-5]?[0-9])+(?:\.[0-9_]*)?$ACK rate: %.2f (total=%d, ack=%d, loss=%d, rtt=%d)initial_max_streams_uni too large: %d (maximum %d)unknown transport parameter marshaling version: %d Queuing ACK because the packet was ECN-CE marked.received an ACK for skipped packet number: %d (%s)LogValue called too many times on Value of type %Treflect.Value read-only flag has changed semanticsexpected: IDENT | STRING | ASSIGN | LBRACE got: %serror while trying to parse object within list: %sslice offset (%d) is farther than data length (%d)invalid uint data length %d: exceeds input size %dgoogle.golang.org/genproto/protobuf/source_contextinvalid Mutable on map with non-message value typefield %v has invalid type: got %v, want slice kindcache must have GetConfigForCert set in its optionsx509: certificate has expired or is not yet valid: ScanState's Read should not be called. Use ReadRunelimiterEvent.stop: invalid limiter event type foundpotentially overlapping in-use allocations detectedfatal: systemstack called from unexpected goroutinequery parameters not allowed with file URLs: got %vtls: VerifyHostname called on TLS server connectioncrypto/tls: reserved ExportKeyingMaterial label: %stls: server's identity changed during renegotiationtls: server selected unsupported compression formattls: server sent an unexpected early_data extensiontls: client did not request an application protocolJSON decoder out of sync - data changing underfoot?http2: invalid Transfer-Encoding request header: %qprotocol error: received %T before a SETTINGS frameloading managed certificate for %v from storage: %vgot nil TLS-ALPN challenge certificate but no errorunable to forcefully get new certificate for %v: %wcould not encode the form data for the request: %wcrypto/ecdh: internal error: isLess input too largecrypto/elliptic: Add was called on an invalid pointgodebug: Value of name not listed in godebugs.All: '%s': source data must be an array or slice, got %sdefault type does not match variable type: %v != %vIgnoring Retry, since we already received a packet.Ignoring Retry, since a Retry was already received.HTTP Datagrams enabled, but QUIC Datagrams disabledauthz %s has unexpected status; order will fail: %sreadPythonMultilines: failed to peek with error: %vline %d: mapping key %#v already defined at line %dlwt bpf decode: received unknown attribute type: %dinitial_max_streams_bidi too large: %d (maximum %d) Queueing ACK because packet %d was missing before.expected = after a key, but the document ends thereslice ends (%d+%d) is farther than data length (%d)invalid AppendMutable on list with non-message typeextension %v extends %v outside the extension rangefield %v has invalid type: got %v, want struct kindfield %v has invalid type: %v does not implement %vunicode code point U+E123 reserved for internal usex509: cannot verify signature: insecure algorithm %verrors: *target must be interface or implement errormallocgc called without a P or outside bootstrappingruntime: cannot disable permissions in address spaceruntime.SetFinalizer: pointer not in allocated blockruntime: use of FixAlloc_Alloc before FixAlloc_Init span set block with unpopped elements found in resetcasfrom_Gscanstatus: gp->status is not in scan statecobra_annotation_bash_completion_filename_extensionsRegisterFlagCompletionFunc: flag '%s' does not existuser and password not allowed with file URLs: got %vtls: server selected unsupported protocol version %xtls: received a session ticket with invalid lifetimetls: internal error: session ticket keys unavailabletls: private key type does not match public key type request header "TE" may only be "trailers" in HTTP/2http2: Transport readFrame error on conn %p: (%T) %vprotocol error: received DATA before a HEADERS framedid not find chain matching preferences; using firstdeleting temporary record for name %q in zone %q: %wrequest to delete the record was not successful: %wrequest to update the record was not successful: %wecdsa: internal error: unexpectedly masking off bitscrypto/rsa: PSSOptions.SaltLength cannot be negativewrong number of args for %s: want at least %d got %dwrong number of args for %s: got %d want at least %dGot UserPassNegotiationRequest: %#v %#v %#v %#v %#v Ignoring spoofed Retry. Integrity Tag doesn't match.Removing connection ID %s after it has been retired.Activating reading of packet info for IPv4 and IPv6.activating packet info failed for both IPv4 and IPv6:path must be empty and :authority must not be emptyhttp3: invalid http header field value %q for key %vdownloading certificate chain from %s: %w (order=%s)successfully downloaded available certificate chainsinternal error: missing handler for resolver table: source and destination ip are not the same IP familyinvalid value for max_ack_delay: %dms (maximum %dms) setting loss timer for packet %d (%s) to %s (in %s)Starting key drop timer to drop key phase %d (in %s)unexpected character 'i' while scanning for a numberunexpected character 'n' while scanning for a numberprototext: error parsing unknown field wire type: %vfailed to connect (server may not support speed test)x509: certificate specifies an incompatible key usagenon-concurrent sweep failed to drain all sweep queuesexited a goroutine internally locked to the OS threadtls: unable to generate random session ticket key: %vtls: received unexpected handshake message of type %Ttls: unexpected server_name extension in server hellotls: client does not support uncompressed connectionstls: HKDF-Expand-Label invocation failed unexpectedlytls: failed to find any PEM data in certificate inputhttp: putIdleConn: too many idle connections for hosthttp2: Framer %p: failed to decode just-written frameillegal use of AllowIllegalReads with ReadMetaHeadershttp2: Transport failed to get client conn for %s: %vnon-CONNECT pattern with unclean path can never matchdescribeConflict called with non-conflicting patternsnet/http: CloseNotify called after ServeHTTP finishedsubject does not qualify for a public certificate: %sfound preferred certificate chain by root common namefound unknown private key type in PKCS#8 wrapping: %Tgetting certificate from external certificate managerforcefully renewing certificate due to REVOKED statusHTTP %d: JSON-decoding problem details: %w (raw='%s')pem: cannot encode a header key that contains a colonmath/big: internal error: cannot find (D/n) = -1 for crypto/ecdh: internal error: mismatched isLess inputscrypto/elliptic: attempted operation on invalid pointreflect: non-interface type passed to Type.Implementsreflect.Value.Slice: string slice index out of boundssync/atomic: compare and swap of nil value into Valuebufio.Scan: too many empty tokens without progressingSent UserNameNegotiationRequest: %#v %#v %#v %#v %#v <- Reading packet %d (%d bytes) for connection %s, %sserver sent reduced limits after accepting 0-RTT data-> Sending packet %d (%d bytes) for connection %s, %sreceived crypto data after change of encryption levelDiscarding received DATAGRAM frame (%d bytes payload)Adding connection IDs %s and %s for a new connection.wire.PutStreamFrame called with packet of wrong size!received a packet with an unexpected connection ID %s^[-+]?(\.[0-9]+|[0-9]+(\.[0-9]*)?)([eE][-+]?[0-9]+)?$did not find expected alphabetic or numeric character %s &wire.RetireConnectionIDFrame{SequenceNumber: %d}invalid value for ack_delay_exponent: %d (maximum %d)Canceling loss detection timer. No packets in flight.script-src 'none'; object-src 'none'; base-uri 'none'chacha20: internal error: wrong dst and/or src lengthinvalid GOLANG_PROTOBUF_REGISTRATION_CONFLICT value: unkown field number %d while unmarshalling GoFeaturesunkown field number %d while unmarshalling FeatureSethaving only HTTP server without HTTPS is not supportedx509: cannot verify signature: algorithm unimplementedx509: invalid RDNSequence: invalid attribute value: %sURI with IP (%q) cannot be matched against constraintscryptobyte: Builder is exceeding its fixed-size bufferfmt: scanning called UnreadRune with no rune available, square brackets can only be used with IPv6 addresses, IPv6 addresses must be surrounded by square bracketsmin size of malloc header is not a size class boundarygcControllerState.findRunnable: blackening not enabledcasGToWaitingForGC with non-isWaitingForGC wait reasonno goroutines (main called runtime.Goexit) - deadlock!trace: non-empty full trace buffer for done generationtrace: non-empty full trace buffer for next generation goroutine running on other thread; stack unavailable certificate is not valid for requested server name: %wtls: server resumed a session with a different versiontls: server accepted 0-RTT with the wrong cipher suitetls: server sent ECH retry configs after accepting ECHtls: certificate used with invalid signature algorithmtls: client indicated early data in second ClientHellotls: failed to create cipher while encrypting ticket: tls: found unknown private key type in PKCS#8 wrappinghttp: Request.Write on Request with no Host or URL setread loop ending; caller owns writable underlying conninternal error: expected to be already writing a framehttp2: received GOAWAY %+v, starting graceful shutdownhttp2: handler wrote more than declared Content-Lengthtarget must be an absolute URL or an absolute path: %qnet/http: can't write control character in Request.URLhttputil: ReverseProxy read error during body copy: %vhttps://acme-staging-v02.api.letsencrypt.org/directoryno matching certificates and no custom selection logicremoved certificate's compromised private key from usebytes.Buffer: reader returned negative count from Readcrypto/elliptic: Double was called on an invalid pointreflect: Value.SetIterKey called on exhausted iteratorname is not in canonical format (it must end with a .)panic calling String method on zero %v for flag %s: %vbinary.Write: some values are not fixed-sized in type virtioNetHdr.hdrLen (%d) < virtioNetHdr.csumStart (%d)end of checksum offset (%d) exceeds packet length (%d)expected first connection ID to have sequence number 0error parsing packet, couldn't parse connection ID: %sexpected retry_source_connection_id to equal %s, is %sClient offered version %s, sending Version Negotiationinvalid value for SETTINGS_ENABLE_CONNECT_PROTOCOL: %dreceived pseudo header %s after a regular header fieldquic: HKDF-Expand-Label invocation failed unexpectedlytoml: cannot decode TOML %s into a Go value of type %stag handle must contain alphanumerical characters onlyexplicitly tagged !!binary data must be base64-encodedblock sequence entries are not allowed in this contextoption ,inline needs a map with string keys in struct Not enough samples (total=%d, ack=%d, loss=%d, rtt=%d) %s &wire.MaxStreamsFrame{Type: uni, MaxStreamNum: %d}Canceling loss detection timer. Amplification limited.received %d bytes for the connection, allowed %d bytesAccepting 0-RTT. Restoring RTT from session ticket: %squotedprintable: invalid unescaped byte 0x%02x in bodyfield %v has invalid type: got %v, want interface kindpacked public key must be of mode3.PublicKeySize bytespacked public key must be of mode2.PublicKeySize bytesx509: authority info access incorrectly marked criticalx509: too many intermediates for path length constraintx509: failed to load system roots and no roots providedeach colon-separated field must have at least one digitos: invalid use of WriteAt on file opened with O_APPENDmheap.freeSpanLocked - invalid free of user arena chunkcasfrom_Gscanstatus:top gp->status is not in scan statetls: internal error: handshake should have had a resulttls: no ECDHE curve supported by both client and servernet/http: request canceled while waiting for connectionnet/http: invalid byte %q in %s; dropping invalid byteshttp2: server: error reading preface from client %v: %vinternal error: can only be writing one frame at a timehttp2: Transport received GOAWAY from server ErrCode:%vfound preferred certificate chain by issuer common name[WARNING] Unable to delete invalid OCSP staple file: %vcould not start listener for challenge server at %s: %vcould not get records: Domain: %s; Status: %v; Body: %smust set at least one of Certificates or GetCertificatecrypto/rsa: GenerateMultiPrimeKey: nprimes must be >= 2cipher.NewCBCEncrypter: IV length must equal block sizecipher.NewCBCDecrypter: IV length must equal block sizereflect: internal error: invalid use of makeMethodValuereflect.FuncOf: last arg of variadic func must be sliceunable to cast %#v of type %T to map[string]interface{}cannot assign type '%s' to map value field of type '%s'bufio.Scanner: SplitFunc returns negative advance countSending a keep-alive PING to keep the connection alive.dns: svcbmandatory: value length is not a multiple of 2edwards25519: invalid SetBytesWithClamping input lengtherror when getting key of section %q: key %q not existstimes are expected to have the format HH:MM:SS[.NNNNNN]number must have at least one digit between underscoresmap merge requires map or sequence of maps as the valuealias value must contain alphanumerical characters only %s &wire.MaxStreamsFrame{Type: bidi, MaxStreamNum: %d}expected preferred_address to be %d long, read %d byteserror parsing list, expected comma or list end, got: %sDecodeSEG6Srh: error parsing Segment List (buf len: %d)extension number %d is already registered on message %vindent may only be composed of space and tab charactersstrings: illegal use of non-zero Builder copied by valuex509: subject key identifier incorrectly marked criticalx509: internal error: empty chain when appending CA certrange function continued iteration after loop body panicrange function continued iteration after whole loop exitprofilealloc called without a P or outside bootstrappingin gcMark expecting to see gcphase as _GCmarkterminationruntime: netpoll: eventfd ready for something unexpectedRegisterFlagCompletionFunc: flag '%s' already registeredfile URLs must leave host empty or use localhost: got %vtls: no cipher suite supported by both client and servertls: TLS 1.3 client supports illegal compression methodstls: client sent key share for group it does not supporttls: SendSessionTicket called before handshake completedptrEncoder.encode should have emptied ptrSeen via defershttp2: request body larger than specified content lengthhttp2: response header list larger than advertised limithttp: Request.RequestURI can't be set in client requestspromised request headers cannot include pseudo header %qnet/http: Transport.DialContext hook returned (nil, nil)b4050a850c04b3abf54132565044b0b7d7bfd8ba270b39432355ffb4b70e0cbd6bb4bf7f321390b94a03c1d356c21122343280d6115c1d21bd376388b5f723fb4c22dfe6cd4375a05a07476444d5819985007e34non-empty pointer map passed for non-pointer-size valuesreflect: Value.SetIterValue called on exhausted iteratorrecord on line %d; parse error on line %d, column %d: %v<- Reading packet %d (%d bytes) for connection %s, 1-RTTexpected initial_source_connection_id to equal %s, is %sSTREAM frames are handled with their respective streams.Conn has send buffer of %d kiB (wanted: at least %d kiB)mlkem768: internal error: invalid decapsulation key sizecannot add nested value to auto-increment or boolean keytoml: not encoding uint (%d) greater than max int64 (%d)attempted to go past the end of stream; corrupted value?anchor value must contain alphanumerical characters onlyoption ,inline may only be used on a struct or map field %s &wire.StreamsBlockedFrame{Type: uni, MaxStreams: %d}StreamFrame: attempting to write empty frame without FINremaining length (%d) smaller than parameter length (%d)wrong length for stateless_reset_token: %d (expected 16)TransportParameter BUG: transport parameter %d not foundhttps://protobuf.dev/reference/go/faq#namespace-conflictpacked private key must be of mode3.PrivateKeySize bytespacked private key must be of mode2.PrivateKeySize bytesa powerful, lightning fast and censorship resistant proxyAperture Internet Laboratory x509: failed to parse EC private key embedded in PKCS#8: runtime: checkmarks found unexpected unmarked object obj=runtime: failed to disable profiling timer; timer_delete(non-Go code set up signal handler without SA_ONSTACK flagtls: Ed25519 public keys are not supported before TLS 1.2received record with version %x when expecting version %xtls: server sent an unnecessary HelloRetryRequest messagetls: server selected an invalid PSK and cipher suite pairbackend tried to switch protocol %q when %q was requestedloading existing private key for reuse with issuer %s: %vsync: WaitGroup misuse: Add called concurrently with Waitcan't handle assignment of %s to empty interface argumentcannot run executable found relative to current directory (set GODEBUG=execwait=2 to capture stacks for debugging)lwt bpf encode: bpf obj definitions returned empty buffercongestion BUG: decreased max datagram size from %d to %d %s &wire.StreamsBlockedFrame{Type: bidi, MaxStreams: %d}invalid value for max_udp_payload_size: %d (minimum 1200)Max outstanding limited: tracking %d packets, maximum: %dDecodeSEG6Encap: error parsing Segment List (buf len: %d)unkown field number %d while unmarshalling EditionDefaultx509: authority key identifier incorrectly marked criticalx509: certificate contains duplicate extension with OID %qx509: failed to parse RSA private key embedded in PKCS#8: x509: provided PrivateKey doesn't match parent's PublicKeyDNS response contained records which contain invalid names"help" flag declared as non-bool. Please correct your codeGenerate the autocompletion script for the specified shelltls: server changed cipher suite after a HelloRetryRequestjson: cannot set embedded pointer to unexported struct: %vcannot push URL with scheme %q from request with scheme %qhttp2: client connection force closed via ClientConn.Closecache must be initialized with a GetConfigForCert callbackno information found to solve challenge for identifier: %sno matching certificate; will choose from all certificatescrypto/ecdh: internal error: converting the wrong key typecrypto/ecdh: bad X25519 remote ECDH input: low order pointcrypto/elliptic: ScalarMult was called on an invalid pointsync/atomic: swap of inconsistently typed value into Valuereceived conflicting connection IDs for sequence number %dreceived CRYPTO frame with unexpected encryption level: %sdns: svcbnodefaultalpn: no-default-alpn must have no valueGODEBUG=execwait=2 detected a leaked exec.Cmd created by: inline table cannot contain nested tables, only key-valuesfailed to ParseRouteAttr for IFLA_MACVLAN_MACADDR_DATA: %vreceived ACK for key phase %d, but peer didn't update keysgob: cannot encode nil pointer of type %s inside interfaceThis should only happen 1 in 2^{128}: something is wrong.runtime: mmap: too much locked memory (check 'ulimit -l'). tried to trace goroutine with invalid or unsupported statustls: server resumed a session with a different cipher suitetls: server selected TLS 1.3 using the legacy version fieldtls: server sent an unnecessary HelloRetryRequest key_sharetls: client didn't send one key share in second ClientHellotls: client sent unexpected key share in second ClientHellohttp2: Transport received Server's graceful shutdown GOAWAYRoundTripper returned a response & error; ignoring responsehttp: superfluous response.WriteHeader call from %s (%s:%d)http: response.Write on hijacked connection from %s (%s:%d)unsupported scheme for HTTP proxy (use http:// or https://)sync: WaitGroup is reused before previous Wait has returnedcrypto/ecdh: private key and public key curves do not matchreflect: reflect.Value.Elem on an invalid notinheap pointerreflect: indirection through nil pointer to embedded structsync/atomic: store of inconsistently typed value into Valuebufio.Scanner: SplitFunc returns advance count beyond inputneed one more IPv4 address in first prefix for system stackneed one more IPv6 address in first prefix for system stackRejecting new connection due to GetConfigForClient callbackConn has receive buffer of %d kiB (wanted: at least %d kiB)tried to send an ECN-marked packet although ECN is disabledhpke: mandatory-to-implement cipher suite not supported: %stoml: decoding can only be performed into a pointer, not %stoml: cannot convert map key of type %s to expected type %sRetire Prior To value (%d) larger than Sequence Number (%d)key '%s' expected start of object ('{') or assignment ('=')Generate a hysteria2:// URI from a client config for sharingmanual span allocation called with non-manually-managed typeaddr range base and limit are not in the same memory segmentruntime: failed to configure profiling timer; timer_settime(runtime: malformed profBuf buffer - tag and data out of synctls: no supported versions satisfy MinVersion and MaxVersiontls: initial handshake had non-empty renegotiation extensiontls: server resumed a session with a different EMS extensiontls: client requested unsupported application protocols (%s) (Client.Timeout or context cancellation while reading body)internal error: attempt to send frame on a closed stream: %vmalformed response from server: missing status pseudo headernet/http: server response headers exceeded %d bytes; abortedfailed storage check: %v - storage is probably misconfiguredexternal certificate manager: %s: filling cert from leaf: %vbytes.Reader.UnreadRune: previous operation was not ReadRunecrypto/elliptic: CombinedMult was called on an invalid pointreflect: call of reflect.Value.Cap on ptr to non-array Valuereflect: call of reflect.Value.Len on ptr to non-array Valuesync/atomic: compare and swap of inconsistently typed valuesBUG: readPosInFrame (%d) > frame.DataLen (%d) in stream.Readfound a tab character where an indentation space is expectedinvalid value for active_connection_id_limit: %d (minimum 2) Queuing ACK because there's a new missing packet to report.Loss detection alarm fired in loss timer mode. Loss time: %sLoss detection alarm for %s fired in PTO mode. PTO count: %dCryptoSetup: keys at this encryption level not yet availablestart pointer address (%d) is after end pointer address (%d)failed getting ZeroSSL EAB credentials: HTTP %d: %s (code %d)x509: failed to parse URI constraint %q: cannot be IP addressgo package net: GODEBUG setting forcing use of Go's resolver runtime: may need to increase max user processes (ulimit -u) abiRegArgsType needs GC Prog, update methodValueCallFrameObjs"version" flag declared as non-bool. Please correct your codeto request completion choices for the specified command-line.tls: unsupported certificate: private key is %T, expected *%Ttls: EncryptedClientHelloConfigList contains no valid configstls: server sent a ServerHello extension forbidden in TLS 1.3tls: client certificate used with invalid signature algorithmnet/http: invalid Cookie.Domain %q; dropping domain attributeReverseProxy must have exactly one of Director or Rewrite setreflect: wrong return count from function created by MakeFuncReceived a Version Negotiation packet. Supported Versions: %sSending stateless reset to %s (connection ID: %s). Token: %#xexec: Cmd started a Process but leaked without a call to Waitinvalid base '%c', should have been checked by scanIntOrFloatinternal error: unexpected tail comment event (please report)lwt bpf decode: received unknown attribute: type: %d, len: %dIncreasing receive flow control window for stream %d to %d kBpacked public key must be of eddilithium4.PublicKeySize bytespacked public key must be of eddilithium2.PublicKeySize bytesx509: failed to marshal EC private key while building PKCS#8: x509: certificate is not authorized to sign other certificatesURI with empty host (%q) cannot be matched against constraintsx509: certificate private key does not implement crypto.Signerfound bad pointer in Go heap (incorrect use of unsafe or cgo?)limiterEvent.stop: found wrong event in p's limiter event slotslice length too short to convert to array or pointer to arrayruntime: internal error: misuse of lockOSThread/unlockOSThreadstrings.Reader.UnreadRune: previous operation was not ReadRunetls: server did not send a quic_transport_parameters extensiontls: client used the legacy version field to negotiate TLS 1.3tls: client did not send a quic_transport_parameters extensiontls: certificate cannot be used with the selected cipher suitehttp2: request header list larger than peer's advertised limittrying to put back buffer of the wrong size in the copyBufPoolno configuration associated with certificate; unable to manage0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZreflect.ArrayOf: array size would exceed virtual address spacereflect: reflect.Value.Pointer on an invalid notinheap pointerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789expected original_destination_connection_id to equal %s, is %sDropping packet from %s (%d bytes). Server receive queue full.Received a stateless reset with token %#x. Closing connection.the message the server sent is empty, incomplete, or corruptedtoml: cannot decode TOML %s into struct field %s.%s of type %scannot have key %q in inlined map: conflicts with struct fieldgateway, source, and destination ip are not the same IP familywrong length for disable_active_migration: %d (expected empty) Queueing ACK because the first packet should be acknowledged.AuthEncapsulateDeterministically is not supported for this KEMmalformed GOMEMLIMIT; see `go doc runtime/debug.SetMemoryLimit`Request shell completion choices for the specified command-linehttp2: push would exceed peer's SETTINGS_MAX_CONCURRENT_STREAMSrequest declared a Content-Length of %d but only wrote %d bytes

HTTP Error 431

Request Header Field(s) Too Large

internal error: exactly one of res or err should be set; nil=%vcryptobyte: BuilderContinuation reallocated a fixed-size bufferreceived invalid offset %d on crypto stream, maximum allowed %dPacketPacker BUG: packet too large (%d bytes, allowed %d bytes)dns: internal error: unpack should never be called on RR_Headergave up after %d attempts, last error unavailable (resp == nil)parser should not permit expression of kind %s at document rootnew destination and destination are not the same address familypacked private key must be of eddilithium4.PrivateKeySize bytespacked private key must be of eddilithium2.PrivateKeySize bytesruntime.SetFinalizer: first argument was allocated into an arenaattempted to trace stack of a goroutine this thread does not own0000000000000000000000000000000000000000000000000000000000000000 tls: certificate private key does not implement crypto.Decrypterjson: invalid number literal, trying to unmarshal %q into Numberhttp: request method or response status code does not allow bodyhttp2: too many control frames in send queue, closing connection Content-Type: text/plain; charset=utf-8 Connection: close suppressing panic for copyResponse error in test; copy error: %vcan't switch protocols using non-Hijacker ResponseWriter type %Terror while checking if stored certificate is also expiring soon5ac635d8aa3a93e7b3ebbd55769886bc651d06b0cc53b0f63bce3c3e27d2604b6b17d1f2e12c4247f8bce6e563a440f277037d812deb33a0f4a13945d898c2964fe342e2fe1a7f9b8ee7eb4a7c0f9e162bce33576b315ececbb6406837bf51f5reflect.StructOf: struct size would exceed virtual address spaceABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_shouldn't queue undecryptable packets after handshake completionClient sent an invalid retry token. Sending INVALID_TOKEN to %s.failed to increase send buffer size (wanted: %d kiB, got %d kiB)class must be IN (Internet) (or ANYCLASS (*), which includes IN). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . readPythonMultilines: failed to skip to the end, returning errorRestoring of transport parameters from session ticket failed: %sunmarshaling transport parameters from session ticket failed: %sDropping key phase %d ahead of scheduled time. Drop time was: %sextension %v has mismatching containing message: got %v, want %vx509: inner and outer signature algorithm identifiers don't matchx509: issuer name does not match subject from issuing certificatex509: certificate request contains duplicate requested extensionsuser arena chunk size is not a multiple of the physical page sizeruntime.SetFinalizer: pointer not at beginning of allocated blocktls: internal error: attempted to read record with QUIC transporttls: server selected an invalid version after a HelloRetryRequesttls: session supported extended_master_secret but client does nothttp: response.WriteHeader on hijacked connection from %s (%s:%d)net/http: Transport.DialTLS or DialTLSContext returned (nil, nil)crypto/rsa: too few primes of given length to generate an RSA keycryptobyte: pending child length %d exceeds %d-byte length prefixreflect: StructOf does not support methods of embedded interfaces'%s' expected type '%s', got unconvertible type '%s', value: '%v'Received first packet. Switching destination connection ID to: %sencryption level changed, but crypto stream has more data to readextended CONNECT: :scheme, :path and :authority must not be emptynistec: internal error: p224Table called with out-of-bounds valuenistec: internal error: p256Table called with out-of-bounds valuenistec: internal error: p384Table called with out-of-bounds valuenistec: internal error: p521Table called with out-of-bounds value %s &wire.MaxStreamDataFrame{StreamID: %d, MaximumStreamData: %d}x509: certificate is not valid for any names, but wanted to match x509: requested SignatureAlgorithm does not match private key typeruntime: unexpected error while checking standard file descriptor tls: certificate private key (%T) does not implement crypto.Signerclient doesn't support ECDHE, can only use legacy RSA key exchangetls: server sent an unexpected quic_transport_parameters extensiontls: client sent an unexpected quic_transport_parameters extensionsender tried to send more than declared Content-Length of %d bytesunable to get configuration to manage certificate; unable to renewcryptobyte: high-tag number identifier octects not supported: 0x%xreflect: indirection through nil pointer to embedded struct field Got Datagram. data: %#v %#v %#v %#v %#v %#v datagram address: %#v received conflicting stateless reset tokens for sequence number %dParsed a coalesced packet. Part %d: %d bytes. Remaining: %d bytes.Dropping %s packet (%d bytes) because we already dropped the keys.-> Sending packet %d (%d bytes) for connection %s, 1-RTT (ECN: %s)-> Sending coalesced packet (%d parts, %d bytes) for connection %sfailed to parse version for sending version negotiation packet: %scan only use a single QUIC version for dialing a HTTP/3 connectionskipping challenge initiation because authorization is not pendinginternal error: attempted to parse unknown event (please report): Increasing receive flow control window for the connection to %d kBtoml: key %s already exists as a %s, but should be an array tableDescriptor.Options called without importing the descriptor packagex509: internal error: supported public key does not implement EqualHelp provides help for any command in the application. Simply type tls: server sent certificate containing RSA key larger than %d bitstls: client sent certificate containing RSA key larger than %d bitscannot make valid ACMEIssuer without an associated CertMagic configcannot make a valid config without a pointer to a certificate cacheReceived %d packets after sending CONNECTION_CLOSE. Retransmitting.Dropping %s packet (%d bytes) that could not be unpacked. Error: %sfailed to increase receive buffer size (wanted: %d kiB, got %d kiB)no compatible QUIC version found (we support %s, server offered %s)inconsistent transport parameter length for transport parameter %#xinvalid logger type passed, must be Logger or LeveledLogger, was %Tfield %v with invalid Mutable call on field with non-composite typeif non-empty, httptest.NewServer serves on this address and blocks.go package net: cgo resolver not supported; using Go's DNS resolver embedded IPv4 address must replace the final 2 fields of the addressAllThreadsSyscall6 results differ between threads; runtime corruptedFailed to find flag %q and mark it as being required in a flag grouptls: internal error: sending non-handshake message to QUIC transportpadding bytes must all be zeros unless AllowIllegalWrites is enabledhttp2: Transport conn %p received error from processing frame %v: %vhttp2: Transport received unsolicited DATA frame; closing connectionhttp: message cannot contain multiple Content-Length headers; got %qcertificate does not need to be renewed, but renewal is being forced[ERROR] TLS-ALPN challenge server: expected tls.Conn but got %T: %#vbig: invalid 2nd argument to Int.Jacobi: need odd integer but got %s2695994666715063979466701508701963067355791626002630814351006629888126959946667150639794667015087019625940457807714424391721682722368061reflect: reflect.Value.UnsafePointer on an invalid notinheap pointercan not look up shorthand which is more than one ASCII character: %qreceived retry_source_connection_id, although no Retry was performedReplacing connection for connection IDs %s with a closed connection.Dropping a packet that is too small to be a valid Initial (%d bytes)crypto/hmac: hash generation function does not produce unique valuesstrict mode: fields in the document are missing in the target structexpected SCALAR, SEQUENCE-START, MAPPING-START, or ALIAS, but got %vVersion Negotiation packet has a version list with an invalid lengthinvalid descriptor: using edition features in a proto with syntax %sextension %v does not implement protoreflect.ExtensionTypeDescriptortoo many hex fields to fit an embedded IPv4 at the end of the addressinternal/concurrent.HashMapTrie: ran out of hash bits while iteratinginternal/concurrent.HashMapTrie: ran out of hash bits while insertingtls: peer doesn't support the certificate custom signature algorithmstls: handshake message of length %d bytes exceeds maximum of %d bytestls: client certificate contains an unsupported public key of type %Thttp2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)%s matches more methods than %s, but has a more specific path pattern%s matches fewer methods than %s, but has a more general path patternin case of issues. You can leave it blank, but we don't recommend it.invalid: OCSP response for %v valid after certificate expiration (%s)response Content-Type is %s but target container is not io.Writer: %Treflect: embedded interface with unexported method(s) not implemented'%s': expected source data to have length less or equal to %d, got %dOnLost callback called although there's no MTU probe packet in flightpacket too small, expected at least 20 bytes after the header, got %dPacket too small. Expected at least 20 bytes after the header, got %dedwards25519: internal error: setShortBytes called with a long string %s &wire.StreamDataBlockedFrame{StreamID: %d, MaximumStreamData: %d}x509: PKCS#8 wrapping contained private key with unknown algorithm: %vx509: certificate relies on legacy Common Name field, use SANs insteadgot %s for stream %d; expected CONTINUATION following %s for stream %dbytes.Buffer: UnreadByte: previous operation was not a successful readsync/atomic: compare and swap of inconsistently typed value into ValueOnAcked callback called although there's no MTU probe packet in flightdns: svcbipv6hint: ipv6 address byte array length not a multiple of 16 %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, DelayTime: %s%s}x509: issuer has name constraints but leaf doesn't have a SAN extensionrange function recovered a loop body panic and did not resume panickingif any flags in the group [%v] are set they must all be set; missing %vtls: peer doesn't support any of the certificate's signature algorithmsjson: invalid use of ,string struct tag, trying to unmarshal %q into %vinternal error: attempt to send frame on a half-closed-local stream: %vinternal error: 101 switching protocols response with non-writable bodyPlease enter your email address to signify agreement and to be notifiedthere is only one chain offered; selecting it regardless of preferencesall external certificate managers yielded no certificates and no errorsDuckDNS request failed, expected (OK) but got (%s), url: [%s], body: %stoo many concurrent operations on a single file or socket (max 1048575)Not adding connection ID %s for a new connection, as it already exists.PacketPacker BUG: payload size inconsistent (expected %d, got %d bytes)dynamic table size update MUST occur at the beginning of a header blockexec: command with a non-nil Cancel was not created with CommandContextpacket length (%d bytes) is smaller than the expected length (%d bytes) %s &wire.ResetStreamFrame{StreamID: %d, ErrorCode: %#x, FinalSize: %d}toml: cannot redefine table %s that has already been explicitly defined{{with .Name}}{{printf "%s " .}}{{end}}{{printf "version %s" .Version}} client doesn't support any cipher suites compatible with the certificatetls: server's certificate contains an unsupported type of public key: %Ttls: certificate private key of type %T does not implement crypto.Signercrypto/ecdh: internal error: nistec ScalarBaseMult returned the identityreflect: embedded type with methods not implemented for non-pointer typeIgnoring Retry, since the server didn't change the Source Connection ID.dns: svcbipv4hint: ipv4 address byte array length is not a multiple of 4tls: received unexpected handshake message of type %T when waiting for %Ttls: internal error: handshake returned an error but is marked successfultls: found a certificate rather than a key in the PEM for the private keycoalesced packet has different destination connection ID: %s, expected %sconnection doesn't allow setting of send buffer size. Not a *net.UDPConn?http3: invalid use of RequestStream.Read: need to call ReadResponse firstLimited by the number of tracked packets: tracking %d packets, maximum %dreceived inconsistent final offset for stream %d (old: %d, new: %d bytes) if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; thenhttps://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geoip.dattls: certificate RSA key size too small for supported signature algorithmsbytes.Buffer: UnreadRune: previous operation was not a successful ReadRunemalformed response from server: malformed non-numeric status pseudo headernet/http: server replied with more than declared Content-Length; truncatedDropping undecryptable packet (%d bytes). Undecryptable packet queue full.Amplification window limited. Received %d bytes, already sent out %d bytesAddAttrs unsafely called on copy of Record made without using Record.Clone%[2]s is a special command that is used by the shell completion logic %[1]stls: internal error: attempted to read record with pending application dataUnsolicited response received on idle HTTP channel starting with %q; err=%vcertificate revoked, but unable to fully clean up assets from issuer %s: %vno configuration associated with certificate; unable to manage OCSP staplesACK rate too low: %.2f, clamped to %.2f (total=%d, ack=%d, loss=%d, rtt=%d)Disabling ECN. Received less ECT(0) + ECN-CE than packets sent with ECT(0).Disabling ECN. Received less ECT(1) + ECN-CE than packets sent with ECT(1).https://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geosite.dattls: failed to send closeNotify alert (but connection was closed anyway): %wtls: server certificate contains incorrect key type for selected ciphersuiteHTTP/1.0 400 Bad Request Client sent an HTTP request to an HTTPS server. on-demand certificate's OCSP status is REVOKED; will try to forcefully renewunable to redefine %q shorthand in %q flagset: it's already used for %q flagconnection doesn't allow setting of receive buffer size. Not a *net.UDPConn? %s &wire.CryptoFrame{Offset: %d, Data length: %d, Offset + Data length: %d}crypto/tls: ExportKeyingMaterial is unavailable when renegotiation is enabledinvalid Body.Read call. After hijacked, the original Request must not be usedMapIter.Next called on an iterator that does not have an associated map Valueinvalid function signature for %s: second return value should be error; is %sgithub.com/quic-go/quic-go/internal/utils/ringbuffer: pop from an empty queuegithub.com/apernet/quic-go/internal/utils/ringbuffer: pop from an empty queueRemoving connection IDs %s for a closed connection after it has been retired.recevedPacketTracker BUG: ReceivedPacket called for old / duplicate packet %dreceived offset %d for stream %d, but final offset was already received at %dreceived final offset %d for stream %d, but already received offset %d beforex509: signature check attempts limit reached while verifying certificate chainrange function continued iteration after function for loop body returned falseThis is a command line tool. You need to open cmd.exe and run it from there. Failed to find flag %q and mark it as being in a mutually exclusive flag grouppattern %q (registered at %s) conflicts with pattern %q (registered at %s): %sinvalid configuration: maxEvents = 0 and window != 0 does not allow any events115792089210356248762697446949407573530086143415290314195533631308867097853951115792089210356248762697446949407573529996955224135760342422259061068512044369reflect: embedded type with methods not implemented if type is not first fieldgithub.com/quic-go/quic-go/internal/utils/ringbuffer: back from an empty queuegithub.com/apernet/quic-go/internal/utils/ringbuffer: peek from an empty queueinvalid quic-go log level, see https://github.com/apernet/quic-go/wiki/LoggingDisabling ECN. ECN-marked packet acknowledged, but no ECN counts on ACK frame.cannot convert slice with length %y to array or pointer to array with length %xtls: client certificate private key of type %T does not implement crypto.Signerhttp2: server closing client connection; error reading frame from client %s: %vinvalid configuration: maxEvents = 0 and window != 0 would not allow any eventscould not append records: Domain: %s; Record: %s, Status: %v; Body: %s; PUT: %sgithub.com/quic-go/quic-go/internal/utils/ringbuffer: offset from invalid indexgithub.com/quic-go/quic-go/internal/utils/ringbuffer: front from an empty queuename %v does not contain enough fields; expected format: '_service._proto.name'local datetimes are expected to have the format YYYY-MM-DDTHH:MM:SS[.NNNNNNNNN]toml: type %s implementing the TextMarshaler interface cannot be a root elementx509: invalid signature: parent certificate cannot sign this kind of certificatetls: either ServerName or InsecureSkipVerify must be specified in the tls.Confighttp: RoundTripper implementation (%T) returned a nil *Response with a nil errorbug: unexpected way for two patterns %s and %s to conflict: methods %s, paths %scrypto/ecdh: internal error: nistec ScalarBaseMult failed for a fixed-size inputDropping %s packet (%d bytes) for which we couldn't unpack the header. Error: %sno port can be announced, specify it explicitly using Server.Port or Server.AddrUnable to extract port from listener, will not be announced using SetQUICHeaderscrypto/rand: blocked for 60 seconds waiting to read random data from the kernel Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sVersion: %s}Disabling ECN. Received more ECT(0) / ECT(1) acknowledgements than packets sent.received packet number %d on a 0-RTT packet after receiving %d on a 1-RTT packetif any flags in the group [%v] are set none of the others can be; %v were all set[ERROR] Keeping lock file fresh: %v - terminating lock maintenance (lockfile: %s)could not delete requested records: Domain: %s; Records: %v, Status: %v; Body: %sBUG: ackhandler would have acked wrong packet %d, while evaluating range %d -> %dx509: a root or intermediate certificate is not authorized to sign for this name: certificate expires soon but is already being renewed; serving current certificateno memory of presenting a DNS record for %q (usually OK if presenting also failed)refusing to use HTTP_PROXY value in CGI environment; see golang.org/s/cgihttpproxyx509: issuer has name constraints but leaf contains unknown or unconstrained name: (possibly because of %q while trying to verify candidate authority certificate %q)json: invalid use of ,string struct tag, trying to unmarshal unquoted value into %vno issuers configured; impossible to renew or check existing certificate in storagereflect: embedded type with methods not implemented if there is more than one fieldgave up after %d attempts, last error unavailable (error reading response body: %v)BandwidthEstimate: %s, CongestionWindowGain: %.2f, PacingGain: %.2f, PacingRate: %sx509: signature algorithm specifies an %s public key, but have public key of type %Ttls: downgrade attempt detected, possibly due to a MitM attack or a broken middleboxpacketPacker BUG: Peeked and Popped packet numbers do not match: expected %d, got %dDropping a packet with an unsupported version number %d that is too small (%d bytes)x509: failed to parse private key (use ParseECPrivateKey instead for this key format)http: WriteHeader called with both Transfer-Encoding of %q and a Content-Length of %dunable to obtain new to certificate after OCSP status of REVOKED; removing from cachereflect.Value.Interface: cannot return value obtained from unexported field or methodDropping a packet with an unknown version for which we failed to parse connection IDsPacketConn is not a net.UDPConn. Disabling optimizations possible on UDP connections.x509: a root or intermediate certificate is not authorized for an extended key usage: tls: MinVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedtls: MaxVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedcertificate has expired, but is already being renewed; waiting for renewal to completereflect: New of type that may not be allocated in heap (possibly undefined cgo C type) %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, AckRanges: {%s}, DelayTime: %s%s}Sent %d packets with current key phase. Initiating key update to the next key phase: %dx509: failed to parse private key (use ParsePKCS8PrivateKey instead for this key format)x509: failed to parse private key (use ParsePKCS1PrivateKey instead for this key format)no issuers configured; impossible to obtain or check for existing certificate in storage Short Header{DestConnectionID: %s, PacketNumber: %d, PacketNumberLen: %d, KeyPhase: %s}certificate expires soon, but is already renewed in storage; reloading stored certificateDropping Initial packet (%d bytes) with unexpected source connection ID: %s (expected %s)%s: no solvers available for remaining challenges (configured=%v offered=%v remaining=%v)http2: server sent GOAWAY and closed the connection; LastStreamID=%v, ErrCode=%v, debug=%qOCSP status for managed certificate is REVOKED; attempting to replace with new certificatetls: unexpected encrypted_client_hello extension in server hello despite ECH being acceptedfailed to sufficiently increase send buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)Received %d packets with current key phase. Initiating key update to the next key phase: %dtls: handshake hash for a client certificate requested after discarding the handshake buffer[INFO][%s] Lock for '%s' is stale (created: %s, last update: %s); removing then retrying: %stls: unsupported certificate: private key is *ed25519.PrivateKey, expected ed25519.PrivateKeyretired connection ID %d (%s), which was used as the Destination Connection ID on this packetfailed to sufficiently increase receive buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)----------------------------------------------------------------------------------------------deprecated: golang.org/x/oauth2: Transport.CancelRequest no longer does anything; use contexts&wire.TransportParameters{OriginalDestinationConnectionID: %s, InitialSourceConnectionID: %s, size mismatch (see https://github.com/golang/protobuf/issues/1609): calculated=%d, measured=%dPerform a speed test through the proxy server. The server must have speed test support enabled.b3312fa7e23ee7e4988e056be3f82d19181d9c6efe8141120314088f5013875ac656398d8a2ed19d2a85c8edd3ec2aefaa87ca22be8b05378eb1c71ef320ad746e1d3b628ba79b9859f741e082542a385502f25dbf55296c3a545e3872760ab73617de4a96262c6f5d9e98bf9292dc29f8f41dbd289a147ce9da3113b5f0b8c00a60b1ce1d7e819d7a431d7c90ea0e5fhttp: RoundTripper implementation (%T) returned a *Response with content length %d but a nil Bodyname.com will not allow an update to a record that has identical values to an existing record: %wNoClientCertRequestClientCertRequireAnyClientCertVerifyClientCertIfGivenRequireAndVerifyClientCertunable to get automation config for certificate; maintenance for this certificate will likely failload yielded different value than was stored; expected %d bytes, got %d bytes of differing elements %s &wire.StreamFrame{StreamID: %d, Fin: %t, Offset: %d, Data length: %d, Offset + Data length: %d}cipher: the nonce can't have zero length, or the security of the key will be immediately compromisedsentPacketHandler BUG: PTO fired, but bytes_in_flight is 0 and Initial and Handshake already droppedcgocheck > 1 mode is no longer supported at runtime. Use GOEXPERIMENT=cgocheck2 at build time instead.\A\s*(?:export\s+)?([\w\.]+)(?:\s*=\s*|:\s+?)('(?:\'|[^'])*'|"(?:\"|[^"])*"|[^#\n]+)?\s*(?:\s*\#.*)?\zHTTP/1.1 400 Bad Request Content-Type: text/plain; charset=utf-8 Connection: close 400 Bad Request Queueing ACK because packet %d packets were received after the last ACK (using initial threshold: %d).asn1: time did not serialize back to the original value and may be invalid: given %q, but serialized as %qed25519: expected opts.HashFunc() zero (unhashed message, for standard Ed25519) or SHA-512 (for Ed25519ph)config returned for certificate %v is not nil and points to different cache; got %p, expected %p (this one)Starting new connection to %s (%s -> %s), source connection ID %s, destination connection ID %s, version %sinvalid nil message info; this suggests memory corruption due to a race or shallow copy on the message structtimed out waiting for record to fully propagate; verify DNS provider configuration is correct - last error: %vVersion: %s BuildDate: %s BuildType: %s Toolchain: %s CommitHash: %s Platform: %s Architecture: %s LibVersion: %s[INFO][%s] %s: Empty lockfile (%v) - likely previous process crashed or storage medium failure; treating as stale %s &wire.NewConnectionIDFrame{SequenceNumber: %d, RetirePriorTo: %d, ConnectionID: %s, StatelessResetToken: %#x}http2: Transport: cannot retry err [%v] after Request.Body was written; define Request.GetBody to avoid this error3940200619639447921227904010014361380507973927046544666794829340424572177149687032904726608825893800186160697311231939402006196394479212279040100143613805079739270465446667946905279627659399113263569398956308152294913554433653942643Perform a TCP ping to a specified remote address through the proxy server. Can be used as a simple connectivity test.tls: failed to find "CERTIFICATE" PEM block in certificate input after skipping PEM blocks of the following types: %vIncreasing receive flow control window for the connection to %d kB, in response to stream flow control window increase flags=() two_word_flags=() local_nonpersistent_flags=() flags_with_completion=() flags_completion=() {{with (or .Long .Short)}}{{. | trimTrailingWhitespaces}} {{end}}{{if or .Runnable .HasSubCommands}}{{.UsageString}}{{end}}tls: failed to find certificate PEM data in certificate input, but did find a private key; PEM inputs may have been switchedYour sites will be served over HTTPS automatically using an automated CA. By continuing, you agree to the CA's terms of service --------------------------------------------------------------------------------------------------------------------------------================================================================================================================================\000\001\002\003\004\005\006\007\008\009\010\011\012\013\014\015\016\017\018\019\020\021\022\023\024\025\026\027\028\029\030\031tls: failed to find PEM block with type ending in "PRIVATE KEY" in key input after skipping PEM blocks of the following types: %v Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sPacketNumber: %d, PacketNumberLen: %d, Length: %d, Version: %s}0051953eb9618e1c9a1f929a21a0b68540eea2da725b99b315f3b8b489918ef109e156193951ec7e937b1652c0bd3bb1bf073573df883d2c34f1ef451fd46b503f0000c6858e06b70404e9cd9e3ecb662395b4429c648139053fb521f828af606b4d3dbaa14b5e77efe75928fe1dc127a2ffa8de3348b3c1856a429bf97e7e31c2e5bd66011839296a789a3bc0045c8a5fb42c7d1bd998f54449579b446817afbd17273e662c97ee72995ef42640c550b9013fad0761353c7086a272c24088be94769fd16650HTTP/1.1 431 Request Header Fields Too Large Content-Type: text/plain; charset=utf-8 Connection: close 431 Request Header Fields Too LargeGenerate the autocompletion script for %[1]s for the specified shell. See each sub-command's help for details on how to use the generated script. if [[ $(type -t compopt) = "builtin" ]]; then complete -o default -F __start_%s %s else complete -o default -o nospace -F __start_%s %s fi crypto/tls: ExportKeyingMaterial is unavailable when neither TLS 1.3 nor Extended Master Secret are negotiated; override with GODEBUG=tlsunsafeekm=1Received invalid IPv6 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.Received invalid IPv4 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.NoMatchEmptyMatchLiteralCharClassAnyCharNotNLAnyCharBeginLineEndLineBeginTextEndTextWordBoundaryNoWordBoundaryCaptureStarPlusQuestRepeatConcatAlternate68647976601306097149819007990813932172694353001433054093944634591855431833976560521225596406614545549772963113914808580371219879997166438125740282911150571516864797660130609714981900799081393217269435300143305409394463459185543183397655394245057746333217197532963996371363321113864768612440380340372808892707005449netlink socket in Android is banned by Google, use the root or system (ADB) user to run sing-box, or switch to the sing-box Adnroid graphical interface client[WARNING] OS reports a contradiction: %v - but we cannot connect to it, with this error: %v; continuing anyway 🤞 (I don't know what causes this... if you do, please help?)%[1]s and %[2]s both match some paths, like %[3]q. But neither is more specific than the other. %[1]s matches %[4]q, but %[2]s doesn't. %[2]s matches %[5]q, but %[1]s doesn't.http2: TLSConfig.CipherSuites is missing an HTTP/2-required AES_128_GCM_SHA256 cipher (need at least one of TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 or TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256)00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899duplicate registration of %q The generated definition for this file has moved: from: %q to: %q A dependency on the %q module must be at version %v or higher. Upgrade the dependency by running: go get -u %v InitialMaxStreamDataBidiLocal: %d, InitialMaxStreamDataBidiRemote: %d, InitialMaxStreamDataUni: %d, InitialMaxData: %d, MaxBidiStreamNum: %d, MaxUniStreamNum: %d, MaxIdleTimeout: %s, AckDelayExponent: %d, MaxAckDelay: %s, ActiveConnectionIDLimit: %d  @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?Generate the autocompletion script for powershell. To load completions in your current shell session: %[1]s completion powershell | Out-String | Invoke-Expression To load completions for every new session, add the output of the above command to your powershell profile. Generate the autocompletion script for the fish shell. To load completions in your current shell session: %[1]s completion fish | source To load completions for every new session, execute once: %[1]s completion fish > ~/.config/fish/completions/%[1]s.fish You will need to start a new shell for this setup to take effect. ░█░█░█░█░█▀▀░▀█▀░█▀▀░█▀▄░▀█▀░█▀█░░░▀▀▄ ░█▀█░░█░░▀▀█░░█░░█▀▀░█▀▄░░█░░█▀█░░░▄▀░ ░▀░▀░░▀░░▀▀▀░░▀░░▀▀▀░▀░▀░▀▀▀░▀░▀░░░▀▀▀ \127\128\129\130\131\132\133\134\135\136\137\138\139\140\141\142\143\144\145\146\147\148\149\150\151\152\153\154\155\156\157\158\159\160\161\162\163\164\165\166\167\168\169\170\171\172\173\174\175\176\177\178\179\180\181\182\183\184\185\186\187\188\189\190\191\192\193\194\195\196\197\198\199\200\201\202\203\204\205\206\207\208\209\210\211\212\213\214\215\216\217\218\219\220\221\222\223\224\225\226\227\228\229\230\231\232\233\234\235\236\237\238\239\240\241\242\243\244\245\246\247\248\249\250\251\252\253\254\255Generate the autocompletion script for the bash shell. This script depends on the 'bash-completion' package. If it is not installed already, you can install it via your OS's package manager. To load completions in your current shell session: source <(%[1]s completion bash) To load completions for every new session, execute once: #### Linux: %[1]s completion bash > /etc/bash_completion.d/%[1]s #### macOS: %[1]s completion bash > $(brew --prefix)/etc/bash_completion.d/%[1]s You will need to start a new shell for this setup to take effect. Generate the autocompletion script for the zsh shell. If shell completion is not already enabled in your environment you will need to enable it. You can execute the following once: echo "autoload -U compinit; compinit" >> ~/.zshrc To load completions in your current shell session: source <(%[1]s completion zsh) To load completions for every new session, execute once: #### Linux: %[1]s completion zsh > "${fpath[1]}/_%[1]s" #### macOS: %[1]s completion zsh > $(brew --prefix)/share/zsh/site-functions/_%[1]s You will need to start a new shell for this setup to take effect. Hysteria Traffic Stats API Server

This is a Hysteria Traffic Stats API server.

Check the documentation for usage.

{ local cur prev words cword split declare -A flaghash 2>/dev/null || : declare -A aliashash 2>/dev/null || : if declare -F _init_completion >/dev/null 2>&1; then _init_completion -s || return else __%[1]s_init_completion -n "=" || return fi local c=0 local flag_parsing_disabled= local flags=() local two_word_flags=() local local_nonpersistent_flags=() local flags_with_completion=() local flags_completion=() local commands=("%[1]s") local command_aliases=() local must_have_one_flag=() local must_have_one_noun=() local has_completion_function="" local last_command="" local nouns=() local noun_aliases=() __%[1]s_handle_word } firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHRESETHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTOPEXTTMETSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastIDUsage:{{if .Runnable}} {{.UseLine}}{{end}}{{if .HasAvailableSubCommands}} {{.CommandPath}} [command]{{end}}{{if gt (len .Aliases) 0}} Aliases: {{.NameAndAliases}}{{end}}{{if .HasExample}} Examples: {{.Example}}{{end}}{{if .HasAvailableSubCommands}}{{$cmds := .Commands}}{{if eq (len .Groups) 0}} Available Commands:{{range $cmds}}{{if (or .IsAvailableCommand (eq .Name "help"))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{else}}{{range $group := .Groups}} {{.Title}}{{range $cmds}}{{if (and (eq .GroupID $group.ID) (or .IsAvailableCommand (eq .Name "help")))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{if not .AllChildCommandsHaveGroup}} Additional Commands:{{range $cmds}}{{if (and (eq .GroupID "") (or .IsAvailableCommand (eq .Name "help")))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{end}}{{end}}{{if .HasAvailableLocalFlags}} Flags: {{.LocalFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasAvailableInheritedFlags}} Global Flags: {{.InheritedFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasHelpSubCommands}} Additional help topics:{{range .Commands}}{{if .IsAdditionalHelpTopicCommand}} {{rpad .CommandPath .CommandPathPadding}} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableSubCommands}} Use "{{.CommandPath}} [command] --help" for more information about a command.{{end}} -----BEGIN RSA TESTING KEY----- MIIEvAIBADANBgkqhkiG9w0BAQEFAASCBKYwggSiAgEAAoIBAQDoZtrm0dXV0Aqi 4Bpc7f95sNRTiu/AJSD8I1onY9PnEsPg3VVxvytsVJbYdcqr4w99V3AgpH/UNzMS gAZ/8lZBNbsSDOVesJ3euVqMRfYPvd9pYl6QPRRpSDPm+2tNdn3QFAvta9EgJ3sW URnoU85w+W6aLI2bNSq3AaE771p3VbkGolpEjo9h+i42TBHo1rhPNKPkGupR8/QX AOLMpInRdeaHyDwb2a3DE5I3dG7VAVzrVfJ6W6Q84YoFX+rpEE2SVM17SAjy6xQy VjKgLvK2mk0xbtfa+h0B6VK7bmODHZqeP18NVm6HsBcXn7iclLgAC3SfWU1jucZK x1lqzw9tAgMBAAECggEABWzxS1Y2wckblnXY57Z+sl6YdmLV+gxj2r8Qib7g4ZIk lIlWR1OJNfw7kU4eryib4fc6nOh6O4AWZyYqAK6tqNQSS/eVG0LQTLTTEldHyVJL dvBe+MsUQOj4nTndZW+QvFzbcm2D8lY5n2nBSxU5ypVoKZ1EqQzytFcLZpTN7d89 EPj0qDyrV4NZlWAwL1AygCwnlwhMQjXEalVF1ylXwU3QzyZ/6MgvF6d3SSUlh+sq XefuyigXw484cQQgbzopv6niMOmGP3of+yV4JQqUSb3IDmmT68XjGd2Dkxl4iPki 6ZwXf3CCi+c+i/zVEcufgZ3SLf8D99kUGE7v7fZ6AQKBgQD1ZX3RAla9hIhxCf+O 3D+I1j2LMrdjAh0ZKKqwMR4JnHX3mjQI6LwqIctPWTU8wYFECSh9klEclSdCa64s uI/GNpcqPXejd0cAAdqHEEeG5sHMDt0oFSurL4lyud0GtZvwlzLuwEweuDtvT9cJ Wfvl86uyO36IW8JdvUprYDctrQKBgQDycZ697qutBieZlGkHpnYWUAeImVA878sJ w44NuXHvMxBPz+lbJGAg8Cn8fcxNAPqHIraK+kx3po8cZGQywKHUWsxi23ozHoxo +bGqeQb9U661TnfdDspIXia+xilZt3mm5BPzOUuRqlh4Y9SOBpSWRmEhyw76w4ZP OPxjWYAgwQKBgA/FehSYxeJgRjSdo+MWnK66tjHgDJE8bYpUZsP0JC4R9DL5oiaA brd2fI6Y+SbyeNBallObt8LSgzdtnEAbjIH8uDJqyOmknNePRvAvR6mP4xyuR+Bv m+Lgp0DMWTw5J9CKpydZDItc49T/mJ5tPhdFVd+am0NAQnmr1MCZ6nHxAoGABS3Y LkaC9FdFUUqSU8+Chkd/YbOkuyiENdkvl6t2e52jo5DVc1T7mLiIrRQi4SI8N9bN /3oJWCT+uaSLX2ouCtNFunblzWHBrhxnZzTeqVq4SLc8aESAnbslKL4i8/+vYZlN s8xtiNcSvL+lMsOBORSXzpj/4Ot8WwTkn1qyGgECgYBKNTypzAHeLE6yVadFp3nQ Ckq9yzvP/ib05rvgbvrne00YeOxqJ9gtTrzgh7koqJyX1L4NwdkEza4ilDWpucn0 xiUZS4SoaJq6ZvcBYS62Yr1t8n09iG47YL8ibgtmH3L+svaotvpVxVK+d7BLevA/ ZboOWVe3icTy64BT3OQhmg== -----END RSA TESTING KEY-----  37?/* & * ; 9 %#>'  1<   0 ")  7  +19$p$: r.r,r:>,s<s*L$L; )  4 4  ! #ʠʣʢʥʤʧʦʩʨؓߔ0 ,)4< '2869/9 :::%;/;%46 7*000.111022-33>'   #(66' &     5     <+)?45454)/)5+++ +<*&*"&8!!"+.4=    <>5<5!5#5&4447133.<.):)<) )+-+5$$''&"6" "   ?  (0 == =1 =, =  ?? < 9! 9) 97 99 6  6 6 7' 78 73 ' '&   3 /    "      > + / 6     <3 ;* 9" 9) 97 + (( &5 $ $ % #< #0 #  # !: ! ! 5  - ( .     $ "   2 =  & 1 : # <     2 1   / +     5 9 = ?1364<  % .2>13 %$8;422/,?  /><>>>:>+?>"4.<% 09'  # ! & " / , $ ' % ; = ? 9. 7 .:9' 1&90  96#20 2 0(2,3 :8% 5*;.-, 87/ ,--/( 57.97 *%60 ;'2.2=$=' 6,;., 2 5 4 ; > 8 * / , % & # !%$+.*&8>460 -2-2-2-2-2-2-2@ @ (3  )1;* # 0 ! !0 ?5   7 +# # 2   #;='  1  3. /,#>8 " 8> /'" + " /1 74 ","?$5<3=*8  7+7(;?  $$;,$  >>  )    '< .' " )*)<,  . # ' 8 %2+&0 )4   * $ 0 *( 29,4'  : . . +0   "0 ;,/"1 .  7 2 . 1 :/0+- , =  ;/ :  . 4  1#4"'8>57&9+ .  ,> 4#%"  +  +  +   =   &0(75'6.=;;, > < % < %!   0' = >4>&? ?( - :3 8:   72% "< /<>+ '?   <=  "  )= /4 7 : ?3 :/   7"0(  %< +  70 >570 =%, 9# >  < +,:%" $ =+ /  ' #   22< 1  -  ?   1& / $<3 $  ?5 ##02(+   +02  + -? #: # %$ >+ 01 1 9    *) - .1 .2 < >  3  2  %,&!"9(  2    #().1 $ '8 07#7-)2 6  (!5  / , 3 ,1 /5 "1 "  ?% <, ?# > &  : + " )   - ( ) /  . , /* -9 "8 %  : ; ? 3% 6 6 7 , ,    8*/24:"+ 0& ;>$>292:1,1<17#7* '-4*7'!%7  1 .0=  :*1-"32:0$6445  7  +  +- 8 8 8 8% 8! 8- 8/ 8+ 87 85 9  9  9 9 u uuu  9 9 `;`>`9`8`7`*`-`,  & =. =% > > ? ?  ?  ?  ? > > >  >, >  ? ? ? ? ? ? ? ? ? ?  ? ? ?  =2 =6 < <:!:#8 :&8 :$:,88:*:7:5:;::<:4:':-:%:?:=:):/s' = +* 99 9; 9? )  (%(')+/ " " "' "/ "3 "$$!8745' 2=;: $ ) $ , .  .# (/ % 90 4  # , 2  :3      0> -> <+ 8 3  % "&   %9 &2 &0 ! !7 5 =4 ? >  : 9  % - - ,4 ., )  6! 1 3 + 8  8= ( ( +   3)!  %#>"%*;70 ; /-715+>79+, "0 ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전)(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)212223242526272829303132333435참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパートアルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキログラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポイントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlklfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhahpinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日18日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմխיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּוֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئمئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحطمظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمينجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترتزتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيسىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميحمىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمىفخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنمينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمينحيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليهوسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\$%@ـًـَـُـِـّـْءآأؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا"'/^|~¢£¬¦¥ːˑʙɓʣꭦʥʤɖɗᶑɘɞʩɤɢɠʛʜɧʄʪʫꞎɮʎøɶɷɺɾʀʨʦꭧʧʈⱱʏʡʢʘǀǁǂ𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκλμνξοστυψ∇∂ϝабгежзиклмпруфхцчшыэюꚉәіјөүӏґѕџҫꙑұٮڡٯ0,1,2,3,4,5,6,7,8,9,(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)〔s〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申割営配〔本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉卑博即卽卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢㠯巽帨帽幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最暜肭䏙朗望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸瑇瑜瑱璅瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦若茝荣莭茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷䧦雃嶲霣䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻AAAAAA C'EEEEIIIINOOOOOUUUUYaaaaaa c'eeeeiiiinooooouuuuyyAaAaA(a(CcCc C c C  c  D d EeEeEeE(e(E e GgGgG g!G'"g'#H$h%I(i)I*i+I,i-I(.i(/I0J4j5K'6k'7L9l:L';l'<L =l >NCnDN'En'FN Gn HOLoMONoOO Po QRTrUR'Vr'WR Xr YSZs[S\s]S'^s'_S `s aT'bt'cT dt eUhuiUjukUlumU nu oU pu qU(ru(sWtwuYvywYxZyzzZ{z|Z }z ~OoUuA a I i O o U u   &'G g K k O(o(  j GgNnAaAaEeEeIi I i O o OoRrRrUuUuS&s&T&t&H h A&a'E'(e')*+,-O.o/.0/1Y2y3  #895P5Q3SVW:\8]C^tvuw60056788>-M#C#C# C 'G+K'S"'T#HT$'U%JT&TTT ( < ) 0 < 1 3 < 4 G V H G > K G W L F V H F > J G > K F W L %.&55 5  5  55:5;<5=>5@?5AB5CA%a%BbB#b#B1b1 D d D# d# D1d1D'd'D-d-E-e-E0e0()FfG g!H"h#H#$h#%H&h'H'(h')H.*h.+I0,i0-./K0k1K#2k#3K14k15L#6l#76879L1:l1;L-<l-=M>m?M@mAM#Bm#CNDnEN#Fn#GN1Hn1IN-Jn-KLMNOLPMQLRMSPTpUPVpWRXrYR#Zr#[Z\[]R1^r1_S`saS#bs#cZd[e`fagbhciTjtkT#lt#mT1nt1oT-pt-qU$ru$sU0tu0uU-vu-whxiyjzk{V|v}V#~v#WwWwWwWwW#w#XxXxYyZzZ#z#Z1z1h1tw y A#a#A a     E#e#E e Ee  I i I#i#O#o#O o     ##U#u#U u   ##YyY#y#Y y YyBB       B B ! "!# $!% B&!B'()(*)+(,)-(B.)B/01021304150B61B7898:9;8<9=8B>9B?@A@BAC@DAEHIHJIKHLIMPQPRQSPTQUPBVQBWYY[Y]YB_`a`bac`dae`BfaBghihjikhlimhBniBoprtvxz|EEEEEEEEE E E E E EEE E!E"E#E$E%E&E'E(E)E*E+E,E-E.E/E`EaEbEcEdEeEfEgEhEiEjEkElEmEnEoEpEEEBEEBtEEEBEEBBBBBB|EEEBEE!8!!8!!8!!8!!8!!8!"8""8" " 8" "#8"$"%8"&"<8"A"C8"D"E8"G"H8"I=8"`"a8"b"M8"m<8"n>8"o"d8"p"e8"q"r8"t"s8"u"v8"x"w8"y"z8""{8""8""8""8""8""8""8""8""8""|8""}8""8""8""8""8""8""8"0K00L0M00N0O00P0Q00R0S00T0U00V0W00X0Y00Z0[00\0]00^0_00`0a00b0d00e0f00g0h00i0o00p0o00q0r00s0r00t0u00v0u00w0x00y0x00z0{00|0{00}0F000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001'.2'/G>KGWL508#compdef %[1]s compdef _%[1]s %[1]s # zsh completion for %-36[1]s -*- shell-script -*- __%[1]s_debug() { local file="$BASH_COMP_DEBUG_FILE" if [[ -n ${file} ]]; then echo "$*" >> "${file}" fi } _%[1]s() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d local lastParam lastChar flagPrefix requestComp out directive comp lastComp noSpace keepOrder local -a completions __%[1]s_debug "\n========= starting completion logic ==========" __%[1]s_debug "CURRENT: ${CURRENT}, words[*]: ${words[*]}" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CURRENT location, so we need # to truncate the command-line ($words) up to the $CURRENT location. # (We cannot use $CURSOR as its value does not work when a command is an alias.) words=("${=words[1,CURRENT]}") __%[1]s_debug "Truncated words[*]: ${words[*]}," lastParam=${words[-1]} lastChar=${lastParam[-1]} __%[1]s_debug "lastParam: ${lastParam}, lastChar: ${lastChar}" # For zsh, when completing a flag with an = (e.g., %[1]s -n=) # completions must be prefixed with the flag setopt local_options BASH_REMATCH if [[ "${lastParam}" =~ '-.*=' ]]; then # We are dealing with a flag with an = flagPrefix="-P ${BASH_REMATCH}" fi # Prepare the command to obtain completions requestComp="${words[1]} %[2]s ${words[2,-1]}" if [ "${lastChar}" = "" ]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go completion code. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} \"\"" fi __%[1]s_debug "About to call: eval ${requestComp}" # Use eval to handle any environment variables and such out=$(eval ${requestComp} 2>/dev/null) __%[1]s_debug "completion output: ${out}" # Extract the directive integer following a : from the last line local lastLine while IFS='\n' read -r line; do lastLine=${line} done < <(printf "%%s\n" "${out[@]}") __%[1]s_debug "last line: ${lastLine}" if [ "${lastLine[1]}" = : ]; then directive=${lastLine[2,-1]} # Remove the directive including the : and the newline local suffix (( suffix=${#lastLine}+2)) out=${out[1,-$suffix]} else # There is no directive specified. Leave $out as is. __%[1]s_debug "No directive found. Setting do default" directive=0 fi __%[1]s_debug "directive: ${directive}" __%[1]s_debug "completions: ${out}" __%[1]s_debug "flagPrefix: ${flagPrefix}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then __%[1]s_debug "Completion received error. Ignoring completions." return fi local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} local startIndex=$((${#activeHelpMarker}+1)) local hasActiveHelp=0 while IFS='\n' read -r comp; do # Check if this is an activeHelp statement (i.e., prefixed with $activeHelpMarker) if [ "${comp[1,$endIndex]}" = "$activeHelpMarker" ];then __%[1]s_debug "ActiveHelp found: $comp" comp="${comp[$startIndex,-1]}" if [ -n "$comp" ]; then compadd -x "${comp}" __%[1]s_debug "ActiveHelp will need delimiter" hasActiveHelp=1 fi continue fi if [ -n "$comp" ]; then # If requested, completions are returned with a description. # The description is preceded by a TAB character. # For zsh's _describe, we need to use a : instead of a TAB. # We first need to escape any : as part of the completion itself. comp=${comp//:/\\:} local tab="$(printf '\t')" comp=${comp//$tab/:} __%[1]s_debug "Adding completion: ${comp}" completions+=${comp} lastComp=$comp fi done < <(printf "%%s\n" "${out[@]}") # Add a delimiter after the activeHelp statements, but only if: # - there are completions following the activeHelp statements, or # - file completion will be performed (so there will be choices after the activeHelp) if [ $hasActiveHelp -eq 1 ]; then if [ ${#completions} -ne 0 ] || [ $((directive & shellCompDirectiveNoFileComp)) -eq 0 ]; then __%[1]s_debug "Adding activeHelp delimiter" compadd -x "--" hasActiveHelp=0 fi fi if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then __%[1]s_debug "Activating nospace." noSpace="-S ''" fi if [ $((directive & shellCompDirectiveKeepOrder)) -ne 0 ]; then __%[1]s_debug "Activating keep order." keepOrder="-V" fi if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local filteringCmd filteringCmd='_files' for filter in ${completions[@]}; do if [ ${filter[1]} != '*' ]; then # zsh requires a glob pattern to do file filtering filter="\*.$filter" fi filteringCmd+=" -g $filter" done filteringCmd+=" ${flagPrefix}" __%[1]s_debug "File filtering command: $filteringCmd" _arguments '*:filename:'"$filteringCmd" elif [ $((directive & shellCompDirectiveFilterDirs)) -ne 0 ]; then # File completion for directories only local subdir subdir="${completions[1]}" if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" pushd "${subdir}" >/dev/null 2>&1 else __%[1]s_debug "Listing directories in ." fi local result _arguments '*:dirname:_files -/'" ${flagPrefix}" result=$? if [ -n "$subdir" ]; then popd >/dev/null 2>&1 fi return $result else __%[1]s_debug "Calling _describe" if eval _describe $keepOrder "completions" completions $flagPrefix $noSpace; then __%[1]s_debug "_describe found some completions" # Return the success of having called _describe return 0 else __%[1]s_debug "_describe did not find completions." __%[1]s_debug "Checking if we should do file completion." if [ $((directive & shellCompDirectiveNoFileComp)) -ne 0 ]; then __%[1]s_debug "deactivating file completion" # We must return an error code here to let zsh know that there were no # completions found by _describe; this is what will trigger other # matching algorithms to attempt to find completions. # For example zsh can match letters in the middle of words. return 1 else # Perform file completion __%[1]s_debug "Activating file completion" # We must return the result of this command, so it must be the # last command, or else we must store its result to return it. _arguments '*:filename:_files'" ${flagPrefix}" fi fi fi } # don't run the completion function when being source-ed or eval-ed if [ "$funcstack[1]" = "_%[1]s" ]; then _%[1]s fi function __%[1]s_debug set -l file "$BASH_COMP_DEBUG_FILE" if test -n "$file" echo "$argv" >> $file end end function __%[1]s_perform_completion __%[1]s_debug "Starting __%[1]s_perform_completion" # Extract all args except the last one set -l args (commandline -opc) # Extract the last arg and escape it in case it is a space set -l lastArg (string escape -- (commandline -ct)) __%[1]s_debug "args: $args" __%[1]s_debug "last arg: $lastArg" # Disable ActiveHelp which is not supported for fish shell set -l requestComp "%[10]s=0 $args[1] %[3]s $args[2..-1] $lastArg" __%[1]s_debug "Calling $requestComp" set -l results (eval $requestComp 2> /dev/null) # Some programs may output extra empty lines after the directive. # Let's ignore them or else it will break completion. # Ref: https://github.com/spf13/cobra/issues/1279 for line in $results[-1..1] if test (string trim -- $line) = "" # Found an empty line, remove it set results $results[1..-2] else # Found non-empty line, we have our proper output break end end set -l comps $results[1..-2] set -l directiveLine $results[-1] # For Fish, when completing a flag with an = (e.g., -n=) # completions must be prefixed with the flag set -l flagPrefix (string match -r -- '-.*=' "$lastArg") __%[1]s_debug "Comps: $comps" __%[1]s_debug "DirectiveLine: $directiveLine" __%[1]s_debug "flagPrefix: $flagPrefix" for comp in $comps printf "%%s%%s\n" "$flagPrefix" "$comp" end printf "%%s\n" "$directiveLine" end # this function limits calls to __%[1]s_perform_completion, by caching the result behind $__%[1]s_perform_completion_once_result function __%[1]s_perform_completion_once __%[1]s_debug "Starting __%[1]s_perform_completion_once" if test -n "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Seems like a valid result already exists, skipping __%[1]s_perform_completion" return 0 end set --global __%[1]s_perform_completion_once_result (__%[1]s_perform_completion) if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completions, probably due to a failure" return 1 end __%[1]s_debug "Performed completions and set __%[1]s_perform_completion_once_result" return 0 end # this function is used to clear the $__%[1]s_perform_completion_once_result variable after completions are run function __%[1]s_clear_perform_completion_once_result __%[1]s_debug "" __%[1]s_debug "========= clearing previously set __%[1]s_perform_completion_once_result variable ==========" set --erase __%[1]s_perform_completion_once_result __%[1]s_debug "Succesfully erased the variable __%[1]s_perform_completion_once_result" end function __%[1]s_requires_order_preservation __%[1]s_debug "" __%[1]s_debug "========= checking if order preservation is required ==========" __%[1]s_perform_completion_once if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Error determining if order preservation is required" return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveKeepOrder %[9]d set -l keeporder (math (math --scale 0 $directive / $shellCompDirectiveKeepOrder) %% 2) __%[1]s_debug "Keeporder is: $keeporder" if test $keeporder -ne 0 __%[1]s_debug "This does require order preservation" return 0 end __%[1]s_debug "This doesn't require order preservation" return 1 end # This function does two things: # - Obtain the completions and store them in the global __%[1]s_comp_results # - Return false if file completion should be performed function __%[1]s_prepare_completions __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" # Start fresh set --erase __%[1]s_comp_results __%[1]s_perform_completion_once __%[1]s_debug "Completion results: $__%[1]s_perform_completion_once_result" if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completion, probably due to a failure" # Might as well do file completion, in case it helps return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) set --global __%[1]s_comp_results $__%[1]s_perform_completion_once_result[1..-2] __%[1]s_debug "Completions are: $__%[1]s_comp_results" __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveError %[4]d set -l shellCompDirectiveNoSpace %[5]d set -l shellCompDirectiveNoFileComp %[6]d set -l shellCompDirectiveFilterFileExt %[7]d set -l shellCompDirectiveFilterDirs %[8]d if test -z "$directive" set directive 0 end set -l compErr (math (math --scale 0 $directive / $shellCompDirectiveError) %% 2) if test $compErr -eq 1 __%[1]s_debug "Received error directive: aborting." # Might as well do file completion, in case it helps return 1 end set -l filefilter (math (math --scale 0 $directive / $shellCompDirectiveFilterFileExt) %% 2) set -l dirfilter (math (math --scale 0 $directive / $shellCompDirectiveFilterDirs) %% 2) if test $filefilter -eq 1; or test $dirfilter -eq 1 __%[1]s_debug "File extension filtering or directory filtering not supported" # Do full file completion instead return 1 end set -l nospace (math (math --scale 0 $directive / $shellCompDirectiveNoSpace) %% 2) set -l nofiles (math (math --scale 0 $directive / $shellCompDirectiveNoFileComp) %% 2) __%[1]s_debug "nospace: $nospace, nofiles: $nofiles" # If we want to prevent a space, or if file completion is NOT disabled, # we need to count the number of valid completions. # To do so, we will filter on prefix as the completions we have received # may not already be filtered so as to allow fish to match on different # criteria than the prefix. if test $nospace -ne 0; or test $nofiles -eq 0 set -l prefix (commandline -t | string escape --style=regex) __%[1]s_debug "prefix: $prefix" set -l completions (string match -r -- "^$prefix.*" $__%[1]s_comp_results) set --global __%[1]s_comp_results $completions __%[1]s_debug "Filtered completions are: $__%[1]s_comp_results" # Important not to quote the variable for count to work set -l numComps (count $__%[1]s_comp_results) __%[1]s_debug "numComps: $numComps" if test $numComps -eq 1; and test $nospace -ne 0 # We must first split on \t to get rid of the descriptions to be # able to check what the actual completion will be. # We don't need descriptions anyway since there is only a single # real completion which the shell will expand immediately. set -l split (string split --max 1 \t $__%[1]s_comp_results[1]) # Fish won't add a space if the completion ends with any # of the following characters: @=/:., set -l lastChar (string sub -s -1 -- $split) if not string match -r -q "[@=/:.,]" -- "$lastChar" # In other cases, to support the "nospace" directive we trick the shell # by outputting an extra, longer completion. __%[1]s_debug "Adding second completion to perform nospace directive" set --global __%[1]s_comp_results $split[1] $split[1]. __%[1]s_debug "Completions are now: $__%[1]s_comp_results" end end if test $numComps -eq 0; and test $nofiles -eq 0 # To be consistent with bash and zsh, we only trigger file # completion when there are no other completions __%[1]s_debug "Requesting file completion" return 1 end end return 0 end # Since Fish completions are only loaded once the user triggers them, we trigger them ourselves # so we can properly delete any completions provided by another script. # Only do this if the program can be found, or else fish may print some errors; besides, # the existing completions will only be loaded if the program can be found. if type -q "%[2]s" # The space after the program name is essential to trigger completion for the program # and not completion of the program name itself. # Also, we use '> /dev/null 2>&1' since '&>' is not supported in older versions of fish. complete --do-complete "%[2]s " > /dev/null 2>&1 end # Remove any pre-existing completions for the program since we will be handling all of them. complete -c %[2]s -e # this will get called after the two calls below and clear the $__%[1]s_perform_completion_once_result global complete -c %[2]s -n '__%[1]s_clear_perform_completion_once_result' # The call to __%[1]s_prepare_completions will setup __%[1]s_comp_results # which provides the program's completion choices. # If this doesn't require order preservation, we don't use the -k flag complete -c %[2]s -n 'not __%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # otherwise we use the -k flag complete -k -c %[2]s -n '__%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # powershell completion for %-36[1]s -*- shell-script -*- function __%[1]s_debug { if ($env:BASH_COMP_DEBUG_FILE) { "$args" | Out-File -Append -FilePath "$env:BASH_COMP_DEBUG_FILE" } } filter __%[1]s_escapeStringWithSpecialChars { $_ -replace '\s|#|@|\$|;|,|''|\{|\}|\(|\)|"|`|\||<|>|&','`$&' } [scriptblock]$__%[2]sCompleterBlock = { param( $WordToComplete, $CommandAst, $CursorPosition ) # Get the current command line and convert into a string $Command = $CommandAst.CommandElements $Command = "$Command" __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "WordToComplete: $WordToComplete Command: $Command CursorPosition: $CursorPosition" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CursorPosition location, so we need # to truncate the command-line ($Command) up to the $CursorPosition location. # Make sure the $Command is longer then the $CursorPosition before we truncate. # This happens because the $Command does not include the last space. if ($Command.Length -gt $CursorPosition) { $Command=$Command.Substring(0,$CursorPosition) } __%[1]s_debug "Truncated command: $Command" $ShellCompDirectiveError=%[4]d $ShellCompDirectiveNoSpace=%[5]d $ShellCompDirectiveNoFileComp=%[6]d $ShellCompDirectiveFilterFileExt=%[7]d $ShellCompDirectiveFilterDirs=%[8]d $ShellCompDirectiveKeepOrder=%[9]d # Prepare the command to request completions for the program. # Split the command at the first space to separate the program and arguments. $Program,$Arguments = $Command.Split(" ",2) $RequestComp="$Program %[3]s $Arguments" __%[1]s_debug "RequestComp: $RequestComp" # we cannot use $WordToComplete because it # has the wrong values if the cursor was moved # so use the last argument if ($WordToComplete -ne "" ) { $WordToComplete = $Arguments.Split(" ")[-1] } __%[1]s_debug "New WordToComplete: $WordToComplete" # Check for flag with equal sign $IsEqualFlag = ($WordToComplete -Like "--*=*" ) if ( $IsEqualFlag ) { __%[1]s_debug "Completing equal sign flag" # Remove the flag part $Flag,$WordToComplete = $WordToComplete.Split("=",2) } if ( $WordToComplete -eq "" -And ( -Not $IsEqualFlag )) { # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" # PowerShell 7.2+ changed the way how the arguments are passed to executables, # so for pre-7.2 or when Legacy argument passing is enabled we need to use # `"`" to pass an empty argument, a "" or '' does not work!!! if ($PSVersionTable.PsVersion -lt [version]'7.2.0' -or ($PSVersionTable.PsVersion -lt [version]'7.3.0' -and -not [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -or (($PSVersionTable.PsVersion -ge [version]'7.3.0' -or [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -and $PSNativeCommandArgumentPassing -eq 'Legacy')) { $RequestComp="$RequestComp" + ' `"`"' } else { $RequestComp="$RequestComp" + ' ""' } } __%[1]s_debug "Calling $RequestComp" # First disable ActiveHelp which is not supported for Powershell $env:%[10]s=0 #call the command store the output in $out and redirect stderr and stdout to null # $Out is an array contains each line per element Invoke-Expression -OutVariable out "$RequestComp" 2>&1 | Out-Null # get directive from last line [int]$Directive = $Out[-1].TrimStart(':') if ($Directive -eq "") { # There is no directive specified $Directive = 0 } __%[1]s_debug "The completion directive is: $Directive" # remove directive (last element) from out $Out = $Out | Where-Object { $_ -ne $Out[-1] } __%[1]s_debug "The completions are: $Out" if (($Directive -band $ShellCompDirectiveError) -ne 0 ) { # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return } $Longest = 0 [Array]$Values = $Out | ForEach-Object { #Split the output in name and description $Name, $Description = $_.Split("`t",2) __%[1]s_debug "Name: $Name Description: $Description" # Look for the longest completion so that we can format things nicely if ($Longest -lt $Name.Length) { $Longest = $Name.Length } # Set the description to a one space string if there is none set. # This is needed because the CompletionResult does not accept an empty string as argument if (-Not $Description) { $Description = " " } @{Name="$Name";Description="$Description"} } $Space = " " if (($Directive -band $ShellCompDirectiveNoSpace) -ne 0 ) { # remove the space here __%[1]s_debug "ShellCompDirectiveNoSpace is called" $Space = "" } if ((($Directive -band $ShellCompDirectiveFilterFileExt) -ne 0 ) -or (($Directive -band $ShellCompDirectiveFilterDirs) -ne 0 )) { __%[1]s_debug "ShellCompDirectiveFilterFileExt ShellCompDirectiveFilterDirs are not supported" # return here to prevent the completion of the extensions return } $Values = $Values | Where-Object { # filter the result $_.Name -like "$WordToComplete*" # Join the flag back if we have an equal sign flag if ( $IsEqualFlag ) { __%[1]s_debug "Join the equal sign flag back to the completion value" $_.Name = $Flag + "=" + $_.Name } } # we sort the values in ascending order by name if keep order isn't passed if (($Directive -band $ShellCompDirectiveKeepOrder) -eq 0 ) { $Values = $Values | Sort-Object -Property Name } if (($Directive -band $ShellCompDirectiveNoFileComp) -ne 0 ) { __%[1]s_debug "ShellCompDirectiveNoFileComp is called" if ($Values.Length -eq 0) { # Just print an empty string here so the # shell does not start to complete paths. # We cannot use CompletionResult here because # it does not accept an empty string as argument. "" return } } # Get the current mode $Mode = (Get-PSReadLineKeyHandler | Where-Object {$_.Key -eq "Tab" }).Function __%[1]s_debug "Mode: $Mode" $Values | ForEach-Object { # store temporary because switch will overwrite $_ $comp = $_ # PowerShell supports three different completion modes # - TabCompleteNext (default windows style - on each key press the next option is displayed) # - Complete (works like bash) # - MenuComplete (works like zsh) # You set the mode with Set-PSReadLineKeyHandler -Key Tab -Function # CompletionResult Arguments: # 1) CompletionText text to be used as the auto completion result # 2) ListItemText text to be displayed in the suggestion list # 3) ResultType type of completion result # 4) ToolTip text for the tooltip with details about the object switch ($Mode) { # bash like "Complete" { if ($Values.Length -eq 1) { __%[1]s_debug "Only one completion left" # insert space after value [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } else { # Add the proper number of spaces to align the descriptions while($comp.Name.Length -lt $Longest) { $comp.Name = $comp.Name + " " } # Check for empty description and only add parentheses if needed if ($($comp.Description) -eq " " ) { $Description = "" } else { $Description = " ($($comp.Description))" } [System.Management.Automation.CompletionResult]::new("$($comp.Name)$Description", "$($comp.Name)$Description", 'ParameterValue', "$($comp.Description)") } } # zsh like "MenuComplete" { # insert space after value # MenuComplete will automatically show the ToolTip of # the highlighted value at the bottom of the suggestions. [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } # TabCompleteNext and in case we get something unknown Default { # Like MenuComplete but we don't want to add a space here because # the user need to press space anyway to get the completion. # Description will not be shown because that's not possible with TabCompleteNext [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars), "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } } } } Register-ArgumentCompleter -CommandName '%[1]s' -ScriptBlock $__%[2]sCompleterBlock # bash completion V2 for %-36[1]s -*- shell-script -*- __%[1]s_debug() { if [[ -n ${BASH_COMP_DEBUG_FILE-} ]]; then echo "$*" >> "${BASH_COMP_DEBUG_FILE}" fi } # Macs have bash3 for which the bash-completion package doesn't include # _init_completion. This is a minimal version of that function. __%[1]s_init_completion() { COMPREPLY=() _get_comp_words_by_ref "$@" cur prev words cword } # This function calls the %[1]s program to obtain the completion # results and the directive. It fills the 'out' and 'directive' vars. __%[1]s_get_completion_results() { local requestComp lastParam lastChar args # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows to handle aliases args=("${words[@]:1}") requestComp="${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} __%[1]s_debug "lastParam ${lastParam}, lastChar ${lastChar}" if [[ -z ${cur} && ${lastChar} != = ]]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} ''" fi # When completing a flag with an = (e.g., %[1]s -n=) # bash focuses on the part after the =, so we need to remove # the flag part from $cur if [[ ${cur} == -*=* ]]; then cur="${cur#*=}" fi __%[1]s_debug "Calling ${requestComp}" # Use eval to handle any environment variables and such out=$(eval "${requestComp}" 2>/dev/null) # Extract the directive integer at the very end of the output following a colon (:) directive=${out##*:} # Remove the directive out=${out%%:*} if [[ ${directive} == "${out}" ]]; then # There is not directive specified directive=0 fi __%[1]s_debug "The completion directive is: ${directive}" __%[1]s_debug "The completions are: ${out}" } __%[1]s_process_completion_results() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d if (((directive & shellCompDirectiveError) != 0)); then # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return else if (((directive & shellCompDirectiveNoSpace) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no space" compopt -o nospace else __%[1]s_debug "No space directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveKeepOrder) != 0)); then if [[ $(type -t compopt) == builtin ]]; then # no sort isn't supported for bash less than < 4.4 if [[ ${BASH_VERSINFO[0]} -lt 4 || ( ${BASH_VERSINFO[0]} -eq 4 && ${BASH_VERSINFO[1]} -lt 4 ) ]]; then __%[1]s_debug "No sort directive not supported in this version of bash" else __%[1]s_debug "Activating keep order" compopt -o nosort fi else __%[1]s_debug "No sort directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveNoFileComp) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no file completion" compopt +o default else __%[1]s_debug "No file completion directive not supported in this version of bash" fi fi fi # Separate activeHelp from normal completions local completions=() local activeHelp=() __%[1]s_extract_activeHelp if (((directive & shellCompDirectiveFilterFileExt) != 0)); then # File extension filtering local fullFilter filter filteringCmd # Do not use quotes around the $completions variable or else newline # characters will be kept. for filter in ${completions[*]}; do fullFilter+="$filter|" done filteringCmd="_filedir $fullFilter" __%[1]s_debug "File filtering command: $filteringCmd" $filteringCmd elif (((directive & shellCompDirectiveFilterDirs) != 0)); then # File completion for directories only local subdir subdir=${completions[0]} if [[ -n $subdir ]]; then __%[1]s_debug "Listing directories in $subdir" pushd "$subdir" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return else __%[1]s_debug "Listing directories in ." _filedir -d fi else __%[1]s_handle_completion_types fi __%[1]s_handle_special_char "$cur" : __%[1]s_handle_special_char "$cur" = # Print the activeHelp statements before we finish if ((${#activeHelp[*]} != 0)); then printf "\n"; printf "%%s\n" "${activeHelp[@]}" printf "\n" # The prompt format is only available from bash 4.4. # We test if it is available before using it. if (x=${PS1@P}) 2> /dev/null; then printf "%%s" "${PS1@P}${COMP_LINE[@]}" else # Can't print the prompt. Just print the # text the user had typed, it is workable enough. printf "%%s" "${COMP_LINE[@]}" fi fi } # Separate activeHelp lines from real completions. # Fills the $activeHelp and $completions arrays. __%[1]s_extract_activeHelp() { local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} while IFS='' read -r comp; do if [[ ${comp:0:endIndex} == $activeHelpMarker ]]; then comp=${comp:endIndex} __%[1]s_debug "ActiveHelp found: $comp" if [[ -n $comp ]]; then activeHelp+=("$comp") fi else # Not an activeHelp line but a normal completion completions+=("$comp") fi done <<<"${out}" } __%[1]s_handle_completion_types() { __%[1]s_debug "__%[1]s_handle_completion_types: COMP_TYPE is $COMP_TYPE" case $COMP_TYPE in 37|42) # Type: menu-complete/menu-complete-backward and insert-completions # If the user requested inserting one completion at a time, or all # completions at once on the command-line we must remove the descriptions. # https://github.com/spf13/cobra/issues/1508 local tab=$'\t' comp while IFS='' read -r comp; do [[ -z $comp ]] && continue # Strip any description comp=${comp%%%%$tab*} # Only consider the completions that match if [[ $comp == "$cur"* ]]; then COMPREPLY+=("$comp") fi done < <(printf "%%s\n" "${completions[@]}") ;; *) # Type: complete (normal completion) __%[1]s_handle_standard_completion_case ;; esac } __%[1]s_handle_standard_completion_case() { local tab=$'\t' comp # Short circuit to optimize if we don't have descriptions if [[ "${completions[*]}" != *$tab* ]]; then IFS=$'\n' read -ra COMPREPLY -d '' < <(compgen -W "${completions[*]}" -- "$cur") return 0 fi local longest=0 local compline # Look for the longest completion so that we can format things nicely while IFS='' read -r compline; do [[ -z $compline ]] && continue # Strip any description before checking the length comp=${compline%%%%$tab*} # Only consider the completions that match [[ $comp == "$cur"* ]] || continue COMPREPLY+=("$compline") if ((${#comp}>longest)); then longest=${#comp} fi done < <(printf "%%s\n" "${completions[@]}") # If there is a single completion left, remove the description text if ((${#COMPREPLY[*]} == 1)); then __%[1]s_debug "COMPREPLY[0]: ${COMPREPLY[0]}" comp="${COMPREPLY[0]%%%%$tab*}" __%[1]s_debug "Removed description from single completion, which is now: ${comp}" COMPREPLY[0]=$comp else # Format the descriptions __%[1]s_format_comp_descriptions $longest fi } __%[1]s_handle_special_char() { local comp="$1" local char=$2 if [[ "$comp" == *${char}* && "$COMP_WORDBREAKS" == *${char}* ]]; then local word=${comp%%"${comp##*${char}}"} local idx=${#COMPREPLY[*]} while ((--idx >= 0)); do COMPREPLY[idx]=${COMPREPLY[idx]#"$word"} done fi } __%[1]s_format_comp_descriptions() { local tab=$'\t' local comp desc maxdesclength local longest=$1 local i ci for ci in ${!COMPREPLY[*]}; do comp=${COMPREPLY[ci]} # Properly format the description string which follows a tab character if there is one if [[ "$comp" == *$tab* ]]; then __%[1]s_debug "Original comp: $comp" desc=${comp#*$tab} comp=${comp%%%%$tab*} # $COLUMNS stores the current shell width. # Remove an extra 4 because we add 2 spaces and 2 parentheses. maxdesclength=$(( COLUMNS - longest - 4 )) # Make sure we can fit a description of at least 8 characters # if we are to align the descriptions. if ((maxdesclength > 8)); then # Add the proper number of spaces to align the descriptions for ((i = ${#comp} ; i < longest ; i++)); do comp+=" " done else # Don't pad the descriptions so we can fit more text after the completion maxdesclength=$(( COLUMNS - ${#comp} - 4 )) fi # If there is enough space for any description text, # truncate the descriptions that are too long for the shell width if ((maxdesclength > 0)); then if ((${#desc} > maxdesclength)); then desc=${desc:0:$(( maxdesclength - 1 ))} desc+="…" fi comp+=" ($desc)" fi COMPREPLY[ci]=$comp __%[1]s_debug "Final comp: $comp" fi done } __start_%[1]s() { local cur prev words cword split COMPREPLY=() # Call _init_completion from the bash-completion package # to prepare the arguments properly if declare -F _init_completion >/dev/null 2>&1; then _init_completion -n =: || return else __%[1]s_init_completion -n =: || return fi __%[1]s_debug __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "cur is ${cur}, words[*] is ${words[*]}, #words[@] is ${#words[@]}, cword is $cword" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $cword location, so we need # to truncate the command-line ($words) up to the $cword location. words=("${words[@]:0:$cword+1}") __%[1]s_debug "Truncated words[*]: ${words[*]}," local out directive __%[1]s_get_completion_results __%[1]s_process_completion_results } if [[ $(type -t compopt) = "builtin" ]]; then complete -o default -F __start_%[1]s %[1]s else complete -o default -o nospace -F __start_%[1]s %[1]s fi # ex: ts=4 sw=4 et filetype=sh __%[1]s_debug() { if [[ -n ${BASH_COMP_DEBUG_FILE:-} ]]; then echo "$*" >> "${BASH_COMP_DEBUG_FILE}" fi } # Homebrew on Macs have version 1.3 of bash-completion which doesn't include # _init_completion. This is a very minimal version of that function. __%[1]s_init_completion() { COMPREPLY=() _get_comp_words_by_ref "$@" cur prev words cword } __%[1]s_index_of_word() { local w word=$1 shift index=0 for w in "$@"; do [[ $w = "$word" ]] && return index=$((index+1)) done index=-1 } __%[1]s_contains_word() { local w word=$1; shift for w in "$@"; do [[ $w = "$word" ]] && return done return 1 } __%[1]s_handle_go_custom_completion() { __%[1]s_debug "${FUNCNAME[0]}: cur is ${cur}, words[*] is ${words[*]}, #words[@] is ${#words[@]}" local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local out requestComp lastParam lastChar comp directive args # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows to handle aliases args=("${words[@]:1}") # Disable ActiveHelp which is not supported for bash completion v1 requestComp="%[8]s=0 ${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} __%[1]s_debug "${FUNCNAME[0]}: lastParam ${lastParam}, lastChar ${lastChar}" if [ -z "${cur}" ] && [ "${lastChar}" != "=" ]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "${FUNCNAME[0]}: Adding extra empty parameter" requestComp="${requestComp} \"\"" fi __%[1]s_debug "${FUNCNAME[0]}: calling ${requestComp}" # Use eval to handle any environment variables and such out=$(eval "${requestComp}" 2>/dev/null) # Extract the directive integer at the very end of the output following a colon (:) directive=${out##*:} # Remove the directive out=${out%%:*} if [ "${directive}" = "${out}" ]; then # There is not directive specified directive=0 fi __%[1]s_debug "${FUNCNAME[0]}: the completion directive is: ${directive}" __%[1]s_debug "${FUNCNAME[0]}: the completions are: ${out}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then # Error code. No completion. __%[1]s_debug "${FUNCNAME[0]}: received error from custom completion go code" return else if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then if [[ $(type -t compopt) = "builtin" ]]; then __%[1]s_debug "${FUNCNAME[0]}: activating no space" compopt -o nospace fi fi if [ $((directive & shellCompDirectiveNoFileComp)) -ne 0 ]; then if [[ $(type -t compopt) = "builtin" ]]; then __%[1]s_debug "${FUNCNAME[0]}: activating no file completion" compopt +o default fi fi fi if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local fullFilter filter filteringCmd # Do not use quotes around the $out variable or else newline # characters will be kept. for filter in ${out}; do fullFilter+="$filter|" done filteringCmd="_filedir $fullFilter" __%[1]s_debug "File filtering command: $filteringCmd" $filteringCmd elif [ $((directive & shellCompDirectiveFilterDirs)) -ne 0 ]; then # File completion for directories only local subdir # Use printf to strip any trailing newline subdir=$(printf "%%s" "${out}") if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" __%[1]s_handle_subdirs_in_dir_flag "$subdir" else __%[1]s_debug "Listing directories in ." _filedir -d fi else while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${out}" -- "$cur") fi } __%[1]s_handle_reply() { __%[1]s_debug "${FUNCNAME[0]}" local comp case $cur in -*) if [[ $(type -t compopt) = "builtin" ]]; then compopt -o nospace fi local allflags if [ ${#must_have_one_flag[@]} -ne 0 ]; then allflags=("${must_have_one_flag[@]}") else allflags=("${flags[*]} ${two_word_flags[*]}") fi while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${allflags[*]}" -- "$cur") if [[ $(type -t compopt) = "builtin" ]]; then [[ "${COMPREPLY[0]}" == *= ]] || compopt +o nospace fi # complete after --flag=abc if [[ $cur == *=* ]]; then if [[ $(type -t compopt) = "builtin" ]]; then compopt +o nospace fi local index flag flag="${cur%%=*}" __%[1]s_index_of_word "${flag}" "${flags_with_completion[@]}" COMPREPLY=() if [[ ${index} -ge 0 ]]; then PREFIX="" cur="${cur#*=}" ${flags_completion[${index}]} if [ -n "${ZSH_VERSION:-}" ]; then # zsh completion needs --flag= prefix eval "COMPREPLY=( \"\${COMPREPLY[@]/#/${flag}=}\" )" fi fi fi if [[ -z "${flag_parsing_disabled}" ]]; then # If flag parsing is enabled, we have completed the flags and can return. # If flag parsing is disabled, we may not know all (or any) of the flags, so we fallthrough # to possibly call handle_go_custom_completion. return 0; fi ;; esac # check if we are handling a flag with special work handling local index __%[1]s_index_of_word "${prev}" "${flags_with_completion[@]}" if [[ ${index} -ge 0 ]]; then ${flags_completion[${index}]} return fi # we are parsing a flag and don't have a special handler, no completion if [[ ${cur} != "${words[cword]}" ]]; then return fi local completions completions=("${commands[@]}") if [[ ${#must_have_one_noun[@]} -ne 0 ]]; then completions+=("${must_have_one_noun[@]}") elif [[ -n "${has_completion_function}" ]]; then # if a go completion function is provided, defer to that function __%[1]s_handle_go_custom_completion fi if [[ ${#must_have_one_flag[@]} -ne 0 ]]; then completions+=("${must_have_one_flag[@]}") fi while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${completions[*]}" -- "$cur") if [[ ${#COMPREPLY[@]} -eq 0 && ${#noun_aliases[@]} -gt 0 && ${#must_have_one_noun[@]} -ne 0 ]]; then while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${noun_aliases[*]}" -- "$cur") fi if [[ ${#COMPREPLY[@]} -eq 0 ]]; then if declare -F __%[1]s_custom_func >/dev/null; then # try command name qualified custom func __%[1]s_custom_func else # otherwise fall back to unqualified for compatibility declare -F __custom_func >/dev/null && __custom_func fi fi # available in bash-completion >= 2, not always present on macOS if declare -F __ltrim_colon_completions >/dev/null; then __ltrim_colon_completions "$cur" fi # If there is only 1 completion and it is a flag with an = it will be completed # but we don't want a space after the = if [[ "${#COMPREPLY[@]}" -eq "1" ]] && [[ $(type -t compopt) = "builtin" ]] && [[ "${COMPREPLY[0]}" == --*= ]]; then compopt -o nospace fi } # The arguments should be in the form "ext1|ext2|extn" __%[1]s_handle_filename_extension_flag() { local ext="$1" _filedir "@(${ext})" } __%[1]s_handle_subdirs_in_dir_flag() { local dir="$1" pushd "${dir}" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return } __%[1]s_handle_flag() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" # if a command required a flag, and we found it, unset must_have_one_flag() local flagname=${words[c]} local flagvalue="" # if the word contained an = if [[ ${words[c]} == *"="* ]]; then flagvalue=${flagname#*=} # take in as flagvalue after the = flagname=${flagname%%=*} # strip everything after the = flagname="${flagname}=" # but put the = back fi __%[1]s_debug "${FUNCNAME[0]}: looking for ${flagname}" if __%[1]s_contains_word "${flagname}" "${must_have_one_flag[@]}"; then must_have_one_flag=() fi # if you set a flag which only applies to this command, don't show subcommands if __%[1]s_contains_word "${flagname}" "${local_nonpersistent_flags[@]}"; then commands=() fi # keep flag value with flagname as flaghash # flaghash variable is an associative array which is only supported in bash > 3. if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; then if [ -n "${flagvalue}" ] ; then flaghash[${flagname}]=${flagvalue} elif [ -n "${words[ $((c+1)) ]}" ] ; then flaghash[${flagname}]=${words[ $((c+1)) ]} else flaghash[${flagname}]="true" # pad "true" for bool flag fi fi # skip the argument to a two word flag if [[ ${words[c]} != *"="* ]] && __%[1]s_contains_word "${words[c]}" "${two_word_flags[@]}"; then __%[1]s_debug "${FUNCNAME[0]}: found a flag ${words[c]}, skip the next argument" c=$((c+1)) # if we are looking for a flags value, don't show commands if [[ $c -eq $cword ]]; then commands=() fi fi c=$((c+1)) } __%[1]s_handle_noun() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" if __%[1]s_contains_word "${words[c]}" "${must_have_one_noun[@]}"; then must_have_one_noun=() elif __%[1]s_contains_word "${words[c]}" "${noun_aliases[@]}"; then must_have_one_noun=() fi nouns+=("${words[c]}") c=$((c+1)) } __%[1]s_handle_command() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" local next_command if [[ -n ${last_command} ]]; then next_command="_${last_command}_${words[c]//:/__}" else if [[ $c -eq 0 ]]; then next_command="_%[1]s_root_command" else next_command="_${words[c]//:/__}" fi fi c=$((c+1)) __%[1]s_debug "${FUNCNAME[0]}: looking for ${next_command}" declare -F "$next_command" >/dev/null && $next_command } __%[1]s_handle_word() { if [[ $c -ge $cword ]]; then __%[1]s_handle_reply return fi __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" if [[ "${words[c]}" == -* ]]; then __%[1]s_handle_flag elif __%[1]s_contains_word "${words[c]}" "${commands[@]}"; then __%[1]s_handle_command elif [[ $c -eq 0 ]]; then __%[1]s_handle_command elif __%[1]s_contains_word "${words[c]}" "${command_aliases[@]}"; then # aliashash variable is an associative array which is only supported in bash > 3. if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; then words[c]=${aliashash[${words[c]}]} __%[1]s_handle_command else __%[1]s_handle_noun fi else __%[1]s_handle_noun fi __%[1]s_handle_word } y !19^}qU=fI)i5Y%-Q9])U !} E6m ] ]MEA=2u.Yej-}5qmaMA% 1J*:- %  /DTel|fi̦v8vvy<@ zp(zv(ă䁧8Lӧۧ(Dmx`t]`]X]]]OXE I \@ '#000p00/Hvdc`d,>Dx((L *- *L@ lv`,(,,T),, ,,,,<,L,l,\,,8,\((($(4((,lb+***,,,S++*HG,,,,,k0.&ԌP<}dxX0:001P1h,xxLww#  D x   X P? h &  H8  c 0$   @T  t|м4  <     < d  x    8 l    X      8   @ h     8 `    H p  h d  ,   @    P |rslt u,kM Ph t̽ 4|x [,  oЪ d h D CML2 L<X|xHl\5l777777666j76661(D lP]h\t^$`&_'_$(_(_ ]̱]]] ]Hoo8o4o%q|7p4p>pep.+[*t<qJhJmJXlJnJLkJ`KlJD@ILhKKMLTM,4Nl*N'NȑN@ OOOPPPx'08pRHR` R`Rp R RR RPIIR$K<)LJlJJ,J JLJJJLJ JJ@IDIEI(FIFIFIGIAIhAIAI8BIBIhCI6@H6H6| 6\c6455(6L:69605G6865(6p'6$ 6 651< 74387La1x1b1{]H[]1===ؽ=xw%w\:wwd&Lvv\vvvvvTvv$vvhd%h@x` NiKipi4f4Yjcj$k@kkg0gX`Hm̰mtmlG EmnnLf nn,p\,pL,p҈ӈӈ|8>`%Db%L3?$4??_?|`?a?a?7Fp/F`/FPFج`|l <!Hdɂ͂ЂނقhvDd0; 0䱁h0ʁāl#P'h82l#I[,Lԓܟ$ՁځPށ(PD4I$Mh_\YM8X[`dqPh(lhlkps%pL^-4숅|`˅ ˅˅<̅hͅͅ΅΅………ÅƅƅDžDžԃ؃݃υlЅЅхąąąŅȅɅ,ɅɅ,z|؈D~ls`{$)D,9|G.D2?X<ઁp\Ă4| d% (<<ȂDʂՂt̂<ςdۂׂt,`9.@$΁ĴԷ$Ɓ, L-<x"%`4,0 PFxV +$,Чp젂(L4 ԁhׁ,$ف|܁`BE`SdGHK [VKHR\V]m\fp( @ tj,my(nqx|4Tl0d\e>~7$pWG@A"; 4,tT (/"N$        !          A      0     ! BB  @+*   DD              !            ,,        !        ' * !@@P@    ) IH   %!    P X C@00 -)=!!(&"@10  K@%U c    a` ?II      # "  %$!  ) +#3'! ͉a&Q!!%%#1CCAKKK! A@ !C#     )     !   3 $  T 1!11!SA  31 UC "   3    & >  * II II    J LH,(  U  !  %      A@A!   .    #2&        - ( ! !!     B -    P  *    0@ wu   S  %     N        m                #!       0     0     **  " $     %!    $    3#  ((   C G #CC@) ! C  @  B) " b     #  ~     k &""=?  0CA@ (!!fg@  L  SQR--,#% D 7 7 7  77 7 77 7 77    *j* B       ]`a`      `AK 33 3fF I  K K K    @`@  IIIIA        ~  >   O  111 I C@A  e  )!"       W      W W AA@'!cc` 7'!    A  %C@C  CC  ! ! P P P CAA      #  @C #   c    ME@           ) ! IHH*   @@%  1'& c jj S     $@      =  DH@0    C 0 !!B  !d  ((  # SQA !!!     @ # "+# S ak D@D/ / L L 5 b b     Q  oma $30  !?)    ga 0  !!322 7  @ ?    !!UT &"             i(  AB    DDDD !%&                    4*    @            &&&"  @j# @     !# 7[   !       )    CC@A   (    #!  !       0000 & !  ##         +) +   !  ##!! 50        $      "! !    "FF&gg` &` g` @Pp      III 3#   ?3    ^wW    CC@CCBB@ "" "!! !      SSP@#""           !    CC px|    $   O  !!!!!!UTT   CA@@     KAA@ *     UUT $,  8 &GGGG T -%% **       G@@@   02     bc~r!!! (    @      330 )( **@  @ !!   )(a0!   Ѐ //# $' - *(     @|&% ? ( `x`  `   @CF@ !"   L     LH ! ! !@          M    -CCAA@     @  0 0 P   @@xA` @AJ@H ?  I     @      KIKKK      "   B   b "BEEEED@       **(  ! $ '! A T T@     2  $ " #   $ " ! 0 $!C   bE  (     & 3 FDDDD      !      I 0 0  ]]]]    %$  禢     $ +++++ $$ 7 7 7   q@ACBEJ @@AI@   -   UZ Z --   "94 RPb &4<  EDa`g   g KK    UUUQ cCS      IH    L@       + +   >8   ! " '# ! '#   K481 +  KI  K+   7 !   [[[XP $"!     **      !!!!! AAP  P PP  K   QPA    0 * !!! AA      &$  I  "aCAA@@ $,4 :%5=  c# @+(())** **    @@bA`@ 62   qq CC@C@    )( @```@     M@ PP       ) FGf     c A    ((  ** QP18<6 2  +     ?  tABJ ***  @@ !! 0          $$$ +J BB  "330 *****3300 aa      PQPP  !! !!!! 0  #@  aI#3    #" "F "#"" """ j**aq(      ]]M    SRPPP $!SPPPP  f$ ()     )    0     8  Q@PP@)   LHB ;                                $              %$%$$$@          02:>       "#:" $1(  82!   () ;       L @ L L L@6&&&&&EGd\l  + )( 1! ))))((@JHLA@   @ $$$$ $$$$    aaaa        @ #  B@           AAAA@@D@NED@          ++*"    0   BCih@CCAAA@&'&"     AAAAAQPR  @DLBA@@DLAB@   #      $4&,- %$$$ QP      ## ### @,)8p| 0("    UUUUPP----(-  ( GeQ  $0      WWSSQP@H@DBA             (! Q (       IIIIA &$$   " &"#&&&&&&   !!!!     $          6%=%!$<8;        0  "  @      @@@OCBP)((((   VUTP@! C     A   D   #    #   `    @DEM@GF   #!   ) - -    ZSsrT          ONL    L   IH4$ 0 "*&'" -----, @     DDDDDDD     0 0  08 $"     ) U    B "   BB " 0R|  c    FF H  I  II 1   ``    `É  !5% 10 0   0  5555  22    UT +)+$4   U   -    " $   1d1d   5%%%      )    ```U   - UU  TTD@BAH@@   ? AA  &&&&        @@AIMC@ IH  HH         %  %         @     CC@CCC@@A@ECGH        kk w       )))))!    ****      $ ###  * 9((   P %%%**  zzz     C@@  !!!!!!! e  $ ! "   ****"   08!'!   3    @IA 0     F  c!!          8   P! TT 0   @ 13 ''%%%%! UU I ss`TP  P $$         BFFFFFDD !    @@  " "'?073333  @@@ @    !!!!! PZ      (       # B    D     #!0@$6 (  ""   B  )         '''''! @EaACB@ "*" 133 !   @ )((       ! 3NN ` uttttt2       (( I'#?>><8   ~D~D  ~d~~TT~TTy13u<`fmM1<`mM1<`fmM13u<`fmM13u<`fmM1<`fmM5X 5P 5T !<"l%O&*+'@`\.0R0"+h h ,(W0W0W0W8p%90!00 /=7</=76A\Ad.Ad.`H1L&04L& 4YNk6RR`S| G<cB(l\Z0/[8*hL28%*0L/c`Cc\@d0W`8`D`P!tG6!!8mhTh""0I0W(nd09q@$!hr-G\<l"-z-z\\<x"} o~01~! ! <L<`| \ ȆD7|0TL2L%!?@9!xy0 ~@<7J\',DȟH! ,p((=pTd*4t4< ˗<6˗x6Ȇ7N00G6Lt*PҲ0QPQ0г?H xy0R`<,}PGLzG6DG6Tܷ0ܷ06P fH0H020%H0H0H0>0ӽl/%\OgyhFӽH/&0',Hb@<@<@<@<@<@<@<@<@<@<@<%8%8"XI! G6 @<5T & *9T9TC@ R080@?X~0?\,r'X&L&L<0@ L4hYNHkN0` 81u *TǘTtZ#TP#T[T0 x@T;7J0<0~Dp QT <<` 0c0c0cTT>h9T;t,TH60X0XpXeJ|?t<>p9w6|?kt<p96 0/8ST@SThST"T(#T TTS\dT%%&&')G)G@*O*X%*T%'X,X,;,;,;,;g-?B)"B)"#/T/Tt/DEQ0Q0_1hs_1hs_1`s0DOs=30`]3H -w$4x44s=s=60 7I7Iw>40J0J@8v @8v B)"B)"TT8<LO0ZDOTDNDW.A8UR8.A8U.AU.A8UR<.AU.A8U.AU.A<U.A<U.A U.A8UR@.A8UR8<R8.A8U.AU.A<UTLIDpSDYS`YSDY4K0-0I<VIXVIXVIXVIXVI<VI<VH`BH`BH<B.A`UKTKTITAT'-RTUTTWRT^OT BT@Tv 1<`fmM13u<`fmpr rr nTO0oTcoT~nTI oT[~oTrpnTDnTVZoTl^pTpT6qT:pTpTqTpTpTpTvy"vy"z yTqxT`7zT/|0|0|0|0s=s=d~`pBpBpBM0k0k݃G݃GUT>T'30`(hQ06]]KL kb|?t<Up9ɍ6ܒb\0]<S9T 9G|?t<p96TT8STW H9 Þ````xx|x||||^TxTޞTTTÞTAhH۫p0[d[dg0g©0PDDs=s=s=|8dZT'T'4-0е0۫|T0TTcrTZTT_ TTdTTpTjhT5T!TRT.<T'T|T=T)mX?WTlTTT&|8<STw\Cw\C0+!0\+<+w "TTHHhHd hs=6D06D0|0sLl"T"8|06D6D6DD_6D*|WXHHC606060"Tstl"T?0C0|?t<p9F6TtiTi"`"T)P)TP>>TT T T&T&T\+\T+%TtiTi"`"T)P)TP>>TT T T&T&T\+\T+AYXG-w0g0ks\=|`q@asl=``0 dZ P`Z P`Z @`Z T`A7 t/ooo(v\vT0Hs=vlkd770H7T+T#%K#M#TO#TOd2%s=%L(de)02%T0*-X?$TD$T'T%[#T)#T0(T/F(T;i(TC(TUe)Tw*TT*T5#6p9:=Y>@B [C7vW0 W Y(7YHs=<zs=s=w>0s|=w>0qakb kb kb B)P"f#RpD,o }o }o }o }s=y |0Dw>TqTTK#Mm<*`q\z00L̎=sd=s=K#MTB_00.4(s =Lq0a8l Tq70IT<K#M0bs=E,<NکTH03wTTt6)<6i|?Yt<cp96|?ft<p96\V<\l00L+0aL Tt6_<6|?Yt<cp96|?2t<Wp9|6ZhIZ<I@8Z8IllTZTITBTTT+TTcTaT wTT,?t tTTTe0 e0 STT0ST\0cTTgTVHTRTb LF[%h w\<ST%+0L-4/-4/7`x?Tq?$dx?xdc T8 #09I%T0KhXKTXv''0.0R0R<RTtC>TDST,-0a|5|5|/7bh/{|/470<A0NZ19Z19Z19Z191<++3+40x60c60g60k7to<h9@9@9@999@9@7;0 00=l>T["0qlas0lT<STTB@B@B@BC*4P&0NEX.E\2F@F@XHJH4P&0N:KA:KA:KA+(+$0NEX.E\2GN,GN,GN,N@N@N@s=$PI$PI$PPI$PIt+t+e`Lt+9@8(KDX#VX?.T8T |,TF:T%:%:%:%:;TQ=T%%::=T%%::CYBG0,0,s4=i'0u0ttTtTNtTtTatTwMB)P"<8yH-={X{{l7<8|H\w>8|l\~@~~@I~@7I45ps=@s="`LB)"B)"45He<pCLCm0uTtTETTT0oB)0"oooo0/0ѝX۟<<WD<٠DtdDD%ts=!TAT=JTQsTXFTT~~7I~G0GLGGaaT|T1$D1D0R<NB)0"d80L02[06[x6:Ll2Hټ0G0q4D 0D90/L02d88@Ll20/L0206x61:Ll2B)0"L02h88*@Ll2L0206x6:Ll2L02B)"Ll2b0bb0O0BL02 h5 5=Ll2TlTsT ݃0G݃0G|t(|(|(Z 0 |(|t(00|t(|(0P0W0803|(F00v0!00|(0u@0G`v`f T0F0!00h386386@0v 3@6t3T;t3T;t3T;50h 0B50h50h50h50h50h50h50h50h@v G=l|(t04T~?j?0jCDOEDD\OED#FH#F\G@u"T"TBD-BD-BD-BD-BD-0BBD-BD-BD-BD-Q$B8-0S;TU|B8)M`oWM`tB8-MDQ$(SDH0'0'0'0'½0-½0-½0-½0-8q~cJDGH"TG@u"TL2#FH#F$#FHG@u"Tm0&m0&tn0Cn0Mtn0Cbo0`bo0`G@u"TLxj)MxoVTTTeuTeJMu6t9@ST-x|?xt<tp9u6yPz8{0641hj@Pv 8p'-R8U݆Te݆Te{8{h$O2p2p0OOOOOO,OOOOOOOOOOOOO06sL=2i'0i'hT(`?ԣ`?{T|T1V0<0T61`0O2T(3T41j0TB2T0 xx88ҳ0ҳ0ҳҳ|ҳhMWlҳ\|t(|t(:|(jT7T)T"!T-0IKhh0IhIA0M03\`ti'0001<g0dTgLx=..L.F&F&Fx&F&F|&F&F&F&F&F&F&F&F&F&F&F&F&#Fls=KB)P"s= 7 Plhvpvxvvs=@U^pls=0 HCpCsl=s=sl=8mB)"060xT o$LH2@STDST@STTXTTT0T`TTXSThDSTT0\!xuLD2b9-TڊP9-<9-4ڊ4ڊ49-4ڊ49-Pڊ4ڊ4ڊ49-49-4ڊ4!u9-4ڊ4ڊ4ڊTڊ49-49-4ڊ4ڊ49-4ڊ4ڊTڊ4ڊ4h{#XdTQ=s\=]s=/<t/Lt/0t/0tGV0Vs\=TTsD=00O@TS#T#TTbh#bdUT"D$#`wB)P"''0* 1(1(2HUw 8'}0 &T'T'TH(TjATAT DC83FEkF/kF8/C03 Jh6C xJJJLDLHLLEMJLP}R\RkR0kRdk R4| R\|VU\U0tCl3@Pv OdO\\`vy0"bwbw{lGDTkT-sXrTv0 v0 v0 v0 v0 x<}P006XL2?ZvTX*wTtԃ;0A05I@)uD.0/\c(18(68L@,Q0,X1܉\6\hLL,Q8,aX1X6hL?L,2Q?8,b`Bp*Bp*`QhptT20%45PQ PPPRPS@c?hIP)e0)0$0$)T.T*>TlTTQGTGITIHTHJTJMKMTKMTM|L|TLޣNޣTNOTOQTQ P TP|STS|RTR@tT@TTtVTVqtUqTUפtWפTW pX TXopZoTZ;pY;TYp[T[֥p\֥T\TBTETfoTbTS\dTn4:hQzs=,Q0<0<TpTs=000 ?T6TbTTTT T.TUT|TTTTTATiT T)T;T%B)P"JTT?T.zT7TIAPEAPEA@Ef8)L)pT T9T_TZyTTT7T yTT>T9+TJTAnTn 0XTw09 +P\i Ml8HOxcY1]xc`xcwLdXe87fd,jx`kx\|ApXmTwThT`T\n TXT)@p102=$ Y} Q,\CDpI0=K _HT<l'i DMwXp| j0qTߢTT+ T 0t000009_i00pX?T T Z @#r0+|9)T# L11H1,{0s.rpr0DD @;  M ;TT h}  0. 0;  .] 3] 3  TT! 8s=qp( 0OW) qpU- I[07L _hdؠ0()5 0k8 8 T:p|pU41jT450/4tW) q"E L T>%= TVJ LnDCtL DCtL s=0CC0O LDM TDM TCtL XCtL s=#U #U X x X TY TY TDZ T+oZ T0B[ T[ T\ TM\ Tn\ T\ T \ T%] T] T^ T`^ Tg xWi @7Wi @7Wi @7Wi @7Wi @7Wi @7Wi @7Wi @7e 0e 0e 0e 0e 0Wn @Wn @Wn @Wn @o o Bp p r \0s \6o T T T T TmT T mT T  J D D> Js l ls=Zt 0Է 0h 0HTTT8STPSTTT L8ST@STDST<ST<STDSTK`X0 PGٷXtt L HwPST 0* 02 0F00 %TPST 0E 0T: 0j 0T: 0j G @G` AX Wn4n48ST LGs=s=xx|-w<w<Tsl=8STT0F n2$ L& L" M 0 p 0 p: xM; xM}= <]A |w4E <I |wjf Z 0/ i ! Z 05 n Zo V" Mr & $  ʾ 0 w y K! F 99 y) q TF T T; _؍ W Tw Bj 4 ,- ,%  . . T TR  T T,p TL> Jc T T T 8L @7 |0s<=1 <t1 <t <zk m W W W W W T TWͼ T TK TY° T] Tg۹ XF XLT   T$ T T L@2 TC 0e @t1 tw1 0w d | 4G_r   L<8STqa@q  dT8STT 0( (A 0s =\L\s=s=0641j8 =T =X t  0_ \ `0xxx d GKTX 8G"j"j8ST8STs\=TxT < 8ST 4_ T  T  T T T T TE G T( D TW @ST$ $ PPW, 0W, 8RT4PP; < 2= $( S<STTST<ST@STTTSG T8G T<DD:Dh,p X DFW W W TX lO\O\O\O\O\O\O\O\O\O\O\` 8O2^ T`` dO2^ T`2^ T`8d'T|d 9Ts<=8x'W pi |TQn |?n t<c p9Nb 6f f f f f w@wLwwwwwPP<sJt2 0"T"T"T"T%%::PP JE >p 0mTU 0"00 < D < <L02B)"B)"" %ֻ 86ֻ 86  <0L6= D2B)"J 0 << Tco T0 T` T TL Ti T+ T^ T Tī T T* |W 0 Lr @rqPa Lr @r P @n @nq XRF XX+000+0) ) T, h t T9 T{ T T/T(sl XKDq T] X]Xo x T TTx |QLDa a  p 0Us= TU T4 Th TZ 6 p=RT4 hrDST@Se P 0t! \< @r$ 45TTTTTT<STTTD ,'E ,J *C JjE BC ?_C 6S 0 OT 0A ,'2 ,b *@ J 2 B9 ?}@ 6q 0 r 0q T r TS T OT TPPs4=i'0 0"T \p;  T 45l T N Q 0T 0T 0T " d \ \" Tp T T T T TG0 T T T" T TK T)6 T, T T~ Ts T" T T< T` ` ` ` `  LΏ @s 8 Pxu D. TŊ <` 3` 0+ pJ dJ dJ dh 0 0j 8F  o `o To T Xp Xp` 0 y; L3; 3 2 0 7p 12 0 7p 12 0 7p 12 0 7p 12 0 7p 12 0 7p 12 0 7p 12 0 7p 10 Ty3 T3 TQ T-Q T.Q T+ZQ T,cN T!+R T/qR T0U T@ V TA{U T?^_ Tk^ Tgo^ Tf_ Tl\ Ta_ Tj;] Tb^ Te] Tc] Td k P+ T[/ xa/ xa+ T[B)h"B)" lѐ `ST4P uT% 0% 0@2ڗ \Mڗ \Mڗ \M 0vڗ \Mڗ \Mڗ \M 0v pvԦ 8}Ԧ 8}Ԧ 8}O`Ώ s hΏ sΏ s lΏ $sΏ s" "  Kx h KΏ sΏ sΏ sΏ $sF Ώ s [ h  | h   h Ώ sΏ sΏ sΏ $sΏ s " h "Ώ sΏ $sΏ sΏ (sp Ώ $s  l   h   h Ώ sΏ $sΏ sΏ (sΏ $s " l " zō , z zō \ z <z zō , z zō \ z <z zō ,,&< zō \ z <z\  0\ \  `\ \ h\  0\ \  `\ \ h\  0,&@\  `\ \ h         x x xN N N N N N ڗ dMڗ dMڗ dM p@@0v @0v @0v @0v @0v @0v @0v @0v @0v x X@0v @0v ]T@tv @0v @tv @0v VTO0@tv @0v }0 BO0 ((ѐ hѐ `ѐ hP `uP `uP `u<ST4OOO@STOL` `  XZ@Pv  0O` 0O0<STO0O0k <Ck <C @D D @D DӒ @f lӒ  @   Se >e e e8e  xz% 0 T( T,w T T T˧ T TDڗ TM TvSeT>Ԧ T} T T T T1 TY{/T/T5TLd5TIW9Tv:T<T ;T0 0 T 5\?5T?T5TLTCL02C34C34,T B)X"-!-h!-!-h!-!-h!B)"`Gy0T-TtlTTTT?Z?Z?Z1,Ms=qs(=ZoXl0Y0U&0Q0E-xY-TYpx]pT]TaTaTeTeMTiMTiTdrTY'0rYRT4T7XSTT_018&DST8STTD_00u41H106@ST`ST81DST@ST<1#/hK#xM1'TbTX@ TJJTT@ TJ@ TJ TB)"0e$TH'0B(d.b**T*T)b9)q<aqa:psDl"T;8>dh>\BB)"B)"pCG8C34Ah4AK#0Mi'xG?E?0`%L0]%L]B)\"%L0]%L]B)\"%L0]%L]B)\"ppd%L0]%L0]%L]:pdp\%L0]%L]%L0]:pxpp0O41j0T6T|T:pp<@B)("X0^G`4GlX0 ZT4Z]pHqH^D4AD_ wc3g0]s=7;0]sh=:pT%L]4A0%L0]%L0]%L]%L]%L0]%L]%L0]B)X"B)0"B)0"B)0"B)0"B)0"B)"B)T"B)0"B)0"B)0"B)0"B)0"wc030Nr40(0~00+0)+0)4w0w?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`?0`%L0]%L0]%L0]7;0]0%00]%07;0]%L0]0%L0]7;0]0]0]Ȳ07;0]7;0]@T@T@T@TBTPSTpTWM0M @ST<ST V8STLh2}<B}B}Bb#F0$45dD .=4TLo''s={0w"T"TL 2$ @MhRTTTwTT'4b'Hb`ST<ST07wwwwwwT?XgTT<P'TDSTTT`STL%08)*<*<*8B)"QLDM++T++TTTT}M<\'/T=|@ST8STNthatRT4atat|80sH=TNt}: w0<o06}XDk}lk%D69&0%D6>G0;>G0;0__.`.`|Tk.hk.h,.P,.E/:E/T:_/D_/TD(UTtttt|8\PSTT\STTLSTPP LJB4nSTҵ8'Ex 0 RT4*T4T'4'R4ҵ'׭T%%sJsJT::B)0"k08QB)H"pTpDpRT4RT4pl:ppl:pqa<00LYMhMhMhM''sJ0pFsh=pFT_T_0.[hT.0` 0A LAd2,\ )0`,0AT[TT` AV >2V ,#aT5T5XTK%%sJsJT::vTaT|(GT45dZolA 0L~T{c}Th}Tq~T T’ksp=XxXxX0`w|%T4fT6T3{@{p{t8KpKZol~oLr45dW(r0T}sTwTd˦Tmȱ ])0f\\3a7#d0 @g CMS<fZo0l < < R<A@gLVqPaGs=s=s=g C'K!<d<Zo0l < d .d/d .d/ < R<@eLV<qPa Gs=s=s=f.<8s,=TFTJ1TN`XRg CO  zZolZole<$#<`j\{TqTqPX$H@qPa|A*}45e<$#<`j\{u+Tou+To,X"d-Hy.@qPa|A-}45e<$#<`j\{;Tq;Tq;=X$=H>@qPa|A>}45)J|)J-M|-MeNl!ND-eNl!45djT<+jT<+&U<.&U8.S8))T8*K#M\L/4t/tqpaqpaj0j0j0j0j0j0p,o045x"o01`T-^`T=#/#/T/Xt/Tt hTl#/T#/TYhTr/Tt/Tt hl hTl#/T#/TYhrYhTr/Tt/Tt hl hTl#/T#/ToTYhrYhTroT"oToTWoT/Tt/Tt+pT=bT xbT'bT-#/T#/TbT1 bT/Tt/TtʛHCpC0x0aUUO$7[AͰ`]ZhͰ4]Z4]Z4Ͱ4]Z4ͰXͰ4]Z4]Z4Ͱ4]Z4]Z4Ͱ4]Z4]Z4]Z`]Z4Ͱ4Ͱ4Z`Z`TTq0a}lqX'1P?`?01s4=''|,+0+0+0+0;T0sh=@D6+P<D'N00.09 T 0-T0,]K  !CB   (     HD          $              5%%%%       @  8:;8<        @x|[KCA                  A           !#%59  $%5 .,       !10 k   *(,)9   "227'  """%"% )    "        CC@AAAAA       TUt ? @AAA@A@@              * )      H@bDPBA  EEEE@DAE   @S@QQAAA         )   Z Z U*b   !   ! 13s  "  ̄        F      ee   *(      7                @@DD@AC@  $I             &           F& U  @A TT                     J  I         300 @HLJI    $,      $  CCCCCC          D@BB@CG@  QUU        3111  !!!   2  FGE   D4  "              0<,>. !!   @`pPr|  >>    ?     !             ####I "  %%(  H20   n         @"*  -@      @  0 @:: 0  A   $d<8*()7  |<   ?@  P !$(   ## !! #!*    *(       ##    Ȅ  @ "E* P          $$    IAAA 2:2@  @MIOKE@BD"DK$     OKBkCS   IAA 0 A!A1A)  @    C#      08<  ++))))( X\  ---   /.,  UTT  FBFBoVO  7  TT       `  f@  -  ]YY#-R `   @AHBBF@@@ @    Q      5=   9  IA IH     %    R&R&    &        !! ! ####   EE  UT    h  03* @@ KKIH    --   T   ! u t t    (          $&'''$$  @   (        D        10@@`@@@@      L ,     -%  -%%$   I$ )(((  @  D` A       BB   fFf     " ., &    ##!!      @    @         !!     OC @    0 CC@@@   EE   Q  *" @   '"         H  @@C@#      )((  )!!!   NN    @A0H b"" I               $(          $(     ++++ '7'" , +kkkkkk@c``  WWWWWW@SPP       PRR  ---------      `PH $                @HIIEA@@DB             $( D&$d,4%   $ OOOOOONHJN                1A@          TS Q@  ]PP]\PXXXP          A! `0  (          0`"b#*            0 4$!+)  @BRC #!       QP   7333         (0 <>   $  !QCKO   @   @   )()())))()    @        (    $,4<G---@-  UUU-!Cd--0 L- BB-- ,((,,-G--B-d-   - G--  G-G-0(--G- G-, -- |- - - -G- :888 )   @@$%d `-d`d--lF-84l-(G-@< -$$-0G-0G-0G-d0G- M@`- $@@\-)` -0G------xxh-80- "0G-0G- P  @--84-- 0 P@ - -G--- -$$--- -0,-HD -G- $ - $ -G-0 L--G- -|--,--d-$$, -40-m @` 40-- - - @-|- G- -($- G- -d-( -$-d- --G-lF- G- |-|-|-0,---@< --G-  -  HHP - TU00L -0 L-PPH - -LDX -x\TT --- 555555551!!-G-  LL - -4, - HD- !  - + G- "`d-"%"% --lF-0,-  $44!- IIHI-$ -1 d-d- - -H@@@!-@@@!-- tl4!--  $ -  &11 - 0,--  CC-p- K - ( A-- G-4T,-(D -x-   .-----  ! E -p-- L- -  --((!--   G- - """"00!- - F- #" 5-!!    G--MbLblF-D0 L-c1d1d  lh"-M lh"-Xlh"-d-|d-   G-  p-lh"--lh"---d- lF-p-UUUUd- -  --- -@@@@HH G-   HDP"-HDP"-d-  - ,- H@"-,-4, - f@   0 L- -PPH - II0 L-     01$$ @d-d- 1! ` -  NG IHHH IIIIAAAAA@@   0p`  IA d--      fvgc`hd  - G-  G-  <,d!- |- -   |-@ @- G- CC@CCPPPPPd-$- +*( - ?? -  SSk0 8c#   sssc  s`s` D< #-  (G- d- -- QH(- IH@8 -x-- CC@-J  d- - 0- 0- 0- G-    -4,d#-!!!ppt#-- HDp#-d@#-HDp#-   0  G-   CCC@--    HDp#-pp#-  1 ,(#-    @ G- JJJJ -0   @JjCAD@{H Aa G-84+-|-@` Bc BX[  G-   %  -|-@8,#-F-  |-HD -!   31110 G-  G-|- $ `D)-plh$-xt -xL'-PL-@-@- L!-( -84l-MM  - G- -%%     0,p -  "  SSC  - -    G-G-G-G-8(,%- +))())))(()   eee|-d-  ($ -($ - MM ) -I )-pH<X%-H<X%-   G-@ -,1 - Bd-((-,,%--     " :0 (2!tpLl#-d-  0 L- G-$$%-  T<4%-     $--0,p -T*-)00 C -+*  G- |- |-G-VB@  " %- PL-IEi{l`%-  B  BBBB '"P@%-  $ ( //,,,   - -,,-),,((,(  18  44(&-- !!!- -)))  <,d!- - C   3%!!$- -,$-****!!!!G- BBBB  #   -LD&-     Goknm                                    $(             +++++())()((   (             @ &                   $  $   $     %%!!               @ I@  (08   $        $!(20   11!!!       33333330000 UUUUU   `&6l$ 3aaAA@  R  3111    UT @     40::; !! BB @    SSC @AA6666  T  0     ( (     9------(-))))) %  TTP   00   -%%%%!! !! D"5      ED@   ggg     $ IHH IHH    _   p8>;@!  @@   k# ( -       `@ nll  D@ srr UL rrrU@  ;:>     !!!!!   qqq!   , 8 px    @  @ hj++(*(+++++(((   7U    %$6  MM  ---%% -%%  -%% -% -%% -%% -   -   RP T ss !!! r`    @(,- UQAA @ #           $%&$  Q CcSI      )@08:999 &B B!C         $, $    $UUTU    $FFF    & & !        .    EJEEJ # !I&$!!C&U-R-R-R        $         **  ("$  !  (     (    $@  #    (   (08<'@@!  B  ??? ?? ``  EEEEEEEEEEEEED @@2r@  @U@ B !C @8# I UUUUQ@Q   -$       UUUE  %%%%! PZXP "2 LMM       P  UUPUUSP  U     KIA   *H )"J  IIEAEAEAEAEDD PsD@9=800 **(   VRR( ,*" (!%64   "ccY VU  - UZ  << ( <  )( BA@IIAA!!!  I  !($0[[[[[[X@XX[ee  #""" K K aaAAAA  sc  CC C C  * * *C!C!C!CC \]h ^d;IIIIHI@@@   5 :2220  UE        CAE  -%%% -%% -%  -%%%      r``    $    AAAA@   !$!$!$!$  SCCAA@4 @@!    &"  ((VURUPUSSPRRPRRRRRPRPP RP$$QAA )((*@ H  I    @                 $    $                            $      (0$,   $(                       $           ! ) -$ M 5U -   $ @  N O O N   " T  $ "#fj@@A@>  @BfA            /  ,      00A!A!     ? ?H H   @@@ (@ @  @@@@@       GFCDE  +*( KAA  6088  AB`PD scccccc `x $<>$ @TTWUUQU   CC C A A A . P-  OOL  *   (     $(    08<    F     #@`$  ---%%  -%%%%  -%%%%%FFF  r``` @   r```@``@  JJ  MMM  +I#IIII   /  BB B ""    0 I  '%7- @ 9 @ @ ,00 C    Q4p"`""" @ A     H(@ @( OG B@@IA@@@@O֒   EE E E E E E FFEFEF@     $    $   $  $  $  $    $  $      $  $        $O    $  $   $(, $  $  (0          $  $(  $(       $$     $  $       $B'B &B &!C     $ K M   $6  @   $     $  WV$" `  @ 01 """"  $ ##!  $     "  @8@@@@@@@@ 5#@@ ?@? wwww7777  !"   $("b !(B4@@@*E$   -%%%!!! --- ----- @ @ @@UU%-R (R(R &H '-R(R'-R-R-R))( """"""""" @  QP  IHHHHHH  $  $ I I IIH@@@@ khh` (  $  $  $ QPPP    $    (,4<  $       $  $ -----%@   MMIIIII@@  $(  $P        $  $  $ H"  $ ssss AaA A Q "$4&* %$$##A   0 (   $ `1``pp`$```   $(,  $(,0** % $( $, @@@      08X SSQQQQAA@NN  $ 8 /@  $      $  !%I $$$$ ))   $   B&.&.   x tdE@A ($ CCC&IIH@@@  @@AI  $      $  ??       $ @xpBr`@!!  $I5%%%%%] ] ] ] Y   !  $            $  $(  $  $HH0H 'H %H 3  $  $$     **   $,4    $(  $P   @               (@@`  $      7  $  $  (@@@@  (,0435  $"""    B@BB  $@@  $  $ 0p  $  III  $ `   +++ + !+)!  A  $ MMMM  $   l|@XZ@ "a5 % DF 0 H*     @  ``hdpb`a` $(,    $  ``hdpb`a`  $  @@!}|z  $ - ,$$$ $$$    $  $ $(, dDT  $( @``aP@ a`a@@ III IIIIII@@@     $      $  $  $ A! @@      $ CC C C CC CCCCCC  (08@  $(,  CCCCAAAA    $  $  $,0      $ S A A A A A A A B B   $  +###   E  %@   GFB ` @QA@XP       A@         $(,T00 C      $ '  FCE"  $  $ CCBB@  $ IIIAA@@@@@ EEE @ $(,  (     $ $,  $  $(  $  (0  $  $      $  $  $(,  $    $  $  $  $  $  $$,48@    $  $  $ ?????/ !C   $5555  $ 5!#!)   $@@ I"I"I"I"I"I"I"I"H"I"H"  ` 80%!  `   8   A!jjj* hHL @ R +_!B!BB   ``````````` $(,4  `7  @  @ADHhjjjJ HH&&&  $?$4??? BB`p  $      -  $  $  $(9d2 b P5%%  (    @ UTT #1  $,:PPPP> > IHHHHHHHH @  @Ppp{}yxEyEpE    @AEAAEE@I III  @  $ A@@@@ @`@@@  `   @  $ 0 0?0?0000   H  b `a```@!p(pp0p  $- )                @  ???;;; ;    (((( !   `  (  $ -mmi```@`@@`       $   @  A!19J J  &0           PPPPPeTeT@@  !  T T  " @ UU    $b  BRbCAJ   $`    PXb@ "brvTP @@@@@@    EEEEEEEEEEE IIIAAA@@@@@ 8Ll~t8~hLn~PTt~lTn~l:$:$:$:$:$:$,P,~@0,`WC0xR<"C0xR<"! !`$4@$4o& `<o& `@:(:((}(})DG)HL)dKb)h|  +|~ ,td*0d*hz.0-<u10<10p1 +4117W17DWG60!6@5L8D*TL<W +dd*@;2DG6D!DH 2<H/=07#@6=@=X"XIt*PDUG6DDUG6PWW&04&4"XIt*P& 4CdD&04C|D&04CxD=l=l&04R0S0x@0;i24*<L*8L*LVPxTd*`@z@z!b4z!b PPPd@e,`[,Db,<[,b"0IQPY"0IQYot\<x"PLf9ql$q fqPBs4+"s"s("sx2{$0@s0``!\3.`CPxRT"FTi\ȄU <X,[,b0G6906ׅ|("LI"XIC0xR4"(|ׅt(!?9o|p!| L yG60!P0tx|G6TPfq\B!3.CxR" 5"s$@z7@z7=r=rTs8"=rp5 X8t$4h141!d-!-$D@$DxyRxyRt``t``xyhR5hM"0I"PIt*DPt*hP"0IQYDUG6_0jdҲ00`4ִ4,},}zx%h"˗6˗6x@X;j06,4b20%L20%HTH`H`90!8606DtUG6e`~"8IQhYY! ` `| 3 2 %@#!i2 * LPDfPlf(=r4x$=rHx =rD'0'0x!j|x!j||`x`dgy45MYNxk v|9wTL!j03\u8<8M<8<8<<    1 1       m  m M  M :(:($?,6@6<?06t?^\qwP6H6d?<SHS;,00|0|eJ S0XJ|A0Xytp0Xr0x2x2[%0"f%0.%0&Q%@ %l[%0"f%0.O(3b((4/b(8(4})`'H')X)@G+N+0"+N+"X,X!%--;$.Lg-<?0DO41j0DO41j_1ts-wQ2DK41LjQ2@K41jQ2@K41jg-d?3d`s=s=s=sh=8&8 8&8 8&8| z9xz9x;,b8;,g;~;d~;,~;4~<8<?<?A4.ADUA4.ADUI<VI$^Ko4K-^D_0J0 J 8IT8IT<L<9P9P.IlB)"QPD%tOR8RHR8RHR@TP'U0.AhUS\Y\S\Y\.A8UI ^.A<UX.A<UXR8RHR8RH'U0Rd'U0.AdU'U0.AdU'U0.AhU'U0Rd'U0Rd'U0.AhU'U0Rd'U0Rd.A8U@\v R8RHR8RH'U0Rd3uhR0R`R8AH`lNXWthhhSDYAD'IHV@I<V]LH8BJ8 I<VJH I<VLI<VPI<V:T5.ITB)"jAT.AlUST.AlUfTTU.AlUTT.AlUoYT .AlUOST~.AlU@AT.AlUVAT`.AlU}AT.ApUAT.ApUAT.AhUAT.AlUAT.A|UATO .AlUAT .ApUYT T:$:$vy"yzyzz0@{8Iph|0-ws=s=s=sh=02T~LspBf0HMhmH1` h` P]xsKd h0S`ܒlbGjDP9yTpXXyTpXX0tt!RsO Þw\Cw\Cw\Cw\Cw\Cw\Cw\Cw\Cw\Cw\Cw\Cw\Cw\C`9oTdTtTh5TtOTÞl<\@(6sx=ZZ\\EdZEdZFFEZEpZTPZ4ZP2h#6 ЩTj>TgITK[wTb[]xsl*0*0*0P|tg*lgt*lgt*N00nTP9g*lgt*Dxg*yTpXXlgt*tg|*t^hxXy`L0k0_ 0_B\ yTpXX|6DL6DF66DY-6D|6D.|6DR||@*<4|@D4T<'\(0<'\( : ~\~x|L`|L`,~TmWs = |l<6Uok88|er`_UoUho\Ahdw s= DA0 0 0 $]xs0 p0 Z `Z `r 8Z ` h \0SA 0cZ X` 0qZ H`r 0Z l`0S0S0S(hTvG(Ud h8vG UPXhv]\]0;`pZ7DZd70-;8;|#hR0 T T7/l7@/d7/d7/lp,xs=i%8t'0L)0)0+ c]xs)Te)h02H4L5h445<02H7lvs=02H7dv50A9Lp9hA9xp902H};lvs=02H};dv+:0=L=hY=`=hY02H?lvs=02H?dv>0BL@Bh Bx@B 02HMDpvs=02HMDhvB0MDTvMDdv!%!%k: :P k: :P 02X_s$=_s=8&8l 8&8l ifTB)"GGpD,pD,p`,p,pX,pX,GGhGGpD,pD,ydyHCzls=dhvGdUzHz0Um<* <fm<*<}XsL=s=k:0 : s=C7qa#02H02H02H02HpD,pD,Pb102H02H|Tʞ4j4Tʞ8jk:L : k:L : q<a?ңTN7dIq0aqak:0 : qasH=m0D$@dz9xz9xLt;~;t~\\\s=`,(})Lw0ad [b($4S_0_pTXTlTka Tr+HAHA82`2S,0S |7  7 8 ` m~l& mdLm7PBpqc<Lqaqa !,#56#$(T"Xt(xCt(Ct(Ct( Ct( Ct(DCt(<Ct(<Ct(Ct(Ct( Ct( Ct(4Ct(,Ct(,C$(T"XCC,<\C$(T"X$(T"XdLdLdLdLdL`Ld/0Ad(PlXl(P0 x9/|5 ,  !<' {7d$(T"X9a9Xo=l=llDS$(T"X|@0I|@0I|@0I|@0I|@0I|@0I02X' {7h$(T"X02H'{7$(T"X||C||Ct(Ct(Ct(Ct(8Ct(xCt((CF@FiF@,G\F@GhP0t(Ct( Cr+8:KA:KAP0\4&Hr+pN@FiN@pOh02Xt(C8(8L(02H]xs9/T|5T/T/{/T|/7LE|0NLET0NLE|0NLET0N0r+X0r+\(})L(})L~sDz90x;~8&8l 8&8l mxTB)"M} M}X ~~ Q4582X7HIH!s=$s=s4=yTpXXp'uxm\ƅd=M0**4B)h"%̎l=wd$D$TsTB)"1T45dրT7IDSޘ #%0<%%%P%ßL۟XLX>L W`L:XLT٠`HnILd`L` 0H0h~G\GG0t0bg-8?݃G B+N0 D0 D0$ D0$ D0 D0 D0 HD0 HDû0 Dû0 D0\G4q0\G4q0\G4q0\G4q0\G4qn0\MH0(B8\GDq0 @D0 @D`0 D`0 D 0 HD 0 HD0 D0 D0\G<q0 @D0 @D0 @D0 @D/0 @D/0 @D0 D0 D0 HD0 HDC0 DC0 D0 @D0 @D0 D0 D0 D0 D4 bLl2bh80 D80 D/0|/T70 D0 D8 D8 D?0 xD?0 xD0 D0 D0 D0 DL42B)"0BLl2L0 D0 DL42Ll2L0 D0 D}0 D}0 D30 @D30 @D0 @D0 @Do0 @Do0 @D0 HD0 HD0 @D0 @DV0 DV0 DO0ZDO0Xj|(<X\% <-L 1}0j|4}0j|4}0j|4}0j|4}Tj|0}Tj|0'`'#'8#qPht$H`$QX0L2\TV|(\TV|(\TV|(50h556L6tL02HJhAXyTpXX `B|(=<F>iJLAxXyTpXX0?'?P@Pv OB8BD-J8A@XyTpXX#F\L2G@uGƅ`=M00\G4q~stB8-~R\B|-TZl@'@@X 8\GLqP@h P@h @@X 0\GHq@qq8\GLqfP8fCgP*g?4j?j\Gq\Gqh\Glq8SPz4_z$}L}pK@X\A.A<U@Pv ߁P/Ah.ATUd(-w2plO2p,O2pO(L}) 0@#L%]s]sg2TT0hO2Ts=P)8)8OtpPGtDt}Tj|X}Tj|Xll(H})~0s@N045@ƅd=M0OLZDOLnDA$]xspT|({L$ lktDсTv0p`:ptp p \0F&8<&8l TB)"k: : !%!%0LL~oLrLHg+P\Xg+H\\K\Kqqd 0+$d K0/d03dC07@s=s=<me|eVsH= 0Tw>4w>U(sP=JLApXyTpXXJTAXXJTAXXyTpXXX\s<=45H8Ss=k00O1Tk@k80OcNkks=k0 s=$\$dJs=s=0\O"+0Y2,|ڊ8ڊl#8$$(.K\IKdPsp=|4i|T\s=s=k: :@ RTMs`=z0z8o0 ݃PG02H"td>/F8TwRj|G|@4{l{02HLgH02Hۃ8,0D,ɇ8ETEh0GHpp DP֐<f$8^ɇ`с|v{pbpY~s-ӣ$Ц<-ӣ@=03|p|0O3`08ʺl'04Li}i0g}ML1i0g}Mr0rL 'Rj"T"\011P D'Rj~xs<8S!lq<ap.G@D\D0PLp8pxD0PL\8 pp@D\\8 G 0HS<S <S<S<S 48(h8(L8vD w<;U0~_qha450( z)0( p02X0x8(@+LS@8(8(02h<S S PS0S48SX  \S<mo(XS0Sr0 D_D41Xj0641Tj06(0 +r'T+OZDOs=s4=01st="00.ʺp~hs0~skH}ti'0i'hr s =X1le6<N6(NP6ir6<+сvP6Hir6<+yTpXXR)Uh)Y L'Rj`0S0&<TX&<p&<TX0Pj46 0'RjHLS~sƅd=M0 H'RjyTpXXyTpXXHL`XH 0St@H 0<dv@ w@X @02XN045840`ScPj6@&4_^`45l@S0SY<<SSdS0S02Hs=s=0Sp`@[]L`h[]tLLS"^G L4 vb0q @'RjD0S0SpSLOO0Su<'@S_m| 0S 0@00GFTfv09v\]sQT5jh TPjh6 T'Rjh;)T:jx.R)TUh)dY3T&33T&3.TX1.T\1C3T&3C3T&3M.TX1M.T\17{ 7{ Tn DXPTn D\Ps s  w  w %PTGD45\J EhMNEhNNNNJOLQ0 J@XXf9XpqjAh.A8U}Ah.A<UAh .A<U[`\o\o\\to\\\o\p\`o\Q0v JQ0v Jpbsbwcbwcbwcxbwc|bwc@b|wc<bxwQ`vb wQ0bwbpwbHwQvgUTKUXtUTKUXtƅ4=M@rT -sX6vh`w0w{0h|p>x}kL2,L41pj0Bсv1T(c1T(c8</@tn2řxstD@/ɅX0N|NɅHX?HhŨXŨXB*B|*%0|-40S0S0It)TI|)yTpXXY0"o<-P2E1s=Dt0,yQTX/@SsH=utu;~;~0Ttd,TydQT$B)"Tqz0S0SqHqp@p40Z9d_: > 0~n 8X`T0w8,x\D-\?=<U<$4P1p6T31||LQqPIpX3I\ d @ ,XsX000PZXZ,FpLp|p00Z9_sX=s=sT=0000sx=]xsLiLaEiO90mi`O#Ųo@vsD66vDdvdL.T +Dd3 H L* ,TE{,ؠ( |x@S }0S0S` & <;HS` & <;k: : !%!%w 0Lw L~oLrw L" (45t,+ (sP=\Y0 ؠ(ƅp=M_xd\PQs=s=sx=s=s|=s=sx=s=e LmT T e LT TWi @7j Wi @7Pk AWi @7Pk AWi @7Pk AWi @7Pk AWi @7l /Wi @7l EJTAXyTpXJTAXyTpXJTAXyTpX g mg x g mg x׈ q_ l#+pC؍ 0W 0 `Tʓ ʓ ޸;  C Cض Ot02h02h02h Z s=s= 0G8 u 46 X6[ 0% 0\ X!  *+ d\02ˣ.B078q; 2t SD T6 L90SX0S<0S  02HS`0S8SPS00S0Sή Lή L 8ZZdٷtBT7Xq0 w+T nBT7Xq0ShS0S |0 4> J> Jn$c 474 n40S0S0S0S0S|p\npV<|>->-pSs=02`8SSd0> Jh 0gw LBh 0gw LB D pܺ 3 p4k D p 3 p~       |- T TX\11A tqaP P D 8L06 L"0j0 @0  W W Wͼ 41|j0DB | p|<Ss=sl=с|v~sX__8S 80S8S 8s=s\= TJ p J@AlXyTpXXHS,x T% h A?0jJ8AdXyTpXXJ<AhXyTpXXyTpXX 'Rj,H$@SHSD 8HSD 8:9XJt0NTX lW TX lW TX lW 5Y 08RY $O\x\ ;A.AUW W ^ 4Nb 6W W hNb P6W f :f f :f f L:f zj Phqawqaw H l)4P4LE|0NLET0N  D 0Z1 eD D< pD D T"X  D lD D 0<s0= <<s=  W$$$ p \pxpp 8 @ֻ L 6 Dֻ 6: 0 p: 0 p  W  WG TB)" 8s=qPah P$ @r dj @r dj Lr tj lr j 0a HrXxlXxlXxl} 4&* T4+ T+ TA T 0 ] 0u] pu 00 0 0+ + 0sH=(0})\8"p 8K K0D6sh=s=s=s=s=s=s= 0u u1$06X& Wxz \+\|+p\dT`d h hсlvp+l+l 4UX0l 0 000 000 08ppqqq\ s= H{,  p<#  /$  U DCU @Cp' p<:pz* \/sP=* < d, , 0 0)1 \k0SzL `L uL `L uM `L uN `L |uWP P tkR hP |kAS h P |k$e /5 uf /5 u4 /5 ug /5 |u0 )1 tkp h)1 |kp h )1 |k(})L(})L PŊ < tō um0um0 TA Q; T" tw T t T t T t"` LΏ syTpXXс0v<yTpXXJ\AXyTpXXJXAXyTpXXJ\AXyTpXXJXAXyTpXXyTpXXyTpXXyTpXXyTpXXJhAXyTpXXJ\AXyTpXXJXAXyTpXXJ\AXyTpXXJXAXyTpXXJ\AXyTpXXJXAXyTpXXJ\AXyTpXXJXAXyTpXX` ` 5 \W` | ` X 0  pΏ 4s` 0` uu` ` 0 < $   Ŋ <Ŋ 0S hJ 0 tJ @ hJ 0 hJ 0 h1J 0 h1J 0 h1J 0 h1J 0 h1J 0 h1J 0 h1J 0 h1J 0s hJ 0s hJ 0s 0J hs hJ 0s hJ 0s hJ 0s hJ 0s hJ 0 hJ 0 hJ 002h 1[ S 4o (p ,p  ` Pp02X02X3 3 02X02X02X02X02X02X02X02X02X02X02X02X' 9 o' 9 o' 9 o' 9 o' 9 o' 9 o' 9 o' 9 o% 0] r  (r  (Ԧ 8} cԦ 8}ڗ pMr  ((r  0(" dΏ ds l lz" Ώ s HKΏ HsΏ s Kx x  \Ώ \sΏ s [ [  Ώ s Ώ s Ώ s $Ώ $s   h[ h  P F  "Ώ sΏ s "  Ώ sΏ s   Ώ s $Ώ $s Ώ s (Ώ (s   l l  z p  "Ώ sΏ s "   Ώ (s h zō ,[ z l Ώ s `z ` Ώ (s h" zō , z l" Ώ s `z `",&< z Ώ (s6 , zō \  z6 , Ώ s `z6 `, Ώ (s h\  0 \  x Ώ s\ p p Ώ (s h"\  0 \  x" Ώ s\ p p",&D\  Ώ (s6 h,\  0b \ 6 x, Ώ s\ p6 p, Ώ s Ώ $s Ώ s $Ώ (s 0Ώ \sK CK C Ώ sK $C Ώ s Ώ $s $Ώ (s |; F ; PF   0 pA.AU0IA0.ADUA0.A@U qA0.ADUw   Ӓ P `uO`kdd\@Pv O z @z@Pv PZIN  0  Ӓ |Ӓ dӒ 0 PDڗ PM PDڗ PM T @L@0@L@0@L@0@L@0@L@0ѐ @e@e@k DCe@k DCѐ Se>ڗ MOr T (u TZ h ;T hZ?T:Ol02HL2MSTB)h"T-x!T-x!T-x!-s=s=s=@S9Y` Y Y` ~o<r o[ o8[0S0XJ00hN,4"s=qJDApXyTpXXJ@AlXyTpXXJ@AlXyTpXXJ@AlXyTpXXJ@AlXyTpXXqqyTpXX } Q5j v@ w8Sq0e1 tC tC<1Mp!0`!0`'0V!)=)=R7m(84b9`)9 =dG=#@X,<@#@0,45</FTppdpHpTTLVsVfƅx=M|l1]>X]Bz0z8pp:p8:p8#@, Zg0]:ps=ps=sD=sl=p%L`]sL=p:pC0:pTB)X"B)|"\?0`_ B)0"B)x"B)"B)$"?0`_x B)"B)p"B)0"B)x"B)@"B)$"?0`_d /0/{C0:pP?C0?C^CpH+0)+)C0:pP+0)+)C0:pPC0:pPC0:pPC0:pPC0:pPC0:pPC0:pPC0:pP?C0?CC0:pP^CpH c4%LH]-c4,%LH][4pHb4bb4 \4pH[4pH[4pH[4pH[4pH[4pH[4pH[4pH[4pHb4b[4pH\4pH'05@]TT41djST0pO)TT06'Q.`2@245Q,.T2<b JDApXyTpXXJHAtXyTpXXPb\ NSbPPXUa03q@n++'|0<py =ƅ=M,{0{0{0<{@{Ld%DSDS++SLT@SK@SK@SK0SPSL4S0St % JSLS`SatPSx))81\W00$DS9 0'Rj02HJ50@O06k02Xrhh3&33T&3.T1.T\1C3&3C3T&3M.T1M.T\1tt@tt%sXYsdX'X' 0 8T۸0 J<AhXyTpXXT`TTXJ|0NXJT0N 0'Rjq|aqaq|aqapXpB)0"'0XJX0dN0vb0 d Ph0V8>l/0lV> 0w hA|lbYXJ|0NXJT0Nk:4 : s=Aq<aB)"Zohl~orz0zhy0yt ~T45Lt!%X!%L1%X1%LL`Zol͔0hJ0ut {d{k:4 : q<a"B)"#TU45X7 7l7\g8C@P2h XMZol("ȱD $H\03(MX#(2X ("ȱD $H\03(MX#(2X  W98(*]D)$O8a^TQAXg)`bLVGs=Ls=s=5L5A]>$L^PQA\gPV}qc}0h PCh XMZol("ȱD $H\03(MX#(CX ("ȱD $H\03(MX#(CX $ Uk6(*]D)$O8aTQXev`bLV Gs=eLs=s=555P5W>lreLPQ\ePV˦m0dm@ALhuLuAqqPbDM` o[-L#z XMZol (O D n*}@iP`$ (O D --},@i,`" (O D U>>}<@i;=`$yDy JDu 0T%Nt)eNl!NH1N0-k:4 : NL1N0-NH1N0-%Nt)eNl!ND-NT-k:4 : T8-X\X\p,p,0g0$:pi0j400pL,pL,i0j\k: : Wo4"o"o0q(ak:H : fT"/htfT"/\tfT"/`tjTjjTjiTjjTjOjTjfT"/\tfT"/`t3kTjfT"/\tfT"/`t݃G݃Gdd 03˙d 072dR0;d0?ʛ@UsH=,+ (sP=JLApXyTpXXJTAXXJTAXXyTpXXs<=45Hή0Y|]Z8]Zl$֫@k: :  <AZk0J5qapJ50q a01EyTpXX$$]sx@s=+s=+(s=+s=+s=+s=?Pj?j+0+0+0+0+0+0+0+0+0+0+0+0+0+0l^^s=' ,s=s`= 'RjY"o-+P; +0+0Y"o@-011Y"o0-  $     (, (,!'@  $  $  $  $  $  $&    $  $  !  $  $""  $  (,  $(  $  $  $    $$,4<@$$  $(,  $ $(&    $% $L$'  $# (  $  $  $  $"@  $  $( D@ B B0@0A0a @H @@  @ ---))))))) $,  $  $  $( $(,  $(  $(,   0 0  24 D  PPPP ! ! !  "" HL  $  $   $  $  7'''' BJBC I I I I IIAA  $     $ -!!! s``bbbbb      $(,0    (,  (0  $  $))))))))))))))))))))))))(      $  $    @@@/@`@` P         Rr  $  $  $  $  $  $  &!$'&A$$ $$$$  F C'   $  $ #))")) )B9B9F8F9@8( 5!!#!)   @@@@@@@@ (, (*+.  H@   *  000  $ @@ $  $    +// ``koa  $    A0&L1d   $ A@H@DBD@  $  $  $  !  $  (0 D ,)8?    08( 0U0 "4  $,0         $(,        @  @KPKDKAKHK`KbK  (     P DB8GB8D8DD0L0D> $(,0$(08  !!@aa KHHH@H b b  $  $  $    IIIIIIII  L  $-0 L--- -- - -G-G-G--  $----   - - BB!C---d---G- G- G- G- G- G--d-@8--  !#((-G-,,-@---TTX-------- -G-lF-d-x---- ElF----d0G-0,-  @ G---- L- G-------- - -G--G-G- -G----G-G- -- --- G-G- G- -- ----TTX-- G- G-! 0 ! #0!0# .&$G- - --G-G-( -G--G-----@@H-- ---0 L--8 -0 L---d-G--  ,  , -d- ----PPH --d-0 L-G-- G-- --88\ ----lF--@ -h-LL --- F-----|-0 L--0 L--G---G-lF- 0`($ " !  $(,--$$-$$$- -- @ 0 L-d- - --0 L-  $ G- ----d-d--,,--DDD!-- P022"184$ --  $ G------d-d-- -0 L--d--- -- -lF--------d--p--lF-G-----(@-d--0 L-p--d-d---- --------- --|-d- -d-- G---d-- (- - -0 L- F--,--  00AA--28&--( 4-<<@"-d--,$<"-- G--  $  $ *-d--d---xD@H"-D@H"--G- G- G-d-d-R0,p -- G--  $-lF-8lh"-d- !C --- D@D"-  $  $PL- -d-d-<(-d--<(-  $@ @*@@@@%```@tT` -d-0--0--  $-- -- G--lF--d--6-RV-R --d--  $---0 L- $,,-,- ( --j *$"--  $lF-- --G-G----G- 33330003 G-lF-$-$-<,d!- -       @@LBF@F FBB F@FF--\X"-0,-,\X"- G-\X"-8\X"- |- |-??`?- -0,-- - !-G-0 L-p\TT --$0 --d---d--$-d--d-0 L------d--d- sbbbbbsss``--- - ss``bbrr ss``bbrr- --- h``p``p0`H@-d-((!-d-00L -d-00L -d-88!-d-d-d-\-d-14(-d-$ -TTP#---LL`--G-G- -HDp#-HDp#-HDp#-- -----d-( --p-HDp#-HDp#--HDp#-LL#-HDp#-p-p--LL#-- --HDp#----d-P--- G-- G--lF-lF-lF--lF- -d-   &IL-` -G-0 L----0 L----0 L-h- --d-|-0 L-G--@8,#-- --"--"-- G-d-@  G--D-Td--d-d--@-0 L--0 L--0 L-G-0,--HD -|-@--- %  $ $ $ UUUUd--G-$t- G- - G- ---d-- -0 L- -%%%%%%    -   TTX-- --   G--G----G-- G--G-- A  - -G-d-d- - -0- --- G--d--d--d- sssscccccc  $---- $ D%-|-d- - --- |-----dG-l G---hH<X%--$H<X%-lH<X%- G- G-,,t%-,,t%--(--0,- --,,t%- ,,t%-lF-$ -$ -lF----d-d-((-((-((-((-((-((-((-"  --d- -d-G-d---d-d-PPH --- -----0(,%--0(,%- X$--X$--  $(, - ---  - |- DDDDDDDDDDD --G- G-G-|-G-d-  $  $  $d--d-G-d-G--d- --G---d---0,-d-G-- - - caC 4I"4I"4I"4I"4I"4I"LLML-0 L-<,d!-<,d!--<,d!--d----0 L--G--0 L------ -G-d- G--d-|- II         $  $  $  $  $  (,  $(,0  $  $  $'B `  08????   1  $  B@&>& @$    @   W  H2H"H"0%     L 0`D`D# @@@@@   @ @@b`#@D &0 A,pB )  Z ZZ ZZ%    'AU@UUB`@   )-R-R(R  $     $! )I$$$!/$@0%H  "***   $            " :    %H  @`Dd   +P  $  .`D`D&#(    X \ |  p@@ @P``@@ @  H@ @ @@ F$$$    `xx?`?x?x?|  *   ! @B@ $,  $  $  $(,0$(08    $( !C  %% @@<< ,   UEEAAAA @   @  @(q(q(q(q(q(quAt@      //////<Du)Du!Du?@(@ jjjjjbbb@@j "               @ @ @ @ @ @@@-RT-R:   A!            ssc``bbrr PPx! FF @( (BD  (, HHHHHH"DHBCC  $(0000000@00000 0$0 0  !  !    @@  "H"H"H H H H"H H H   "T P(2,  !          ??????? !   8   c! 0(   !a           @@C@@@ACqC1CC             n   H@ @@" 08  "   &#b""  333033 IAAAAAAAA@@@@@ I I I I I I I I IIII I  @DDETP@@AAAAAAAAAA     @@@$&" U    ! !  D $(#" 3 !!I&SI&SI&SI&SI&S5"'PUQU QU,PU^U'!C!C!C5" 8`D`D# B B"B*(B&$BBB0B  )!C B  IHHH@ dDfDfDdD`DhDhD`DaDaD  B` VUUVUUTUUPUU+_2_2_2 * @@ @@`A@0@ @ A @ 00602060>0"00 DFFDD 0 ( @@@ J   @** ccccccc- bCI  @@@@@  )U@U @@` ! UUTUPU@UUE  @ ! #### @DDD@G ???     ssscs`ccccccccc    $%-=?;:*(((   L4/HHHH    * * * * * * * * * * @`p@@@H@LD @ B R"@HI @@PDBHA@  @@@  $  H      (     )- -   ii PPPPPEbX,Z    H 0  , [00 C   BBB  ?/@_@@@ %%%%%`%%  HJHH"0% WWWWWWWWWWWWWWW -mmeeeddD@@DDD@@@@@  GGG G    $&  $(,0 @B„¤ʤʥҥ¥Ҥ֤bbb ==== ==0@ A  @&' Q Q0 DdRHZ[[  TT * PRVVVPEPPX TT @`d`b(`     IIh( ha@0    $$$$    TPPPR$%@X@!C^@\@L' B   B B @@ B  BB@@ B"  @@ @    5(( !11""** $$`@$%B"B" B"AB"B"AB" @@      ZZ@@   ''   bU@b@b@bQ`P``@ %!!a  @    !         @@ ` P   @` P)8~x <n~l T|n~5 `` ,"0I"pI"IWW<Wd* + +1,'D,3/h` .1|1|1\181<x22{2L%1 3-P-T1107*1oC0xR4"9H JL!P7J"0I1,'0!03.8;dOTRxt*hP!x&4&47G6\!;d;DG6\Aa0AaZa^|ad*PZa|ZaDHUG60cBlfi4`O\< "CXxRd"G6!XG6pdqt)9q$!P@fb)H=rP=rQr``x `@\<"!3.́0߁`xQrXG6XG6X!`,[\,h[!lŇ(Z \<,"@Xz,<[,b,b6X6L,b~X| P !?`9F`? FH`r>`˗60!j7JhrL7J Ȇt70,H[\H hppˢQ~,&=r4Xۣ0ߤdDDITLI1x`$@}W&*<E,\xyR<EX,D\?H |$L@G6$D@sD0tӽx/Ȅ0U90H090!8HDLUG60ǘLt0 x cBl&04&4&4wE$ZE2{C0 z.-f0(z2<!\\<"6!!l $`@$@$0@ .l`+%Pp1o+%P`1o+%PP1o+%PP1oxʈ@$&4x@P;L8dm<8X~<8`hT "^TMlh}TUMlhT]lhCd_00~CH_``~06?X6;,;,;, 9 h9 90SXX\0dS00T[%T"f%T.f%.[%0"f%0.%4[%T"f%T.% ''''''Xb(DB)D"sD=b(DB)D"sD=q*n)GV*w0<O41Tj_1ps333 4:c8&8 w>4>  > P@xv H3\u8II<VI$^I$^I@V'JXEI@V'JXEI<VsJ,J I<VsJJ <I4.A8UI ^I ^'U0.AUR`CB<X`SDY}AD.AXUSDYAD .AXUSDYVAD`.AXUSDYVAD`.AXUSDY}AD.A\USDYAD .A\USDY@AD.ATU}Ah.A<US0YAh .A<USPYSDYADO .AXUSDYADO .AXUA.ApUA(Al.AXUALA.A<USYVTS.AhUI^WTg.AlUWTt.AlU~lsD[==L=ˆd??pIIIKx %<Oh02\|02X0$6w\CwC@w\CwCPmTO|Þl©<PЩ0jl`Es=s= ZhLk $Z|k@ZkXxZEZEZEZ0E\ZPZXF24ƲdƲtƲQ8S`8 s=ҭTZTEZ9;9;9\;A0*A`*A*02H|tg*sP=pgx*,JLAxX4glgt*lgt*lgt*pgx*8lgt*Jlgt*lgt*"lgt*x b1T848AX X w0`06Ds=n|%6Dl-6Ds=5<4<4p6D<d|04j8t|048HE(CdCC`2Q G~s=jPz\kpCB6hY-BT6lY-B6hY-BT6lY-gggkkxkYXGLAL5UogAl.AhUAls-Tw0wxs$=0ws8=Uxow`s=@ws=0 0 0 ( = = L=Z `Z `Z P`>06N?0S xP ]da|a$0_HZh70_HZh7_4ZT7.TEp77 +/AX.A\U&T0r+|_r+_.;.;.\;g.0*g.*g.4*`5L6k: : 9L6k: : 0>L6k: : BP6k: : 505005X06p`56s=G70|G7||G7|+:0+:00+:X0N;p96s=;0|;||;|>0>00>X0?p0>6s=@0|@||@|B0B00BX0DpB6s=D0|D||D|b1b11%,qap^,s=GdU[y{4>{t |lDw>Pـ8 ـ Ղ &s|=s=Ղ0&s=s=Ղ0&s=s,=Ղ0&s=s8=ՂX&s=s =ՂX&s=s=0PGpl,p,p,2Q<BL@Bh  2M(=L=hY}2'JA9Lp9h2yF4L5hs=GGvywyyy0yL7It_AX.xX +ZTqZTY0b[F@s=s =s=q`aG{9sB)d"rT0k: :$ TCk: :$ 3`s<=45_Z(7;pML8X6Ѯ)6@Y0\V@8;g8;tg;~;$~4,4,84(x 4&s=w0a0 B0 0a X6_6)T;;$;Dl*D*D*hI|IIR;R;R$;rt*r*r(*lIII<ShCp_~ShqCx_HH~Ch_~h  ` 0S LTSxSKXPҭLZxd,X o6%%mb !,v'@)dPCCt++(+CCC-O|X5-XOb|p5h  !<v'8  !<v'8;80O42LE9p02H9@)H9@).H9@*RH@@0U@U@|@0I|@TI|@xIP  C0<A''F@)H|G>G>I|t(xCI|t(xC0<A''Xl,,4&$\4&N@)HW;W;W\;YW0*YW@*YW*r`rhss0l" w>4M}  M} K#HMlK#HMK#\M\lzsd=s=s=qs=E]\K~HI~~Q`s|=<K<Ks=PCs$=e (/b(OO<~O3``p~G G3`pVpTVe (/b(e (/b(HFL$ DHFL$ DHL DHL D L/P dD L/P dDL1P \DL1P \DGL- P dDGL- P dD*L-P \D*L-P \DL1P \DL1P \DTL1/P \DTL1/P \DL-P dDL-P dD L1P \D L1P \DH7L DH7L Dbb0C.HSL D.HSL DL;P PDL;P PDeH)?L DeH)?L DWL13P \DWL13P \DL1P \DL1P \DL1oP \DL1oP \D7L1P dD7L1P dDL1P \DL1P \DFDX l~ s@F F FTh A 0}j| D m ` 4v}0j|D0b 0qv 0i;LT}Lj|`Z4}0j|D4}0j|D\!\F\uhA0.AhUAA<.A8UAP50h@v 55OZOZDOA.AUOxAD.AHUA=DF>:=FOEH\GqC?`j?j@\GXq`NBd-(S[0O0O0B@@ `qC~s}x}~A<.A8UAA.AUA݃GOZDOZ<ZZ{0F02 0@h(<;<;<\;4*t**ݥ;ݥ;ݥ\;0*p**<2T>Q2hK41pj|2TdQ2dK41lj1T[41hj0Oҳ@(,H<H<pkVk@V|((d=d=dL=e (/b( hЩ`j,D>!%  L ..P$T KX/P'TCX7'C78m8x Ht@e4JTS@S``,{#L#<|!0|T s<=Y'hs0=s=9-lڊڊ$ 0DO"hPhGz\ey-zb4|8 <WTX W|C WCsd=C7#sp=c%s=m,`2xuPE@45xs=s=st=wP (t{0;{W{D|8{`W{LgHh;@/FT&@ϋ_0Z8&Z8&09.'|o0D{08`3=00O41Hjs=0<O06410jӣsh=s=41pj0B41@j8333`;d/FTOqas=s=sh=s=%0b%b%bu<u'|Tj'LH_TJT q,q B',bƅ=My8HPj6ҭ0ZSA\0S `SA,<&| \8D s=\l@D\l ?h B)4"s4=0 42L0( **0(  G\01 20( xQ;@( .0( pp0( i@;0( @9@ 9ҭ<ZҭxZҭxZPrhsh=<( 0i#02X8S DPTS,Sҭ0Z@S$SPS  (410j006=8SLSuLSul(% (pdSpl 'S,u9T-X-l|(.)T^l^ 'Rjp2up2xP6 ir6<+60P6,ir6+,'8P 8P 8P 0S=X=H6)h;W4$;@W4|B\,.| 'Rj@dS @ 0D_v w<N $L@uWLP`pl4545LB)<"''42\|^r\r`@OhC wL\SqH@hJ0hGq@{;{;{\;|0*|p*|*~|sto2sD=o2s,= 2 pe2s$=e2s =]0$/4/,P 2d2D9|`%/0`6k00Z}t\s=$s=sT=t*psL=X*<0Qh<0Q~sH<0Q~TstMHM40xB \R h=@ h<1dAE06f\|fl|N.#N.\,\1 P R =!4!t! "P$"$"$A.AUAH*@ *<*+0 d(+dсv*8 ݃GOZDO  XR d=  XR d=A.A<U@v KPсvDH`~sEMFEDKXJxJJN45OHV$V3A.AUA$\lo\\\h\Po\BZj~sGb0 R| JUcbQvb wc@b|wexbPwcdbwbPwcdbwbHsbwbwITg Rl| Rl|Q`0bwbwQ40iLbxwCTG6Chx[C:CTG6Chx[C:BZ0j~s }7~Dh~`dU,u.u.U,u.?h4#$:s=s=JAX>,,t,ht0,lhU<(8Q DQD%O0otJnT~ttd,X@0X4AEA\EAE0S|00S|0DS%<$<U?=8^C0'|A@XC0T5E1p2pE[Q Q4LEIp=KpT+^Cx'|AXX0E\Z@mt0H8Mؠ( +^.CT& 000Z0Z:pppXF220Fs|=Z000Z000044sP=s=ph;;\;D0*D`*D*ؠ0(9Pmi\O0d|R3pL.sT.$ؠ(L. %(L](`]vdҭ8Z T < L w 0w w 0S Pxc- Tb# - 3  3 p3 8 p3 ?q<aqaUJ 1K "bK M \ M N e L J> DJ450ʓ  SV $(ҭtZ8 u 68 u8 u8 uo LKA9ױ  h*+ 8\ X< *+ \ p6 pO 68Sܺ 3 PSʾ \ s =0SS9_ xBضOSp k0Sp k00Sp k00S $w0S w * 2 F0S $ 0S  HS0S qX0SX `Lp> 8J74 n4` A0S7 0S7 eD (/b(e0 (/b(s=sT= y]A w]A Xw}= `I wI Xw4E `q|aA q0a˱ 0 < @ԯ D. 3 3 0_ 0 09QD : zQD : zQxD%O|x(00O0641,j00O41Hjs= 0       09D .'| << n P$_$s=0S4qakpJ5Q5j $ 11s,=d1 'Rj $ p # (k m (< 6M 6\ 4< (6M ,6\ DLD_\J\ L4_@J@ utu'~Ps4< "qLaS(5Y 8RY $W -R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADUO\mZ RY $-R8UAX.ADUO\mZ RY $-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADU-R8UAX.ADUjA8.A<U^ }Ah.A<U^ Ah .A<U^ 0AT'^ ] 6A.AUA4` 8OW 8W <A@.AlU^ ,^ HA.AUSNb 6c 9Ld_0J0 A0.AdU^ $qaq aw$'%9B06HY|-t pp P*    W ,  W   W % P%-O PTeXJR ` z `Lt\ 0+X 0,0X+0 06 = <? "06sL=s=@(|B\(|B\u 0_0u 8_p0_0p8_Pkax wD -   - P  < a B-OD& 0C plpp8S 2 B2 8S 2 B2 N p6D xdD Y?O p6D xdD Y'R jE BE h pA xdSA Yi pA xdSA Yo  2 B2  t{, 8  T % Tumhc TumhJhAX`  H=U PH  @=U H T A Q | LP R Du . `  @ . dP 8P RP R`  Ώ s` Ώ sƅl=MtL2% 0um<s hJ 0h hs hJ 0 h% 0um< ,p  (4 ,  Tp  A |Q 4 hA Q 8 \ xp  p? 0 0y0 Ty0 y% um0% um0% um0u . U` L0_HJH L_J L_J L_\J\ Ӓ   T Ώ (s<S` ` <ڗ dMA.AU 0v 0Ώ ds 0v v \cڗ lMA.AU7 0w P T7 w  Ԧ 8} PΏ sO 5˧ x7 4w D H7 w  OD 5˧ 8 tS  Ώ xs Ώ s" $Ώ $s" Ώ s K KΏ 4s Ώ sΏ s   tF   Ώ s  \ \Ώ \s Ώ s Ώ xs Ώ sΏ Ts T" "Ώ s Ώ sΏ \s \  tp ( @ @Ώ @s   Ώ s Ώ s Ώ s Ώ sΏ \s \" "ō hF Dō | lp   tA QN N  tA Q30Xs$% um0@Pv @v @v A.A UA,Ŋ O0P<U)#8'O|)#8'  @Dڗ @M@v )#8'  @Dڗ @M@v @Dڗ @M@v @Dڗ @M@v @0@4k TC@0@4k XC@0@4k XC@0@4k XC@0@4k XC@0@4k XC@0@4k TC@0@4k TC@0@4k TCe@k DCѐ pe@k DCѐ p7 Tw t xL _J h43'dLC3@-O-<Os=Y Y@ ~or o [ o [D<8<<0SDPS EJHAtXs|=a T!d`!d` %<s=9L2Z'?b~HsD4Adת~<' \-ת~<' \-ת0~|' -תD~' -s=s=+ k: : 0EZNr0C:pB)T"B)x"B)"B)x"B)"B)D"B)"B)"B)"B)0"B)x"B)"B)0"B)x"B)"B)0"B)x"B)"B)"B)"B),"B)0"B)x"B)"B)T"B)x"B)"B)T"B)x"B)"?C0+)K(+0)+)+)?C0?C?C4?C0?C?C4?C0?C?C4b4bbb4bbb4bb?0`zdzl?0`zdzl?0`zdzl?0`zpz|?0`zz?0`zdzl?0`zdzl?0`zzbn:#<:}H2 ҭ0ZYD"o-}BNTS~`sd+2+80+4^B(.+Y"o-'`c%'DS'|0-0{4 {0{ҭXZ?ZrL%mhp{h{6t~Hs%Hw0 6Sq ewP' bkT 'Rjk @'RjHatat`atpu09lPT1f5z9<{5ҭ0Z:Os=;XF>G0; 'Rj02XHH`0<'0S$pDpppb9/|5b4V6b0V0> \AV \#tlV|>/t0l3|> AV #y@/yd s=#DdB)" T#H45ZoXl!%t!%h1%1%@1%.Bzoz )}Tbk: :$ kX:0Ž4 ^7Ž y04T4)p s=WlA45ZT^k: :$ źL 8/H\3X @,@X @,@J 5, @[^TQAXg.c}h0[^\QA`g)0b\V}0q-H\3X @,@X @,@d0fJ 5, @2[TQXe.d20[\Q`ev0b\V˦0m o [n I8XIdALuTIlALu&-Czp-z1 O  { D,@-=`iP$1 O  { D,@-/=,`i,"1 O  { D,@-f?=<`i;=$-x+-+,H x11DK4 }x02HOP=N01N4-OL=N01N4-ZOx9%N@)eNp!Y0&s=s=Y0&s=s,=Y0&s=s8=YX&s=s =YX&s=s=x 02H\Tpt,pt,G4iTj"o0/q"olo0q}o`8xٞHt@sh= 7Z1`@-^`=s(=T \HnV C;C;C\; 4* t* *ת~ -s=\1e (/b(+0Y"o`-+4+44+4+4+4011X1$(08<4!C B @BH`DP @ I!  *5FFFF$@HZH&""@())8b0I&BI&I&I&SI&*ZZ%            IIIIIIIIIIIIIȄȀ@@APP@     !  (@@08 0 @(80(0 B@ 4 @7$ MDP B@% /qAcei1BU@UU%`x``    D0a aaaaa A@@QQ@@@@@@@P@@@@@@@ @@p%%%%%%%%o@d- -@@H-HD-8&----- - -d-|--- G-0(- G- G-,- G- G- G- G- G-- G---------$-P-d-lF- L-- G----G-G- --- ----G-- --G-G---0 L--- -G- G- G- -d--G-G-G---(-G-G-G-0 L-----d- G---G- -d-G-d-- G-- -(4'--0 L-G-G-0,p ---0 L--lF-- L--- - -- 5((5(( - -- --00L - -----$$-------8 -'-- $  ,,--- G- G- G-lF-lF-------G------- - - --d- --- -d-d--lF-lF--p--- L--d-d-d----- -((!-d- @`  -0 L- -0 L---lF-----0 L---0 L--,--,---d--d-d,-- -l<<@"-d--,--d-<4,"--40 "- G- G-$8"-- G-d-((-0,p --p-d--<-x-d- -- ---d-d-d-d-&---    B * *  * t(----d-- -d--  @ @ @ @ @@@@@@x88T"--D@`"- G-PPh"-d-lF-----d-lF-G---P--G-G-G--- G---$ ------G----  """"    H ?---lF-- G-44"--|-- - -- - -|-d`"-|--- --h---d-- G-- ---d-<\TT -0 L-- - !-0 L-- -d- |- ------d----d---0 L--- |----- -d----- -d-- -d-- |-d---d---d--G--$4'--0 L- A*IA*AA*AA*AA*AA*AA*AA*AA*AA*A G- --d----- --- ---00L - G--84L#-0 L---0-D-L(-((!---THDp#-HDp#-HDp#-00#- -HDp#-------lF--G--HDp#-lF--HDp#-0 L--d@#-LL#-($-d---d--  $" "lF---800L -hG-x-d-0 L--(&--d-0&---|-d-0 L-G--0 L-G-@8,#----- G- G- G-|-\\$-d-- -0 L- BBB0--F-----0,P$- -(-0XTd$-xt - G- G---lF---d-G-8 -)-- G-DD%--,,-- -R8--d-G-d-- {{``c`cccccccc```cc -G- - P@---d- |- |-d- |-- DDD]]E---------G---`-h-- G- G- G--- ----@< -d--@-@-0,-$(-,,t%-,,t%---d-((-d--t((----- -((!-00L - - @@0@@------ ---&--0 L---d---d-d- G- G---d--d--d-d--------44"-----G------------d- 8Q9;;8h--0 L--- --- G-h--0 L---d---d-AAaaqaaaIaaqIHHHH@@@@@    @000   @   (@  (@H(   (  $Y9 $B@ @ B !I&SI&SI&SI&SI&SI&S@ !H@!C FU( 4U( U( U(  !@"bH PPTP  PP #@CC CCC C@CC CC C@UUUUUUUUU #@`px|~ 5XXXXXXXXXXXPPPPPPPPXXX  ssssssb`ccccccccc @   `   X<$ T ** 0 ccccccccc;I&I&I&<BH1d?@`   ))))))))))))))) (   ())*b3( (( AEEAUICB+-RT-R-R-R-R @@@@ @. 08<>?~  #+    *IIIII BB BB A      ((6@@ @6cL&cL&L&L&8bccb1!C$$2 L01  #@@ 2 $ B@ @ B %B<B> & (,<,-(KUU !`````` %U $A   @        0    @m@008pp00@  0 p0 @   $&$0@DD@WWVvv^T@!     @@@@  @@@ AA 0000@ 0@00000@00          ---)                (hjz*X*@+        @      @ZZ@Z @      (TUTU@AE***JI -------%%% $$$ *@%&$  -00B400@( 0 ,&@(f&>d>?>            /@`hl|~ ) Nn~   @@@C@P $@!@BB! "   **@j $  (  %@PH`!Cd`@@!CSBATBATBAT & 0:00R0 00 # @@@"""""""""<DuDuDuDuDu=LL&L&L&L&L&9 BLH2 @ @ @ @ @ @ @@@@@@@@ D +(((((( 6%$I$%$I$%$I$%$I$@ DUTT7V scccccccccccccccccccc  0 0 p S     G $$,(PPLpH:TT~\k~&~&~ &!83.<CpxRt"C `vk@DCXxR\"!0! !l!03.4CXxRp"Q$f$@Q$f$|@F%;T%F%;F%;%8&4&4&44'P '''B' ''d'BH*pd* H*t*TP08t 1 *1ou1<1 p1<71lL{3LKd{3dK-+4 1$4XzG60!G6&4,X[,b,<[,b&04C0;Csx@;cBXlcBlcBlcBl!03.8CTxRX"!03.8C\xR`"UhG6\07:S7F!P3.TCxR"!03.4ChxRl"!03.4CxR"CpxRt"!3.4z4z4`z4zL cBXl !|3.CxR"fip4`OO\< "!X3.dG6tG6L>|KCxR"!03.4CxR"k04k!3.CxR"| P !?X9WȆ7\<"ŇHZ \<L"@xz!03.4CtxRx"DdUG6XClxRp"&04ChDx@;x@;!03.4CxR"!03.4CxR"0 d4ad dLr4>`Xr>`5"sDD`CD `ԦCԦXCԦCԦC--h-`P-T--`l| !3.!03.4CxR"!03.@CtxRx"!03.@CxR"_0js0Sx2l2{-GP }t,}5!!D UG6zx%5E}s\!83.<CxxR|"!X3.\CxR"dWӀtd|!83.PCxR"!@3.DCxxR|"!@3.DCtxRx""4!H:T&!83.<CxxR|"k- -,-@Dx,<[DTUG6L,b.`G6CxR"`G60!0!|y;8_G60y;t_G6C0 C| 5< --p-  }|txy|RE},+%Pt1P1op'`%l%Bp|Bt|?DX:dLLLLL?TEmlh~Telh06x6? 9f%.[%"%d8%8 (p/b((`/b(@*OV*wq*n)G- A-X-wg-T?-d.--j43}483483|4 3?|<?h3B0 CB|A.AU.AHU@Hv 3B0 CBJ| ^DyLLLLIMMM\KHO"KMP0 9P`P0 9PR83tuPt'U`.AUR'U`.AURV@W{STl\\tAt.AUSXYW@TDWTcIDFX:d4KL-I<V~J nK01MMM\W0TDWTVTF.AhUIH^IH^x@x@x`x `g-`?Mс,v(| \|r DAˆ0?0?D2\JAXD2\JAX5p6} v @/4n?<~x8 x8 ©PЩ jHZhZZhZZZ((ZhZhhh0sd=Z9P--8-<EP:<EPp:ݴݴ`DhITkZ$9TkZ+TkZTEZTEZTEZI|g*g *lgt*XH5lgt*hH&lgt*hH1\gd*lgt*`Hlgt*`H7Itg|*S tg|*-H|XIpgx*L!x\p)P7Lli\6k@C0ks-8wk0ks-8wkL_J U4ows=s-wxws$=0 0 0 0 8A LcZ ``A cZ `>D6N?>60S x X(0,h4vH;TP,X0p_Z70p_Z70o -(;$px_Z7T7/Z7h7`/Z7H7/.8EX7p7/7(7\7/hZ707*;tb/p,p.DEL7.DEx7|Z7.E07h78/tZ7#TOGG)0)x))3B CB<X``506`5p6k: :$ 78G7G7G7G9069p6k: :$ <8G<G<G<G0>060>p6k: :$ B46Bt6k: :( 6p6p`5d6`5066p6p`5d6`56N;pN;p9d6906N;pN;p9d696?p?p0>d60>06?p?p0>d60>6DpDpBd6B06DpDpBd6B6_Y0_Ypk: :$ ;TbIf8Yf8YfDTq4aGvD4v{0>{ |Dy{4>}t`zlU~$%<8<<<(tTNՂX&s=sH=m<*GGՂ&s =s=s=vywyyGZYPZHZ<hb;;0845t(תX~' -0SS0_0m0HͭF004uvL:!%L41%RuXl_0m0H@FT@Y\VTwa Be<X`e<X`lSH< K{)lo6`'{++x + PS,++|/7\/{/|/P7?+,XDl v'(!tv'02H 8C+;8pO02HJ8;8tO42Lu8`;8pO02H8";8pO02H8&E9p02H=A=A=A=AX|@HI|@lI|@IS:K(A:KA:KA:KA4r+pr+8&8l z9x;(~8&8l z9x;4~s=s=s|=sT=s=s=s=STs=D$|s=\!s=s=<2TJ|AX{\\ƅ=ML@w0$D$bdD$45TD$45u9HLL2b* "TD$D$lD$D$<4mՂl&s=s4=4mՂl&s=s4=́Ó\ÓxO̎<=4mՂx&s=s@=4mՂx&s=s@=8mՂ&s=sH=4mՂx&s=s@=CDCb$CD$Cs=@Cst=D$2Hvޘ#S$l$LD_\J\ O|~xspƅ=M4 e ((/b(<0Je (/b(Je (/b(Ll2e (/b(~ls0 }0j|4}Dj|H}dj|Y||}j|tY|x| BP c lZWQZ ( |ztQ83833B CB0X`Ap.AtUA@ v 3B\ CB$I0&=dF,I?IYl@'t\Gq~0sD~Ls 8\GLq8\Gq8\GTq8\Gqƅd=Mƅ=M 0\GHq(\G@qL`2\GqL2thUt9tHM}0}L~} 3B CBpA.A<UA '0H<`M{׋U04Pd`ҳεbi'ҳ yxKyKpGy(Klltltl1ҿU80=|`t$0v@I8 B{ #*\/3B0 CBH`h0?`0?d0?h0?lRl p ZolZolZolZol0UD6g+\0UD6g+\сpvtсHvL<8<<<(eeees=8 s=s(=0T6k4g2(T0@O0mՂh&s=s0=0mՂh&s=s0=LmՂ|&s=sD=,KT,KP4mՂl&s=s4=4mՂh&s=s0=*dSՂ\&s=sd=@mՂt&s=s<=4mՂl&s=s4=4mՂl&s=s4=*`SՂX&s=s`=4mՂh&s=s0=4mՂl&s=s4=4mՂh&s=s0=*dSՂ\&s=sd=4mՂx&s=s@=*dSՂ\&s=sd=*dSՂ\&s=sd=*dSՂ\&s=sd=4mՂh&s=s0=4mՂh&s=s0=4mՂh&s=s0=4mՂh&s=s0=4mՂh&s=s0=4mՂx&s=s@=4mՂl&s=s4=4mՂh&s=s0=4mՂh&s=s0=4mՂh&s=s0=*4SՂ8&s=s0=4mՂh&s=s0=*4SՂ8&s=s0=4mՂh&s=s0=*4SՂ8&s=s0=4mՂl&s=s4=4mՂx&s=s@=4mՂh&s=s0=4mՂh&s=s0=4mՂh&s=s0=4mՂx&s=s@=$`r*4mՂh&s=s0=4mՂh&s=s0=4mՂl&s=s4=*dSՂ\&s=sd=*dSՂ\&s=sd=4mՂh&s=s0=4mՂh&s=s0=4mՂh&s=s0=J.KIKdIKTdOP0O"qas=4mՂl&s=s4=V,fWX WC WCVfWxX WC WCVLfWX WC W(C8s=sh=s=4mՂx&s=s@=4mՂh&s=s0=4mՂl&s=s4=4mՂh&s=s0=o00EZqas=s=~sT~sXpppp@Ss8lqYq(rqbN0458v45N0458v45wwRjRjI{P^t{l;{W{Dۃ,2R0ϋp_<mr,@ϋx_ɒ{bYל\   0\0DO41djs= *hs=L2b~si0g 'Rj}MU{sLls,=q,ad sp=\8pp h 4 px9N4453`0 42Lƅ=M\ƅ=M0( ;d;0( u<0( (q ;t;L( o<o@ҭ<ZPSu}4uf/.PDdSS41Xj$ B)"06fDh||0Y|4}\j|`P6ir6+P64ir6+\PJ9ElO;H6r;W4QxD%O~sEZdJLAxX' @dSLS<S@0 KX 0'RjPAO<q4I4DI4I4xR4rzU**0*0e edPjh6f/@qE^` lE/:;l/FTDSS_m@| *0**i'LJ0A`XypX_`}8ss|s0so2s=E0Po2s= ,X@2 2p9@`s8ss4s0e2s=0e2sT=/  @2 2p9AL.AHUA.AU@Pv q A.AU4  X 06  MdM?j?jPL2 40lp P R = X,3B CBh+ +@, (@\v A.AUA`*4*A.APU*X A.AU*0 3B CB3B CBA.AUA@ v @Tv H>H>ENFEDD D`~$s@v 3B CBA.AUA@v -R8UAH.ALU@tv JQX0 JJ<QlQpl Jl R |QlQl Jx R,|QHl RH| R| Rd|XXRA.AUX^сDvxA@.A<UVA\`\/BZj~s]Z@D\o\Po[(\4oh`5h:bwbwjq R<|Qlb@wQvg R|gɅX/<p0EZ0EZ0EZEx]p(iZ8JTo>htl,}=!%@!%Ze)p*37+)^CP'|A0Xl8l84l%x |~n X/Q\E[tQQe0 (/b(9TqҭLZ 0C &` xs 2s=;\0d$[d QTؠX(rҭ(ZL.< QrJ0A\XypX0S D x0?`0?d0?h0?l  l   p ZolZolZolZol8Sb! ! p3 ?tp3 ?7 01ؠ(+^0.T pHnV ; }90_< 0/Pt/t01ؠ@(d+^.sl= R =R sl=R R S 8`; 4_؍ |W |%F > tJ> HJ> |J* PASV 8 u8 u8 uo K> pJ> J> J> XJ D7Է L 7Է <S  D <S S<SS! $Zz  L33 `Sp04 :8 >h Hh H $G 04 8Z W 0 < 0S qҭZ> J?? 45<s 0ܙ Z> Jٷt> J $b ( H$Z 8(| \ 7 Dԯ t. t3ԯ .ԯ 4. 3 3 dk D3 h3ԯ 8.hs= 3 3 W ,W 8%L06 ) X< << < <z  |W  # k dm( T( T ( ( D D Sq$PSHS (0O0 6 < X  P s=  sp=J<AhX8/ !00O<2>Q2XK41`jSpSd5Y 08RY $5Y 8RY $^ T2qp*l%] 6APO .A8U^ x\ ;-RTU^ W W q A.AU@v 3B CB<X`f @:f hf :f f @:f hf :f f :f f :f \Ld_0J0 if qaqaqaw0DBpB)"'0DBpB)"'0DBpB)"'| .| H.| e| e0X:p2 hh < ,D D D  W# ,դ p9/|5 p p, Lph p p pq pq p/T/P{//{P 0P LP h (* 04+XB)0"'0 Tm+ T0 + , Ps=+< fp\yLxk K\4w `\w ` H J0A`XypXJ0A`XypX% T% C% Z) ) P) p7s$=<S 2 BS2 4@ 0R}@ L6A dSA Y4@ 0R}@ L6A dSA YC 0R_C L66D dD YC 0R_C L66D dD YU 0U XV lV :4| d W F @q R 0p` 8 @Ώ <s DT A Q" u .c um0JhAX( L` JhAX( L` JhAX( L`  A PQ ; 8F` Ώ s Ώ @s[%T"f%4.f%.A$54 T,  p p ,p  ( L0 y0 y` `  T/% \um` T/% \um` T/% \um` T/% \um` T/% \um` T/% \um` T/% \um` T/% \um`cT T;% humlUX TM% huml[ T\% huml/ la U/ a/ aL_\J\ Z% 0% ] <  v 0  0v7 Lw P T c Lv T0 T vr  ( 0˧ $7 w   cr  ( 0˧ ,  z 0 0z" Ώ s Ώ lsΏ s K Ώ \sΏ s  Ώ ps 4Ώ 4s Ώ s [ [ Ώ s " Ώ dsΏ s  Ώ ps Ώ s Ώ s  , ,Ώ s " Ώ psō [ ō [ ō hP DF Hō ō  ō  ō h DF Hō ō  4ō    h   lz p    h   l p   b h b  A PQ Ώ s Ώ s A TQڗ @MAt.AU}4 3B CB<D@Pv @,v DI)0#88'0I@Pv @v TIA0.ADUA.AU@Pv @v Ik 0 AD.AHU~ lsk <C ` ` D o[ o[nhInlI A PQ ; 8F ; F DA QLd_0J0 5 `Dڗ `MA`.AU PDڗ PMA.AU @Dڗ @MA.AU `Dڗ `MA`.AU PDڗ PMA.AU @Dڗ @MA.AU PDڗ PMA.AU DDڗ DMA.AU dDڗ dMA,.AdU DDڗ DMA<.AU PDڗ PMA.AU@0@4k XCR eDk HCѐ ѐ eDk HCѐ ѐ eDk HCѐ ѐ eDk HCѐ ѐ C-T% humlNB)4"B)"B)l"F9[BFd9Fx9r{`G~Kh.L2ƅ=MpL2'0|~s'0~Ds,+8Y"o-0EZ+&Lk#/+&kCqLYqxbqr7;]@ת~4' T-AX GGC0:pT?C?C0l\B)"B)"AW#?V!?V!?V!C:pC<:p@[p[p, c<%L]-c,%L])(B)"B)"~ s ~ s XEZ:pXB)H"B)|"B)"yGB)D"B)x"B)"yGB)"B)"B)"B),"B)X"B)|"B)"O{nC0:pP?C?ClC0:pP?C?Cl^C0pPC:pC0:pP?C?ClC0:pP?C?ClC0:pP?C?Cl?C0?CC4:p8C0:pP?C?ClC0:pP?C?ClC0:pP?C?Cl^C0pP?C?Cx[4pHb<b[4pHb<b\4pH[p[4pHb<b[4pHb<b[4pHb<bb4b[p<[4pHb<b[4pH c%L][4pH[hp[4pHb<b[4pHb<b\4pHbTb5\e%L ]%L]2T;/FHT0EZƅ0=M<ƅ0=MY"ot-b 4X+2+b Y"o8-+b +ww \'Rj}M1 DS L'RjXkҭZ,,<l'+k`dZ\S(})<'\S(})<'xu90|xu9xu9xu9J0A`Xyp8X0gMh>tB  Zh>tB9/|(5ZB)0"'0Q5j 00O<2>Q2XK41`jJ0A`XypX!0IL2T"[#P!0IL2T"[#P60I7L2d9[:Pk@:DŽx s=l\!%|!%!%!% (T5y`d44ԴtpсpvtсHvLX0[^\QA`g)}Hbk: fH: ~H45XHI C<h X20[\Q`eZH^k: H: #HU45XH<P1`K\1K94gCh@ @^ K,&@-@Cp\k:X : ,@sX|iP$^ K,&@-@CP,p\k:X : ,"-@sd-X,|i,"^ K,&@-@C<p\k:X : ,=@s=X<|i;=$y4/y| k: : 11J0 JHOp5eNX!v(Y&s =s=s=| 02Ho|}0g0$:p:pqapTR"o/q"ohqT_oq}o<8<<<(*ZLmY|&s=sD=K\TK\P*Z4mYl&s=s4=*Z4mYh&s=s0=YdSY\&s=sd=*Z4mYh&s=s0=*Z4mYh&s=s0=*Z4mYh&s=s0=*Z4mYh&s=s0=*Z4mYh&s=s0=*Z4mYh&s=s0=*Z4mYh&s=s0=YdSY\&s=sd=*Z4mYx&s=s@=*Z4mYh&s=s0=YdSY\&s=sd=YdSY\&s=sd=*Z4mYh&s=s0=*Z4mYh&s=s0=YdSY\&s=sd=*Z4mYx&s=s@=*Z4mYl&s=s4=*Z4mYh&s=s0=*Z4mYh&s=s0=Y4SY8&s=s0=*Z4mYh&s=s0=Y4SY8&s=s0=*Z4mYh&s=s0=Y4SY8&s=s0=*Z4mYh&s=s0=*Z4mYx&s=s@=*Z4mYh&s=s0=*Z4mYx&s=s@=*Z4mYl&s=s4=*Z4mYh&s=s0=*Z4mYh&s=s0=M/qas=s=0s=hf*Z4mYl&s=s4=J8AdX 'Rj s=sl=sX=+,+,s@=s=+X+Xs=s=ƅd=M0ƅd=MV ,4><+@Y@"o-+H+@Y@"o-+H+@Y@"o-+H+DYD"o-+,+4+4Y4"o-+4+44+4ccccccccc     @ @"" ` 7777711117-R         CSQ% J"J"H"" @@@@  lF-- -d- " $ A>>>H>><@ >P>6>D>.?: G- G-- G-t--d- G- G---4(-`,,-- G-@-,,- - -- +XXXXXXd-d-d-d-lF---d-Y -40G-p G-G-(@@\--h------|--------LL-<-XD'--lF--G--I```       - -H--- ---"""""""""----T -`d-|dd,!- ---- - (" ,,-- --d-----|--d-tHD-d- --0 -<-D---lF- --d---d- ^ ^^ h008!- -((!-p-@@`p ` `` ` hp$4uPePeeEGGCCCBMM--d--hd-xLL -d- - -0 L- - -  @A x -TTX---- --d- -- -d-x-- !-$--d-- ----d-,----lF-((!-0 L-  ---lF---0 L-t ---$ 4"-d--X40 "-d-G--t -$ 4"-d--T40 "-d-G---F-d-- "PTTh -xlF--- "-llP-H-0 L---d-d--d- -d-lF-lF--d-D&---- --0 L--t-((!-84--d-- -84- *`4(!---d-x0,p ---d-----tt"- 0,p -<-D0 L-G-G-G-G------------- G- G- G- G- G- G- G- G-|--TTX----- G-@-H-P\(--- G- - -I-d-- |-PP---d-A* A* -------00L -L  -(-ld-|(--------- - -----lF-d- '@!!    '@@@D@d@T@P@R@X@@@H,(#-tp-HDp#-,(#-HHP -d- ---d--G-$$-G- - ----- /- |-d--G--d--xG-G-d--G----G-G-G--lG- !-,$<"--@llP--0 L--\-<,d!----------- )-h-G----------@ @  !  @   ----------- ---------$---d- ---d-4("--d- -----!!!!!!!!!!!!!!!p-PH`&- |--|-PH`&- |--=    )))                   6-RV0-R-R-R-R-R@ !  ``@ 4     0A00 08!042100 00 0000IIIIIIIIIIII PP08"@@CC3s@ C 08@:$@? 0P@a@P 0"  ! $ (@ H  H004}% 'AAAA@ AAA &   ( _&_&L (  &XX X X X0X0XX X X( 'P .(,.B   @   )@B@HBJB 0 LNML^n +  , @                  -    ؀`@`@B8<KCxR"OoO OPRlt*XPi2 * Lx2h2t{h!X3.\*hCxR"' '$ r8>`H``rd&r&uT dPvv9wl$@xyR>KCxR"r4>`Xr>`s0!\3.`CxR">H66p66,b6H6866|,b6H6866|,b!H$@sG6x!t*@h!3.CxR"6l6\66,b6H6866,b20%X lȆ7&04&T4&4&4CD!03.4,CxR"H8*<Lx2|2{I!03.pICxR"!\3.ICxR"CPxRT"!3.IԦ,CGG"H1.ԦCCxR"7J<t*LPt*dP!!!83.<@TzCpxRt"Pf!3.C4xR8"TBHW!tG6$p@xy<RjX|xy8RxylRzx%DUG6ǘt D8UG6pDUG6h"`E2{k68F@!jDF`!jdO|8 e ~@~,[6PDf6d,b& }t,}50T&L<qBp|qB|?8L:XX~`<8~~^hqw<6S^@qw46f%.[%"%`8%4 % ,`+N+"+( "+P "4:c8Xk:t &8< : cI8F0:XX~`^D3u<R8RH{Sld{Sl'U0RdsJH|BJ| 'U0Rd3u|.A8U`P`0 9PSYPLwnK1L wnK1A8.A<U{SlTT@Pv A.A@UA.AU@Pv SYS\YVA\`.AlUA<.A@U{Sl\\I<Vd)L~Jd @Tv A.AUA@%U]oM\]IHLZPZPPPƲƲƲ<ƲƲҭ@Zg*Itg|*Lqg!X\Itg|*Lqg!X\Itg|*Lqg!`\Ixg*Lqg!\Ixg*Lqg!\Ixg*Lqg!\g*-HqgXIg*(L&t!\E|`.d>d`CQ C|C+LN~x?hZsl?XZmPxT@w~PU<o@v kU$ok0Z7lp7A cZ L`/TZ7?P-<;.HE777/|Q|Y|||(i'l~Hs@~s))*$9*@*|+Z0q`Z0$_YZ0Yhh.h  .h$ .h( hh.h  .h$ .h( hh.h  .h$ .h( hh.h  .h$ .h( 0<G@vGLUTGPUX[yDzHz0Uz;lbsx={T>}`zU}l| .4(+Z\qt_ t_0+Z@qsl=[F[FL`B_d0B_D0L(: 08;<8x)6)6)6) 6l 9`h~V)XPlAuXlhuX\l;~; ~8;gm0s4=s=s8=s=_6_6_6_ 6 9T@uSDLSX cҭZ< AxAAATAT00td`d2XM<2`r>RS0Bl6<Yx-t($LC1=o1=o1=o1=oS= Y7z z z z e{ly{0#s4{{@7hs=sh=s@=\sL=s=s=0@?ZLt2?$Z~I#/sXs= s=l$ (902LO~ ~ ~~| Q||Q||(@s;/FT@'\J }0tBM@X=, = 0XtGxWu\3B CB\4/5<hA@.A<U@@v 61A0.A4U}AA0 @v L\GdqvhIN(NB8-WY½-ƅ=MT41xj@D |@8 OED~s~ts80'^8X'^(00<P}A.AU00<PA .AUA.AHUA4@v ߁/A.ADUO0@$v ߁$/0޺޺|(ҿUB\8=?_B)("//LB)"HT-UlYP.TY\.TAP.A8UAB)"O0A<.A8UA<.AlU@v 8m ,)PuUT Xxx x s=hs=s=Φk:h :H xJ l | | q a/s= J0Ss=s=@Ss=s=s@=%XRJk:X sx=: J+k: : s=ڊH*SՂ&s\=s=t4NՂ8&s=s(=ڊ*4SՂ8&s=s8=ڊtLNՂT&s=#<̎=tLNՂT&s=#<̎=tLNՂT&s=#<̎=*@SՂD&s=sD=ڊtLNՂT&s=#<̎=t4NՂ8&s=s(=ڊtLNՂT&s=#<̎=tLNՂT&s=#<̎=t4NՂ8&s=s,=#tLNՂT&s=#<̎=$TFCEnHtLNՂT&s=#<̎=*@SՂD&s=sD=ڊ%XRJk:X sx=: =</tHsp=PJ+k: s,=:| s=kXS0,O0x6Okk8lkdlklsLlsxslskj6t;/F8T0 GFT;\/FTqan\Vn`V'(p02H0O0O#l(#p(#(#0(#h0|4~,s'4@u9@D\tT @0\d @<0(  20S d(% (8S\QH(% (3 ZP_/((lu}u}u(< +X*( +&*( +{*{*P***,0',0',`',L',p>@1s=r8uhs=011** * J4AdXI9XyXpX:X:hss(Ql5j +%8P 8P 8P +%JHAtX'HCG$s=H,'sh=s=4?4`&4$_ Xh<|H&4_&4X_\S]B]0B]PL]$B0lGFT ;/F@T  l 3B CB@v 3B0 CB8\d@v 0T00'H C06JHAlXyXpLXx]#Fk 06<QP#Flk06@Tv K8K0{-uH-@Pv -RU@v Ox9O<0"YX |^ =<,*3B CB<X`@v \<o\o\\toN]QxvQvbwQvbwibLwQ0idbhw3B CB8\d@v @s;/FT<0NI)IX)3xlNI)?4hI)<0NI)IX)>E Z e{ly{0#s4SlY"o4-Y"o$- ҭ0Z 4 4v K`"(#h =$D IL=K`L`EI=KQTQRE4TQ4T4VP4TUW(34T,1L2`T5`E12pls=2x2+C0(T;L "xar+ҭ0Z99@SҭZs=@Sb" ,45! , Y, `vbt0 - t\YDSZ9_0 606dEZ Cz822ҭ4Zq,s,=ps=pTs= g PmoS  g m g m g m g mg xg ,L1ؠ\(+^. $ҭ`Zܙ  Tr`^ 4 6X lV T=s(=0S/ S,0S  Pwp k4S  }X W4S  }X WA+J999A+J999h 0gw LB T; _ -h 0gw LB T؍ W %1e (/b(1 D 8p:p W \8(})ԯ . W |W W  8C p02H0O0O\S z0O41js= xtSH : 4A \BB(B  pLL2h| D 8D  LEX0dNps=pO\mZ RY $mZ RY $O\mZ RY $mZ RY $VA``.A8UmZ \RY d$^ `q Ad.A`UW W ` 0O2^ `A.AlUAA.A,UAH.ApU^ |d 93B CB8X`)0Px 0 5H p1 )p0@`us=s= ` s=с`vxM s=MTDS.0q R 0FC b" A <= xhn D2u ` +8'+('lpp(p( ( dEZ 2 TB 2 TBhEZ`z` ` ` ` ` Ώ s` Ώ s` Ώ sJhAXc um7 x7 m 87 7 u . |@`  `p` T p A xQ |~ Ls . P  ` Ώ s TΏ s t\c um7 p 4 ,  p?  4 ,  lp? 3 03 03 X3 3 XA Q^ / 8a  7 Lw D H LΏ xs7 4w D H Ώ LsԦ H}7 Dw L Pڗ MԦ 8}7 w  ڗ M Ώ s  Ώ s Ώ s  4 4 Ώ s  Ώ s xΏ xs x \ \AP.A<Uk Aw @Pv jA .AU z@\v " d3Bd CBx@Pv }A.AU[ @v \3B\ CBp@Pv }A.AU @v \3B\ CBx@Pv A .AU @v \"3B\ CBp@Pv A .AU @0v \"3B\ CBx@Pv VA`.AU @v 6 \,3B\ CB@Pv VA`.AUb @v 6 \,3B\ CBx@Pv }A.AUx @v HK3BH CB\| ` LӒ X @f d Ӓ D+ Ӓ 43B0 CBDdlO0P u3B CBpP u3B CBp3B CBL2OKK~sO`A.AUA@v TDڗ TMA.AU}\ eDk HCѐ ѐ R eDk HCѐ ee<-~KR~$KcyLy#yl1Da|p18H8Xe7Xq9`^7`qFDB)D"F80B)0":pT:pl:pqppXp@ppppAW#?V!?V!?V!mWx'AW#?V!?V!?V!mWt'[p[p$_7`]Ch:pdCh:p[lbpb4-O%L`]sL=s\=B)"B)"B)"B)<"B)p"AW#?V!?V!?V!mW'C0:pPC:p?C?C0?CC4:p8?CC0:pPC:pK[4pH[lpb b4b[p8bh[4pH[hp SlTS+t++Y"o8-+t++Y"o8-N@S_+dY"o-+pY"oh-R4R4ƅ=MƅX=Mwu90|'DS<d'k@ 'RjPSuT9 1xҭLZcat?t}o}s<=0Ss =TppppppPp\9/L|5pJLA|X[ypXJ0A`XTypX\\.]s=_:72-+-+]F]lFy44|A"TAAB)"X"ȱ 73 :,Դ@3 :,Դ@X"ȱ 73 :,Դ@3 :,Դ@S\3^K&-CSd3^K&<-<C45k: :\ lt&\1^K&-C&d1^K&<-<C45k: :\ 6.ly.tS7\3^K&-CS7d3^K&<-<C45k: :\ >l>t-P+-x+-+G G(k4:8Ž k: : ]ZHYSY&s<=s=aY4NY8&s=s(=]ZY4SY8&s=s8=]Z~hs0bxdd?0(P?p?<(ʉ(+4+++,\>@+$+d+@+$+d+uTUUUUUUUUUUUUU"**P****@@( 8 9 q  ! ! -@-d-lF---&---- G- G- G- G-G- G- G- G- G----d-- G---,$*-Xl`*--&--TTX--$&-x G- G- G- G-- G-G- - - -llP-L-h-xllP--- -- --- -F- --- ----- -F- --- -- -----d- - G- G- G- G- G-@@0 @ @ @,@.@@( @@0 ` ----d-DDP!-TTT!-0-LDDP!--d--,F--d----0 L- -t --TTX-- -xG--d--0 L- --d-- ----,$<"--lF-((!--d--&---d- G-%!J@%!JV R R R R R R  R R R R lF-d-d---G-G-G-G-- G- G- G- G- G-@```hb` %5-$0 ----P@@ --d- |-- |- |-d- - |-G-4'--d-0 L---,(H#- G--LL#-HDp#-@((!-hLL#-LL#-P-p-HDp#--HDp#-- -d---@@@ @4D G-XLL`--0 L-d-@BG-|--0 L--X-----------G-G-G-G-G-G- |$- - -G-- - ----lF- --G-G-d----G-G--G-((8%--d---($ - ---d-----0 L------ - \*-40%-G-G-G-l------d-- G- G-4("-P-pllD-----G-G--P-h-,,+--0 L-SI&I&BI&I&W`H``' 32 +Kb  08B6BB ;!!!#' scccccccc * *  @@@@`DdttdD@@@d@Defd`! L&L&L&L&L&L&L&L&L&L&L&L&L&L&L&&       R R R R R R   R R X}EE N`00      QQ Q Q SS S S [[ [ [ _^^ Hrprpr@s*BBB" BRP!CB@DL Y 5X-``hP``aa` &@)**DDDDDD+@D@ 8@!@P+$$$II I I-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R 60 p ` @ P h aZ%cZ%h .PPPPPPPPP 7 @ B @@ @ B@  @ @ B 8    @("  eXe-! 'J'J' B' B'9'  "   !     = @  P  =    !C  B   @@@@   @@@ >@` !H3.``CxR"Ad.!kkPT'dXD>-XD>-xDx E&4 2%cBl&4x@ ;x@;x@\;x@;x@;GP8GPP8GP8GP8GP 8GP\8d*PPPPd*;2d*Td*8d*= = = !03.4CxR"CxR"`4S`4`4S`OOeG6x!@3.TCxR"edG60!3.CxR"Pf\<d"Z6$6E2{E2{ `` x f$@f$@0t:p8t:pUpU0t:p8t:pUpUk@\CxR"CxR"$$@xydRxyR$t@$$@xy$RDEX,L\$d$@$gy4gypt }t,}E}xyRxyHR!83.<CxR"CxR"k0Pkdj2 %,ӽ/O_!3.gfCxR",<[PDf,lb,bP(f,\bO0_!43.8gfCxR"O_!3.g fCxR"O0_!43.8g|fCxR"<8t)\~t~08xT8P^`qw86S^8qw(6>p9^\qw06S^ qw6( /b($O(3b((/b((,/b(0O(3b((/b(O(3b(O(3b(b(l((/6*780780"78:780J7:?0_<?_?_A4O .A@U3B CB$A4.A@U3B CBA.AU3B CB4<A8.ADU3Bx CBA.AU3B CB<DKo4K-yMK${nK,1J$ MpMppp[Mp[MpIHIHMlMlMx\ID8}@ }@P }@T }@ }@H .A8Upty^D9PR8SXYX{Sl||A<.A@UhAA.AXUQ`9PIQ`(9PXIlˆ??ˆ??ˆ??ˆ??A.A<UAd.AUAT.AU߮߮x[[[[ EZzLktzkg*-Hq gXhxg*-HqghX<xg*-HqghX<g*-HqlgXg*-HqHgXg*-HqHgXpgx*SqgXxg*-HD`qHgPXItg|*LD|qg!\|0U4|e8L|tB\B 6Y-kC|%D||@? `,0 0? ,0 ? 4,0  xnZ |` nZ ` nZ `@_\Z|7_Z$7WdpZ77/WdpZ77/lZ7p(Z`7%-;TZ7pL,x_Z7p<,L0_8J8 Ll_pJp L0_DJD L|_J L0_TJT L_J L0_TJT L_J L0_8J8 Lt_xJx L0_<J< Lt_xJx L0_DJD L|_J L0_HJH L_J m@8Gm@Gm@Gm@Gm@@Gm@xG7@v6Tp6td6d6j6d};@vN;Tp;td;d:j;d?@v?Tp?td?dX?j?dMD@vDTpCtdCdCjCdsl=b1bP1b1bh1b1{4>}t`zlU[yL}T|l ~jL$tGGp\,p\,p,p,AX0.xXh AXH.xX AX`.xX AX$.xXP AX,.xXp AX4.xX AX$.xXL AXl.xXp AX0.xX pD,FqaG#{9{9s45B)|"0b;wx%|,/lts=sD=;xX/t/tq aw>4{>{>vywypyTͭtFl9ͭFc(9ch9c 9(@})h(@})(x})w0w0a@ a@ ~B s=@tF9@Fc(9ch9c 94|T4  P  P   d7  Pl  - K{)H7   t- AL ҭLZҭ,ZҭZ||c44N$0 <2`6$6#9XlX7B@B-O8\ 8Sq|@ Iҭ8Z0NCMC*<(*$*T02T!2~xsps,ss<=Mli'`ƅ=Mi't,t~s\'D'D1=o1=o1=o1=o1=oS=;~8;g8;g8;g8; g8;@gs=s@=qst=s=s=h4vds=ṕÓ4Ot́xO< @mՂp&s=s8=sT=C7L_J u9,s;/FTxs;/FT0`~0s~slF` F(< }0j|4},j|8}Xj|\|Y||Y||Y||ztQ|X\zXQGxX\GX\\44/{44n?Dj{44n?j\48/Ax.AtU@v @v A8@0v A.AUOS~ATA@v =0FJDAtX0? 'yp p XL0_DJD L|_J L\_0J0 Ld_lJl L\_0J0 Ld_lJl L0_8J8 Lt_xJx Z`0't\Gq\GqB4LjT11, 1 1A.A`UO00<@v ߁/00<jA.AUL0_@J@ Lx_|J| L\_0J0 Ld_lJl L\_0J0 Ld_lJl L0_@J@ Lx_|J| L\_0J0 Ld_lJl   `,0,4,H0wHY(2HR0$ K// 2L /7gt2P2=Xs=kkP(Skt<NՂ@&s=s(=!Cd#$`r*FDCELLLs=!Ys=T ,=Pzo8YLp`os=OJs=s0=s=s=@"`ލP͍s=ҭZPPdcvb0~s`s=s`=s=s(=~sdSdsDlqYq$rLD2 Bqbq<aQ{~4pdC{~Llgt2202H`.Ў`}r,P<mɒ0r,D<mɒ@'r ,P0{ߗh|qM\M\0`j$T^[hu%Xkٞ k43Ѭhd333ҭ4Z@_cci}Pj6  'RjH01h|?0+lkZ l'Rj_4S_\0l L8 p 0( r@|i$oX l.~s'D'8H_  d11L#P2tDS$>(, ' w s= ' Hw PhG 0m< 00S@9S<#@2d(% (mL.041 |'Rj 'RjPPjT6 'Rj h'Rjl@S]JDf<pEZ8!K 2@ EKhws=B)p"sp=qas=s,=45Tt%GmVV8st= h \Z/4yHyH02X|SSHh_9aXa,;ҭZ3idesx=TATjYi OrrrrrrT&ddd' \^ h= ^ = R =01HA|01DAx|}j}j|$A||(3034[4(44C5x5 5.6,B6<5@.3034[4(48AX.A\U3Bx CBAp.AtU3B CBA.AUA0@Tv -RUO(Qll JQvQP R|| JITgQP R|QlQl Jl\<o\o\$\\oN]\0o\o\oN]P\\oA<.A8UjA`}AA VA`xs;/FT{D{{l{{{0uX.I<)3D]tl/<0NI)IX)I)I)<0NI)IX)&C <0NI)IX)I)I)<0NI)IX)I)I)0NNE8Z(8@KADEfB&f&Q^C'|AX& w E4T4V4P4TUW34T4To!o4!Do<!Lips=p\4&pt4p&2ҭXZ(YDa;hLiaE{LE{(E{ҭZҭZll0S Dd xx X  MT H 0 HY 2 H 089/L|5L> J> J> J> J> J> J p  ҭZ00[ 0N8 u 6 6 7[ 8N0S5  `3 |xҭ0Z ؠ (HLS xq> J> J> JҭZ4Z> Js=׈ Pqd4ZA+J97P 97x  HAHF> J 4$F Sx* tG+ |G+ x* G+ G+ x* tG+ |G+ x* G+ G+ J0A`XypXyp XJ0A`XypXyp X 0'Rj4 ,'Rj\ T'Rj# k \m# @k HmN [ TITkzZ W 8 W 8   @  Z  ,Z  qM\M\F `jj T^ hu5  Xm  m 4 'RjsL=s=s0=s=D d.~s'h'\0S`SJ0A`XypX!0 W, XL0_TJT L_J L0_TJT L_J L0_HJH L_J L0_DJD L|_J L0_TJT L_J L0_TJT L_J L\_0J0 Ld_lJl L\_0J0 Ld_lJl L\_0J0 Ld_lJl L\_0J0 Ld_lJl b@l9/|5:p0T|9/|5k(|5; GkL; 0GB)8"l (L0T|9/|5  W# ,դ d mդ   W# դ , mդ   W# դ  mդ  {, h0 + , 0 h8 `{ 5p6 = { 8q XR Xa r /%4O}j|}(j|(|(hX~B t {h, ls=\ @ FS ] q LRq LR 1% x  H1%  P) 7:p\:p:pDP) 7:p~xsp , s<=Mli'`ƅ=Mi' , 30su9H$JhAXutm( DL` D8 8 8 8 8 8  x xc pu m p4 , , p `8V p> Dڗ Mڗ M@v ڗ PM P0 PDԦ H}7 Dw L Pڗ M c@Pv @v AO .AUK PC A PQ3B CBԦ <}˧ , 0ڗ 4M 4 0 PDڗ PMA.AU@v @8v @0@4k XC`@@ƅ0=M\'dd@dds=|PH6\`dS(69\6}H2 K#M#R,PN@|Ti|t\|\^#@ ,4Ap:pp:pL9ת~l' -#@T,:pdzX+kZ ?C0?CC4:p8?C?CC0:pPC:pC:pb4b[p8bhb|[4pH[hp[4p4;x/FT992(bPƅX=M$ƅ=MxD 4.k8?rH%Hr30s 30spatatat} M xLH2`Su|9H%1Datatatƅ=M40 BL0_LJL L_J JAX y pXpppppDp0dps=sX=u`''rrupJ0A\XypXV>JLAxXypX w A\-+-+w%]8Fw%0.Bz@ozD 8.Bzdozh X0`X@|XPUWs=s=sl=Yo^07@ŽD ^07dŽh j0`j@|jPҞ4/’kT,; ,l  & $ l  o[P o$[\nVnV}02H25pBsd=5B5BJ5q,as`=3/tu"ksX=$L4uWL`+<<L'+ s =+@+@Y@"o-+++@+@Y@"o-+++@+@Y@"o-+++@+@Y@"o-+++@+@Y@"o-+++@+@Y@"o-+++D+DYD"o-++s =s=s=sh=s=s=Y|"o-Y"o\-Y"op-Y|"o-Y"o\-Y"op- N@HB 2dH- pp``@@ ooooooOOOIIIIIIIIIII J `B` `! $@@H @@  3$$400P (% G- G-,- G-- G-&-,-@-T- G- &- G- G- G- G- G- G---G----- --- --p-----d-l G-x G- G-H@!-- G- G- G- G- G- G- G-l,,---@@@!---x<,d!-d-d----. --- --d---lF--d--------- ---d--G- -,88!-d-|-d- -lF---- --- lh"-(--0 L-0d-@-X84----G-G-G-G-G-G-------8-@-H $-h$$--h\"--- |-d--- P@4 t t 454h$ -$ -----x------h-|----lF-x--0 -0 L--d--d-0 L---lF-<&---d--lF-lF-lF---- -8-DG-L-Td-LL`--G--)--0 L-----------G------0 L--- 08  @ $      $ ($" D -d----x-(BBB B !C B @BB!CB@B'`` ` `` `  @ 0 !$4@VPP 0 555555555 5* IIIII I""222)@ (( .       ($($  @ <<IBB!!C!!C2$!,  AH ;B 0 +  ;XXXXXXXXXX @8< <<  8 889  888 x 8 YHhx >   P P}@`1@PU-/3    C@@ $B 2$ M!   ""@    @"  B b r r @@C @  $ P@ /B(ƨ@"b  '&&&$$*2 >P ********    !H3.LCxxR"CxR"*Si2`*LL2<%2u1<121P7d*ld*`1i2L*8Lx2$2{x22{6\6LW66,b`W!03.8!\f t~| | CxR";P;0G6H&p4&4Pfx@;!03.4YDYCxR"YQ\jQ`jO]O]O]^O]Q8jQ\uOtO]O$oOQuiL*O<iDi|ii*i"dI"|I"I"I"|I"I"tIG6D!L3.PG6|!CxR"!03.8CxR"YN4k`YNk,<[2H%!p3.,bCxR",[2%,(b!$3.(CxR", [,0b,bDUG6,b,TbDHUG6<|rDUG6DUG6,[2$%!<3.T,bCxxR|",p[2%,b!3.CxR "RH1Ӏ dpDHUG60!P3.T&*CxR"  G6\ׅ(Ȇ7!03.4\ |h CxR"mHx17 626\<P"\<"\<T"G6!!(\<d" }0t,}E}$ }lt,}x5? || P |  |,xy$R$8@eeh~~~H~~W0G68F0!B!F0!8B!DUG6<!03.4kLP@lzCxR"ˢQ~\&=r=rˢLQs"~\&!3.CxR"CxR"&i2(*Lx22|{1T*1<o.0@L ;ChxRl"vfllv$f8PC0_dd~eLhp^\qw06S^ qw63`45445X3`'3t`45<?<??<.@%.@(%.@x%DSL_J L_J Mp\M4\M,\M\0SMDMD.A8UlCBTltSYRHA$.A U3$u4$ARD{S lW WT,.A8U`P`0 9PSYP00 9P<SYA@.A<UA@IIA8.A<U@|v @$v @v A4@Tv IXVcIhF|:~4K-4K<-}8j|D}j}j|||D(xA}@j|TE|2|8Y|<|(}j||Y|}Pj|p|\(}j||Y|}Pj|p|\(\|rh h 8ƅ=Ms=ׅl pwCwCw Cs=s=}l 8SJLAxXypXSItg|*LSq,g!\tIxg*L6\E!\HFh69S!1?dZ?Z8LC0HP||@|E ls \E \sws(=|pT_hZ7_Z7,H,TXStZ7Z74`56Dj`5`6sD=s=#6@A9`p9:Dj9`6sX=s=:T=`=YX?Dj0>`6sh=s=>dB`@B CDjB`6s<=s=[C8{4>}t`zlU~$%}\`zLUCzhqDaLGp,@Gʞjʞ@jt_t_t_;08L@0b_Z7s=s=s=B0B0X lXX l D7 j 9 $  02  j 9 H$ $ 2 `I b????q!4!P!.!)4"9v"^"t(hC*,*$(*l$*l$*lT8,C*0*$*$*D(*L0NCMCC*(*0$*0Rss=ƅ8=M i'@hsh}sum0s~Psh'Pt*u 9L2 *LP20S${4@S03B\ CBAP.ALU@|v M~sQM~$sA.A`UO010t<@,v ߁,/A<.A8UA<O0<@@v ߁@/A<.A8UOxAO A}AA 2OLj`0OLjOOҿUB8L=@|4khkk k\ k k8kwHYRdHD(2YU0UD67BREg+\0UD67BoMg+\'bP|T Xgg22~lY2gx22/\t/t/t/t/ t/Lt/|t<s=oDP@o@lJ8JVs=s,=sh=s=$X75Q5$=DnH$!4YqDaD.K|IKds=s,=,Ls=YL``s=o@PTJJTVs=s=sX=*\SՂP&s=s$=9-9-̎`=o ݃DG|tY|||Y||( s=s= Xs=0( @w H7{ JP( w \G 0m< x0~0s308s U[8(% (8(%d ((% (01`BOO`BXOXOD_DSҭZ+TUst=}4}hJ50O060TST4<+4k`dZ>0gv@l,.1*8^? Pj,6K 42\ L $LuWL`L(N/04`4`4t`]4XR 4`CT\r48`R)Uh)Ynh>@6U6@g+D\3B0 CB@\dA.AUs=e| (/b(3B  CB @H`josx|pbj|bp݃HGSodso01EA01lp0AEX D^ P=  R = ,*4*)/ _//@_/0A8.A<U9XO3B CBJJ J`Q0 JtJJ( R,|QvQlQl JX R | J \(o\o\@o\N]p\\oD`~sD`~sC3Q`v R`|Qv R|Q vjqbw3B CBA.AUA3B CBA.AUA<0NI)IX)I)΄8IH)gK[b8tl*#F>I@)u.I)Ip)u.I$)30EZ0x004e0 (/b(b98K9H:es:sllllpsDDDs\\\ HY  dT H D 2 U9d_9_EZ<lf S H^S PTX g mg x9/|5փ \7ҭLZ$1ؠ0(T+^. 6 <h H- 4 \8 uo \Kҭ0Zή 0 s,M   4 8Z GL =ή  GL @=ή ,  h8TZ |G i(  i0S qx $ h 09! |F 99" hM9x* G+ G+  , \G+ `G+ `) 4q3B CBxA.AUA` z  W z l W B D_| `@ Ds,=_X_[W 0=~W JW p6W W W W @Ah.A8UmZ \RY h$mZ `RY l$^ dOOO\` O] L62^ (`W Lp_<J< L_J @qaq(aqaq<aqaqHaw`qaq(aqaq<aqaqHaw`l 4 P ( (<, ,<Ƴ #+ }\j|d}j|Y|||l(wLal T)8\4@ 0R}@ L69 ?@ JA dSA LYA '4@ 0R}@ L69 ? 2 BA dSA TY2 C 0R_C L6C ?C J6D dD LYD 'C 0R_C L6C ?jE B6D dD TYE  s=ƅ8=M i'@; hx ~Љ Ds\lމ :~or Dx <x a  7 =U |H 8 p? 3 3 3 3 3 <3 <` / a  pō P  U+ [Ԧ H}7 Dw L Pڗ M xΏ $s~ @s 0 Ώ s c~ s @c PDڗ PMA,.AU@,v A,.A|U `Dڗ `MA,.AU@,v A,.AxU PDڗ PMA.AU@v A.AhU hDڗ hMA.AUAA.A$U DDڗ DMA.AUA.ApU@8v eDk HCѐ ѐ ,ѐ ѐ ѐ ||k||k|k|hk|k|kQ@EZ @3Al7@NTSlqpz@ JIt|@ J++@ XJ+X++GLGGGG Y< o .|-|Y|\|<(|(.|-|(|Y|\}pj||Y||(| Y}tj|||Y||0|(}@j|\}j|Y|||`(C0:pPC:p+)+)+)30sD<30lsƅ=MB)p"'pB)h"'hPSY"o|-S0+\kZTb ~ 'Rj@ 8'RjD}M1813B< CBLhpA.AUA%Qd5j Q5j Q5j 'ҵP'p'ҵ'ҵX'ҵ ' E/: ;/FXTOq aJ0A`Xyp X AV #L)`X.Bz|oz XZolZolZoPlZolZo0lZolZol~or~o`r~or~or~ohr~or~orLD`^X7|Ž jRtJ5 ~"ȱ$ k: k:H k: :P : : wX%RtJ5 @|"ȱ, k: k:H k: :P : : wX%aZolZo\l~or~orZo<lZo4ls= 4p`  p DpOjj4Gph,jijYXSYL&s=s =ͰͰFb\b\s=sP=sD=<Ys= s=s=s=st=s =sh =&  " 2 :  z : ~ z z0z0z z z(z,z(z(z z(u@0 H0 5 ]] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] Y     ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] --------G-,,--G- G-$- [       G- - --d--G-llP--llP-t-0 L-0 L--d- - ---- -d--d-d-lF-- -T-lF-- F-- -$- C-RT-R-R-R-R-R-R-R-R-RG-G-G-G-G-G-G--- - -- |- |- E  @@)  @ d-LL`-P-ld-|LL`---d G--LL`-L-<8#-G-d------- G-`-t------% B@@@@ T0I$I%I0I$I%I $I$I%I8I$I%I(I$I%I"I$I%I@ I$I%I%0p0P04p0Xt0r0p0p2p10`JH$I"``JH$I" `JH$I"``<L&L&L&L&L&L&L&L&L&L&L&L&L&1@      @      0@ @@,x(_R@(8H H@@@H"0 @0@8@@@ <@>@>@>@?@@@  @DDFB G@ 8@@@A@ @ @ 4    7@@D`D&I$IT&I$I&I$I'I$I%I$I$I$I$I$IP2 "$$$$$$$$$$$B $B$2 ^,,,,,,, O@B !@@ &L$&LB$&LB$&L! &L!<L&L&L&L&L&L&L&L&L&L&L&L&L&L&@DHDH(BLHTH=                  N` `$@`$@ b$@ R$@ $@ Z++++++++f @~| L ;X!3.G6CxR"x2H2P{!3.CxR"du1<2%E42{fH`cB8lcBlEH2{H8*<Lu1<1H1\Ix_1<,*1,oIP+4X1TPfQj(QMQrQTOoQYQ|u!03.4YLClxRp"YCxR",d[!P3.]C4xR8",Xb[@Q`uQPjO]`a`CO]O4gy4xyRy``8yD`t`H !h3.E2{k;EH2D{Ȇ7!3. CxR " G6G6"Io\<" !L3.PCxR"CxR"!03.4Ed2`{klpCxR"6@6066,b66, b!03.4E`2|{kCxR"h&T4tt:XtĔ|B0 d<{` dd,9w B@ dD!83.<CdxRh"!?9CxR"Ȇ07Ȇ7!3.CxR"),bCHxRL"!p3.!3.CxR"@!<3.DȆ7kCxR"WG6F!$B8!\ Ln~ t~hn~l!03.4PLfPlf6d6CxR"2@%6666|,b*40y;d_.`G6CxR"CxR"CxR "e\Hdl~ "P^\qw06S^ qw66?^Xqw06tS^qw6>H9R.L `.R. `.R.$ `.R.< -wL18MLML3Lu\3Lu.A8U3u\3Xu4X-RU}@jf}8j|t|H}j||h(}jMt}Pj||}j||p(QLDhUH]o|M]ɍ6b?IH[[[[[[[@[!!!!l!л.p!xg*-HSL6qgtXJdAXG$~s=s=s=ҭ4ZEZh A<.A@UUTo@v k@kkUoA @cZ T`r (B&(r Z `&QZ `.0ET7.E7.E7.DEh7\H'xn,n,n,n,n,0;`7$p@7/4/,t, $ P3At7PNZ7- ;r+_4r+_r+_r+_r+P_r+_r+_yF@4d5F@-505050: 'JTA9dp9|JT/+:0+:0+:,0: Md=d=Y*Nd->0>0><0: Q8Bd@B Q8-B0B0B0: ;b;b;b;b8;g8;g8;g8;g;b;b;b;b8;g8;g8;g8;gdvs$=st=tXNՂ\&s=DmՂl&sL=s=s4={0>yyq<ayDvywyyAX0.xXp AXH.xX AX`.xX AXh.xX AX0.xXh AXH.xX WX4X AX`.xX AX.xX AX.xX AX.xX AX<.xX@ AX$.xXX AX,.xXx AX4.xX AXH.xX AX$.xXT AXt.xXx AX0.xX AXD.xX W4X W4X W4X WD4XH B)"s=B)X"sX=B)@"s@=4s=0X)xi0X)xix0id03x0id03xid3xid3DP(J ci$[$%+`+`++$tt|9D7 :&2@7 :&2o063&s6#,6#   !%T RC<(!\C C<t 42Lz9txwMGxGxx[xwM{47{X7{*{@*s={*s\=0Ds<=sT=́ Os|=i%t#s$=s=s=Xs=C, h H D$ /HHHDHHHlHl L'\J }0|Bu|9pDl~sTx ~sLF d}j|}dj|X}|j|x}j||LY|P|LY|`|Y|}j||ztQ% |-zXQL X1PG,Q54h8617d?5h3B CB( H P 86@<v A\.A4U!;\!;\@\v @v [~sL\2L2LjLjWMXtHuMu6uBeJ%HOv@SA<.A8UA<O1T0<@v ߁/ώNώ}}K K KX~Y2,2$Y2\N45y pHXN45qaeLJlSSkkqas==X J!Ysh=" s=]s=0dO"s4 =s =*8SՂ<&s=sh=9- ڊ9-ڊt@NՂD&s=s0=tNՂ&sp=s=45p45454545454545PP~I/ts =<mՂ&s=hmՂ&s4=s=s\=,sdL0BLsX0 60 6, >0| O" Lh=L O) 3Ѭ333|*@0\  @ lX vLb^05Pj60Pjp6XStooPSh sl=s=|S@9@9HSJHAtX88~s~sL0_LJL 3B CB@HOPS"^$GҭZ<<E^  ,lс0v4L2~4s,30DsA@.A<U@Pv Ax.AUq( A.AUu9L'pL`_J /6hTh/xh]Lh2th6hL_0J0 3B CBl@v G17H$Gj$H1j411@ 1> x^ =  R = ,A<.A8U}AjA(Ax VAH`APA P xR = , ,  R =w 8'AH.ALU7\At@v A@v K`\o[l[K`|4545[4545bwbwQvg R|g0 l@T3B8 CBHdlA.AUAHDD`~sHDL`~Ts dz<Idk ZX  z H@NI)Ip)I)I)I)<0NI)IX)I)I)Id)I@)%0t,`1yQt,8P],\ҭ(Zl84l8D-X\^C'|AXb.ҭZ@@<pU:4eŲs=&L _ J  (\;H;[ sd]]P_]HҭZttsl=.\. \%tؠ(+0(\](p]ҭ<Z@\9/D|5D:p:pJ\AXypXJAXyp@Xkh h ,kh h 0kh h $kh h e LJ\AXypX T  T xp 4Z (- [  %  ք 8    ,ք ք $ \7 i 2  ( "> J> TJ> J > J > J> lJJ0A`XypXypXyp@XJ0A`XypXypXyp@XL_|J| 3B CB`hA' W W DWDAt5t  8 0^~s 0^D t~sU PU T^U |^,V  ,V  TV rV ~W XJW 6 X FW XW @v W W ] <C^ dG] ?^ G] 6|d 9sd=|d 9HSzj f :f f x:f Sv  ,V   (',V   < ( @ Df ' ?Ǹ DU l/ e  ͹ XW <W <W <W <W H<W d<W <W < < m $ Hm C  m 8mLe\hwt`p| KsT=s= F1% / <F1%8X<l+0B|B|XllXlll 0sH= |s= s= ds|=ka pa -Opp\p:ptpd:p:p:p0:ppq+ P+ + H d s =+ sT=` Dc um` 4c TumK l% 7 =U ,H 4 ,  lp < 7 =U H   p? ?  7 H =U H p   p?  P/% u m /% um P/% u m /% um P/% u m /% um P/% u m /% um P/% u m /% um P/% u m /% umڗ dMA.AUA.AdU @0 @D@@v ڗ tMA.AUA.AU@v  p0 pDk LCk A.AUk  A .AU 80h@cѐ p@@h@pcѐ @@3B| CBA.AUA@Hv 4>X"x>>"s=s=8pppL2Pj 6h|Pj6x(DS+$6@ $J$HLdPv$LLP)4])2)\])h2)])2)<])t2}2 d2|GG0pT|5s8=s=9/|L5s`=s|=B)"B)"B)"B) "B)"B),"B)"B)<"C:pC:p@^C`pC4:p// {C:p?CC:pt?C\SS\SSPsl1"w$?HZwSp<qX+U,` +Y"oX-Y"o-Y"ol-4XNSQ5j ,>+0+|++8kZ`b$ ~`Su|9H%ƅ=M1igQ5j Q5j }M L`LB)l"'llB)"'b0,D:p8,9/`|h5pD,4_LZl7pt,ldˏh lˏ Ju &  l0 < l  AgA$  4 @   eAs=s=j8pjpjTp N45y pHXN45M/qaY8SY<&s=s\=Ͱ]ZͰ]Z*Z<mYx&s=*ZmY&s4=s=s\=h(4; |x ~$VyN'QTHig 'Rj 'Rj}M10+@+@+@Y@"o,-++++@+@@Y@"o,-++ƅ =MBLL~B -------- G- G- G- G- G- G- G-- G- G- G- G- G- G- G- G-X G-d G-p G-| G- G- G-<< - G-`0 L-d---p-p- G--- ---- -0 L--|-------- G- G- G- G- G- G- G- G-------0,-$d(-DG-XG-lG-G-G-G-G-G-"  * @@EB@HB @HB @Ȑ B@HB@ȐB @Ȑ!C!C !C !C @Ȑ= @@@ ;   @$ ((,,.>** )) >>nnNnjJhh!     @  L   !        .  (8(P((($D@$ 7``ppppppxxhhh h `H` ` `3@@@@@`   ; 0=`@`@`@b@`@`@`@`@`@`@`@&`@'`@F`@Fa@=    0  <~ Dn~x n~n~L:X`<&&&&&y6-d`LO-l`+i<O- k-\ `P <0< <<,<x 2<D<\<&*!3.CxR"!3.C0xR4""0I"It*PcBl"LIcBxl,[,TbcBDlT UKh"I? 666@64,lb;H;0G6T6666,b"I!3.CxR"!p3.tCxR"{<|-dd* | ?|X &\*?| &*!3.`v&*CxR" , ,,l=rp6X6HȆ766,@b,<[ׅx(!3.!?9CTxRX",pb,b>HDUG6?p |prDUG6DpUG6T+hj<| | +hj<| |  C\j| h | p !x3.|?u?Q? CxR"yeF\E| x | | eFTE| ( | l |  16<$036,8=6DL;6X764268_9x 8626?8 | L8DUG6h "$ @xy, Rh"DTUG6DFE2{6DUG6F20{X!\3.`p kCxR"@!<3.DȆ7έUk`dCtxRx"OT8t eePe~H~L~eXe~~~~~~8d!L3.\ee~~TCxR"e~~~ $~~`ddL6H68W`G6h+ӽ/66,@b,`[!h3.tCxR",bC$xR(",Lbo4oG6o$o<o<p|@z@zxX <G:i2*L d Ln~~ n~hn~l1=o1=o1= o1=,o1=Lo1=lo1=o1=oS=;~8;g8;g8;g8;$g8;Dg8;dg8;g8;g Ln~~ n~hn~l Hl~xt)~ Hl~xt)~~:5II4`)H~Ih?IIIDMMITI.A<U{Sl{SlH<A8.A<U@xv AA`@v @ v ˆ\??ˆ??ˆ??3B CBA.A U}ADA r_e9`ws=|tws=w0s=.$E7Z7.TEd7 /1%1%1%(1%87G!% !%!%!%1%1%1%(1%8<G!%!%!%!% D8GDGDGDGD@GDxGDGDGD G8l{>X|jlzTUs=sH=Cz}|0f;~;~;,~;~;~;4~;~;~;L~.4(AX.xX AX.xX \_Y`Z$_Y.4(D:(B_0B_0zz-T- S|6$6<M\c9c9v4w)$LpaL dL3oSx606o@\c9c9JhAXypXJAXy pLX?JhAXyp XJAXy pLX7,mQ3XQ3hQ3Q3Q3HQ3Q3pQ3 4Jc `TtFp LF p $ h  $ҭ\Zҭ,ZҭZtt 8xZ |4 d 84 Z GL =ή 9 dy9 dy9 y9 y9 y , G+ DG+ D9H H'Rjd h'Rjl H'Rjx @'Rj h/$  4Q5j 'Rj    B)"n X~PsH0tO0O06 L2  W# դ , mդ  C `mդ ƅd=M0 n L2{e{y{#s% xUL tQ*0%L Q*%n L2 X< L7 L/ DY^ Da ]2 (= Bv Y _:p\* L P*  *  <*  <SEZ4 T/5 uE$Zt  x x # %   * wk <C | D D5 <W`  v5 W` ڗ 4Mڗ xMA.AUk ` AdA.AHU} @Pv @Tv A.AUA4' 4; F ; Fk <C ` D D v #\ XD dD7T7q~s'u9C}$2, 02HCk4A[(p[p`\p[xp\|PY|T|,Y|DVf}j||Y|0EZ|z+|k Zp4b +\+^}b ++b ,>+0+xVVPT~s'ƅd=M4~ds $B' ' $ƅ=M~s}2 p2CCCV+$Y$"o-+Hb +S$pSK~p+^B(\.LpNi5D$i$g  'RjtHtHatatA<.A8U}AjA(Ax VA4`O AAH2p}8}M__l_ q0 _-+yy yPy y/y y/y }2( 82H21`<-x\R]1`$-s@=s=s=e0 (/b(J(AXXypX 'Rj mzm zmzm,ze, (/b(mXzmP@'8)f4f4f4+t+++\Y"o-++$,h>+  P@@,X& `` h4'--4'--4'-D-`TTX--0 L- $-,-H-P-Xd-h-pPL- - - H-`-t-G---d--d- T-hG-l G-- -d-G-G- -3V  V V V  V W  WIK W  W # W V  V  V V W W  W  h((!- -- G-- G--- -I R) R) R) R) R) R) R) R) R) R) R) R) R) $-8-@-X-l-t-0 L- |-- \ -|-d-----lF--7@@@@@@@@@@@  U DH HH `H BdH - @aa H@+@ @ @ @ 6 WGxG`GdGbGbGb$Gb Gb$GxOxJ  PPPHH H @H rH rH HH HIIHH <B    B     H d*L*<h*L*L*xS*Z*L +(*@L*`L| ,[!?9,4[!?@92L%x X ,b!?9x@\;&4x@;!&4&4x@T;&4&4x@;TP@TZS7F07 :T8DT<@T`DTd@T|@T@VV, I +4()Wt88T8)WV8[X6H66,b!3.C8xR<"eLG60!x3.|!3.CxR"CxR"DHUG60BgEG6,[gM!ngPI!T,bTII\+4d1`8vII*Lu1<nOnhOf ~| f ~| PfZ4PfZ|H|gy }|t,}0E}|ssHsXxyhR!3.C8xR<"CxR"CxR"C8xR<"28%Ȇ7E&4cB\lcq@!?9|  !X3.\~4~ dCxR"khle<X`A~ HPs=s=z9xz9xsH=999990?0?0?0?0?0?0?0?0?0?3B CBLhp3B CB@v @v A4O .A@U3B CB$,3B CBlNLWN|WHIIMMRHA,.A(U3,u<,A 3duMdsd=T0{S<l.AU{SlHLe9`\wsh=|ws@=ws4=_Z7(_<ZT7PFdF\FpF3B0 CB@\dLlA.AUA_J dphvhvhvhvS=tS=S=$S=|S=S=,S=S=S=s(=Z Z ZDZDZDZDZDZZZw>D1PS,s8lpxq a{9#{p9#s{9{ 9HsB)"0;8: ΦΦ: :  0:Φ0X)xixiuLt)8@Y\\Vs= d~B ds=s ='{''s 7x s 7 s 7 '(i'i'$K#LMK#MK#<MK#<MK#<MK#4Mi'K#tM}0j|4(X})}Xj||<Y|@}Hj|L~ls,~sƅl=Mƅ=M$~s~Ds~dsDƅD=Mt~sƅd=MA.AHUAPA0<@v ߁/@<v ߁</m@8vmmvmX\vmv, s==Ds=s(=/toEZ+^45^T45t^|45N`45hN`45r, hZr,PZNlkx7p</xx~s3d =7LZ_t0%j+i'i'l&4_Gm>4&4_&4T_&4 _Q,s4=s=QPB)"Q(B)"s(=QdB)"3B CB@v 3B0 CBLlt@0v 4H~^n݃|Gsdop ]s|8b|b@Tv A.AU@`v A\O .AxUH-X{-u-d- d@Tv AT.AU@Tv @Tv -RTUA @v )T#8'@v 3B CBh&3B CBG\@Lv 3B CBG HC83C 3ATO .A<UHY:ƅ=MpD`~|shC3CL3`` ```< ` `8 ` ` ` nx(6nian n`3B CBnEn u<mDumu.I)03]/%%p%|x+kZ; ~ ]2d2(2s =s4 =s =s8=s=s=oS 0 T S h S ^S Ps=sp=s= y q 0C-  -  - L h Hԯ T. 8) k Lԯ . Z < @ 3 <3ҭ4ZEZxHzs=qHa% dhV 1Pj6Pj 6 4;l/FT1~hs`,Oq\aa  s=a\  Ds\=+`+` s=! 4)! LR )! RT! t z!  $ ! !  /% Tuxm\ </% u m  ,AL.A8Uk A Ώ s~ s 0 Ώ s 0 XD D v #l hD tD  DL_TJT Ou . ,L@_LJL Z Hv P0 P v vڗ MA8.AUڗ XM 4A@.A<UA A}AjAA VA`@AA\Pj6 'Rj 'Rj 'Rj 'Rj@ 8JY"oP-+8+@ JY"o-++P|Y||DY||Y|LVTf}Tj||(?C0?C?C4?C^CDpH^C p^Cp^CDp^Cp^Cppt^C8p<^Cpb4bbb0\ph\pL\p0\p@\p\tp\Xp\<p^L7\Ž` j^T7Ž jR./y<.h/$ 0 $    zLzzzzzzzzz/\t/t/t/t/ t/Lt/|t `p/tO&,+ 0(s=.6sT=O&PU.d6PY"o\-;FY,"o-Yt"o(-|9\ +4+++N@Yt"o(-+\+,>F00@`0`0 0 `00000000*80"0H""@ 1 @@N.5$,$--- -$33 3s9ss 3Ys3AY)  -  ((D F D!D(   D)*     888      .V pV pV pV pV pP 0P 0P 0P 0P 0P 0 0 0 0 0 0000 L-`-- -((!-0 -(`!`?(`a@?(`!@8(`!(`!8` (`O(`O(`C (`C(`M(`L3$$ttdltCCG@P@@HLP*@*D@d``B`@`/QAAAA@A@.00000 @0 @0 000@0Z00z00X0X00H0H00L00L0L0@0W-)aTJ% -)aTJ% -)aTJ% -)aTJ% -)aTJ% -)aTJ%-)aTJ%-)aTJ%T@X@``bp`lh``m s@@FD  q @  @    n@H2dH @HB 2dH I& dHI&2dHI&,[!3.d*,b,CxR"d*C4xR8"-<-T-  --`dO-`x`G60y;_G6y;_G6;;TG6X,[G6,bV?Mt?]?S!$3.(?@u?DQ?X CxR"?S&04C8CDyC{CdcBDlDcBxlCcBlcBl!03.4C`xRd" y| !3.2EC8xR<"TIpI+4<1l,*1,ovIt1$I*Lx@h;"Ix@;"Ix@;"I66 6l6`,b!h3.l;!3.;0;G6(;DCxR"7G6D!lx2,2{6tU`G6!(U!,d[!P3.]L@]t-*xLCxR",(b,d[!P3.]vV`5t*dLCxR",(bd*8;2p^*PfQj@zQjOHO]*0S*8ZJe0G64!x!3.!3.CxR"C,xR0"ZZPfooG6o o o pX.pzTzT%h"hD"CxR"\<"!3.!3.,P[!3.,,bG66E20{CxR"| \ FL7F`F7!3.?u?Q?  CpxRt"Zp8G6.G6\< "CHxRL"DHC`xRd"P,fP,fE,2X{E,2|{ dR1Ӏz%?h -G }t,}tE}е@xyRxy8Rе,^Xqw06S^0qw 6l?>9kt9`R8.AHUH{Sl{SlxxSY3B CB <DLq A.AU_pJp s=X$Z-zlk Zx )dP|tc=?Z"X?Z|z?\Z?Z"dpp07t/7 /// /( yF\45yF45 Ft-5h05050s,='J\A9p9'JA9p94|J/+:0+:0+:0sL=M\==YM=(=DY*N->0>0>0sp=Q\B@B QB@B Qd-BX0B0B0s=[p \ [ \ [ \ [@ \ [ \ W, [l \[\ \[t \[ \[ \WH {4>zxzlU[y0|L }| $h vGUH_Z73B CB3B CB$,{>{>{>{>vywypyTvyTwyy{>0X)xixixiTuw00BBa ,% a8 8q́HÓÓOs=ƅ =Ms =bHs=!y!G,|("L2,|,(L217?5@h5h3B CB3BH CB`@v 3BL CB` 3B CBh 5 hO<50h3B| CB3B$ CB8X`17?5h3B CB<X`L A.AUA{_J VA``.A8Uf%.[%"0<<d% A5/߁/Ll_<J< 3B CBAD.A@UADOL_J 3BL CB (Ap.A\UAO3B CB|@v 3B CB@v O(3B CB<X`q A.AU@v @v @v @v 4^p^p^pG^p\s=/@ts =s< =s =tDSs5'J5 cNJ50O0@6chN0O<S@LSPs=j0Sd45 #sl=s=s0=s=s=sP== s=s={#|y$P~I\ JJdJVs<={#@sp=WX WC WC|ti|,\|ti|\Gztey-GzteyT-i'4i's`=\|5}j|}L j|| }< j|l |t (]GH{~0pC{~h;GH{~ ٞ$,%%<T 0( $DPQo\@xQsh=,#2 % (_%p ($_%h (%( (3B CB@\d@v 3B8 CBXx@v @v 3B( CBl@(v @(v TO<Xxiwj++U~sLGm\?>4?&4 _&4 _&4p _$o2s`=so2s=nxo2s=W t R =w 's \,W45s45@ W t R =w 's \,W45|s45 tW ` R = ,sw ('Y ^ =45lIj?Ijl?cjDcjD Jibwi\bwi8bwlhT6m<)Sm\1}mPN3B CB,HPA.AUAqL%@u<.ӎ)@LNuT.u4.Ix)u.u.n0Id)N ,Nu4.I()ɅX?hI)n PX\h`cccҭdZcDsx=h  T   0DP.ss^l.ؠ(+3r  ($ ](8 ]ҭZppǘ DZLҭZTTˣ.(S" |/22)nLV" / DG  $ ,5 5   <  T  ~sA n  30s0O0O0$6 ,.hp114 0}lM 'Rj 'Rj p'Rj|%D9T:%:dƅ=M<%# Dc D  xy\9 \ } h8S4 /5 ,upEZ,EXZ9 @? 2 LB| 0(| l(| (| (| d(| (| (| d(| (| (| p(3B4 CBXt|@v % *% ,% /% `0% 1%6 ,6 ,"  S`  " \A Q K ,  \    ( Ώ s u . p ~,s$~s~(s ƅ<=Mb( ƅ =M sUU_UU8V$#?Vp!?Vp!?Vp!\V'U_:pNrC:pCd:phC:pC(:p,C:p[hp[4p[p,[Lp[p+Vp(Y"o-V$+V< +  Ju Ju k:Ž k :$Ž( L1Zo`l!%0!%4!%8!%<!%!% !%!%!%~o<rqa,0.j ;;/FT' qaq` a' 08׭0`$`l@ P-`-p--------- -\ |-h-p-x---l(-d0("-LL`-- ----------- , |-8 |-D |-P |-\-d-l-t--- |- ,-4-<-D-L-T-PL&- |- -d--*   @qqDq q q@qqq#"?? ? ? ? ? @7 5 5 %      @    8(@ @0@ @@@@ @ A A @ @ @#% @ @ @ @ 0 0#0$0 < <H0000g````VfFH`> @ ` @(@,@"@   0    P P @  P F%;T%T%F%;`T%L`TT%T`h`F%;F%;!03.8C4xR8"| N;0 !T3.XCxR"S\S SS  S\ SSHS SS SH Sx202H{6I*LV@xD\q*h<!03.4ChxRl",\[u1d<,b!3. *LhCpxRt"!L3.PCxR"@z,@[,b!3.*hC(xR," ^ !3. ^ ^ ^ C<xR@"CxR"CxR"QpjQtjQxuQ|uO]OT]9_X_X^O]u_\_ 6O4]E\2X{klpk1,'qfqBq$fqPB~~| !?9 ~8W~WG6@G6~?y;_G6,6H682h%66,bc4q(@!?89@| H C<xR@" \y \y!3. ? f ~|    !43.<?u?Q? C xR$"C0xR4"CTxRX"!VD0UG6d626(71A8$3\<"!@"HIt*Pt*P2P{t!x3.|Ȇ7k`HCtxR"p !!G6!3.G6P!(C`xRd"kPHCdxRh"2{!3.kCxR"68P\f6hPfO8 6!X8 dP!6!DʈD$,[!3.Ȇ7CxR",@bC|xR",b.A8UdP{Sl3,u,3u4I\V4K$-nK\1|~OP5|)~:d5qa3B CB (LdA.AhU_TJT sd=qaN\45^45NX45N45 ^45hzzˆ??ˆ??ˆ,??ˆ?? `,ˆ0l?l? ,ˆX?? ,ˆ|??s=۫%s=s=s=sx =s =sX =s( =s =s=DHdT\ÞtޞOmmL<P|\|ws=A @cZ T` r <B&<r &Qr X&XQZ `Z `Z `h00080d_lZ7p_0ZP7-;.TE\7.lE.E7 p7-;D'}x02H 2TX2h͍ލDp`,p`,8$8vs=s=pv{x>{<>{>{<>vywy@y$s=s,=vywy<y 0b;k: : :< ΦΦ@Φ:\ :P mD(})<tp~B l(})@X@9/@|5@@9/@|5V5*w5KX<5<w5<9/ | 5X l 5 }0<NCM*0(*$*$**p$* $* $*  C*ps=zd^z^z^z^;b;b;b;(b.zZz9xs=CG`sD=s=@CCs=s=s@=s=D$4D$HCC45D$HD$45D$D$D$D$x02H}2T X2h2A<.A8U@v @v -RU@v A@.A U@v 8'8'O43B< CB@\dA.AUA(Ap.AtU@v @ v s=45ds@=%%s=s@=:%U45$s=s0=s=s=$ 75$u5u5 t0NՂ4&*0SՂ4&s=s@=s=s(=*SՂ &s=s =N45Dru'N045N45uuru8'N845hp)~sHpAw#w# -)؛HA)HAh,|0i'@hh|i'h||DP0?h|,?,$30s$30,sD4( ePj6 @'RjL$2oh|   414jsT=(k030s4k|_|(0|6B)d"B)"30s`kl]44`1*d4`44lIEm 'Rj $'Rj(E< M0' '(S']TQ] i] oM(@l]4 B]p L]\ B] B] LTSkp11k 'Rj,.kP 'RjA8.A4U3BD CBTt|Ah.AdU3Bt CB4H~`xls odVL]dx|b|Tb|bTj|Uc@bbwbw R |bwQv R|Q,vIj?cjDb wb@'wL2kyz|MzS #z4*/z0z {0G0{T{(Y<0NI)IX)I)RIA5Il)RIA05I)ID)<0NI)IX)[%("u.f%H.uP.f%h.up.RXIAd5Ih)IH)I)I)I<)I)I)I)I$)u.IP)Il)0EZ,2Q<$G\Lp;aH1;a1ҭZ,,ҭZҭZttҭZ$$ |WU xc Wk m hW H Z < (  D @  3 p k p)~s pA2 #2 #[ - )  A ) A xs=B D' l30|sH'   /  +k Zh 'Rj1< `6M d6\ |,Pj86 p pq pLq xp 4pP p p pq pLq xp 4pP p B 5H 1@ x9 )p@@ 9 )p@ 9 d)pڗ 4Mڗ xMA.AUk ` AdA.AHU}  0 0 @@Pv @v ]-RU@v )#8L'O8LII \Dڗ \MA8.AU@8v A8.AUA.AUA4xIj$7*7**78&7P7(7 7 L'Rjx9}M++LEEV8@18@ J++@  J+ +@ J++@  J+ +h C0:pPC:pC:pCX:p\C:pC:p[p[p[Tp[p[pP[pC0:pP?C^C?Cpp^Cp^CpCd:phC0:pP?C^C?Cpp^Cp^CpCd:ph^Cp^CDpHC :pC:pC:pC:p[4pH\b@bp\p\p[xp[4pH\b@bp\p\p[xp\0p\pl[pP[p[xp[ppu90|u9u9@u9L4}B++++ +8 Y "o -} B+,} B}4B+L+Yl"o -+$Y"op-,@>+4++ZoLlZolZolZolZolZolZolZol~or~or~o4r~ohrz0zxBzHoz yPy yy zzzhz ͔0xHŽ JPu Ju ͔͔h aY0NY4&Y0SY4&s=s@=s=s(=YSY &s=s =Y"o-;FYl"o -Y"ol-Y"o-,>d-!{!{!{{{{{{{{{{{I{{xxx(xxxx@{UEI&EEBI&I&I&I&I& L-XlF-h-p -| - G----p-lF-lF- -------d---- - L,,-x,,- ----------&(@@@@@ @@@@ B@@B@B@@;  Z@`i  ` d2!C d2d2d2!C d2d24 DPPPP: $$''''''''$-p-`x.` .2.6-`$`` <6---`.` .,`e/`t`/h`6---`.` .,`e/`t`/h`i2T*@L'x22{24%2|u1`<12 3'T!03.4eFE| | | "I| ( C,xR0";\CxR"!l),b|rDUG6DUG6l|rD$UG6DUG6!G6G6H   <{d cBpl {  `j<| | j<| | !3.2E2E@CxR"<16D@<$\36X$x36t=6Ԟ:6;6?Q#E 2D{PԦtCbԦCu$Ԧ(CGz-G?4xylRgy$@o1gygyo1`8$@$h@$t@6---`.` .,`e/`x`/h`6---`.` .,`e/`x`/h`'(/b(p(/'O(3b(@O(3b(X( /b(( /b( 8Klo4Kp-lyMK {nK01Ls4K-yO9O5L<wnK@1.A8Uh9PlSYP0 9PSYPl0 9PpSY.A@UxTA\A}ALjAA( VA`@Ax@v .A<U{Slll{S$l3uh3$u$©PID KЩj( [ I K[ gwb[(g0w0b[XL_J 3B\ CB08TpO3B CB 4/|/(7//7H/h/ / 7@ / /D/!%0!%H!%X!%h1%D1%H1%L1%P1%T7`G7tG7G7G!%0!%H!%X!%h1%41%81%<1%@1%D<PG<dG<xG<G1%1%1%(1%81%H1%Xm@G!%!%!%!%!%!%QB@B Q-QB@B Bl0B0B0QpB@B M ==Y*N-M==Y>0>0>0M==Y'JA9p9|J/'JA9p9+:0+:0+:0'JlA9p9yF45F-yF455t05050yFP45p,_Z7#,R#Rp,p,p4,#RpH,#Rp,!%0!%H!%X!%h1%1%1%1%1%GGGG0X)xixTixTixixiso(,})(,})s,=(}),s=|(})8s= t|(}xj}lj.|-|Y|tx|x|@Y|D|LCp,p,p,p,sP=s=C(Cs=s$=p,sh=45dҭ@Zs=iw$LT @w4 $6L mD$ D$ D$| M0p$- F (F ('#"DLL2|PhhQ8b qv i@Pv APO .A8UAO .AU0L<0<0<<A<O .AdU߁ /@Pv A@.AU} 3B8 CBHdlq A.AUA .AU//|2/L220 / 2 ;}(2t 2,2(XVTJ%%s=sx=Z*4w(s|=s=s =s=s=s|=sd =s(=zol=\YL`oP+k: s =sh =< :` T{} r,da<hm`&P?&<ҭtZt|s=s=sh=as=sL=|?ҭdZ$`1`$EPZ$EZLHS@"SSx"Sh$  S  &>h&<t&<&<&<04&<48&<hAp.AlU@v A.AU} 3B CB q A4 .A0 U\o\o\o\o\\o\T \l o\ \N]d45tN]np(6niannX3B CBn En6m)Sm1}mNA4Ol.A8U@v AtO AA}A@jAA VA`AA$/4/<f@|b.@XAd|A<X/H|AtX//Ah. Z9_Z^p  ,^p  , Z94 _TZ9`_Z9L_` dz  W   ԯ .  k Z < H@0 h8@Yh\~ LVL~ X 0   #Fg L|(}(j}j.|\-|dY|hg (|(|Y||3B CB3B CBH`h]@v )#80'@v k @C P  D D p  d( d!0 D 8D!L_J LT_lJl O)#8'c umPO41ljDk 'Rj+Y"o4-06 0(B0l B0 6PCD$C%D$PC>%Ce>%  e eD$ C0:pT?C?C0^Cp^Cp^CHpLC:p@:pTs=-|Os=sH=s=s=ts@=-tOpppHpppp4EZDH G G @0C:p^C,p0@NrhC|:pC8:p<C:pL%HX%u9T}Mi<gQ5j 'Rj   DiDg 0'Rj8  'Rj5}Ms\=rҭTZq88Hq``pqq>E  MZo lZolZolZol~or~oXr~or~o\rZoxlZo@ lZo lZo l2 A#{lDp|-e$  ^K&$-$C|' ?#{lDp|-e$  ^K&$-$C|/8 A#{lDp|-e$  ^K&$-$C|;}(2t 2,2(UJ4AdXypXa41ƅ=Md 'Rj 'Rj%s=s=sl=s=s\=s=ts=sh=sX=s=3@DeDe DeDDH@@ @@DH@DHDH@!de  D,,-p,,- ----------- P  8-@-<8#-TLL --LL --$ll#--0 L-- |-d-^$I$I $I $I $I $I $I$I$I$I$I8$I$I $I $I  --- -(-0-8-L-`t'--4'--PDL%-G0 L@@ @C@@@A@@@@@H@@@ @H@ @ H@@@<L&L&L&L&L&L&L&L&L& L&L&L&L&L&L&L&L&L&: @     @TN-----)()))))))))))*(@ @ O/O , , @,@ @@A!!k  -)aTJ% -)aTJ%D @ P@ *D  %%@$@*$$TTR 0ht*0Pt*Pt*Pt*Pt*Pt*Pt*Pt*8P&4t* PE&4>l&4&4&4" I" I" I&4&4&$4>h&<4Jx@;Jx@;6|6l66,b&44&L4&T4&4666X6L,bD<UG60,`[6666,@b,b|rDUG6DUG620%'(-4H0E2{c9Xpy?h c924%!83.@6p6`6 6,Lb| 66,bC@xRD"DDZ8X\ D|\<H" .8;D\<p"CxR"--NE`...-NE`6-`6-`o`o<G60oPohohpoHoG6 o8oPoPpB)<"I<MdMdMl\M\M\D$Oe O e O e s=kZEZk,Z|kZTs=s,=Hks-DwUoL_\J\ kUoU4o@Lv LkUo\k\LkU okUo3Bh CB\UoUokUo;pthvhvGUGUpD,pD,p,p,0vsX=s=vpW4X AX.xX, +ZqZt_LYpt_<B_D0AXH.xX s(=sx=& QsX=s=@_tZ7_Z7HK#Ms=|xX|X|X|X|(X;b;b;b;(b;<b|TTz9xs4=0?0?0?0?x0?0?T0?L0?0?0?T0?|0?@0?0?P}j|}j?xj|.|D-}Dj|T}Lj|P}j|%4 |4 (t4bg-L?t4bg-?$XAL3p`3p ` $`}j|}j||Y|}j|j} j|$Dj}\j|`@Tv A.AU-RU@v K3B CB$,@xv @xv @Lv @ v s=XnVnVnVnVnVn VnVnVnVnVnVs@=*8SՂ<&s=s\=9-*SՂ&s,=s=tdNՂ&ڊs=s=E`FCE75Pr*<FCEHQ5=!7 K,k !0Xz`s=0D0$O41,jwwHw\wX 1,Pj86 B)"H1|+kZtt7@ 1$ 50L2L2ƅD =ML  D Bƅ4 =M< 9| sƅ$=M $Bƅ=MA8.A<UAh@v } \ H^ T=N7HR}8 d R  = X,D`~sDaPt~p s ~ s` ~t s( ~sLA<.A8UjA`jA`.A|U}A}A.AhUAt At .AUVA(`VA(`.ATUs=# XnVnVnVnVnVn VnVnVnVnVnVs@=s$= B ~ -    8C 3B CB@v z  W HU c# 43 ` z  tW   z l  W J Iqa SV  : G| @ T G o > N  'Rj AL.A@UAT@Tv S^ G] 86` Ola P+a la 4+2^ l`s|=@v 6 p,f%.f%.[%<"//" " , A Q " K T`  < T7 = 7 t=U H U H  0 p 8V > D 4J3 5 3 5 3 3 3 ,3 ,` \` 3 |` |3 \` \ڗ 4Mڗ xMA.AUk ` AdA.AHU} A'3B CBt PDڗ PMA.AUA.AU}AjAA8 VA`VA`,&AT@v |k|pk|pk|k|k|k|k|Dk|Dk|@k|,k|,k\QQ@ J+V, 80 + T V T @  J+0V+@K#MZ+&|+L dZ+ &+ .+, .+\ ++Dz,,Z+&Z+/&B)4"ңN7@I4A4AK#M4A4A4A4A\4A04Ad4A4A Vf|Q|}j||Y|(Q||dY|h||0Q|T|8 (Y"o,-V~~~Y"oD-V@ ~ ~0 q+h~\~+}B+`  ~+(+pY "o-},B+|}pB4\EZ \3A@7\N:p :p( XnZ \`:pxL<206HhHl yz yz Bzoz zzy$y( yHyL Y8SY<&s=s\=ͰYSY&s,=s=aYdNY&]Zs=s=`B5\PǼ*\<BH<Ys=s=sH=s= Ms@ =s =-s(=Hs=s=Y"o-;FY\"o-Y"o\-Y"o-++Y"o4-d-l-t-|----------44- G-, G-8 G-D G-P G-\ G-l G-x G- G- G- G- G- G-- %!J%!J%!J %!J@ %!J@%!J@%!JD%!J@%!J  G- G- -0 G-@G-H G-XG-` G-pG-xG- - - - -."@@ `  ((((  @@@@@@ @@@A@A BABCJCJC BA  *  !0    $$  @PP @--`.` . 2.0B.X?H6-``@X`5X!5355,55585@!5l55D5h555!43.8CxR"!3.CxR"!3.CxR"994 : TIXI@+4L1HIx_I+418vII*Lu1<H|/[Vx17u1T<1TpV@xD/\] I*L6PXf!03.H@pznG6PfG6!C0xR4"!H3.PCtxRx"!03.4ChxRl"CxR"!3.!3.9 6C0xRL"9T66P6@66,bcPqD@!?T9\| d 666x6l,b!0!p3.t!T3.Ȇ72p{kCxR"CxR"+LW0G6\F0!B(!LWG6F!XB!d*@ET2l{d6!3.d64CxR"@ zj C8xR<"--`.` . 2.0B.X?H6-``H``Ppf!L3.`PfPf@z@(z@PzntG6PfG6!CxR"^qw6hS^qw6lL(?Rk<>`9k,9Rk<j'@8Tj'j,'j<'j'j'9j ' dddHHHp 4D_\Zx7 _Z7_Z7., EH 7. E 7d7,/pPd7/P7/$78/ /h2o}}2` (28o`}2o}82o8}}\2l 2o}L2$oL}2o}}$2 H2Xo}2o}\K]LbL]b`5ލ0͍st=s=sl=F@T F F  Fx F| 50h{77 B3B CB$3B  CB(HP3B CB+<khlZ\uX]\u(]\u, ]\u| ]\u]\ut]\u]Щ$j|\u$]\Qzzpz,zxzDzzJTAxXypXyxppXJAXopypXo8q8ao@ s=s=}20 <2L2s8=s=\s =45To!L|o44z== #oz /t= T 4( ;<@@8; i ( ;|;h|RPj6Pj6h$|Pj6Q5j <@(v WR^Kl VU c#FL3B CB @Hp,D,KxLx2Lx_8J8 tL_J < d3Bp CB08h5ht:bwh5h:bwQvgg  R|b wUc0 bQ vQP vg ( ) q) (qx* G+ G+  , G+ G+  , G+ G+  , G+ G+ 1 X X X xX X 1 X X 1 1 1  1 X 1 L 9 0\ h 4d{ 5p6 = d{ 5p6 = d{ 5pL6 = \  w ( w ( ; " ; "   L"  t"lbx b b +HY"o-U4 b@ Y, "o -5o}Mr 1uNtNt`NtNtxNtNt@Nt8 s=JTAxXypXyxppXJAXOp7ypXO7M8/q8aO@ 7')@@ @@@@@@ @@@ @XXX R)[U A%UUUUU --.2.0`6-``Pe/x`l`x`d6-0`6-`d7G68!`66C8xR<"6|6p,b!3.CxR "!\3.`,d[2t%DUG6Ȇ7,8bngI!'46X6HWIt66,bG6dG6lQrCPxRT"}(LȆ`7ׅ(CxR"C xR$"CxR"CxR"P,T[,bxyHRG6hxyRxyTR,[1,<'\,bG6 $H@xyRxyR,b+i--\.h2.T`H.z.-6-l`p/h``h`+i--\.h2.T`H.z.-6-l`p/h``h`+i--\.h2.T`H.z.-6-l`p/h``x`+i--\.h2.`H.z.-6-p`/h``0`|}@ }@ T~`()?@m?~P?@mCZCZ.A8U'U`RA.AU3u30u RAt3uJP JP 3B CB`|A.AUAk$6Tk s-`wkkkUoU`oPs  -w|xws= Dhs-lw pps-w||$|h_Z7_Z7_-;_Z78Z7'pppp.E7Z$77 lZ7<;P.E7t /- ;S6d6c|9c9\J,Sc9d6oS,6t6c9c9tJDS0c9|6Wr1Wr1erT=er=er=erL=erL=|LY|@|Y||Y||< Y| |` (3B CB@\dA.AUAtO3Bl CB,4A.A|UAHOD$0D$ 2D$\}2D$ D2\D2s=+8kdhZ+kZX+kZ$3B0 CBTpxA.AU3B CBAP.ALU@v @v @(v @(v 3B0 CB@\d3B CBA.AU}AP}AP.AUAO .AUAO Lp_<J< L_J 3B CB@4v @4v A4.AUA4O, B4@v 3B CBA.AU@v @v q, @`v @v @v -RxU@v              $,K,K.57Q5=,K|7X5$07P5Q5=7 5$75qPan,V|zH'h('(qapnD't(qa@pnD'L (qa 'd (сXv0сXvɡtɡt(0p(xpT8T8(p(pTTsX=1*uG1 x'Rj    0 P0 PҭZHHD( ?. 0?. 0?X. x0?. 0m < ( 0Q 5jT x 1  w  @SX  }$pJs.o`e(8q($ ( ( P_P s=/Bs=H\dJ/ypH1h |h)` Y $ e\SSgl]P1*Pe   Pj 6 Pj 6*<*< jdxG1j`tG1,jf|(1 j f | 13B0 CB@\dA.AUAA.AUA3B CB8X`K3@@K3@A@.A<U7A@v A.AU@Dv WR^A<OS<~@v N74 R} @ v @ v @Tv @4v Ax.A U@ v *IDx`~pshAO .AtUAO @v } A O @ v 102`$4P12T5E1 2 T5(E126X31t2l631                  4 4" T@" @" @" L@" L@|LY|@|Y||Y||< Y| |` ( b  x z ; FK D @C |x x d[   A PQ45 ; F 7 =U HH  E  p K % 7 4=? U H d|XY||(|HY|L|Y|||Y|}lj|}\j|tVf}j|b VPX+8Y"o-b Vh q` bl V   S@bL ~,>tb q  , >+ 4 b@ l ~ZoHlZo0lZo4lZo8lZolZo<lZo@lZoDl~oHr~olr~or~or~o r~o`r~or~orZo0lZolZolZol!%!%!%!%1%1%1%1%~or~o r~o0r~odrJhul ˏ Ju Ju ˏ  J@uD dŽh KhLl ˏ ˏ Ž ͔J4u8 JXu\ @ G-L G-X G-d G-p G-| G- G- G- G- G- G- G- G- G- G- G-P-X-`-h-p-x------- G- G- G-d-B@ ` p ` ` @ M(]((h=-=(-(-(-( ( (x--------------- G-I@`P   PPPPPpPtI*S@*@@@@@@`@x@`@eHeLeBeeeBeB*eBeBIHhl !3.VCxR"`C$xR("CdxRh"RHkdh!--.`6-4`0e/H`<`H/h`$,6-`6-d`--.`6-4`0e/H`<`H/h`0D6-`6-|`F87E@&D4!3.cBlF7F`eFE|  |  | 0 Eh&l4cBlCxR">L"I&4"I"I"I"I&4&4&4"I"I"I&4>L KC` xRd "D0UG6DDUG6G6G6x o|p!  t |rDUG6DUG6DHUG60f ~|  j0<| < | T j`<| l |  !3.2E2EC$xR("4 !|3.!Qr!G6E2d{E2`{96ClxRp"2%C xR "Lt::UtUD|&h4G6|(|::UĔWx2l{2{!3.kC4xR8"l!p3.tȆ7k\XCpxRt"!03.@nPfG6G6!nOP8fZnPOPfZ$CxR"o\<$"|!-T--d--P-L^-p-- C --T-` L8x:Y~y4xy~s8~4s~(s$~s~ s}`j|d}(j.|0-|((|P|(w>L{\>{>{T>{>{>{ |D|{t |D{>{t>{`>vy wyy*?H,<[!X3.\,b}L96CxR "H CtxRx"!3.,bCLxRP",tbׅ(E2{! 3.$!<3.@*0!3.*0eF<E| \ | l | | CxR"CxR"D<UG60cq@!?9| 666t6h,b$@|rDUG6DUG6t!\!3.!3.Ȇ7"IXέU2\{ktlCxR"CxR",<[2L%h!`3.l!3.έ Uk!CxR"CxR ",@b\:h`:l&&~~$x x ))|~,~R`\|~@m@<m9P9Pp?t9P9P9PR9P R Qkkkkk@Qk|k|k h k  kM~d hLvM~ zPUr~hvr~(zU~T  h< v~ z@ U h( vz U|Y|i'l|(um|Y|}j||Y|||(\|5|Y|}4j|t2vD$|s| =s =sD =sD =s =$ D$x D$ s=sL=s=s=s=s0=s=zxQ |ztQGzQL2zQ^ W L 2 Qm  5@h36386A\.AXUAAAA @8v 3B CB(HP3B CBt8|6@Xv @v A.AUA@\v A.AU@v @v 8'-RU@v 3B CB<\d3B0 CB@\dA.AU}AAAO 3B  CB0LTA.AU}AAxAO Eu'|E0ue8'|E ue 't |E ue 'l |E ue '|ELueT  @Tv A.AUAA.AUAO .AtUq A0.A,UOZ+Oq0 Ap.AlUZ0+tLNՂT&s=*XSՂL&s=s(=*SՂ&s<=s=tLNՂP&s=s =ڊڊ̎\=4 zh Lz  z|}4L4_XJX }lLl_J C>?XCH9,.?C9@( 4@4 T2Dlv |B( QDh p|oD5DDB;/FT^HSs$=$4u uXH0B41j*B)X "0| B414 jUH x0,B41jLd_0J0 L_J Ll_8J8 L_J L(_4J4 L_J L4_PJP L_J L4_J L_DJD L_ J  L_J 0Pj46pPjt6Pj6Pj60Pj46pPjt6Pj6Pj60Pj464 ,  x; lF $7 $=U H H $E  p K ` % | 7 =? 8U $ H  $/% PumX2 $0 $ 0w 0GOH GO /2 0% um$  Z!% !%!%!%!%!% !%$!%(!%,!%!%!%!%!%~or~or~o,r~oXrX)\x)|HH yy HH yz y z$ y<y@ y`yd d--- -( -4-<-Dx-\-dG-l-x--d--((!- - -<<%- - -L -X -d -p -| - - - - - - - - - - -`-h-p-x------------- G--( G-4 G-@ G-L G-X G-d G-p G-| G- G- G- G- G- G- G- G- G- G- G-T@ لP`@@@D D!C ɄD@DD0) 1W            0    _0O]O oOo `O!`7`4 `O!`H `7`,O!`S`, ` O !` O@QjQjQuQuO]PfOX]PXfQjO]Qu`a`COp] a kX_^O]Pf!03.4< CxR"!<!<CxR"6666,b6860,db!3.[%"[%",&,&\f%4.% f%.f%.f%.9&0%h %d&QB&%%H K&0 ]K& ]%` R8RH{S@lRh.AUR{SlR{Sl{S l!%0!%H!%X!%h!%x!%1%T1%X1%\1%`1%d1%h1%lm@xGm@Gm@Gm@Gm@Gm@G1%01%H1%X1%h1%x1%1%1%1%DG!%!%!%!%!%!%!%!%!%};\vN;pp};v};vN;p}; v};0vN;Xp};v};vN;p};v};vN;`p};pvN;p};vN;p}; vp,s$=4545s=sl=s=+kZd+kZ0   s =sh =F<P F`t F 8F dFPd F  , 3BP CB@\dqP A.AU(A.AU@|v }AjA4A VA`AO @ v @$ v @$ v 3B CB@dl3B  CB@Xv @Tv AL.AUA.AUO3B CBl(G?<tmr,P} r,$ < mLG<mXadG$a<ma~ts<L|2s =h|i'h|s8=h|ps=s=s=s =>} >?7?[?(u?a?l?,.?Ln&>(fL ? nH/||?n?nAl.ApU}H }| @v }| A0.AU*ID<`~<s4O A .A UA .A UOC3J4A`XypXKML2L4_TJT s=s =s| =sl =), #8 's =sL=s$=H2p p}s= }s4= X} }s\=   P} H___ < / p  p tK A Q A LQ456 ,6 ,r R[% "[% "[%"[%" " "  " " A4.A\UjA|jA|.AU}A }A .AUA A .ATUVAH`VAH`.AUAHO AHO .AxU.I,B)"K<L|2A .A U}A< .At U}A .A@ UK$K`KK 2 0 KOHL_J SH@ 4JY"oP-+4+@ J++8 ,W  j z@  J@ J++ @ J-+yz yy Bz oz$ zDzHy/y z(y/y \.Bz`ozd -+YL"o-;xFY"o-Y"o-Yx"o,-,T>+$Y "o - + D +D ,,-,,-`d-x----------------\-d-l-t-|------------- G- G-R'''`'$@$@h@$@@$@@$@$@ $@" $@@ $@@ $@H@$@L'j'` 'j'`'hO@@``pp`@@N L@L*D*H@ P@ BATU( BATU( U( U( [@`@@ @@@ @`@@@@DBAHPG:li2*tL`:u14<14p147:5 ~(`:`::)~<d*d*,@[2H%!P3.dCxR"6|6l6@68,lb66,b!,3.0CtxRx",b6H68Ȇ766,,bId6E2{!3.CxR".(fdq \<h"x=r4d*!83.<YTCxR"V$[H6866,b!p3.CxR"I4IȆ7!2X{kCxR",!$C<xR@"!3. C(xRt"!3.--.2.0`B.\?L6-``p8``6-D` 6-`<s==$q=Pq=|q=q=q=q=,q=Xq;\b;pb;b;b;b;b;b;b=mz9xsd=A@.A<UA|r r< A@Dv rL rr rr 9sYs0+ysysXprT r WR ^s s8=tx|s=L<s=D \s =s =CXCX9 P-C XCXC`XCXmCXC XEZxkZH kt  Z mT pXpX9P-pXpXpPXpXpXpXE`ZPkZ kL  Z , k60kUx oheket 6 k kL _p Jp   kUokUor_kr(_AL.AHU@Lv @v AOp&D@v OOAO @pv Op@ v AO O@v O2%s8=yFL4p5FL-50505$05050456dj`56G7|5L0504t5xs=sT='J`A9pp9|J`/+:0+:0+:80+:0+:0A9p9:j96;|+:h0+:40A9p9s=sx=Mp=p=Y*Np->0> 0>H0>0>0==YX?j0>6@|>0>P0==Ys0=s=QDBp@B QD-B0B0B0B|0B0B@B CjB6D|Bl0B80B@B s,=s=s0 s=s='Pi't~,si'ƅ=M~s~sPM~@s s=s@=CD$C0Cs=s4=D$s=D$Cs=D$hC?(s= Cp^| ,| s =sT =X<Ad.A`UX<A.AU}A}AA }A,A, }A,}A}AVAP `VAP `A O A O A A 3BP CB@\dqP A.AU(A.AU@|v }AjAXA VA`AO @0v |@P v @P v 3BP CB@\dqP A.AU(A.AU@|v }AjApA VA`AO @Hv {@< v @< v 3B CB@\dq A.AUA@v O@v O.AUATA`A ADB)"O Z+s=w( k: s$=: s=(Lu(`s==, T Jozd@"D\XKs<=s=s=54\5\5T\\5x\\5\5,\+6\+6P\5\o6t\\5\68\5\7h \7 \5 \58 \h4|8L2hp|i'\h|0h|i'X+ k  Z\ HL  L0\6l H    C  C  Ѷ , 'C A@.A<U@v ,3B CB$A@4v }h A.AU-RU@Lv N7R} ,@v @0 v A<.A@UAp@v @\v  ^ =@v A.AU@v WR|^AOS~  4R @= l,AhIL),NhNLNNNXNQnHlNNI)I)ɅX?hI$)I )u .jg 8S P^S dhljg S ^S jg S ^S jg S (^S DHL 8S P^S dhl S ^S  S ^S  S ^S <@D ǘ  83 Ps $Z 2ˣP.ҭZҭZL L ܙ  P X1BL7Tqҭ@Zc <TPF> J`F Lp+0C> 4J> J> hJ> J> $ J > J> J> (J6 xx 0s=s='Pi't~,si'ƅ=M~s~sPM~@s s=s@=3B CB3B CBH`h]@v A0.AU)#8P'@v @v @$v @hv )h#8t'Xbd ,>++(b ,>+, +t V  VL P @bL +$b0 +L%H+& !u98  X%uX98igQh5j Q5j } M  , u9sD="sp=,4tˏx |Ju Ž Ž kH:LŽ ^7Ž `4XD\xD|KL Ju KL ˏ  (ˏ, 0JLuP Jput Y"o-;FYl"o -Y$"o-+P\P -d- - -H - --,-Y"o- G- G- G- G-$ G-0G-@ G-L G-X G-d-t G- G- G- G- G- G- G- G- G--!<3.Df ~| V<( !f ~|  V !C<xR@"` Ty CxR"@`z!p3.t*hCxR"!3.*DhCxRh"!3.*hC(xR"!H3.L*xhCxR"QTjQjQjO]QLuubLrb;2Xb(O]Quub\rbO<o;2<b$Qubxb>bd4|zd0!P3.TdldCxR"d&e`d!|3.&e`d4dDdHdXChxRl"CxR" 1,'VVRhHR0H!klpT c c!<`H!`Vp[666,bH*\Lx22{!\3.`CxR"!3.CxR"LId~p9P@m49P@)~D @m9P9PR9P R IX (xXz9xz9xz9xz9xz9xz9xz9(xz9<xz9xs=s$=sp=Cl    1&ƅ=MD'D< C J8 A@ Xy p X~tsl~s~sA<.A8U@<v -R<UA.AtUAA.AUAA.A@UWR\^A.AUA@v @v TOOD3BH CB@\dqH A.AU(A.AUjA}AA VA`AO AdO e ( /b( @v @v 3B CB@\dq A.AU@v A.AU@v L _J }D @v q A.AUqT q  +XUс,vdсvs=s =sp=sh=сvсlvL++t zT sP =s =sP=s=s=@Tv L4_J Ld_J <d}p t3B CB WR ^DSҭZdd |qW <iLҭZ88ǘ  ZҭL Z  ˣ| . SP S qсv~psh~s~Ds<~X s % humx~ s` `30$s h\7  E LP_J  L_,J,  VLP_$J$  t /% u m L|_J תX~t' -ת~' -# ת~' -ת8~l' -=ת~P' p-s=ת ~@' `-++V+Y("o-+Pb ,,>+p+Y "o -+<  b , >+\ + Zo0lZolZolZolZolZolZolZol!%!%!%!%!%<!%!%!%!%~or~or~or~oDrZo0lZolZolZolZolZolZolZol1%1%1%1%1%L1%1%1%1%~or~or~o$r~oTrZoPlZolZolZolZolZolZolZodlZolZolZolZolZolZol~or~or~o r~oD r~o r~o r~o r2A#S3^K&2HA#T0vH O ( S43^PKX&dMt-tCL#zX-XC'?#&1^K&'H?#T0(F O ( &41^PKX&R(dKT-TCL#z8-8C/8A#S73^K&/8HA#T0r8H O , S783^TK\&8hM|-|CL #z`-`CZ@`   ! 0 0 $ @ H( ( "  ` b Q IH II H IH@ IH IH0INH0IHIH4IH4IH 4IH0< <  8 @8 < H < L ^@$v O>^OjA>,^EZX>^HEZ EZK8Zo`l!%,!%0!%4!%8!%<!%@!%D!%H!%L!%P!%T!%X!%\!%`!%d!%l!%t!%|!%!%!%~or1076666,b6h@76666,$bG64!\07 :S7F5L6 66P6D,|bs7(Tl0d&@4PpfTld&4xliCDjd*@jLdP`@kkh dll<dld\<"ldjdl@!!03.@nPfG6C(xR,"nPfG6CxR "oX\<d"G6!nhOPfZ<G6!npOPfZD!03.@ nPfG6CxR"G6 !(0(((nOC@xRD"o\<"n`OPfZ4PfZB_0t_B_00AX$.xX( AXL.xXP Wp4Xt W4X AX.xX W04X4 Wp4Xt AX.xX AX.xX AXx.xX| _Y|Y|4F},j|0|Q|,|Q||Y|| Q|||Q|#PRK#PM} j| K#| M. |h Q|l |(3B CB<X`q A.AUA.AUA0A .AU@v WR ^@Pv WR^A.AUq8 A.AUq A.AU`s=οοx1r4rT 'RjοҭZ}w  sP = s =ҭ Zx x ҭZb, s=qas$=B)T"sT=p \ s =q aB)"s=s=sD=B)"s=qaqa9/|05s=S X^S lptS ^S 9/|$509/h|5hS ^S tx|S ^S $(|PY|T|Y||Y||8Y|<l} j|(|Y|//{B)"}$j|0|(}j|}Tj|PhfCxR"!3.Pf@jdjj dj*`jd@zCxR8"j`*@jHdL`@kkd dhl4d,<[dG6Lo\<"!3.k48El2h{ktxCxR"2%ׅ(T zY666H6<,tb,b8\:Y~Ls4K-Klo4Kp-LwnKT1MK{nK1yL$s4K,-Klo4Kp-Ls4K-LwnKT1MK{nK|1yP|:P,:<EP:P:P:P:P:P:P:P|:P:b<, EPX : XP :XPp : i< EP :d<EP:wh$w$wp$w$$w$hw0$X wt $w$w$̎\=w$lD$TD$ D$D$xD$HD$D$D$D$t D$4!7P5h75745L$8r@*X75\r*<7`5x75 7 5  % (0p$8\JX;/FT.GpG\B4 SL ӣl   w (\ . s =?. 0mT< s=sh=0 w  (L (s =s\ =  w    w  t 1t B O O`Pjl6Pj6ZoPlZLZXZZLZZtZ Z Z Z Z Z Z, Z0 Z Z0 Z Z| ZZZZZlZp@& ` kO al, 8  X*])J5( J4R@pwX@A7,D[,b,b <h < <@6666,b<HG6&,4h 2<\<D"<<T,[ 2<<,by;_<!0<!@<@hz9BRdd~@Pd=rƂ`fՂl   @ !3. t*PL<CxR"s+i--\.h2.`H.z.-6-t`/h```@X``\`L+i+ iA.AU}A iB  }AtBt }AB }APBP }A&C A< VC< A C A C A C A D Al MDl .AU@v \L1 r~\sTs4=~sBBB$B@B\B<OO O OOOOOOOOOlcXi9apc9ac9a4 c c  ^crr(c,cP1P/FpTd*Ji's=s= !'Rj!JAXhqb Y"ot-y pP X b Y "od -ҭ Z  ,b8 hq}hBb <bH Y("o-zXz\ytzx yz yz zzzzyz Bz,oz0 BzPozT Bztozx yy yy yy yy Bzoz zzyy y y$ yDyH Bzhozl zzBzoz zzyy  y0y4 yTyX Ju Ž ͔Ju J u$ JDuH hŽl ͔Ž ͔Ju  J0u4 JTuX ````(X X"X$ `  e/`e/`- -,`.P`\ .x2.6-`e/````/h````,`|`/h`\.L.\`0 .-x```.```6-X`H`d`h```x`x/h.P`(`,``e/`e/`--0`.T`` .|2.6-`e/````/h````D``/h`A@.A<UA.AUA.AUA.AU@v @v AO @ v AO }A}AAT AT jAjAVA`VA`@A@AA| @ v BL Bh pp,s=45sP=s =s0 =s =s =s<=s=s=sH=s=s$=s=s=sP=s=s=s@=s=s=s0=s=s=s`=s=L4_@J@ L_<J< 3B CB3BD CB\3B CB(0W PW PW P3B  CBW PW P  W# դ , % 01ww( @  \  ~B    h\0t~Bt ` J 4? ?Zo4lZolZolZol!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%` !%d !%h !%l !%p !%t !%x AAA AAAAA  $H""  $H""A.L.\`0 .-x```.```6-X`H`d`h```x`x/h.P`(`,`` .L.\`0 .-x```.```6-X`H`d`h```x`x/h.P`(`,``DLUG64DhUG6XF$EX2T{6tDtUG6|FtGzD UG6-GGGx.lG,KGGGG8GG"HDhUG6TDP UG6< 6H68DlUG6`ŋ6 6,Lbcqt@!?9|  !3.\eFE|  |  |  CxR "|lrDUG6pDXUG6<0%Ȇ476x6hŎ*Ȇ76 6,Lbcqt@!?9|  !3.*0E02,{k8<t\eFxE|  |  |  ChxR",[+ ~d*Xd*xd*d*,b(0-@-l525(p`$, b,H [+~, bV 6 6 6 6 ,< b!%4!%L!%\!%l!%|!%!%!%!%1%1%1%1%1%1%1%1%1%1%DGDGD(GD<GDPGDdGDxGDGDG$TDXP( 'xS\(@9@9< 'S( '( '8Sh Q( S@ @ 9 S$  (ZoHlZo lZo lZo lZo lZo lZo lZo$lZo lZo lZo$ lZo( lZo, lZo0 l~o4 r~oh r~o r~o r~o r~oX r~o r~o r~o r~oT r~o r~o r~o r~o\r-IA!         X```8```      28%[h!t3.CxR"[t:!3.CpxRt"CxR ""xIwExZE\2t{&4& 4 6| cBlVp[666, b6d6T66,b!03.4L kx|66 6X60,b  C0xR4"zY  Eh2d{!3.!3.3B\ CBAP.ALUAh.AU@v @ v @| v @ v @x v |P@v ws=@0v w0s=@dv wds=w@s=w,s=@Tv A.AUAO ,QAO ),GAO E,[AO @4v @v A$Ax'jA}AOO<b,</OX O KA.AUAP'Kl,K&T+:40};vN;p};vN;p};Dv};TvN;|p};v};vN;p}; vN;Hp};hvN;p};v};vN;p};(vN;pp};vN;p};vN; p};0vN;xp};vN;p+:0{@>{x>{>{>{>{H>{|>{>{>{>{L>{>{>{>{>}`zU~%zzlU~\%{x>{ |D}$ [y$ |` }t | s=s$=!Ys=s=!$|T lqla<q<a  q a!X \ K"XY\K@"T\,Ks=s=sT=["sL=s=s=s\=$  `Oa   (4X@\*]p)Y|J5  RuX@G@d0fA(|7*T` @@H`@H``` h h(h$h$h,hlHh$h&h&hfHBlfHh&  R R P P P h`&1`&1@H &1 !&1!&1!&1 &1 &1   wExZE2{E&4E&4" IcBll666t6h,by;d_6666 ,Db6666,$b6|6l66,bD$D$45Ds=p,sh=s=s=sd=s=D$s=s=sd=D$s(=s=D$ ^t Ct s| =s =sd =p ,p ,pX,pX,s=s=s=hBB?$OO<O<OBOO(BTOTOBOO@BlOlOBOO`BOO B O Oс v ~Ts~ /< P / /{դ @\9/h|5դ  Lm9/ |L5դ  \m mդ x  p mդ p  l mդ  C xmդ  <Ώ <s "Ώ s (Ώ (s" Ώ s DΏ ps `  Ώ s Ώ Ls ("Ώ (s A \Q Ώ s TKΏ Ts  Ώ s 0  0 Ώ 0 s0b< ,>+?JPAXy pXL 2,(>8 bD , >+ +Y@"o-,>b ,d>+P+++{ dy,h>JAX8bD Y$"o-|b  b Y "o -+L y\pX+,kZb d~b Y"oD-b Y"o|-͔X\tˏx |ˏ ˏ ͔͔(ˏ, 0LŽP pŽt Ž Ju Ju Ju  z( JJ@@K@K@@K() (    (KK(K((K((J,R@$$$$@$@$`$$ $ $`$p$08$08$48$4$4B$4$4H$H$H$ $$ JJ J@$8$8$($($($ $ $ $$ DD 5407v6p7v6,p7hv7xv6p7v7v64p7Dv6lp7v7v6p7v7,v6Tp7v7v6p7v7v6<p7xv7v6p7v6p5P0@v }@v A(.ADU}$8p'A} }3B CB}}}} } @v }8t'}L}A.AUAWR^@v @v } 4  d<4 < <$ 0 Z  ,H  xpxDZZ (Z<0*DSՂH&s=sD=*0SՂ4&s=s$=*(SՂ,&s=s$=*SՂ&st=s=*SՂ&sh=s=ڊ*( SՂ, &s =s$ =ڊ *T SՂX &s =sP =ڊ O4Щ$jP'@v -R U@ v ) #8')T@v O< Ap .Al UjA }A( A VA `[% ""* =A5A5VA`[%P""*=A05A85AA@v AO D|`~sxA8.APUA8O-RtU@v P3BP CBX|VV3B CBA.A$UV< 3B CBt V kFx /@ v kFt /> Xp Vpd 9  p y\J p4&9  \p4& #   p 8 F 4{, {, s= ` sx =  s, = DF  a rq \R a r Fq HR# U:p2 = _v Y@ 9 )pJ pq :p <:pH T:pXJ 0 + <Yq tR8-@-H-G-G-G-G- G-G-G-G-G-G-G- G-G-G-$G-,G-4-HG-PG-XG-`-tG-|G-G-((!--G- -.L.\`0 .-x```.```6-h`X``t````/,hX.2.l`` `t` 8y6X6H? |  |  !0!\3.`?xu?|Q? CxR"eFtE| 0 FT7FP`|  |  2 %!3.?u?Q? C@xRP"F76 6,8b@P X@X ~TsL?4yH??4D,.l?h S A, 4\ 9A 4 ( 1y H4 ,.,.t?TAj,.,.1*L%HX%u9T+&!uT94uT9XX%\ u 9 d igQp5j Q5j }M    +&\ !u` 9 @ u` 9d  ͔ˏ ˏ ˏ ͔8<xˏ| Ž Ž ͔ Ž 0Ž4 JXu\ Ju Ju 0?0?0?@0?D0?0?0?0?0?00?40?0?0?0?0? 0?$0?p0?t0?0?0?0?0?`0?d0?0?0?0?0?P0?T0?0?HH HH yy yy HH X8<X`dyz yz yy yz yz  Bz$oz( zdzhyy yy "v @ 6E2{PfPfE2<{E2`{l dp!!ʈ$!X!3.E2{!"ICxR "ClxRp"CxR" CPxRT"6h6X66,b !3.CHxRL"&*2%66ŋ6X6L,b6`6P66,b!3.CxR " 8 } L!? 9ׅ( (Ǒ| =8hd3u[MP3ud3PuP3Pu|3Pu3u3u3u[M3 u MDMD B40MDvDpMDvMDvD(pMDdvMDtvDpMDvMDvDpMDLvMD\vDpMDvMDvDpMDvDTpMDdvDpMDvDpMDvD pMD@vD|pMDvDpMDvD pBT0p,_Z7_8_PZp7Z7p\,_Z7__Z<7Z7p ,p ,#, Rp,pl,#R_Z7_Z7#xRL42 }Lh2z {GL30hsud 90 < 30X s uT 9  zt z {4G30su9H30s u98z2 = p4& hBA h p(4h&h,D,v Y, :p _@f  5 0, $:pLT, Ts=v Y :p  _  $:p  DF  a rq \R a r Fq HR' 9:p y\  d6 = Y{ 5p }J p q P:p0 x:p :pJ 0 +q R}Tj|X|Y|}j|}j|}j||Y|}Xj|x|Y|}j.|<-i'ƅ=M}j|||h Y|l } j| | Y| } j| | ( b ō ,   [  h 4ō  ` ,  , zK C S`   d ; ` F `; \F $; F x ō [    [   6 ,\ 6 , z  X"  P"\ P ," ,z" X <S` \ P. P  t  P " A QN  K $ $z P\ P   T T` 2A#(X*{tDX*{tD:e$vH O  {,D0<-e|$] O  O   SL3^hKt&^K&-C-C--'?#(:)X({tD:)X({tD)8e$(F O  {,D0<-e|$] O  O   &L1^hKt&^K&-C-C--/8A#(9X*{tD9\*{xD9:e$r8H O  {0D4@-e$] O   O  S7P3^lKx&^K&-C-C-- X X X ؘd2 ؘd2 ؘd2ؘd2B ؘd2 ؘd2 ؐ X ؐ ؘd2 ؘd2 X$)X$)XB$)ؐ X ؐ X ؘd2`X ؐ X@@ &LR &LҐ &L &L` &L`$)&L`$ r$)$$)$`$)$$ @ &LR &LҐ &L &L` $ $ $!C  $ !%!%!%!%!%!%!%<!%!%!%!%!%!% !%$!%(!%!%!%L!%,!%0!%, !%0 !%4 !%!%1%8 1%< 1%@ 1%D 1%H <T G<h G<| G< G?v?p?v?p?$v?4v?\p?v?p?v?p?4v?Dv?p?v?p?v?p?<v?Lv?tp?v?v?p?$v?4v?|p?v?p?v?,p?<v?p?v!%4!%8!%<!%L!%!%!%!%!% !%D!%$!%(!%!%!% !%l!%!%0!%!%!% !% !% !%L !%l1% 1% 1% 1% 1%  G G4 GH Gt_j$7s=7e X'Rjd D'RjP $'Rj08PjD6Pj6Pj6 Pj 6  'Rj   'Rj _oS 78&Q5j Q5j @v K>|XL2q  A.A U>^@v At.AU>d^q( A.AU@(v @$v OA .A UAP @ v tthttL >4^A>^>^>D^KAtt0Btt'l@@@,,,, ,,,,(,(, (, (,(,@,@@,(,,,@=CA@@@@ @@@@@@@@@@@ @@@@ @ @ @@@P@P@Q@P@B     !@@P@P@ P@rr}j||Y|}lj|}j|}j||Y|}<j|\|tY|x}d j.| -i'ƅ=Mp}j||h |L Y|P } j| | Y| }d j| || (@Tv O$@v Kd3B CBWR0^O@OLZ +#FZX+#FZ+3B CB (OZ+OA .A UA .A UAD!.A\!UK!L!2AP".AL"UZ$+ Dy4\ Dp4D&9 A  \pT4&,, (}|4, 4:pl 0f h 5 X 0|, |$:p, sD= @ }p  < :p@  ( t  ( $:p< Zo4lZo$lZo(lZo,lZo0lZo4lZo8lZoHlZo<lZo@lZoDlZoHlZoLlZoPl!%, !%0 !%4 !%8 !%< !%@ !%D !%X !%` !%d !%h !%l !%t !%| !%!%!%!%!%!%!%͔ˏ ˏ ˏ ͔8<^X7\Ž` ˏ Ž Ž ͔Ž  @ŽD Jhul Ju Ju s=!LYs=sl=qas=s<=Ls(= #=s=`0>0>0MD4vMDpvMDvDpC0dDLpCdDpCjCdCPdCpjCdDpDpCdCdD4pC\jC|jCdCdCdCdCjD<pC\dD|pCdDpCjDpC(dCDdB`0B0B0!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%~or~or~oDr~or~or~or~o4 rq$\5\ӻ\`6Dd(5\Ǽ*\H(5\`6D DX5\(4 5\d 5\| x 5\  <  6D < <D t <L @Tv %%&s =0&M&\-j&% O80&A.AU%+&s=M&Lj&|j&3Bd CB|&6@`v @ v K%3B& CB '@'H'K(&|+3B, CBH,`,h,&->40?v?p?(v?@p?v?v?p?v?v?,p?hv?xv?p?v?p?v?4p?Xv?tp?v?v?p?$v?4v?\p?v?v?p?v?Hp?Xv?p?v?p?v?0p>x042L7v6p7v6p7Dv7Tv6|p7v6p7v6p7Pv7`v6p7v7v6p7,v6Tp7v7v6p7v6 p7@v6tp6p456j6HpG7H|50G7(|6(p7vA@.A<UA|s&@As&A@(v s<&A< VAl`sls&VA`@AssjAt?t-_t}At1t<}AtD5s}ADt9sx&}A_tD AD t A s A WR ^u @Tv @v @ v @v K,A.AUMMMA.AUA.A0UA.AUA.AHU3BX CBl@ v @v } @v q` A0 .A, UOq qp 3B CB ( 0 @ v @ v -R U$75.5`7d7(5r*H7(5`.5<7D<75T7` 57 5 7 5D Q5 = Q5 = .5 7 u5< T Q5=Ax.AtU3B CB @@v 3B CB(P3B@ CBPx3Bt CB3B\ CBl3B CB 43B CB4<3B CB 8 @ 3B CB < @ v 3B CB @@v @ v Zo4lZolZolZolZolZolZolZol!%!%!%!%!%!%!%!%!%!%!%!%!%!% !% !% !% !% !% !% !% !% !%!%!%!%!%!%!%!%!%!%!%1%1%1%1%!%!%!%!%!% !% !% !% !% !% !% !% !% !% !% !% !% !% !%H !%L !%P !%T !%` 1%1%h 1%l 1%p 1%!% !%!%!%!% %@L`` x p q q q p p@@ptFF@@$@,`@@p$`$p4` @u @w u u w u w u*PSՂX&s=s$=tNՂ&s(=s=t$NՂ(&s=s=*8SՂ&s=sT=9- #DtNՂ&s=sT=tNՂ&sP=s=tT NՂX &s =s =t NՂ &s =sl =^ !C #x # 9-4̎=YPSYX&s=s$=aYNY&s(=s=aY$NY(&s=s=Y8SY&s=sT=Ͱ ZDaYNY&s=sT=aYNY&sP=s=aYT NYX &s =s =aY NY &s =sl =  Zx Z Ͱ4V= <4P`fB <,8[Bp@pz,b666$6,Pb6666,<b<!3.<CxR"WpG6xӽh/,x[!BBT,pb < < <@ <| < , [<x , bX<A.A|UX<A.AU}A.AU}AA }AA .AU}AjAd.ApUjAd}A .A0U}A p<p Ax .A| U@ v Ol Ol @A .A U@A A4 O .A@ UA4 O A0 .A@UA0 VA`.AUVA`@v @v @v P13`3xҭZ<<l1ؠx(+ҭZ1ؠ(+ҭ|Zҭ|ZҭtZ X1ؠd(+^.ҭ Z  ҭ Z8 8 D t 1ؠ ( +@@@`@`@Hp@Hx@`(``````` @` ``I@I@H`X@HD`X@H`X@HX@Hp@X@Hp@X@HxX[9[9[9[9[9 [9([90 [98 [9@ [9H [9P [9X[9`[9h[9p[9x[9[9[9[9[9[9[9[9[9[9[9[9[9![9"[9#[9$[9%[9&[9'[9([9)[9*[9 ,[9-[9.[9$/TH13u3ul1Xl1|3lu3lu3u3uff3u 3u3u3u^D^D \  ~ \ $ ~,   , )~  \ )D ~ !%!%!%!%!%!%!%(!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%L!%!%!% !%p !%t !%x !%| !% !%X1% 1% 1% 1% 1% 7 G7 G7 G7 Gt%B)"}j| }j|}j||<Q|h}@j|\},j|0|Q||Q||Q|} j| } j| }d j| }d j| }p j|t }j| }8j|T}$j|(}j||Q||(Zo4lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo l!% !% !% !% !% !% !% !% !% !% !% !% !% !%$ !%( !%, !%0 !%4 !%8 !%< !%@ ~oD r~oh r~o r~o r~o r~oL r~o rZo4lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo lZo l1% 1% 1% 1% 1%$ 1%( 1%, 1%0 1%4 1%8 1%< 1%@ 1%D 1%H 1%L 1%P 1%T 1%X 1%\ 1%` 1%d ~oh r~o r~o r~o r~o4 r~op r~o r)5f@@@@@@ ` " "@     1@M 0@M @         (( (4}j|}j|}j|}j|}$j|(}Xj|w|}j| +k  Zx |Q| } j| | Q| } j| } j| }j|}pj|}Xj|}lj|p}Pj|T|@(HDH`~sX3B CB@v 3B @v -R(UO0AD.A@U@\ v @p v W g W$gWgWg WtxWptWtWt(CBHhp3BH CB@Hv @Hv kFL/C3  0 B B B B $ B RB )R $ B B  $ @  $ $ BPP<4&4 ,[6666 ,Db= 2<t*(Pt*HPt*hP!3.CxR"=Dt=HG6L!7(G6!<= "pI"I"I"I&4&4>KCxR"!3.CXxR\"><<$,PbLT_pJp LT_J L_J L_xJx Ld_(J( L_J L_J Lt_8J8 L$_J L_J L_HJH L4_J L_J L _X JX  L _ J  !03.4ChxR"CxR"( E<2`{!<!3.E2{!kCxR"!h3.lkCxR"! 3.( "hIG6QYox\<"G6E42{!3.kf ~|  C xR"64p6p6p6d6`d6p6d6j6 d68d6p6d6j6d6d6Xp6xd6j6p6j6(d6Hd6hj6d6p6d6d6j64j6Td6td6d6d6j6p6p6<p6`d6p6j6p6p6d5$05X050N;4pN;pN;p;d;`dN;p;d:j; d;8dN;p;d:j;d;dN;Xp;xd:jN;p:j;(d;Hd:hj;dN;p;d;d:j:4j;Td;td;d;d:jN;pN;pN;<p;`dN;p:jN;pN;p;d+:$0+:X0+:0?4p?p?p?d?`d?p?dX?j? d?8d?p?dX?j?d?d?Xp?xdX?j?pX?j?(d?HdX?hj?d?p?d?dX?jX?4j?Td?td?d?dX?j?p?p?<p?`d?pX?j?p?p?d>$0>X0>0D4pDpDpCdC`dDpCdCjC dC8dDpCdCjCdCdDXpCxdCjDpCjC(dCHdChjCdDpCdCdCjC4jCTdCtdCdCdCjDpDpD<pC`dDpCjDpDpCdB$0BX0B0HJ546s|=k|sH=kH0Ok 606 G0h6k  G0\ 6k  G0X 6k  G0\ 6k g2 T0$O0OkDkkdkkxkkXk08Ok kkHk46pkLkkk`kkD2 4 դ h w<a ~ /&@l\ mwaP ~ / &\ mդ  mդ L  mդ  pmդ  Dmդ  mդ  mդ p mդ P mդ  mդ  mդ  mդ  mդ P  X!mդ ! "mդ p# x$mդ % @ @ @  II$IR $H$$I II$IR $H$$ILp_4J4 L_J Lh_,J, L_J LP_J L_J L_ J  L_xJx L(_J L_`J` L_J L_HJH L_J Ll_0J0 L_J L0_@J@ dR:X5A.AU@dv d~PD~(~sJ(HBJ Pl8<? Rl9P8 ~ @m8 X )< ~  @ m 9P D9P(RI<9P@R@v IL@Tv A8.A4U@Tv AO .AUjAp.A|UjAl}AL}AL.AUL(A A .AUʉ(VA`VA`.A$U(??@A@A.ADUD (??d ( ? ?@ v 3B CBP h p @ v 3B CB8 P X !(AO ?(??! (AD4Ob(3 D @-tOb(  Ob( T"Ob(`!9"P-"$Ob(#E%Z%k$&H&Z&b(|'k' (Z\(ET*ZD*b(+k+4+Z+k*,Z,-Ob(@.b(.1Ob(0b(0b(2\4Ob(4b(@507,8@dv AP@dv A( @Tv A@.A<U@A@A.A UVA<`VA<`.AhUjA<.AUjA<}A}A.AUA A .AUA( O .A UA( O .A UA A( A @d v A 'A 'A AP.AdUATAT.AhUAD.AUADAAA.AUAA B B4AdA A&wA  ,0vT8p/w,~w  RpJ5 X@(RPtX*])H\3R 0 D X` "ȱt  H\ 3R   XX$ @8 T H\h 3 "ȱ X @ 0  7d 7l 7T!%!%!%!% !%$!%(!%!%,!%D!%H!%L!%P!%T!%X!%x!% !% !% !% !% !%!%!%!% !%!%!%!%!%!%!%L!%!%!%!%!%!%!%!% !%!%!%!%!%1%1%1%1%1%GG G G0~B 8~B @~B 4  ~B    <  ~B    D~B L~B T~B \~ D|5|@5|5|X5CL C C"z"i'|pp}j|\|,Y|0}(j|p }j|4 |4Y|8&p *|Y|p}j|| Y| pP | Y| |L Y| }T j|X } j|( }j|0|<(o| ݃G}xj||Y||Y|| Y|<}(j|H|Y|}j||hY| b ō  @  [   x ō  (  zK d C S`  | | ; 0F Hx ō [ `  \ [  d d   [ " "[ |#ō $x $ % & &z (ō ( <) )[ * + , -ō P.b / /}j|}j|}j|}j|}j|}j|}j|}j|}j|}l j|\ } j|t } j| }j|}j|}j|}j|B)"}j|t}j|}lj|B)"}j|B)t"}j|}Lj|T}dj|h}\j|`}d j|l}l j|p @A$uGA  (D`h-u@|u $ RJ5 XH@\|0fR  X8 *]L )h H\t 3R   X "ȱ 4 H\H 3Rp   XX @  H\ 30 "ȱT Xp @|   7 7 74X@z7|  626@z7@z@Lz47ȟL! z%626(71A8$3!DUG64!h"ʈ`$Ȇh7!QrG6!,!L7_9x862617EP2L{626(71A8$3!-z !DQrDG6D!H yz yz yz yy yy  y0z4 yPyT ytz yz yy yz y$z( yPyT ytz yz yy yz y0y4 yTzt yz yy yz yz y0yT ydzh yy yz yy !@c &LHcB &LC $Cd2 &LB $!d2 &L!d2B &L!d2B &Ld2 &Ld2 &Ld2 &Ld2 &Ld2! &Lb $ &L &LB $!%h!%l!%p!% !%!%!%!%!% !% !%!%!%!%!% !%L!% !% !% !% !% !% !% !% !% !% !% !% !%!%l!%p!%t!%x!%|!%!%l!%p!%t!%x!%|!%!% !%!% !%!%!%!%1% 1%$1%(1%,1%07<G7PG7dG7xG!%p!%t!%x!%!%!%!%d!%!%T!%!%!%!%!%!%!%!%H !%L !%P !%!%T !%!%X !%\ !%` !%d !%h !%l !%p !%!%!%!%\!%!% !%!%!%!%!%!%!%!%!%!%!%!% !%1%$1%(1%,1%01%4<@G<TG<hG<|Gp# Y 1 t1 J J 1 T1 1 1 0 1 1 ? 1 ? 1 1 1@Y\\~B $ 1 1 1 p1ka  1dVd~B  ( 1 !~B! !(" $1D%kat%  (1X(ka(  *1 \,1 .1 /1 411 P21 31 41T4OA.AlU@v kA Uokk@v kHk k@ v -R UAd A '@ v A kAL p kA$ U oUoA.A<UUo@v kUoAO |k4kjAX}AAT VA$`VA\`@A@A$kUpo@v DkUoU`oUoU,oh!kU|!oA" .A"UUX&oP%kU&oU&oU'oyF4P5lyF45yF4L5hyF45yF,4L5hyF45yF,4L5hyF45yF,4L5hyF45yF,4L5hyF45yF,4L5hyF45yF,4L5hFL-5P05|050yF 4 5 yF 4$ 5@ F -5 05 05 0'JhA9Pp9l'JhA9p9'JhA9lp9'JA9p9'JdA9p9'JA9p9,'J|A9p9'JA9(p9D'JA9p9'J A9@p9\'JA9p9'J8A9Xp9t'JA9p9'JPA9pp9'JA9p9|J /+: 0+:8 0+:` 0'JH A9h p9 'J A9 p9 |Jl /+:` 0+: 0+: 0M =P=lYM ==YM ==YM=0=LYM==YMP=p=YM==,YM==YM0=P=lYM== YMp==YM=0=LYM==YMP=p=YM= =, Y*N0 ->4 0>` 0> 0Ml = = YM =, =H Y*N -> 0> 0> 0Q4BP@Bl Q4B@B Q4B<@BX QB@B Q B,@BH QB@B QB@B8 QtB@B QB @B( QdB@B QB@B QTBt@B QB@B QDBd@B QB@B Q-B0B0B,0Q B, @BH Q B @B Q -B 0B( 0BP 0d8d8ͻd",8,8ͻ,"ͻ "4848ͻ4"88ͻ"ͻ"ͻ"D8ͻD"8ͻ"08ͻ0")8ͻ"}8j|<}j|}8 j|< } j| }0 j|4  )ͻ "}j|ͻ"8ͻ"}j|} j|}j|}8j|<}j|}$j|(}j|}j|!%!%!%!%!%!%!%!%!%!%!% !%$!%(!%,!%0!%4!%8!% !% !% !% !% !% !% !% !% !% !% !%!%!%!%x!%|!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!% !%$!%(1%,1%01%41%81%<<HG<\G<pG<G!%x!%|!%!%!%!%!%!%!%!%!%!%!%!% !%$!%(!%,!% !% !% !% !% !% !% !% !% !% !% !% !% !% !%l!%p!%t!%x!%|!%!%!%!%!%!%!%!%!%!%!% !%!%!%!%1% 1%$1%(1%,1%0<<G<PG<dG<xG!%!%!%!%8!%<!%@!%D!%H!%L!%h!%l!%p!%t!%x!%|!%!%!%@ !%D !%H !%L !%P !%T !%!%!%!%!%!%!%!%!%\!%`!%d!%h!%l!%p!%!%!%!%!%!%!%!%!%!%!%!%!%!%1%1%1%1%1%GG(G<GW4X W4X W4X AX.xX AX.xX  W,4X0 AXH.xXL W4Xl W4X AX.xX W 4X W4X  AXH.xXL W4Xl W4X AX.xX W4X W4X AXD.xXH W4Xh W4X AX.xX W4X W4X AXD.xXH W4Xh W4X AX.xX W4X W4X AX@.xX @Tv WRT^3B CB$,3BP CBTt|L_J @v }h 3B CB@ v 3B CB@4v 3B CB4<L_`J` @v }( 3BT CB`@v L_J q A .A ULD _L JL  qD A .A UL$ _ J  q$ AH .AD UL _ J  q A .A UL<_TJT L_J Lp_4J4 L_J LX_J L_J L@_J L_xJx L_J Lh_xJx  z <b K C @; 4F` ` ` L( _ J  L _` J`  L _ J  L| _H JH  L _ J  3B CB8 X ` 3B CB !%!%!%!%P!%T!%X!%\!%`!%d!%h!%!%!%!%!%!%!%!%!%t !%x !%| !% !% !% !% !%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!% !%!%!%!%!%!%!%!%1%1%1%1%1%7G7 G7 G74G!%x!%|!%!%D!%H!%L!%P!%T!%X!%\!%x!%|!%!%!%!%!%!%!%h !%l !%p !%t !%x !%| !% !%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%1%1%1%1%1%7G7G7G7(G$75.5\7`7X5p.577d5r`*x(|.570   h    Q5 =  .5 7 .54 7< u5  75Q50=75750Q5=,xK.5`7875l75r*D'Tq$\5\ӻ\\6D`X5\p6Dd5\Ǽ`*\x(|6D0   ӻh \  D  <   6D 4 6D< 9 \ 5\0<5\5\0<xK\`6D85\Dl5\Ǽ*\D'TW04X4 WP4XT Wp4Xt AX.xX AX.xX W4X AX.xX WD4X$ WT4XX AX.xX W4X W4X AX.xX WL4X, W\4X` AX.xX W4X W4X AX.xX WL4X, W\4X` AX.xX W4X W4X AX .xX WL4X0 W\4X` AX.xX W4X W4X W4X W4X W4X  AX\.xX8 x2x2{66x22{6P6D,|bWU TITI,+44108\Vt,V17RVvV<5D*@LVVV0 I$+4,+4`+4`1d1p6 50L6VxW5L6d@W5 L W W< -+4@ +4@ 1D 1L )W8 8  V$6L6<EWl66,b)WL`H,VPUtUV,V D6@N6d6 z6|6L6H6қ6t6p6@6<+6B 6Y|6xp6H 6D!6"6̜p#6l$6<%68&6( '6 ?x (6t V )6 mD *6@  +6  ,6 l -6h ɝ .6 8 /64  06  26 $t 36p < 46 R@56<//,L{: L p Lmդ - Hm ,m m m~ t /D ~ \ /TAp  m d m ,m m m m tm m m $m m Dm m d m !m #m %m &m ,(C (m 8*m +mF ,դ . 1mդ 1~ 2/<2 3m 5m ,7m 8m m?=9/=|=5 =m ?mB B9/A*V**H+2L+Ejx,l, ,i--L.2P.EVT///[/P02T0E1vH1 22+2H32L3Ex4b4 46g5 `6)6#626E"7H,7>P82T8E 9E89: o;-O;T!%!%!%!%!%d!%h!%l!%p!%t!%x!%|!%!%!%!%!%!% !%$ !%( !%, !%0 !%4 !%8 !%< !%@ !%D !%!%!% !%$!%(!%,!%0!%4!%8!%<!%@!% !%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!!%!!%!!%!!%!!%!!%!!%!!%!!%!!%!!%t!%<%!%@%!%D%!%H%!%L%!%P%!%T%!%X%!%\%!%`%!%4*!%8*!%<*!%@*!%D*!%H*!%L*!%P*!%T*!%X*!%\*!%(%!%-!%-!%-!%-!%.!%.!%.!% .!%.!%.!%<4!%@4!%D4!%H4!%L4!%P4!%T4!%X4!%\4!%`4!%d4!%-1%h41%l41%p41%t41%x41%|41%4m@4Gm@4Gm@4Gm@4Gm@4Gm@4G!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!% !% !% !% !% !% !% !% !% !% !% !% !%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!% !%!%!%!%!%!!%!!%!!%"!%"!%"!% "!%"!%"!%"!%"!% "!%'!%'!%'!%'!% '!%$'!%('!%,'!%0'!%4'!%8'!%<'!%,!%,!%,!% ,!%$,!%(,!%,,!%0,!%4,!%8,!%<,!%@,!%01!%41!%81!%<1!%@1!%D1!%H1!%L1!%P1!%T1!%X1!%\1!%46!%86!%<6!%@6!%D6!%H6!%L6!%P6!%T6!%X6!%\6!%`6!%<!%<!%<!%<!%<!%<!%<!%<!%<!%<!%<!%<1%<1%<1%<1%<1%<1%<1%<m@<Gm@ =Gm@ =Gm@4=Gm@H=Gm@\=G!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!% !% !% !% !% !% !% !% !% !% !% !% !%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!%!% !%!%!!%!!%!!%!!%!!%!!%"!%"!%"!% "!%"!%"!%'!%'!% '!%'!%'!%'!%'!% '!%$'!%('!%,'!%0'!%,!% ,!%,!%,!%,!%,!% ,!%$,!%(,!%,,!%0,!%4,!%$1!%(1!%,1!%01!%41!%81!%<1!%@1!%D1!%H1!%L1!%P1!%(6!%,6!%06!%46!%86!%<6!%@6!%D6!%H6!%L6!%P6!%T6!%<!%<!%<!%<!%<!%<!%<!%<!%<!%<!%<!%<1%<1%<1%<1%<1%<1%<1%<m@<Gm@=Gm@=Gm@(=Gm@<=Gm@P=G UUU)UU5ED"P*TTUI$TUTUTU :/,f.!!C!C!* RUX  A I $AA$U@HF`0+(i%' N8m <d *!$IUU XUUU<"5H%A۶mv IA*2%LCMS*&:$#; ZIb`$`UPUbb bEDH1I)Ib $H!""""Idj&1ݒ$b$IADH2m\j0|)`PU[_ I)d @ 0ffff y7Ke,@UUj*2 tKDu1dUI )I1d )rEJUb" RU<UZ *E jj.J@F@bsIae0'H  00eLTUA)e24Jebl۶6Jes `  AA$EHT @  I $I@u*` lPp,@= NW(+IUUUUaa$EJAJAAA A!D!Hjk39UUUUUM 'I$ $ SU)U& IUJ*UU% U >Ud J*UUU eUU<) (U $%IHL$H$$UIU@Bk +  ITS$II"G! @ %  @`$a!8E 2 R? B 4I& Ab U0D`O8 $$V#L(T&T&    |HI~kk-kH&/'TUUUTU%I!C !C  $ H$A$0 $0qTURJ))RJH$p 3**TUTU$I$IUUUU'ITUTUm۶TTB_D"H$?)\0HH&)Q[2`4&zN. H$%ITUMblx"GpxaJRT*H$D"bҡ_P2U 1d TUefff!C 2$!C 2dH.&LbɴU( A%!J T*UUUUUUeL TU%$I$M &@AAAA@AP HaZkVdfff#%H$6:<r\ { Y@6TUUUU &H"A0BMHUUUUUjdUE)RUTUJ @*@QUzfERU5t2%&ɱ?S$$I$DB!!BJHl۶!!!!!!!!bX,(`!(`!@(`!(`(`!(`! (`(`!$(`(`a(`aNt:@$I @@H@@*-@i+00 CUT0 @A:x$.kZkk1H@$A 1H@$AI"$I*I$$%U9vA$D"%$I$DT*JR$IT*JRADAD!C 2dȐTUJ*UTRRJ*UT$I$H`` 1Rr(UUUUUUUUU$H"I"I!$ $@"D$ TU(`! @8NtZ@4I`0@A%IkZkZk-PST)R*0@(@$IF)P AT*JRD"H$UUUUUUUUUUUUUUTUDADA$IpQ!$ $$I@"D$ 0ID2Q&D(eLeL2Q&D(TU2Q&D(eLUZe*VYʪUVjUVUXUaUUVUXUaUV= B8DHIFpQII$IR $H$$ITUUjUZe*VYʪUTUUUXUaUUVUXUaUUTUUUWU鯪_UJU*U*UUWU鯪_UJ1dI&SL2bLd2$)&LTU$)&L1dI&SL2bLd2UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUI$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$  ?_UZ2RTRJUUUUUZiV*UUUUUUUUUUUUU*UUUUUUUUUUUUUUefTJL_UTU*ZZUUUUjeZS*SR+UURUTZjUefZU*R+UUJM-jZiZUVTU-USSuf"""""""DDDDDDDDDDL335353fjffffffffffffffL733333333333ffffffffffffffffL13333333ffffffffffffffffL3333333333333333ffffffffffffffffDDDDDLDDDDL5335133fff""fffffffffffL333331333313""fff""fffffffffLDDDLD3SU11QUU3UUUSUU&&"f&""""DDDDDDDL333333333333333jffffjfffffffL33UUUEDURUDTUu***4444444444444444hhhhhhhhhਨ(QQQPPPPQQQQQQQQ!!!!!!!!!!!!!!!!BBBBAEGEEEEEAAA>>>>>>>>>>>>>>>>|||||||||||||||( A ) RR@'$$$'$D"%%%%gO????????????????~~~~~~~~~~~~~~~~$$HHHHHHHHHHHHHHHH!!!!!!!!!!!!!!!!BBBBBBBBBBBBBBBB $$$$$$$$$$$$$$$$HHHHHHHHHHHHHHHH!!!!!!!!!!!!!!!!BBBBBBBBBBBBBBBB aa |UUUUU@@@@@@@@       :tttttttthUU *UTUȔUUVUTU H*`ff`ff*SUUJTWUUUZ+(**UUUUUUUUUUUUUU**DDDDDDDp@ @T*IB P@ AP@  I$I$IDA BUUUUUUUUU@IR v%U9v%%&Jrj'J%&JTOەJLT~+(ʩ+*1PRS?oW*1 UUUUUUUUUUUU*UUUUUUUUUUUEUUUU*UU$I$I$I$II$I$I$I$P@A (H  (H  $P@A $()RRRRRRRRRRRRRRRR$III)RJ)RJ)RJ)RJ)RJ)%)RJ)RRJ)%)RJ)RJ)RJ)J)RJ)RJ)RJ$I$I$I$I$I$I$I$I$I$I$$I$I$I$I$II@UUUUUUUUUUUUU*UUUUUUUUUUUUUUUU *UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU*UUUUUUUUUUUUUUUU#RUSUuRUUUUUjY*UUUUTUUTUQA"f"""""""fa3  ***  *TTT0000000000$pIIHPIHP#""***Z0!AUc"b"b"$ `!P<@VZk?)\0pe @f @f7<UUUUUUUUUUUUUUUU"(1PОc70@('dD!B!B!B!!B!B!B?B!B!    @@@@@@@@@@@@@@@@ @@@@@@@@@@@@@@@@IQ$@@    AAAA    AAAA    AAAA    @@@@    AAAA    AAAA    AAAA    @@@@    AAAA    AAAA    AAAA    @@@@    AAAA    AAAA    AAAA    @@@@    AAA >dA 1-l=mhͫ7d<>[c] ̱x|z ~YZ{}ɱɱ ɱ@   @@Oɱ`M`@  ˱'P@@I?(linuxv2.6.0Zs9*t9( 83 3I"VQj8Z'c/29;("A4,|F ̱(H(H8H(HHHPH(H(H(H/ ( j` ` ` ` ` ` ` ` eŶ3E@E-|F ̱@&;-h-g7!-.& i$) )Y#(}%u"X܄#*G /& -!A,0([#0]m$$1+m,)m$9%1m$]&')\#_&*)&FhKFɱxKɱ !Jdn2z:c=L"Z#t( =Z^ nA5RF_%-xi%:'Uo$KM<!IK5g\ຮٰ`ڰ ٰZ;3'am8%@@@@@@@@@@@@@@@@ɱ/Z(K L*# /d7~Y6~) (f0A.p$)")^#XY%Z\]z\L5(M&j1>>!qM@0.M5O"n.-. FɱOO OO0O8OOOO````````G#EY2=P"tC/{:CP" ONIr$  i v lP$$$$$$$$) MQ"r$)N-- v9;*%? % .l {J%  O5<3<|:rPjH`#)1E4: .@O5)122b<|:[6<3%΃%%F0]k?a. 3A!Q"e7is$d(b%f7h .32(%. TA!Q" 3Yo8 ,)* )%%/ԅ%(s+/v00*+,(T(lZ*/K=-%{ls$<&h;A!;B!R"Uډ< |(,[6. *N .o8M)Ӗ& >S")S"(̸(,| .*1O5 .K32(/W/ʶD/ KS"`#9g'@X3iV;B! t$X!/ n)),*ނ;-)|:O5<FGB! t$@*C!*%@8@8@8@8@8@8@8@8/ +P5,,ss&z_g $%3T;;n 3@%nQe  3}]Ѯa(*  l &  y@k+QX:n NOOXM  3*1]6!0 "@2NM}3F|EgQqp8lD!Q5>U 4 @;m^   @ Fްm@G K ÜF!5 *0 DU"+1%+1Y&J*(E42]v$ 'np8}.`A qQk) ~4 .~-~Y tE!J (?Cc#mR PG ˱h[h[x[h[[[h[h[h[  ' h sBa'RF X^6A4AuAAL(KEF!-%5 S 8 D ,"@ʚ;a (1 ~:-e#se#Ux$|=,C(pbbd qR -y$Q&S?qN?H@aH@aH@aH@aH@aH@aH@aH@af#!a3 ![& hG@IP^@I*)&3 'cG!)"TaO".)372?:g#4 GdS5WG!G!cݓ؜gR 2-_->**""~27_Is8ߴRd9Y y&&B:Tm?3_82JH!*kH!!0Qfdv7E`=*5 WX"H!,Rh#yX"X"{$X"uh#!6 7 *a6 M)(~: x%8E releasego1.23.2mipsle-sfXHPHHHaH` I` a` B@.`7B- 5IIXbLຮٰM@@ M@@b@@PM`Mb@O8OhO`xO`c``HP$XP$`c$FPPc! ſ|! ǿ6"`ȿy"@ĿV)(GɱͱV@8V@8@d@8 /`J /- K/`J0 .`K[[Зx]]H@a]H@adH@aFw!Hi8J/Ix+ H}zy ~ I:q~Vp:Y l&,YE @c5N-鰧ht  6-`;t-@c5J- `}chbXb1C@R @ P  G"  HWp`<@J?!QR@ Z"`<`Kֹ&Nnl,3P;yoR`; R^91JR20:XL x&ߺVJ D]~ vK\ gg:Q@NLaN-R 6R<? R 34.K@[0S/?O !yLV30P `˙"O !yvLS @/.0OkR`@ŬRB1JR g|R^dX Q 6XQ@756Zp#S7?S`>0:xL@" ]pDS|7%i$S`dN-@" 7/bS'ߡbHBh|g "2K?iHR  ɱ cc` ~(h1 #@Tt +P {. {ce@.@8-ސ\6 Ucę~lg=д<(>i(8ʟT JΣ:` >$]Ǩ> 7@>4Fǿ0Vl`#g} #g v  $0@93c{]hߜ@@C\e@9Ň 9 pc`c$ Bᯌa%a\v ccd_@CHc`$cС ſc ǿc`ȿcp@Ŀ0 +@v\c>1#@@  }G<. E \ d@v)V@v)"4(Kf\Lt6ശ?1)(H=_T^SPd@d@8@м+[] Ź!]܇=!,=!y,T=! {d=!>v=!iC\=!@#",=!Z =!a 6 =!`Fnp=!˫ݼ=! 6ڃ=!b =!yP=!@Xs|=!5T=!`ghؓ= "ٶ Ypw "<[x "x 4ܗxζv޴sD`ಿD`ಿ`g" s/އ"`j`"cK)S<"[BdDڇ"ࣴ Iه"@"؇0@ռr0ռǧ X0| 0ľl(0/#:0ng@#Z@#`/pz̴0{ `0S"6hGa`<шg@%{u/`$plbl@# & l$`zۭhf#w4j<4 h`ҩtaJra#Ck=j@Kh#`ÿi /r iܶ?oaGCxa`X¾:@aݶ-LRa.Mg` ȷnN o 7gnn%JaXn o>&!C(p%b%`pT,? ŶqmG 'җ+OFٴY~^F௴.DF ܼ DbF 'YYMG`N@` Z"` Z"`Ԝb{ͷL]`ݼ}`܄Gº20ڹ͠(<@?SUif< 7lkf<",lf<V ff<?5`cf<R$턐nf<@@(of<@dgf<W0^f<W[f<X0`f<@Aؤaf<X_M~T]f<YLYwdf<`R(wrf<R5P`qf<&GZf< S"hf@>8|ɴ  DS9 ?Ti2 K`y4 >L`Pż@ `>sO`>Xmmp̕Ε`>@i `> y-b *`>@YG,`>`;a9Xt4x>`p=9 6 V=$4qr}̦Φ`5 r(@ŦǦ5rw@4rb/ -ȹ3@s$\/ FD\x/@޽0e,Le,@13,t\?@N:$0? 緌LO?1mD?.5d eGQQ@D/@n\,x,/߽d ",",/o[ m|**/mc\*x*/:Jù--/ 04$P-P-/64-D-`AKHZ Z B-PI$ $`I-@. 3`8p@ 3С 3e'4| 3 <FpKFKɱ6 Z"`|86<NB^|^63X5__6u7ؿ^^63_T_JEHqzqz5 X CdC8" DX D8VCC8`:k*CD8͂C C8 42^DD8UC\CC8 eCDC'ǭ=@_&ƭͱ3Dx/pRRD WҮxQQD-ZD PP/E@']P,]PD@Ĵ`GODODtpNTN@:O*TMM@:qboMMD>樘S\SD@4]MMD x@XMM9 u@RR9 s]%ϼRR9@z#Z-! SS@:@?V4 S S@:NB5)X S S`A A8 = 98RtR9nmtR,R<nmLJJ<8JJ < \JsJD28QpeH?tx2:?ȼ L ?2bћ|қ?`2 ژdƛƛ?3I>$śś@c`(Aݘ$ԧܨAਸ਼$$AK($lA B)Q|C,A`qA u$@AB|@`hA@_]AB_3%4إK``ձձ +`@@QF>G\FihdFN `D@گѨ`DA AP˱ ̱˱ ʱ˱ʱ˱ ˱˱˱˱`̱˱`ʱ˱ʱ˱`˱˱˱˱̱pI`# .`# @/)|u@IGw@9c1d1@I^}911@I_Nr6'11@I_h.f11@I`0x1H1@I`qt 11@Ia 1 1@Ia=(1H 1@I`11@I@;!;141@I`&HD11I uT=$=Ic 4==Iຶt=D=J[ *x'x0(x` ɱ @``@)D`ಿ`J}dvv/@V`,vv`S 2h TڶFha̎a@L`ؼh/iĺi`Mq iti@UѾh8va`a@Up"bTaa@U^slbY`TDSY G%(SY@O)SYc|HLhSYŹSY-US॰ɱ`Y_tt`Y`%3.ss`YɹۺJtssR ϶){$StStR϶>",St@StR϶ iΟ\StpStR@ж'pDAtXAtRжJ־QtRtRѶIQtQtR`Ѷn̘@t@tRѶsQtQtR Ҷ>-OtOtRҶP OtOtRҶ;uhOt|OtR@Ӷ#|8OtLOtRӶ뗬PtPtRԶTNthNtR`Զ`2$Nt8NtRԶ?S@t AtR ն,vvRնldBt4vRն:4BtHBtR@ֶKtKtRֶ']BtBtR׶y/@t@tR`׶x8@tL@tR׶T0h@t|@tR ضSTKtAtAtRض{8AtAtRض~AtAtR@ٶyu@t@t`Y@iss #@ *@?|D|`VVԒc(c`V`aAccVdqM`cPcV`d.E!LeM\9zŐ \?j,\ aDN \@1\ *p4\ gCL\ WĬRP\@u,\Oސ|(~\]Y`S2gD 2024-11-12T00:10:09Zgo1.23.2 linux/amd64 m`ɼדu(̟ @n77f=,D@,>, @`3l@,l,,`QEU-d++`Q`Zg4++d+`~ (8((`Q'^< 5`~Z7\77@S`v\Qx `!`"`@S Z"`Ԝ|8 @Uڼl_q`qHaq`uܹYz8qzczUڻVp|php U5_pppUڻ шpTpp @vIE<FXFzj} S Q4"S``@@JJTJ dvXRRhR dـRRLR^`6@YLbLdZL @`;`LSxS4+P^@/._O0Os\?s```˱` 0`˱``` ಿಿBD`jR(h!hh}uPA$hhthoKpjjj`qф]g]g]g`rg.w]g]g[gjRhphh@ KFhTWlWlhXlt@lzXNjOjxOj^%uo oo` /װh`~XHĊĊƊ`~LJ>H`~7jUjUlU`~^ \\D\ ĺHMN`OúJrPQRĺ:l(T UUSJddxdS%dXdd`@Nb/$e4eԐeJJ`e||`~j*bGpcGhdG`~`z;`G,aGbG`~`0(p;do;p;NNg``` -``!4Z,ޡ fG+&**4¢h`:hĹRTg8Jeٷ& x{d{|7Mg{|{o̒(t @ *|"||ٷ_ Ѵ`ٷ`|$X0SlTU`WC@C@D@ڷ` %D`๻<hٷ`]nbde]5?Dq[],Y@Ѩl ݹ ؞ٞڞ ޹/XѝXҝӝ `@@<0=զӦlۦ4ڦ;`0yoDD;X{=`8[x'4(X((@9`%Ț=`W0-2-3-+AջlP=ܻ[0_(\(p('=vI;h(p'''=7Π8((p((=@w(Ťq'(,((=9|PP((((=)qE (X (l ((`=ƻAlEF(FF`=`dnh#E EE$EA3/P?D ??? >`?zpnKnK\nK@oKۯ ɱ@Κʚh̚ΚF@?`A ¾@Th@E~gxxпxx0`````˱` FټⷾHiiTihla`@Yx G _ȀȈtʈɈLjGQxJ, G Gh GlGG Z"`Ԝ}G@v#x H4 @H`j3D(H̻aH`89A6DAܺd@dddO@cccLc`O@Nb/$eee0eA@\JudDd,ddO`Ռ$NHlldlXlP P OZߡLޡߡ ޡPztŢ4ĢTƢâP@)<P`"dca`daI *p4`L WĬRdP J gC LL9zOh̋ MH>MlKOޤ|$}|(~ M?j@,L@u,@K lLxJ` p S`a D0|<S<\ܝ4SX!ԗTS@dTL̔$S DS9|৞ P"!J|P= YLY\ YP@ߤР`a@ *@?|D|P3|8|@T`,~O䁠x4tЀ`xD|ݽ}=dʼ*L""4""X"hXE.P>.HE.G.hE.!h#d#$"l"" ",o""""d""4""D""" jgXT]U]U]\V]W] 8s_D__H__ u$J@]^]]P] `Ջ̻^^^l^8^߻G35s1@ 2@X1@3@|2@ ߻#)@+@)@@*@0*@ @լ'@(@'@'@|'@þ]v.tu.|v.,y.v. -hMMMNxM Z"`Ԝ}; 1ݴ##H#t##>P jjd j j j@l@Ƥ8$P `>>>>> ɾNP?x?d??T?9"qXh8_ьл໌ i ̺_@ഌ`n ذ䯌xTЬୌR!ئ䨌覌lH@"@0P`èȞP=\ 0 Y˥dxltAD`Th쎌xT"||脌XLMz |<|yz`z4<d<D<T<H<v<ȍ<< << }ԏ<,<<p<Ў<tRm,(̌P@ï̞H䤘+oW"L%|#&( Hglhxnj I@yt  NNHdङ|` Z <8, 5bl|t跙  <Ùę xNlд, ȪتL< t}$॰ɱ`*L(=u=u4Au=u$?u54>54@4`\o4=5m4tm4n4m4@;*u48>5,r4\>5u4r4@2i$g4xF5Xe4F5g4te4 F_pq4>5o4o4\q4o4^}H4?5|44?5444`ʾ4X?54|?5̓404ʮ|k4<5h4<5k4h40蘌X4`=5M4=5S4M4ޟT4>5y4>5@4y4@b4=5h]4<=5b4 ^4 40F54TF5 484@/vC4;5x?4<5d?4p@4,44B5B5C5C5C5@^bP\4=5X4=5<\4Y414B5d4-?-@-*F@c5|I-J-,K-L-,N-,@`7`7@55Mst?XIz,NzOzJzdQzGzLzFnQ/$ |O ɾNP??P?x?d??T?M`1)H|pxM`09<6{0||}p~ N`MӿuhwwwwwwwN`ÿPiiii0i i-\>-?-@-A-Ż@c5|I-J-J-tK-K-L-,N-N-HaHiHHHH@HaHiIII I` IHbIiIJJJŻ&q'q(q(q*ql+q,q<.qŻ@%՟fqgqaqiqHjqkq mqnqŻܰpHp|pdppppPpŻ7D%A{@$ AH|@|@H}@}@ AMbM`o(M0M8M@M@@HMbXMohMpMxMMO(OFbFHOOPOXO `OcpOpsOOOO```ʻظc蒐eݐP$\׏`ʻ欳o@c#`ʻ'^(u-pǐ0`ʻ!~|rT ܏dY`ʻ0t0h`wHs86Ż;  \ `ʻT ̘̐P`ʻsz 8ʐ8Ծ@PPcPP u`PhPpPxP$PcP`uQQQQ@V0dVvVVVV@8Ż` "GHsHsHsxsdsȒsPss"`:`: `: `: `ɻ PA|iXSit=iixi`ϻ;KOĀd}d d@dddvdd`ʻzG4llXΐ``ʻ@; &Hdϐ(ď`ʻ`%\cѐPǏ`ʻ(phPҐ0hǏ`ʻkxď֐|Lȏ`ʻ@FVF;<ێؐ00ɏ`ʻqwِ8zˏ`ʻʾT&vr(ېDttϏ`ʻ$Ԓ<hܐĝ!Hӏ`ʻ6ސp %8؏`ʻ@ xɎxt'lۏ`ʻ˾I$z||(X܏`ʻWk;B8|X+,`ʻ /L h,`ʻʾd~`|/`ʻtގ2`ʻꈓَ$H3`ʻ@fڎ$5`ʻ󰓐Pݎ$5H`ʻlēě$7`ʻB:[ؓe@9`ʻ@&vx쓐Ў8ԥX:t`ʻ }P>|`ʻ 㦦̴4@0`ʻ@ (nlC`ʻ@7<ĀP@E,`ʻ 8PTH`ʻ HdԎȩJ`ʻ #'xx֎\K`ʻ@xhܪtM `ʻ[؎p\xS`ʻ'f|$8U`ʻ{l`%ȔjV`ʻ@?RܔiV`ʻ.\gW`ʻhTxXh`ʻ$ilY`ʻ@s+,Xk8Z`ʻ -\@X\\`ʻ-\TҎ䲐``ʻ`[hߎldDb!`ʻ@|юpb"`ʻRBU(Dtd|$`ʻ HȨH teX%`ʻ̾~>̕D tf&`ʻ@/ȿ <$l-`ʻ]t@4\d̶p42`ʻA%(Tq3`ʻ1V@XrL5`ʻ@u#9Dp<t7`ʻgX8t7`ʻ\!"#Hw;`ʻmڔpqzd?`ʻ`F<)򨖐L(|@`ʻ@  6nȽlJ`ʻ`Gr#Ж腑|dL`ʻ;Dp o@p, o/ MWR@^pO_YlT b([`Q16kA4$0 P@pL4 7@@7@7@@@7@6`7`76`76`7`7`76`7` b@iB -$$-@. -`6`6`6`6`555`55`5555`55౽ٿUQΤLSTMSNSLOSPShQSRSRSXSSTSUS8VSVS Z"`Ԝ|};<|t8@<|!!T!p!|!@!!!! ǿ!! ǿ6" ""p'"l" " " " "`ȿ " "`ȿy"Q"@H"hl"U"""""Ŀ""Ŀ((( ٽ (=/_al`a<_anatnanacacacacanaea]a|^a ٽ ~$``P````t````` ` ```սjRyh zh'hglghhzh({h{h0|hthԊhԅȟh ֽKXjj|j\jpj jjjj$jdj|kljLk`սJa4p(6pln7p@ o@9pl:p;p=pP>p?p@p,Bp`Cpֽۿb4MpXNp|OpPpgokoQp8SphoTpVp|WpXpZpٽ ,(ݡ`l<ݡxۡۡpۡPܡܡtٽ@lh@\4hT|ٽ~EC  !#%&'()*8+,,02ٽXt ,TX  `ؽ;TY~$8dV~@ \ Y~W~X~ ,W~׽@cӔ((v~( w~4w~(Tv~w~))w~w~X*`ؽ.A29@::@;;<t==|>>t?@@Aٽ੿ɉ@p4,XHhxhٽXb^_`X<^XXXXXdcٽ >h\TpA l ઽ ઽઽઽઽ ઽ ઽ@ ` ci`HÆ\ņxH,Ć0tYl- K- K-- K- K0Il@@ .N`K .N`K . .`K .`K`ddqM(c,*d)dd*dd,d7dccH;d/dcXEdCd7d46dc@r>{ͷUVDWXXYYZL[[\^(__p`ac@igl̆(ņ͆|Ն8ˆņֆpІpņцpdžȆφ0ֆLņ ӆw4Zl [lj[l[ljt\l$]lpj]lj^l_l_l<`l`lBBBBBBBB BMBBBMBMBMBMBMsF4+l6l340@A-E;IGH/h8C1=LXtD ,TX  ~EC,@l  !#%&'()*8+,,02-46d779:;<=>?@tBLC$DD(H0I৾`(^@^?^|@^e?e=e>e,=eH eee`^$(^@^?^|@^߾@>߾@>߾ڷ߾ڷ````` `g`C3 ؗݗٗ@pޗ`$xhxXhhۗ` |^c(H^^Ȇ^ԅ^T^0^_^^^(^X^^^^4^^4_d^ܓ^ ^4^^d^^` ;+:x^^^l^l^ ^ ^ ^T ^:^;^ ;^l ^<^@^H^^^p<^H=^<^^=^ >^^ ZlYl `J`J`J`J`JHJlIl`,`,`,J``,J`J``,J``,JL)z^T^^^^4^`^^^^^,^X^^^^H^t^^^^<^h^^$]Ȕ]8_ ;+:x^^^l^l^ ^ ^ ^T ^:^;^ ;^l ^<^@^H^^^p<^H=^<^^=^ >^C^PF^^``````>>asynctimerchan=1,gotypesalias=0,httpservecontentkeepheaders=1,tls3des=1,tlskyber=0,x509keypairleaf=0,x509negativeserial=1`7B@.--`7B@.`7--``6`7--``5 5 533`5533܁!H!Д!!!!`O`O`Oſ`Oſ`Oſ`Oſ`O`Oſ`Oſ`Oſ`O`OſT!!l!(!p!|!       `R`R`R ǿ`R ǿ`R ǿ`R ǿ`R`R ǿ`R ǿ`R ǿ`R`R ǿ" "\""p'"6"`P`P`P`ȿ`P`ȿ`P`ȿ`P`ȿ`P`P`ȿ`P`ȿ`P`ȿ`P`P`ȿ@H"Q"[">@??@@@DAADBBHCDDEE F|rU];a,I kn_e C~xpO\S*"<;%>1'0+lmf 7A-$ijk #h 8/23 =) 9.5c!,@:4edg?sִpdј, P֘Ҙ ܘLؘ 8D, ݘߘ< ژԘ``bPI`XI`$B@.-@$B@.-7@`7`7$`7@-$B@.-7@`7$ $ @`7@@(bpI@@xI@`# `# `655`#5`# `65`# `# 5ɱݮɱݮɱɱɱɱɱɱɱݮɱɱݮݮ. F= [0il0KKK}0G xAX=xT *"0iY0 [.[,@@@l@l@l@l@l@l@l@lk@l@l@lk@lk@lk@lk@lk@l@l@l@l@l@l@l@l0c0cɱ`(ɱ`(ɱ`(ɱ`(ɱ`(ɱ`(ɱɱɱݮݮ`(*  n . & H ơҢ81 @ 8 p @K 6  U| "0G" '" '"0G" '" ' '" '" '" '" 'ಿ `M`ಿ `MB``ಿ `MB``ಿ `M`ಿ Bಿ `Mಿ `MB``ಿಿB`Bಿಿ `B`ಿ Bಿಿಿ`Bla $@ $ $ $ $`` $ $ $ $`` $`xxxxxxxxJ xx  J F%F%%%%%%%%%%%%%%%]] ̺ 4G '4G ' ' ' ' ' ' ' ' ' ' ' ' ' ' 'bb````Ѻ````````B ڤM X c  ~7 ޤr  K vݝ,X e WL""'  #r | "]k1 jL  >}L L| |1 ¡# !"#$%&'()*+,-./0123456789:;<= K ݝ+ Wsvzi,X e WL""'  #r | "]k1 jL  ( >}L L| |1 ¡#1  !"#$%&'()*+,-./0123456789:;<=L!mv"&aP*u.2Ʃț˩VЩƛ6թ :> 1+B ک"}\(.ߩF$bJNRhnr Gԝl 6Cadgjm G= GK GGvGݝG,GX Ge GWLG"G"G' G #Gr G| GGGG"G]GGGGk1G GGjLG GGG G >G}LGGGG GLG| GG|1G G¡GG#G0w tApath github.com/apernet/hysteria/app/v2 mod github.com/apernet/hysteria/app/v2 (devel) dep github.com/andybalholm/brotli v1.1.0 h1:eLKJA0d02Lf0mVpIDgYnqXcUn0GqVmEFny3VuID1U3M= dep github.com/apernet/go-tproxy v0.0.0-20230809025308-8f4723fd742f h1:uVh0qpEslrWjgzx9vOcyCqsOY3c9kofDZ1n+qaw35ZY= dep github.com/apernet/hysteria/core/v2 (devel) dep github.com/apernet/hysteria/extras/v2 (devel) dep github.com/apernet/quic-go v0.48.2-0.20241104191913-cb103fcecfe7 h1:zO38yBOvQ1dLHbSuaU5BFZ8zalnSDQslj+i/9AGOk9s= dep github.com/apernet/sing-tun v0.2.6-0.20240323130332-b9f6511036ad h1:QzQ2sKpc9o42HNRR8ukM5uMC/RzR2HgZd/Nvaqol2C0= dep github.com/babolivier/go-doh-client v0.0.0-20201028162107-a76cff4cb8b6 h1:4NNbNM2Iq/k57qEu7WfL67UrbPq1uFWxW4qODCohi+0= dep github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE= dep github.com/cloudflare/circl v1.3.9 h1:QFrlgFYf2Qpi8bSpVPK1HBvWpx16v/1TZivyo7pGuBE= dep github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= dep github.com/fsnotify/fsnotify v1.7.0 h1:8JEhPFa5W2WU7YfeZzPNqzMP6Lwt7L2715Ggo0nosvA= dep github.com/google/go-querystring v1.1.0 h1:AnCroh3fv4ZBgVIf1Iwtovgjaw/GiKJo8M8yD/fhyJ8= dep github.com/hashicorp/go-cleanhttp v0.5.2 h1:035FKYIWjmULyFRBKPs8TBQoi0x6d9G4xc9neXJWAZQ= dep github.com/hashicorp/go-retryablehttp v0.7.6 h1:TwRYfx2z2C4cLbXmT8I5PgP/xmuqASDyiVuGYfs9GZM= dep github.com/hashicorp/golang-lru/v2 v2.0.5 h1:wW7h1TG88eUIJ2i69gaE3uNVtEPIagzhGvHgwfx2Vm4= dep github.com/hashicorp/hcl v1.0.0 h1:0Anlzjpi4vEasTeNFn2mLJgTSwt0+6sfsiTG8qcWGx4= dep github.com/klauspost/compress v1.17.9 h1:6KIumPrER1LHsvBVuDa0r5xaG0Es51mhhB9BQB2qeMA= dep github.com/klauspost/cpuid/v2 v2.1.1 h1:t0wUqjowdm8ezddV5k0tLWVklVuvLJpoHeb4WBdydm0= dep github.com/libdns/cloudflare v0.1.1 h1:FVPfWwP8zZCqj268LZjmkDleXlHPlFU9KC4OJ3yn054= dep github.com/libdns/duckdns v0.2.0 h1:vd3pE09G2qTx1Zh1o3LmrivWSByD3Z5FbL7csX5vDgE= dep github.com/libdns/gandi v1.0.3 h1:FIvipWOg/O4zi75fPRmtcolRKqI6MgrbpFy2p5KYdUk= dep github.com/libdns/godaddy v1.0.3 h1:PX1FOYDQ1HGQzz8mVOmtwm3aa6Sv5MwCkNzivUUTA44= dep github.com/libdns/libdns v0.2.2 h1:O6ws7bAfRPaBsgAYt8MDe2HcNBGC29hkZ9MX2eUSX3s= dep github.com/libdns/namedotcom v0.3.3 h1:R10C7+IqQGVeC4opHHMiFNBxdNBg1bi65ZwqLESl+jE= dep github.com/libdns/vultr v1.0.0 h1:W8B4+k2bm9ro3bZLSZV9hMOQI+uO6Svu+GmD+Olz7ZI= dep github.com/magiconair/properties v1.8.7 h1:IeQXZAiQcpL9mgcAe1Nu6cX9LLw6ExEHKjN0VQdvPDY= dep github.com/mdp/qrterminal/v3 v3.1.1 h1:cIPwg3QU0OIm9+ce/lRfWXhPwEjOSKwk3HBwL3HBTyc= dep github.com/mholt/acmez v1.0.4 h1:N3cE4Pek+dSolbsofIkAYz6H1d3pE+2G0os7QHslf80= dep github.com/miekg/dns v1.1.59 h1:C9EXc/UToRwKLhK5wKU/I4QVsBUc8kE6MkHBkeypWZs= dep github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= dep github.com/patrickmn/go-cache v2.1.0+incompatible h1:HRMgzkcYKYpi3C8ajMPV8OFXaaRUnok+kx1WdO15EQc= dep github.com/pelletier/go-toml/v2 v2.0.6 h1:nrzqCb7j9cDFj2coyLNLaZuJTLjWjlaz6nvTvIwycIU= dep github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= dep github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= dep github.com/quic-go/qpack v0.5.1 h1:giqksBPnT/HDtZ6VhtFKgoLOWmlyo9Ei6u9PqzIMbhI= dep github.com/refraction-networking/utls v1.6.6 h1:igFsYBUJPYM8Rno9xUuDoM5GQrVEqY4llzEXOkL43Ig= dep github.com/sagernet/netlink v0.0.0-20220905062125-8043b4a9aa97 h1:iL5gZI3uFp0X6EslacyapiRz7LLSJyr4RajF/BhMVyE= dep github.com/sagernet/sing v0.3.2 h1:CwWcxUBPkMvwgfe2/zUgY5oHG9qOL8Aob/evIFYK9jo= dep github.com/spf13/afero v1.9.3 h1:41FoI0fD7OR7mGcKE/aOiLkGreyf8ifIOQmJANWogMk= dep github.com/spf13/cast v1.5.0 h1:rj3WzYc11XZaIZMPKmwP96zkFEnnAmV8s6XbB2aY32w= dep github.com/spf13/cobra v1.7.0 h1:hyqWnYt1ZQShIddO5kBpj3vu05/++x6tJ6dg8EC572I= dep github.com/spf13/jwalterweatherman v1.1.0 h1:ue6voC5bR5F8YxI5S67j9i582FU4Qvo2bmqnqMYADFk= dep github.com/spf13/pflag v1.0.5 h1:iy+VFUOCP1a+8yFto/drg2CJ5u0yRoB7fZw3DKv/JXA= dep github.com/spf13/viper v1.15.0 h1:js3yy885G8xwJa6iOISGFwd+qlUo5AvyXb7CiihdtiU= dep github.com/stretchr/objx v0.5.2 h1:xuMeJ0Sdp5ZMRXx/aWO6RZxdr3beISkG5/G/aIRr3pY= dep github.com/stretchr/testify v1.9.0 h1:HtqpIVDClZ4nwg75+f6Lvsy/wHu+3BoSGCbBAcpTsTg= dep github.com/subosito/gotenv v1.4.2 h1:X1TuBLAMDFbaTAChgCBLu3DU3UPyELpnF2jjJ2cz/S8= dep github.com/txthinking/runnergroup v0.0.0-20210608031112-152c7c4432bf h1:7PflaKRtU4np/epFxRXlFhlzLXZzKFrH5/I4so5Ove0= dep github.com/txthinking/socks5 v0.0.0-20230325130024-4230056ae301 h1:d/Wr/Vl/wiJHc3AHYbYs5I3PucJvRuw3SvbmlIRf+oM= dep github.com/vishvananda/netns v0.0.0-20211101163701-50045581ed74 h1:gga7acRE695APm9hlsSMoOoE65U4/TcqNj90mc69Rlg= dep github.com/vultr/govultr/v3 v3.6.4 h1:unvY9eXlBw667ECQZDbBDOIaWB8wkk6Bx+yB0IMKXJ4= dep go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE= dep go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= dep go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60= dep go4.org/netipx v0.0.0-20231129151722-fdeea329fbba h1:0b9z3AuHCjxk0x/opv64kcgZLBseWJUpBw5I82+2U4M= dep golang.org/x/crypto v0.26.0 h1:RrRspgV4mU+YwB4FYnuBoKsUapNIL5cohGAmSH3azsw= dep golang.org/x/exp v0.0.0-20240506185415-9bf2ced13842 h1:vr/HnozRka3pE4EsMEg1lgkXJkTFJCVUX+S/ZT6wYzM= dep golang.org/x/net v0.28.0 h1:a9JDOJc5GMUJ0+UDqmLT86WiEy7iWyIhz8gz8E4e5hE= dep golang.org/x/oauth2 v0.20.0 h1:4mQdhULixXKP1rwYBW0vAijoXnkTG0BLCDRzfe1idMo= dep golang.org/x/sys v0.23.0 h1:YfKFowiIMvtgl1UERQoTPPToxltDeZfbj4H7dVUCwmM= dep golang.org/x/text v0.17.0 h1:XtiM5bkSOt+ewxlOE/aE/AKEHibwj/6gvWMl9Rsh0Qc= dep google.golang.org/protobuf v1.34.1 h1:9ddQBjfCyZPOHPUiPxpYESBLc+T8P3E+Vo4IbKZgFWg= dep gopkg.in/ini.v1 v1.67.0 h1:Dgnx+6+nfE+IfzjUEISNeydPJh9AXNNsWbGP9KzCsOA= dep gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= dep rsc.io/qr v0.2.0 h1:6vBLea5/NRMVTz8V66gipeLycZMl/+UlFmk8DvqQ6WY= build -buildmode=exe build -compiler=gc build -trimpath=true build DefaultGODEBUG=asynctimerchan=1,gotypesalias=0,httpservecontentkeepheaders=1,tls3des=1,tlskyber=0,x509keypairleaf=0,x509negativeserial=1 build CGO_ENABLED=0 build GOARCH=mipsle build GOOS=linux build GOMIPS=softfloat build vcs=git build vcs.revision=15e31d48a09af0835773bd5c62cedbb3fc0e351d build vcs.time=2024-11-09T01:31:35Z build vcs.modified=false 2C1 rBA  #&'( = $(+035x  #%+/47      % 0 @C OUZ_ iq z     !$, <DGNU[^cim v            ,2:BG SY\^dl v       ' 167? HQU] jpw          & F !$''n            0 >&'''(*28=BFJN   "&&' #&,28>CFGI)C O `fl   !#        8 FLPSZ^bdknux{~            ! $ $ &  3  =  H  U Y ` a e i o t t t y {                         )  7  M  a  q    $(+-.0                 # ( . 3 5 > C J N R V [ [ _ b h l m  |                     .  > A D D E J J J J M N  [  f  v ~                             /  A  O  [ c k s  ~                %.6? K U q       !( 1 > M ] h rz   & 02237; F Y jpqqtuv    %+- ;B TZ djrrv      ',2 JRX acdfflu~       "&*/ D S e s        ' 6:AGKOTZ]]eksx{    "&(/58?DFO Z e           ! , 9 S _b n }      ! 7;CEJQS ^ kt }    ( <E U j v~         % 7 C OSX bhl ~          % 3 B LT a z         ! *37>@FJN )8  ))*++,-.0  ', 5< G [ qv|         #&* ? OT `cddffh s|        "#%%*28=>AAEJOT] ikkmnnrvx        " - : K _efhijlnorsuuuw       " %  / 4  D I L L L L P V ^ b f  o w }                             !! !!! !)!/!8!+@+B+C+H+K+P+W+]+a+d+g+j+k+m+m+m+n+p+r+t+y++ +++ + ++++++++ ++ ,  ,(, 8, A, Q,X,^,`, r,y,~, , ,,,, , , , , ,  - '- C- `- u- - - ----- - -- - - -- . . ,.7. F. Z. j. y.. . .. ...... . . / / / */ 5 T5 ]5a5d5i5m5o5 {5 5555555555 5 5555 555 55555 6 666!6 -63676=6=6A6G6O6S6Y6a6 q6x6|666 66 6 6 6 6  7 77"7)7 77 F7 V7 b7 l7p7w7 7 7 77 7 7 77 7 7 8 8 !8*8/81888>8C8N8 ]8_8 i8l8q8 8 888888 888888 8 9 9 $9 .9 ;9>9A9 L9S9Y9[9  !"#$'().9 99999999999999 9 999999999999999:::: : ":*: 8: W: l:t: : : : :::::: : ::;; ; ;;%; 4;;;?;F;H;L;M;N;R;T;\;d;l;p;t;t;t;x;|;;;;;;;;; ; ;;;; ; ; ; < <<%< 5<8<;<A<C<L< W<Z< f< p<t<x<<<<< < < < < < <======"= ,= 7===C= L= V=X=Y=Y=Z=Z=Z=a=e=g=i=o= z=}= ============== "$&()= !$&+,= !'((()*(>,>->/>1>4>:>=>A>G>H>N>P>T>X>]> j> ~> > >> > > > > >#%&()*,--165? ').0346m? ? ? ?????????? ??? ? @ @@ %@ 2@;@A@G@ S@[@ g@n@ x@ @@ @@ @@@@@ @ @ @ @ A AA !A +A 5A ?AGA RA \A fAnAsAyA{A~AAAAAAAAAA A A AAA A A AAB B B"B"DBKBOBOBRBWB lBuB|B BBBBBBBBBBBBBBB B  C +,011GEGEGJGNG WG kG wG GGGG GGG GG GG GGGG GHHH H'H 1H5H:H>HEHNHSH\HaHeH oHvHHHHHHH &3@MQRTUVXYH I I *I 3I AI NI ZI fI qI I I I I I I IJJ J JJJJ$J(J,J3J4J;JDJIJMJTJYJ_J_JaJeJeJgJkJpJuJyJ~JJJJ JJJJJJJJJJJJJJJJJJJJ J JJJ J K K (K/K2K6K9K>KCKIKOKQKVK[K^KcKjK vK}K KKK KKKKKKKK KKKK KKKKK  L !L 4L =LELMLTL _LfLkLtL|LLLLLLLLLLLLLLLLLLM MMM'M/M 9M EM RM ]M gM rM M M MMMMMMMMM M M M N #N 1N =NCNHNNNVN[N hNnNwN N N NNNNNNN NN NNN N OO $O :O QOUOXOZO\O_O jOnOqOsOxO O O OOOOOOOOOO OOOO OO P P&P 0P6P7P@@` @>`?@?>@@@? ?>@ Q@`   . @@ w``,@3` @u ut ` u ` u @ @ @@@ <` a@5`  ``v`p`us` rr%@s `:qqqp@q@rr@ st p& @t' ttu@uu` s((u6@ @A@ @ @QO^ @P@QPPP@_ Q s vv@v 7 @@s `q `6 @@@@@@@@@s q r @r @ r @J@JJIK `K ' @r @ `( ( /`@42@2`# $5```7     @ HrGrH:` @@HGHs@sR@!WX@Wx@XvW `X@w` ST@@\` @_` B@w@@  `H@`  @`@` @  @ @   @@@y @@0@ @`F @ @`G!"@#$ @@ @@$%@&`!''(@)**@ @II `  @@`K@ @<! ""` @ ``` w%v #@``y@@`O`R`P`Q`<@`   / @ @  ` : ` `/@// ` `3`  `~]]^@^@8gkh;h@h@h  kg `i9@&jk #ii @j`  @ig=` j@j  @g@kl`& @l@b`^_ aa_^`` SS``N`` @ @S23@LK@L@((@'(')`F(`@)`'@; `t t 4L M` @ @@E @ `@wwww @ ``@    @  @@`` ` gb@b baa@aa`b@``@c` x@ @ @#@` @ @@ @`@@+@ @@`J@@@@@@@@@@@@@@,@@`@@@ @@ @@ @@@ @ @ @-@@ @ @` @@@ @@@- @@@@@@@@@ @    @    @    @    @   @@@@@@@@@@` LN M@MMM N` LLN@N@N@@ #: ` `@/ ~ ~@QQ@R @ \`  `"@`{ g`9po ` oy @M@kklcu p@llv @ fn{chd`p !klr s s  m`{ `@mmoiv `~ x m@t q @ y t `u j@dp hj@w @z n b@n @`Hw nb sa`m ~c jr `o `ax fm n@t | @n@`x @z @ o nez ` | | k"@e` @ @gy e `6`?n f@}  p @c! @j@f @bb   ` g` d@q r @h `^ g u ei} o@@i h@od@}{ @g o~ v ~ `r !|  s `~i{ P` @-@`~`   ` @  w@ u` `E  @ ` @@p @q# `!` @@ p 9r@Q`' oo`@pln @|n @@n `ppq  q @i@q n`i@@ol`o@mqmmm]@$`  Z$$ $# 1001/3V @V@@  @ `/.`.@&% V`` ` @ vD@@@C B C@ O4 ``@}@ `@O`+ `] i @_ @ @h `i _i h `l m I`@F_@``j j k l `l @k a@az @\\[[,`--@@     d @l  DEEFDDBCC@CCE@D@EF` |@) @ 0`@ @xx@Ay@y/@ =@@ @  @ @ x@x@ -)@*+= < `o  u w *`*,@-*@, @ ^@n@`3+-v mh x ``w = +w k< ; `< ,> @> `@v u `? @+)"@`,-@`-? `?   @ @3 @ ` ` ` 0@ ` @0 ` 32 @ @ 02 11@ 3@1` 2 3  ` @ @ @2 1 04@@ `` @  @c`% @@5 @TT@T@f` @@ @ Q @t R @@fff@f x @H . @ @  @A @ .@.@ ~ @3` @@2`   ` 13w?@@ `@@2@/@! !@ 0 ` H@ !!@   @`[[\ZY@ZYXWWVXUU@V`STSTRQQPRZ@Z ` @@K`#@ K dd@dd%@@ @%%A @ AA B @Ajc7=@775:=@;;@8<=6;<;888`56@668@=99@ :@<<7 @99@::bL7@ @eeee+j@ c@ @r  @F``F  @Q  @;VWj@ ts@ @@ @ @@c` rq @`Bqj  `   }@    .-  @ @`  @`C @ `` ` @ @ @`  w@ ` o@@  `O^ @ y `   @ M M @ ` ` u @` @ @@@x@y ` `@ @@XX6XYYWXY@W@YW BB @ @B@4 F y ~ 4@y `A 6A z @666 ~ @=x @A4C `@@>z :D `i`B @7>7{ } C =p5:@< C 8`} =`{ ;>B>?E `E 5`z @8B ;o| @4<=9@ B ~ @5} A@q7@? { 879E `??9@D 85:`@9@;;@<@@@@A<@| @:`}} |@|@}|~ ` }{{ ``/| @{`@]@v @]v  @[Z[Z.@`@O@P PP  ` `PQ` < ` sst @ !@tt`] @ N @ @RR @/` B` BF F @G %L {|@D@SSST@TTT`>`8 8v  9 @@` @8` U @U@ ``UrU@ IHFG@GI GD@EEH@DDCCDFEG CH I H G `H EH@HF@ l@F@CO_@_" @@"""`d# @@x@x  @` J @J +` K I @IIg d ^ f ` Yx`f @@]7 e @e ` g @c XY_f @Z d @ d @YZ g ]@^]@ ` @ @ ^x@ y` ] ``[\@\[  o\@^ @]Z@[  `@ [@Y @ @ @Z \$`+ `$`$*@ `%` S&&@&`@N` N`  @t N@~g] `@ s @``_ nR 5 `:`M41@00@1/2@` `$@ @@@ @@@ ` ` @ ` @ 3 @  `  _` ` ^  ^  $@ `00`1``B@B4@ OO3@O{` |@@ L L K@KJL o` x`;`   F ` @ @G` ` @  G` `9 : 7 @8 7 !@ f8 t 9 9 "@"""#@$$$!&%@%%%!&'@&#&@!#$@#v)`)`* &'@'@' ' (@(/.(@,@.(-@).@*+ ))-@-,,` -@+)*,+*+ *.r`@$KLK[ Z Z @Y N @\ LW X T U @V T W @M \ M @L@S R O @P Q N Q SS@b ` S@@VRa @UUR  @TVa b @STUUTT @RVC`` ` c Vu ;Wu  a `` @ ` `    ` `yyzx7   `@}@s `  @J`@u@  `;@y`}}y@ ~@y`P`P3z` @3 `@ B`>``4@~`[?@> 497` ~`@II@~}:`x=@=@x `:u` C `Z j @``4ad`@ ~;y`@z @ L`~`@: O`.  @~} M`EV I`  Nx`K`K@k@v @ `@8@@``L`J ` ```,`V` @w M `ML>:`I@ Q@887 @   @.@.../@//`\Y^Z\`][]@SU@U K`   `b b`b@ @J`` `4453B`}6 @@@ `  `~ } }`N01   }@@  ;> Z[` ` 9`@`c```W Q L` `@I@@@ @7` @6 `J@H@`@`|`{{ c `edGH``N`@:@@`5 _`_`Z`Y^Z\ ]`[]`^MM `@ \ @9@ `  @`URRU`?  &$@!@   @! `!!$""@%@%%%##@#@&@&&@"#'@'"''(@(((@)I`L@L `  ``   ``  G`a8 `O fee e`f` J@@:@ ` @`   ` `C`@@@ A`AAA B`B` C?B?@44@53`C@NXX`@66````I@`E@W [VV@DbYF`F ^W FD@K~@3@@ @ @@@`7`@    `  3Jc ` `V`@N@OOQ7@@00 @11@22 `0`2 2`18W9:@R`  ` `@R:  @H  ``~> ?<;= >< =`==`< <`;;@  ` `@  `  ` @@@@@@```` ~@? w` B @t;@tE w V @9 @=  @F *qp@? @r+@r+@ *  `|& @Gi `C@;  [ E % #@`, 0/ `h `$   <` `` : 88::;@<==>9@8@:;;<@=>>8 ` ) 2@7      `     00 1`19:3`@@`@??@;<-@`@@9 ``` @@   `  ", `@=@>`(@``    `   <*`@ `-@@@B@`@$`@ ` `    6@``` @3` @@9` `B/`..@DD` ``7@7@(@ &`'`%%%`@   !! ``  `  #`##`"` `!`   @` @@@A/@.,**++@*`, `@ 1`2` @2 (AE`BA@/D B Cq A/ + @0 2 3 9 @7 @8 5 @ : 1 @? 1 ` @)`b 1` `% `* * ` @ ` & M`N NX `@ 0 ? > `<   @ C `` ` N O O @`A R N Q M  & `@j @j @k @ @k `@8 @,@ 3 @ 4 4@l r ` @       ``} }?`@ / : @ 6 7 8 9 @ @ `@EC@`q p q `p t @9@9@@$ $r @ ; @; @< @ 6 4 5 ud   K`W @ KW L`X @ `JV z@y" # O `/  `! 8H I @B G D `& R E P g ` `` ``d y < `@ zg `2 @ @GU  `U  U @ @ @ J ? = = @ > > @   s `(E  +r @ &` $#@#n` S@ ` R`w@`@+@`@s  ` @< B `G G `t @(  ) Z% v  ` 5 e ``j k k l c W X X W a L f `  @u @ @ @ @ i j @i @h h g D D`@@ @ ` `O u ` ! t G @  `   `c   V @ `o `R  ` `I c R % ` Q P P % @ 7  [ F a `\  R @ 9 : `@: `p ' 'o  ( ` ?  ? @ N : ; or@@pk *  H !  `  `$jkj@   @ ^ _ `@ % @ @X C J F @J B @C B I @I H @ |`1 @ T @W ^ W X @Z @[ ^ \ @ @ @ @ @ @ @ @ @ _ @` @a a b b @b @c c d @d @e R S @S `  ` ` ` & & `& % @ % % `%  @ @`  @ @C C C K e @ e T \ U U W _ X X @ Y  @Y Y Z [ @^ @\ W ] @_ _ \ ` ` a a c b Z c U d V @V d e @ ` @] V V Y ` Z @   @ ] @  @ @ @   ! `  ! ! " ` `" ] @ @ @ @ f S $  ! @ @ [ `S  ` `     ` `   ` [ `! @ @  ^ `  @ M ? AA @8  @`)  `q`` @  4 5`"4`5+' @ @ 3  =`@6u @ @`   @ @6M @7o ``n  `   @9 `M 9 @) ` `P  `b@d@8@cic^@a_@i_aec`age ` `  C` l 8@ `> `( ` ` O ` L h) 6  @+   C`@* n  L ` %  `@ 9E`@ g@K  @ `  `> `f ) `) @ ` J `DD   @ @ @ h d )s@  | x @ |@x x @ &m@l m` `8 D`  d @@ v @v @t `-v ` `'  @@@` < ` = `@= C < @` @ ZU V  WV= @45 `O`5 @ ? `@` (4q n@qlb F `H a F @ H %` E G G )p( ,@G H l` m '@m(`n*b @o s b c n@@H -@D D `#`+ *`*@I I H `/1 3`20/ /`_ `3` @@`@bhb````@?` !@ff@g^ l `m \ m  `^ `]]^@^ ]@cb@^@]^@_@e_g\ \ "@``#ff` ` deC @w6C @7 @` ,`$D     `5 `  6 `  ( `-  x x u`e v@O   `Y  `V  @ @ 0 0 0 2 2 `2 `1 ' `0 4  $ 7 / M . `. ` @ 1 . - 2 K 3 `3 3 ` `# 1 1 m m ( ' `!  . - 3 7 4 `4 4 @@R"@w`@ ````d v@x  `k  "@H @g `6 R  < '  ( # # @ v` @Y @7 - + } `R @ `Q Q Q Z ` A @  @ `Z @ @@  @ @@ u @ g / @@  0 2 3 9 7 8 5 @: 1 ? 0 / @@2 @3 8 @9 @6 6 7 8 w  ; ; < @5 @4 4 " : @1 > `O < @= = @> Y  Z @ N @ O Z     `] ] \ `\\K `@@ _ % p ``x`# ` @jr q t |   H <@ @$ @ H`N ; @ `   @ *    &@E `   `@  @ Y    `'' (&l`&'@a @ @@  ` @   @ @ @ ` . @y  `    M  `+ + @v v v h `  `  * N @h P , - `- @ ) D y v N `  `    `      q @q E  u m   @D  i  t @  B @B  j j k @k k k l @l l l ` F K I J M F G L L `K K L `L J `J | z @{ @p  @| @ } @  ~  @ | } @ } { @~ q ~ @ y y z i ` @z @j  h @ + ` `! ! ! " @} @A `   N @g `(  @  -  e `,   i   g ` `"  z  e & #  ` " # `# # " `$ O `P `   $  ` @E @/  @w ` `N  @m m m n @n n n o @o o ( @f ~ u I  w @U w f | , P ` @i j @ ` g A B   P Q  ` `    ' f s  J `F `M / `Q Q D f ` ,   @%u b c b < u `b ``< v v@ ` `u A`UB x @y `w _^x ` G l I M @z 0y { f`#z #R @ @"F `B !@0@d ee,e c X  f ; O |   mMW   ' > V n )c(q`)(43Q4 '-,~M-s----.G.p....#/H/o////0=0h0v'0001-1[11112A2i2222&ow44^5545-5(`2`_`))()!*U'+>. bN~v%*+<,i,+/)a `Da__cbaUAABA Alff[ zJIDB')n(ICJJKC,^M4+JbL UcP(I[ U666".J06'(]oOS v?(FLM[ E'QN"+^ y|Ob4AlFc: $ s\[&Oy>(W'&&%*m( 6y#C,Ed(  8)*_9,bb3^ba]] x \3' (MG* ɰЫ^>%C;C,_(()+[ + *!(,i,+ +>. bNq~v%~ov'*<,##9#7+]%j", 0U,#"P"! Z+o%,%g#F%!!()+ 9b%&>"+H&u % >b  ?+ ) ) ( > ))e ) ) () /  )[ L /  )l x  )@@UAA Al +>. bNq~v%~ov'*+<,i,+&ABU'&B AA9 [ BA x jAABAB>A !@S>/BTBsBg#9###''G'' (`'&F(')n(&&%5(0)]%j"+,#"P",%U,7+L Z++">;!!n@n?o%F%!+>;*bF=$&6"u  >b  == %@@) x 0C[ _n  6y#~oC,Ed  8&9 pN&CT`k L~ <*{KN) [ x  ))r#0=W~Ie))[ 6Iaq,&#) &))[    F )0E)[ b w0)){> V[ )))"2l x H&F&F[ W)k[ l ) &k),  F  [ )7 [ KZq)JI*I DU'~oB'v')n(UA+>. bNq~v%+<,i,+ACJJ&KC,[  .J=JBA SJiJ> BAA&AA @AB!@AS>/BTBsBKx I6IdI 9zJ6 JKK'm( 6y#C,Ed(  08)* (G*fKLKKJJI"J'G''(`'&F(&&%5(0)KDnDC-KKIuH,CB&KZq #F_&xCsGGGF|&L :kC)+[Cn&KKGHB$,H&L?+j& 1 N)|"qK) F) )C* x n 6 Y[ U)o[  ~ nF6)[ # )0[ <)L[ j)  )nX - P*~)P]n[  6y#~oC,Ed x   )5'&&%'G'&~oU'' x '(`'&F('v')n(5(0) [ 'm( 6y#C,Ed(  0 8)*''' S)3*C) (G*^)*'*(W(}(u)((((*))')))())) **[*s*PL Kq|& )q x "~ [   6y#~oCn,Ed 08&KZqI|a) =)~. >b Nqv[ x I#& ~))>. b Nq~v"~o [ K&H&)% )Jn>b [ )2 Jn Q u  >b  [ ) e!0![ )![ u  ! >b  !% e!0!)!!!&w)"6"2 JnP">. b Nq~vu  >b  [ )j">. b Nq~v"[ )"" "[ )#)9#>. b Nq~vg##~o#"[ )#[ #>. b Nq~v"P"! g#9##~o2 Jnj"u  >b  #"!%!6")# e!{$($O$$ [ 0!)$ $$ %>. bNq~v[ %L n~o  6y#C,Ed 0),% &# e!{$($O$"[ $)F% o%[ ]%>. bNq~vj"%%)%)%~o>. b Nq~v %)[ %)%%% )&%/&% %&H& [ &q )_&|&n&&&&KqZ )&[ ~o / )&)' x )*[ #KZqqH& )* *w&)+ +[ )[ )+0~o ?+Lkn 6y#C,Ed  8KZqTj)Z+ +n+[ ), C &~o,),[ ~q"K,oa&,F  6y#Cn,Ed 08H&N),[ , ),[ , -)'-[ ,~M-s----.G.p....#/H/o////0=0h0v'0001-1[11112A2i2222q  6y#oCn,Ed 08&,,- "a|&_&%,) 3'3C3q~F)`3"[ q3v3C3'3 3 40~o #)+*F)33~(43'-Q4 ,M-s----.G.p....#/H/o////0=0h0v'0001-1[11112A2i2222&ow44^5545-5 3q|&9  6y#Cn,Ed 08v3C3'3 3"`34)+L  &)5)6  6y#~oCn,Ed 08 x qF)6D66  6y#~oCn,Ed 085 )6"6 6 x 6l 667 K,q&Fq, [ #arH&N)&7)R7k7757777&_&|&)88777 x 77k77FR7KZq)+8A8"qZ8 87877 r8688)8[ 8~o6",a&A8q)9/9n9 J::]9C9Bo9::~ o:_&k&;))?;;"x;[ |&&6,aq~ov'H&&););&w) <?<<[ ks<) =<k)F=[ ==< = <k?<s<)>)+> ;[ )S>!  !!F=[ k)>p>>>?. bNq~v%*+<,i,+A)DE)PE[ ED)GEEVFFF F!F k)sGGGNGPEHGDFVFF Eq)GHuH(sGC) I[ H x  H6IdI )I[ ,q)I*v'sGGG(9[ )Iv''&&%U' (n('*')~om( 6y#C,Ed(&  0 8)*'G*zJIDBUA+>. bNq~v%*+<,i,+AICJJKC,)L),L[L)L[ 0~o LL)+n.J L 87877[LF|&q6&C# `)MzM >M)M87877 9,`0 )+ 6y#~oCn,Ed 8q|&&L)M!N8 M|&)fN)NNfNq&)QQ ONNOq3O|&Q)ONN3Oq)cO NNFq  6y#~oCn,Ed 0887877[ )O[ ONcO NOq):PPNNq&)P[ PONNnP P:Pq)nP P:PNNFq  6y#~oCn,Ed 08[ )Q"ON>QeQOPNOq|&,[ )Q)RQ6ONeQ Q)R TRsR87877RR"~oS%S ESShS,q&50[ a,   6y#Cn,Ed 8H& )STRS8%SR ESS~oR"R|&)[T6WU)TT, ~T87877"T%Uq9JIDU'oB'v')n(UA+>. bN~v%*+<,i,+AIC&KJC,J5|&H&)U[T)TT, ~T87877U8|&)#V)bV)VV)*WaWWWXV bV)IX*WaWX x bV)XX"~oYZY)YWY YIX*WaWWX )ZL 5bVFn&V#Wa&qH&)jZ)Z"Z~oZ87877 [P[ [0[q[[\'\I\ [[ qF#a&|&H&)l\Z)\'- ,~M-s----.G.p....#/H/o////0=0h0v'0001-1[11112A2i2222\\L0oTR>M M; #]  6y#Cn,Ed 8q",,?;L)+8 [ L9 x 6l\#VjZRSU[T)TTT87877MD68jL)R] x  qx]L )]] x ~oa,)]] x ])W^~ {^3^)_~o^ x _2` `_`Da _]]-_V_`[ ^]`aW^{^ ,R]6]"q#6`& ,a)ta[ 2``~o_ `_]] x ^V_baaa `Da_cbb3^bzJIDU'B'v')n(UA+>. bNq~v%*+<,i,+AICJJ&KC,a 0  6y#C,Ed 8=bcbba 63cR]]F666",W^{^|&)+& j)Uc&) dKdc c=W k)d[ dc dKd~o Peeyfff kq$c)5g~) i~oUi5g}ghxhghU'q'v'&&%*n(,9)\A&~olff UA+>. bNq~v%v'*+<,i,+AdU'i5g iUi}ghxhg)i~o5g,9q)i, :jj~ojyfWkq$k9  6y#Cn,Ed 086)k l)۞I DU'~oB'v')n(UA+>. bNq~v%*+<,i,+AklUck,&C)lXlU'yfdq@)m[ Soyfopm~d&nnndeikmPe. bNq~v%~ov'*+<,i,+A U'3A& APe) ;[ )nʄ.dUA+ >. bNq~v%~ov'*+<,i,+AePeowyfff&&%&U'BA ABA&AA @AB! @AS>/BTBsBdjopimm [ `zG'*n( >!$lkL lXl3<̂B)n x ̉U' 'm( 6y#~oC,Ed(&  0 8)(* (G*'v'&&%*')[ 'S)XVtŋk,?/9]99&:)b)g[ 0v'Y tU' 'S)b<e~o 'm( 6y#Cn,Ed(&  0 8)(*);'&&% ('*kqX9:)[ v' tU''S)b~o '&&% (n('*')kqm( 6y#C,Ed(&  0 8)*ŋX9:)-dƓXlݒyfU'~o &&%iA&lff UA+>. bNq~v%v'*+<,i,+AdowopemmjPe(~ʔՙuq̚6v!s3a x :jsݑ7̗jјn}r pGkm#Ж WkSo&nXrropsjuugBA 6|.c dKd[ . w['*n(m( 6y#C,Ed(  08)*xVv(9J:/9 t;'S)b0,9L k;>$wq 6vt QtujHn. bNq~v%v'*+<,i,+AdU'nB 0/ ʨIIDB')n(CJJKC,Pdowyf&&%opeimmjPeJCzJBA ~ݒ GXl(j xk:DnD}B'*m( 6y#C,Ed(  08)*fKKLKK(G'L :&liJ x .,CK NCK)" qO)~87877 )ҩ) I*IDU'~oB'v')n(UA+>. bNq~v%+<,i,+ACJJ&KC,BA zJBAA&AA @AB! @AS>/BTBsB6x J,'SJBҩ+iJ> K  6y#C,Ed 08,CKGHK))T)l)U'~o+ >. bNq~v%v'*+<,i,+A&lffUAAd` T~(Uc'&&%*n(m( 6y#C,Ed(  08)*BAdowyfopeimmjPeʨ)U'~oЫ  )~U'oJI*I DB'v')n(UA+>. bNq~v%+<,i,+ACJJ&KC,K(SJ iJ> BA BAA&AA @AB! @AS>/BTBsBK)Ȭ[ U'~oq'v'&&% (n(I )MU'~o'v'&&% (n(m( 6y#C,Ed(&  0 8)*G*k[ '()U'~o'm( 6y#Cn,Ed(&  0 8)(*v'&&%*Э/9:]99q()J[  ".w x al q  6y#~oCn,Ed 08,k)[ U''v'&&% (n('*~om( 6y#C,Ed(&  0 8)*G*^ &k(65')U'~o ^'m( 6y#Cn,Ed(&  08)(*v'&&%*k()k-U'~o'm( 6y#Cn,Ed(&  0 8)(* (G*v'&&%{'*q( &'()ɰU'~o'v'&&% (n( '*m( 6y#C,Ed(&  0 )&~oIk ))Q&~o$_U'L )?ݳv'k  6y#~oCn,Ed 0 8]9*-~ [ q6/9:&:)v'[ \?  6y#~oCn,Ed 0 8]9*δS)'׶"s-^&&%Ek U'q' ((ݳ ~5C&6%:/9)E x y U'~o_$[ ) E)xy U'~o&&%'v')n(' ('*Q(kE&)[ &&%BY+v'k)&~o&&%'v'U')n(' ('*'G'' x (`'&F(5(0)Qy þ_'[ )p3 _/9nQ]9'S)U'&&%'v')(' ('*[ )þy U'~o&&%'v')n(' ('*) [  E  6y#~oCn,Ed 08CC _pN&&09)+X&:L LH&?+j)U'~oy &&%'v')n(' ('*þ J:m( 6y#C,Ed(&  08)*G*(*]9:9:QL k)  6y#~oCn,Ed 08CC _pN&&9)0&&%kv'kn&q _&F[ 1H& )nQ0$&~o y U'&&%'v')(' ('*u þr+  6y#C,Ed 08;δS)'׶s^5?n&kB[ _/9Bo]9:nL E CC_pN&0k|&m(()*G*'p()a `_`~oDa _2`_cba&U'&&%'v')n(' ('*y Q'S);r$)[ #|&qH&)P  6y#~oCn,Ed 0 8k)[ P))(v?q#& )v[?()Nq")v?( )\v?(9q  6y#~oCn,Ed 08  ))v?()8v?(s)%q"v?(P)e #>a&Pq )v?(q&#a)N\v(?q M x %"[n& )v?(\e>[&qs8)"v?(&N\q M H& )Uv"(?[\LM SF NGl \Nq M D~onD n&kD6&P|&8)H&& )v"\(?N q M SFLM[ \H& )O"v?( SFLM[ )Sv'87877 OS "v?(FLM[ q[ n&)[ )&)&)& [ )=&)OS "v?(FLM[ ~oUAAU'o +>. bNq~v%v'*+<,i,+&BA (+JIIDB')n(CJJKC,SJiJ> BAA&AA @AB! @AS>/BTBsBK666=&  6y#C,Ed 08(B+[ )g[ /k)U'~o _'m( 6y#Cn,Ed(&  0 8)(*v'&&%*g())v'U'C~o x [ '&&%*n(m( 6y#C,Ed(&  0 8)*L ('))[ IIU'~o*IDB'v')n(UA+>. bNq~v%+<,i,+ACJJ&KC, J6 zJuH,CiJB-KL xCSJ( > BA BAA&AA @AB!@AS>/BTBsBK )~o x  878774^6&JI*IDU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC,a `_`Da_2`_cba "N>]%#"P"! #$6;L  b)y  6y#~oCn,Ed 08V&^N"2`++>. bNq~v%v'*+<,i,6JIIDU'B')(UAACJJKC,a `_`Da__cba QBA +|zJ]] x ^`b"^87877 (H*LOb #'6:BAA&AA @AB!@AS>/BTBsBBfKKLKK+7(9`)+6[ 'G''`'&F(&&%5(0)Y>]%j"+,#"P",%U,L SJiJ> K66"$n&&cb|&V_6"u )|JI*I DU'~oB'v')n(UA+>. bNq~v%+<,i,+ACJJ&KC,a `_`Da_2`_cba ^6"N > #"P"! $U,%7B|&bL n&) +%>. bNq~v~ov'*+<,i,+[  $+]%#"P"! &)Y&,q&)) >. bNq~vLq(U'H* ~o'm( 6y#Cn,Ed(&  08)(*v'&&%*=UAA+%*+<,i,+BA x a0]%#"P"! ,%Lz"m''G''(`'&F(')5(0)j" t'S)b;&k%;Z+>"[ n&B,/9#)+"|&$,(*F%#6"u  >bNH&jL?+ )O&~oq)O&~ob 4I*I DU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC,6J66"6 C)O&~o *II DU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC,J5G'' x '(`'&F(&&%5(0)')AO&~o I*I DU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC,J666"6 )lO&~o6I*I DU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC,J566)qFL #&)FO&~oJI*I DU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC, 87877666")]%>. b Nq~vj"v~o *IIDU'B'v')n(UA+%+<,i,+ACJJ&KC,J5xC6[ )&~o*&v II DU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC,JK SJ6[ >$6)t"~o*&q))~6  6y#oCn,Ed 0887877JI*IDU'B'v')(UA+>. bNq~v%+<,i,+ACJJ&KC, ZL  iJ)s&~oJI DU'B'v')n(UA+>. bNq~v%*+<,i,+AICKJC,J $ \[&Oy>(WtSJiJ> BA BAA&AA @AB!@AS>/BTBsBK''G'' x (`'&F(&&%5(0)6[ 6)cO&~o:JI*I DU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC, $ s\[&Oy>(Wv &)'~oU''G'&' x (`'&F('v')n(&&%5(0)[ UAA+ >. bNq~v%*+<,i,+BA Alff[ zJIDBICJJKC,'m( 6y#C,Ed(  08)**T~ddowyfopeimmjPe~ݒ GXl(+L \nB 0/ʨOUc. ()]U'JI*I D~oB'v')n(UA+>. bNq~v%+<,i,+ACJJ&KC,[ SJ iJ> BA BAA&AA @AB! @AS>/BTBsBK66  6y#C,Ed 08CC_pN&&)4zJI DU'~oB)i[ JI*I DU'~oB'v')n(UA+>. bNq~v%+<,i,+ACJJ&KC,5( Zk&5)PU'~o $)k)[ MU'~ov'OS "v?(FLM[ JI*I DB')n(UA+>. bNq~v%+<,i,+ACJJ&KC,5(BA ''G'' x (`'&F(&&%0)(H*LT~U'm( 6y#C,Ed(  08)**^Ek&BAA&AA @AB! @AS>/BTBsBB'S) (SJiJ> K1S()b>. b Nq~v)>. b Nq~v)=k[ )b ){>. bNq~vbk"&$[ ) k[ )G[ q>)o2%Gk[ >. b Nq~vb ) ik) Xo2&$[ )`)=a9)A)A `X 1 k$=)~  `X [ )   {~  `X$[ )G A ) ` q  k$=)  ) ` q  [ )  K X  ) ` q $[ ) )  % 7[  )8  Ak)j [   k)2 8 A)z`A4k)z`O 4))z`O $)_z` 4))*_z` $)iz` 4)>i)}>iz` $)l.k)Jk )|">. b Nq~vP"[ }*lJ$2 ) >. b Nq~vO~o"[ )DH1wKnP4$l)V>. b Nq~v"P" >b6")%[  %^ + ">. bNq~vP" lJ ~oV}$kO!< )[  x zJIDU'~oB'v')n(UA+>. bNq~v%*+<,i,+AICJJ&KC,k)[ !!) x b![ !& ~o!)e" " ""4""0k)b&J### #l +>. bNq~v%~ov'*+<,i,+ #U'&U%%$)& $*$=[ x %& m$!  >O''G'' (`'&F(')n(&&%5(0)%%"6$K%$k "|&>;"  6y#C,Ed 081 ]%j"+,#"P",%U,7+L Z++!!o%F%&6, !b!!;*b6"u  >b  %< )k'&  ''n&l[ O >. bNq~v~o!>k)'A~olff &T~* ')&##*$(IIDU'B'v')n(UA+>. bNq~v%+<,i,+ACJJKC,)'(A~olff &[ zJIDU'B'v')n(UA+>. bNq~v%*+<,i,+AICJJKC, &666"Kq6, )S*internal/abi/abi.gointernal/abi/type.gointernal/cpu/cpu.goruntime/internal/math/math.gointernal/bytealg/compare_mipsx.sinternal/bytealg/equal_mipsx.sinternal/bytealg/indexbyte_mipsx.sinternal/chacha8rand/chacha8.gointernal/byteorder/byteorder.gointernal/chacha8rand/chacha8_generic.gointernal/chacha8rand/chacha8_stub.sruntime/float.goruntime/iface.goruntime/netpoll.goruntime/signal_unix.goruntime/os_linux_mipsx.goruntime/select.goruntime/alg.goruntime/typekind.goruntime/stubs.goruntime/arena.goruntime/mheap.gointernal/runtime/atomic/types.goruntime/lockrank_off.goruntime/lock_futex.goruntime/cgocall.goruntime/chan.goruntime/time_nofake.goruntime/proc.goruntime/runtime2.goruntime/cpuprof.goruntime/debug.goruntime/env_posix.goruntime/error.goruntime/symtab.goruntime/traceback.goruntime/extern.goruntime/fds_unix.goruntime/hash32.goruntime/histogram.goruntime/metrics.goruntime/atomic_pointer.goruntime/type.gointernal/abi/switch.goruntime/rand.goruntime/lfstack.goruntime/tagptr_32bit.goruntime/lockrank.goruntime/malloc.goruntime/mem_linux.goruntime/mfixalloc.goruntime/mem.goruntime/mcache.goruntime/fastlog2.goruntime/runtime1.goruntime/map.goruntime/msize.goruntime/map_fast32.goruntime/map_fast64.goruntime/map_faststr.goruntime/mbarrier.goruntime/mbitmap.goruntime/mwbbuf.goruntime/internal/sys/intrinsics.goruntime/mcentral.goruntime/mgcsweep.goruntime/traceruntime.goruntime/mcheckmark.goruntime/os_linux.goruntime/mfinal.goruntime/mgc.goruntime/mstats.goruntime/sema.goruntime/mgcwork.goruntime/mprof.goruntime/print.goruntime/mgcpacer.goruntime/mgcmark.goruntime/mgclimit.goruntime/stack.goruntime/mgcstack.goruntime/string.goruntime/mgcscavenge.goruntime/time.goruntime/mranges.goruntime/mpagealloc.goruntime/mpallocbits.goruntime/mpagecache.goruntime/mpagealloc_32bit.goruntime/mspanset.goruntime/netpoll_epoll.gointernal/runtime/syscall/syscall_linux.goruntime/defs_linux_mipsx.goruntime/sigaction.goruntime/panic.gointernal/stringslite/strings.goruntime/panic32.goruntime/pinner.goruntime/preempt.goruntime/symtabinl.goruntime/write_err.goruntime/runtime.goruntime/stubs2.goruntime/rwmutex.goruntime/security_unix.goruntime/trace.goruntime/profbuf.goruntime/retry.goruntime/signal_linux_mipsx.goruntime/signal_mipsx.goruntime/sigqueue.goruntime/slice.goruntime/softfloat64.goruntime/stkframe.goruntime/sys_mipsx.goruntime/tracebuf.goruntime/tracestatus.goruntime/traceallocfree.goruntime/traceevent.goruntime/tracetime.goruntime/tracecpu.goruntime/traceexp.goruntime/tracemap.goruntime/traceregion.goruntime/tracestack.goruntime/tracestring.goruntime/tracetype.goruntime/unsafe.goruntime/utf8.goruntime/vlrt.goruntime/timestub.goruntime/asm.sruntime/asm_mipsx.sruntime/atomic_mipsx.sruntime/memclr_mipsx.sruntime/memmove_mipsx.sruntime/preempt_mipsx.sruntime/rt0_linux_mipsx.sruntime/sys_linux_mipsx.sruntime/tls_mipsx.ssync/atomic/type.gosync/atomic/value.gosync/atomic/asm.sinternal/runtime/atomic/atomic_mipsx.gointernal/runtime/atomic/unaligned.gointernal/runtime/atomic/atomic_mipsx.sinternal/runtime/syscall/asm_linux_mipsx.sinternal/bytealg/index_generic.gointernal/bytealg/bytealg.gointernal/runtime/exithook/hooks.gointernal/reflectlite/swapper.gointernal/reflectlite/value.gointernal/reflectlite/type.goerrors/wrap.goerrors/errors.gosync/map.gosync/cond.gosync/mutex.gosync/once.gosync/pool.gosync/poolqueue.gosync/runtime.gosync/rwmutex.gosync/waitgroup.goio/io.goio/multi.goio/pipe.gomath/bits/bits.gomath/bits.gomath/cbrt.gomath/exp.gomath/ldexp.gomath/floor.gomath/modf.gomath/abs.gomath/frexp.gomath/copysign.gomath/log.gomath/log10.gomath/pow.gomath/signbit.gomath/sqrt.gounicode/utf8/utf8.gostrconv/atof.gostrconv/atoi.gostrconv/quote.gostrconv/itoa.gostrconv/decimal.gostrconv/eisel_lemire.gostrconv/ftoa.gostrconv/ftoaryu.gostrconv/bytealg.gocrypto/crypto.gounicode/tables.gounicode/graphic.gounicode/letter.gobytes/buffer.gobytes/bytes.gointernal/bytealg/count_generic.gobytes/reader.gocrypto/subtle/xor.gocrypto/subtle/xor_generic.gocrypto/cipher/cbc.gocrypto/internal/alias/alias.gocrypto/cipher/ctr.gocrypto/cipher/gcm.gocrypto/subtle/constant_time.gocrypto/cipher/io.gocrypto/internal/boring/sig/sig_other.scrypto/internal/boring/notboring.gocrypto/sha256/sha256.gocrypto/sha256/sha256block_generic.gocrypto/sha256/sha256block.goiter/iter.gointernal/itoa/itoa.goreflect/type.goreflect/value.goreflect/abi.goreflect/deepequal.gointernal/bytealg/equal_generic.goreflect/iter.goreflect/makefunc.gounicode/digit.goreflect/asm_mipsx.sencoding/binary/binary.goencoding/base64/base64.goslices/slices.gostrings/builder.gostrings/reader.gostrings/replace.gostrings/strings.gostrings/search.gointernal/bytealg/lastindexbyte_generic.goencoding/pem/pem.goslices/sort.goslices/zsortordered.gocmp/cmp.gointernal/fmtsort/sort.goslices/zsortanyfunc.gointernal/bisect/bisect.gointernal/godebug/godebug.gointernal/godebugs/table.gosyscall/env_unix.gosyscall/syscall_linux.gosyscall/netlink_linux.gosyscall/exec_linux.gosyscall/forkpipe2.gosyscall/syscall_unix.gosyscall/exec_unix.gosyscall/syscall.gosyscall/flock_linux_32bit.gosyscall/rlimit.gosyscall/sockcmsg_unix.gosyscall/sockcmsg_unix_other.gosyscall/zsyscall_linux_mipsle.gosyscall/syscall_linux_mipsx.gosyscall/asm_linux_mipsx.stime/format.gotime/time.gotime/format_rfc3339.gotime/sleep.gotime/sys_unix.gotime/tick.gotime/zoneinfo.gotime/zoneinfo_read.gotime/zoneinfo_goroot.gotime/zoneinfo_unix.gopath/path.goio/fs/fs.goio/fs/format.gointernal/filepathlite/path.gointernal/filepathlite/path_unix.gointernal/testlog/exit.gointernal/testlog/log.gointernal/syscall/unix/at.gointernal/syscall/unix/copy_file_range_linux.gointernal/syscall/unix/fcntl_unix.gointernal/syscall/unix/getrandom.gointernal/syscall/unix/kernel_version_linux.gointernal/syscall/unix/pidfd_linux.gointernal/poll/copy_file_range_linux.gosync/oncefunc.gointernal/poll/fd.gointernal/poll/sendfile.gointernal/poll/fd_mutex.gointernal/poll/fd_fsync_posix.gointernal/poll/fd_posix.gointernal/poll/errno_unix.gointernal/poll/fd_poll_runtime.gointernal/poll/fd_unix.gointernal/poll/fd_unixjs.gointernal/poll/fd_writev_unix.gointernal/poll/sendfile_linux.gointernal/poll/sock_cloexec.gointernal/poll/sockopt.gointernal/poll/sockopt_linux.gointernal/poll/sockopt_unix.gointernal/poll/sockoptip.gointernal/poll/splice_linux.gointernal/poll/writev.goos/error.goos/file.goos/pidfd_linux.goos/dir_unix.goos/dir.goos/file_posix.goos/dirent_linux.goos/env.goos/exec.goos/exec_linux.goos/exec_posix.goos/exec_unix.goos/file_unix.gointernal/syscall/execenv/execenv_default.goos/executable_procfs.goos/rawconn.goos/file_open_unix.gosyscall/timestruct.goos/types.goos/types_unix.gointernal/syscall/unix/nonblocking_unix.goos/getwd.goos/path.goos/path_unix.gointernal/syscall/unix/siginfo_linux.goos/pipe2_unix.goos/proc.goos/removeall_at.goos/stat.goos/stat_linux.goos/stat_unix.goos/sys.goos/sys_linux.goos/tempfile.goos/wait_waitid.goos/zero_copy_linux.gointernal/bytealg/compare_native.gofmt/print.gofmt/scan.gofmt/errors.gofmt/format.gomath/rand/exp.gomath/rand/rand.gomath/rand/normal.gomath/rand/rng.gomath/big/accuracy_string.gomath/big/arith.gomath/big/float.gomath/big/nat.gomath/big/int.gomath/big/intconv.gomath/big/natconv.gomath/big/intmarsh.gomath/big/natdiv.gomath/big/prime.gomath/big/arith_mipsx.sunicode/utf16/utf16.goencoding/asn1/asn1.goencoding/asn1/common.goencoding/asn1/marshal.gocrypto/internal/randutil/randutil.gocrypto/internal/nistec/fiat/p224.gocrypto/internal/nistec/fiat/p224_fiat64.gocrypto/internal/nistec/fiat/p224_invert.gocrypto/internal/nistec/fiat/p256.gocrypto/internal/nistec/fiat/p256_fiat64.gocrypto/internal/nistec/fiat/p256_invert.gocrypto/internal/nistec/fiat/p384.gocrypto/internal/nistec/fiat/p384_fiat64.gocrypto/internal/nistec/fiat/p384_invert.gocrypto/internal/nistec/fiat/p521.gocrypto/internal/nistec/fiat/p521_fiat64.gocrypto/internal/nistec/fiat/p521_invert.gocrypto/internal/nistec/p224.gocrypto/internal/nistec/p224_sqrt.gocrypto/internal/nistec/p256.gocrypto/internal/nistec/p384.gocrypto/internal/nistec/p521.gocrypto/internal/edwards25519/field/fe.gocrypto/internal/edwards25519/field/fe_arm64_noasm.gocrypto/internal/edwards25519/field/fe_amd64_noasm.gocrypto/internal/edwards25519/field/fe_generic.gocrypto/ecdh/ecdh.gocrypto/ecdh/nist.gocrypto/ecdh/x25519.gocrypto/aes/block.gocrypto/aes/cipher.gocrypto/aes/cipher_generic.gocrypto/elliptic/elliptic.gocrypto/elliptic/nistec.gocrypto/elliptic/params.gocrypto/internal/bigmod/nat.gocrypto/internal/bigmod/nat_noasm.gocrypto/sha512/sha512.gocrypto/sha512/sha512block_generic.gocrypto/sha512/sha512block.govendor/golang.org/x/crypto/cryptobyte/asn1/asn1.govendor/golang.org/x/crypto/cryptobyte/asn1.govendor/golang.org/x/crypto/cryptobyte/builder.govendor/golang.org/x/crypto/cryptobyte/string.gocrypto/ecdsa/ecdsa_legacy.gocrypto/ecdsa/ecdsa.gocrypto/internal/edwards25519/edwards25519.gocrypto/internal/edwards25519/scalar.gocrypto/internal/edwards25519/scalar_fiat.gocrypto/internal/edwards25519/scalarmult.gocrypto/internal/edwards25519/tables.gocrypto/rand/rand.gocrypto/rand/rand_getrandom.gocrypto/rand/rand_unix.gocrypto/rand/util.gocrypto/ed25519/ed25519.gocrypto/rsa/pkcs1v15.gocrypto/rsa/rsa.gocrypto/rsa/pss.goencoding/hex/hex.gocrypto/x509/pkix/pkix.gomath/rand/v2/rand.gounique/handle.gounique/clone.gointernal/concurrent/hashtriemap.gonet/netip/netip.gonet/netip/uint128.gointernal/weak/pointer.gointernal/abi/escape.gosort/search.gosort/slice.gosort/sort.gosort/sort_impl_go121.gosort/zsortfunc.gosort/zsortinterface.gocontext/context.govendor/golang.org/x/net/dns/dnsmessage/message.gointernal/singleflight/singleflight.gonet/addrselect.gonet/lookup.gonet/net.gonet/dnsclient_unix.gonet/ip.gonet/interface.gonet/hook.gonet/hook_unix.gonet/conf.gonet/parse.gonet/dial.gonet/iprawsock.gonet/tcpsock.gonet/udpsock.gonet/unixsock.gonet/ipsock.gonet/tcpsock_posix.gonet/dnsclient.gonet/dnsconfig.gonet/dnsconfig_unix.gonet/fd_posix.gonet/error_posix.gonet/fd_unix.gonet/sockaddr_posix.gonet/file.gonet/file_unix.gonet/hosts.gonet/interface_linux.gonet/rawconn.gonet/iprawsock_posix.gonet/ipsock_posix.gonet/lookup_unix.gonet/cgo_stub.gonet/mac.gonet/mptcpsock_linux.gonet/error_unix.gonet/nss.gonet/pipe.gonet/port.gonet/port_unix.gonet/sendfile_linux.gonet/sock_cloexec.gonet/sock_linux.gonet/sock_posix.gonet/sockopt_linux.gonet/sockopt_posix.gonet/splice_linux.gonet/tcpsock_unix.gonet/tcpsockopt_posix.gonet/tcpsockopt_unix.gonet/udpsock_posix.gonet/unixsock_posix.gonet/writev_unix.gonet/url/url.gocrypto/des/block.gocrypto/des/cipher.gocrypto/md5/md5.gocrypto/md5/md5block.gopath/filepath/path.gopath/filepath/path_unix.gocrypto/sha1/sha1.gocrypto/sha1/sha1block_generic.gocrypto/sha1/sha1block.gocrypto/x509/x509.gocrypto/x509/cert_pool.gocrypto/x509/oid.gocrypto/x509/parser.gocrypto/x509/pkcs1.gocrypto/x509/pkcs8.gocrypto/x509/root.gocrypto/x509/root_unix.gocrypto/x509/sec1.gocrypto/x509/verify.goos/signal/signal.goos/signal/signal_unix.goflag/flag.gostrconv/atob.gostrings/compare.gobufio/bufio.gobufio/scan.goencoding/csv/reader.goencoding/csv/writer.gogithub.com/spf13/pflag@v1.0.5/flag.gogithub.com/spf13/pflag@v1.0.5/bool.gogithub.com/spf13/pflag@v1.0.5/bool_slice.gogithub.com/spf13/pflag@v1.0.5/bytes.gogithub.com/spf13/pflag@v1.0.5/count.gogithub.com/spf13/pflag@v1.0.5/duration.gogithub.com/spf13/pflag@v1.0.5/duration_slice.gogithub.com/spf13/pflag@v1.0.5/float32.gogithub.com/spf13/pflag@v1.0.5/float32_slice.gogithub.com/spf13/pflag@v1.0.5/float64.gogithub.com/spf13/pflag@v1.0.5/float64_slice.gogithub.com/spf13/pflag@v1.0.5/golangflag.gogithub.com/spf13/pflag@v1.0.5/int.gogithub.com/spf13/pflag@v1.0.5/int16.gogithub.com/spf13/pflag@v1.0.5/int32.gogithub.com/spf13/pflag@v1.0.5/int32_slice.gogithub.com/spf13/pflag@v1.0.5/int64.gogithub.com/spf13/pflag@v1.0.5/int64_slice.gogithub.com/spf13/pflag@v1.0.5/int8.gogithub.com/spf13/pflag@v1.0.5/int_slice.gogithub.com/spf13/pflag@v1.0.5/ip.gogithub.com/spf13/pflag@v1.0.5/ip_slice.gogithub.com/spf13/pflag@v1.0.5/ipmask.gogithub.com/spf13/pflag@v1.0.5/ipnet.gogithub.com/spf13/pflag@v1.0.5/string.gogithub.com/spf13/pflag@v1.0.5/string_array.gogithub.com/spf13/pflag@v1.0.5/string_slice.gogithub.com/spf13/pflag@v1.0.5/string_to_int.gogithub.com/spf13/pflag@v1.0.5/string_to_int64.gogithub.com/spf13/pflag@v1.0.5/string_to_string.gogithub.com/spf13/pflag@v1.0.5/uint.gogithub.com/spf13/pflag@v1.0.5/uint16.gogithub.com/spf13/pflag@v1.0.5/uint32.gogithub.com/spf13/pflag@v1.0.5/uint64.gogithub.com/spf13/pflag@v1.0.5/uint8.gogithub.com/spf13/pflag@v1.0.5/uint_slice.gotext/template/parse/lex.gotext/template/parse/node.gotext/template/parse/parse.gotext/template/exec.gotext/template/template.gotext/template/funcs.gogithub.com/spf13/cobra@v1.7.0/cobra.gogithub.com/spf13/cobra@v1.7.0/completions.gogithub.com/spf13/cobra@v1.7.0/active_help.gogithub.com/spf13/cobra@v1.7.0/command.gogithub.com/spf13/cobra@v1.7.0/args.gogithub.com/spf13/cobra@v1.7.0/bash_completions.gogithub.com/spf13/cobra@v1.7.0/bash_completionsV2.gotext/template/helper.gogithub.com/spf13/cobra@v1.7.0/powershell_completions.gogithub.com/spf13/cobra@v1.7.0/zsh_completions.gogithub.com/spf13/cobra@v1.7.0/fish_completions.gogithub.com/spf13/cobra@v1.7.0/flag_groups.gogithub.com/spf13/cobra@v1.7.0/shell_completions.goio/ioutil/ioutil.golog/log.gogithub.com/spf13/jwalterweatherman@v1.1.0/notepad.gogithub.com/spf13/jwalterweatherman@v1.1.0/default_notepad.goencoding/json/decode.goencoding/json/encode.goencoding/json/scanner.goencoding/json/fold.goencoding/json/indent.goencoding/json/stream.goencoding/json/tags.gohtml/escape.goregexp/syntax/perl_groups.goregexp/syntax/compile.goregexp/syntax/op_string.goregexp/syntax/parse.goregexp/syntax/prog.goregexp/syntax/regexp.goregexp/syntax/simplify.goregexp/backtrack.goregexp/exec.goregexp/onepass.goregexp/regexp.gohtml/template/attr.gohtml/template/content.gohtml/template/escape.gohtml/template/js.gohtml/template/template.gohtml/template/transition.gogithub.com/spf13/cast@v1.5.0/caste.gogithub.com/spf13/cast@v1.5.0/cast.gogolang.org/x/sys@v0.23.0/unix/mremap.gogolang.org/x/sys@v0.23.0/unix/syscall_unix.gogolang.org/x/sys@v0.23.0/unix/syscall_linux.gogolang.org/x/sys@v0.23.0/unix/fcntl.gogolang.org/x/sys@v0.23.0/unix/fcntl_linux_32bit.gogolang.org/x/sys@v0.23.0/unix/sockcmsg_unix.gogolang.org/x/sys@v0.23.0/unix/sockcmsg_unix_other.gogolang.org/x/sys@v0.23.0/unix/syscall_linux_mipsx.gogolang.org/x/sys@v0.23.0/unix/syscall.gogolang.org/x/sys@v0.23.0/unix/zsyscall_linux.gogolang.org/x/sys@v0.23.0/unix/zsyscall_linux_mipsle.gogolang.org/x/sys@v0.23.0/unix/asm_linux_mipsx.sgithub.com/mitchellh/mapstructure@v1.5.0/decode_hooks.gogithub.com/mitchellh/mapstructure@v1.5.0/error.gogithub.com/mitchellh/mapstructure@v1.5.0/mapstructure.gocrypto/hmac/hmac.gocrypto/rc4/rc4.govendor/golang.org/x/crypto/chacha20/chacha_generic.govendor/golang.org/x/crypto/chacha20/chacha_noasm.govendor/golang.org/x/crypto/internal/alias/alias.govendor/golang.org/x/crypto/chacha20/xor.govendor/golang.org/x/crypto/internal/poly1305/poly1305.govendor/golang.org/x/crypto/internal/poly1305/sum_generic.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305_noasm.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305_generic.gocontainer/list/list.govendor/golang.org/x/crypto/hkdf/hkdf.gocrypto/internal/hpke/hpke.govendor/golang.org/x/sys/cpu/cpu.govendor/golang.org/x/sys/cpu/cpu_linux.govendor/golang.org/x/sys/cpu/byteorder.govendor/golang.org/x/sys/cpu/hwcap_linux.govendor/golang.org/x/sys/cpu/runtime_auxv.govendor/golang.org/x/sys/cpu/runtime_auxv_go121.govendor/golang.org/x/crypto/sha3/hashes.govendor/golang.org/x/crypto/sha3/hashes_noasm.govendor/golang.org/x/crypto/sha3/keccakf.govendor/golang.org/x/crypto/sha3/register.govendor/golang.org/x/crypto/sha3/sha3.govendor/golang.org/x/crypto/sha3/xor.govendor/golang.org/x/crypto/sha3/shake.gocrypto/internal/mlkem768/mlkem768.govendor/golang.org/x/crypto/sha3/shake_noasm.gocrypto/tls/alert.gocrypto/tls/auth.gocrypto/tls/cache.gocrypto/tls/cipher_suites.gocrypto/tls/conn.gocrypto/tls/common.gocrypto/tls/defaults.gocrypto/tls/common_string.gocrypto/tls/quic.gocrypto/tls/prf.gocrypto/tls/ech.gocrypto/tls/handshake_messages.gocrypto/tls/key_schedule.gocrypto/tls/handshake_client.gocrypto/tls/handshake_client_tls13.gocrypto/tls/handshake_server.gocrypto/tls/handshake_server_tls13.gocrypto/tls/key_agreement.gocrypto/tls/ticket.gocrypto/tls/tls.gonet/http/internal/ascii/print.gonet/textproto/header.gonet/textproto/reader.gonet/textproto/textproto.gomime/encodedword.gomime/type.gomime/grammar.gomime/mediatype.gomime/type_unix.gomime/quotedprintable/reader.gomime/multipart/multipart.gomime/multipart/writer.gomime/multipart/formdata.gocompress/flate/huffman_code.gocompress/flate/dict_decoder.gocompress/flate/huffman_bit_writer.gocompress/flate/inflate.gohash/crc32/crc32.gohash/crc32/crc32_generic.gocompress/gzip/gunzip.gonet/http/httptrace/trace.govendor/golang.org/x/text/unicode/bidi/prop.govendor/golang.org/x/text/unicode/bidi/tables15.0.0.govendor/golang.org/x/text/secure/bidirule/bidirule.govendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.govendor/golang.org/x/text/unicode/norm/trie.govendor/golang.org/x/text/unicode/norm/transform.govendor/golang.org/x/text/unicode/norm/composition.govendor/golang.org/x/text/unicode/norm/forminfo.govendor/golang.org/x/text/unicode/norm/input.govendor/golang.org/x/text/unicode/norm/iter.govendor/golang.org/x/text/unicode/norm/normalize.govendor/golang.org/x/text/unicode/norm/tables15.0.0.govendor/golang.org/x/net/idna/trie.govendor/golang.org/x/net/idna/idna10.0.0.govendor/golang.org/x/net/idna/trieval.govendor/golang.org/x/net/idna/punycode.govendor/golang.org/x/net/idna/tables15.0.0.govendor/golang.org/x/net/idna/trie13.0.0.govendor/golang.org/x/net/http/httpguts/guts.govendor/golang.org/x/net/http/httpguts/httplex.govendor/golang.org/x/net/http2/hpack/static_table.govendor/golang.org/x/net/http2/hpack/huffman.govendor/golang.org/x/net/http2/hpack/hpack.govendor/golang.org/x/net/http2/hpack/tables.govendor/golang.org/x/net/http2/hpack/encode.gonet/http/internal/chunked.govendor/golang.org/x/net/http/httpproxy/proxy.gonet/http/request.gonet/http/header.gonet/http/response.gonet/http/cookie.gonet/http/fs.gonet/http/h2_bundle.gonet/http/transport.gonet/http/http.gonet/http/server.gonet/http/socks_bundle.gonet/http/transfer.gonet/http/transport_default_other.gonet/http/client.gonet/http/h2_error.gonet/http/pattern.gonet/http/clone.gonet/http/responsecontroller.gonet/http/routing_index.gonet/http/routing_tree.gonet/http/mapping.gonet/http/servemux121.gomaps/iter.gonet/http/sniff.gonet/http/status.gonet/http/roundtrip.goslices/iter.gogithub.com/spf13/afero@v1.9.3/mem/file.gogolang.org/x/text@v0.17.0/unicode/norm/trie.gogolang.org/x/text@v0.17.0/unicode/norm/transform.gogithub.com/spf13/afero@v1.9.3/afero.gogithub.com/spf13/afero@v1.9.3/ioutil.gogithub.com/spf13/afero@v1.9.3/os.gogithub.com/spf13/viper@v1.15.0/internal/encoding/decoder.gogithub.com/spf13/viper@v1.15.0/internal/encoding/encoder.gogithub.com/spf13/viper@v1.15.0/internal/encoding/error.gogithub.com/subosito/gotenv@v1.4.2/gotenv.gogithub.com/spf13/viper@v1.15.0/internal/encoding/dotenv/codec.gogithub.com/spf13/viper@v1.15.0/internal/encoding/dotenv/map_utils.gogithub.com/hashicorp/hcl@v1.0.0/hcl/strconv/quote.gogithub.com/hashicorp/hcl@v1.0.0/hcl/token/position.gogithub.com/hashicorp/hcl@v1.0.0/hcl/token/token.gogithub.com/hashicorp/hcl@v1.0.0/hcl/ast/ast.gogithub.com/hashicorp/hcl@v1.0.0/hcl/ast/walk.gogithub.com/hashicorp/hcl@v1.0.0/hcl/scanner/scanner.gogithub.com/hashicorp/hcl@v1.0.0/hcl/parser/error.gogithub.com/hashicorp/hcl@v1.0.0/hcl/parser/parser.gogithub.com/hashicorp/hcl@v1.0.0/json/token/position.gogithub.com/hashicorp/hcl@v1.0.0/json/token/token.gogithub.com/hashicorp/hcl@v1.0.0/json/scanner/scanner.gogithub.com/hashicorp/hcl@v1.0.0/json/parser/flatten.gogithub.com/hashicorp/hcl@v1.0.0/json/parser/parser.gogithub.com/hashicorp/hcl@v1.0.0/decoder.gogithub.com/hashicorp/hcl@v1.0.0/lex.gogithub.com/hashicorp/hcl@v1.0.0/parse.gotext/tabwriter/tabwriter.gogithub.com/hashicorp/hcl@v1.0.0/hcl/printer/nodes.gogithub.com/hashicorp/hcl@v1.0.0/hcl/printer/printer.gogithub.com/spf13/viper@v1.15.0/internal/encoding/hcl/codec.gogopkg.in/ini.v1@v1.67.0/ini.gogopkg.in/ini.v1@v1.67.0/deprecated.gogopkg.in/ini.v1@v1.67.0/parser.gogopkg.in/ini.v1@v1.67.0/struct.gogopkg.in/ini.v1@v1.67.0/data_source.gogopkg.in/ini.v1@v1.67.0/error.gogopkg.in/ini.v1@v1.67.0/file.gogopkg.in/ini.v1@v1.67.0/section.gogopkg.in/ini.v1@v1.67.0/helper.gogopkg.in/ini.v1@v1.67.0/key.gogithub.com/spf13/viper@v1.15.0/internal/encoding/ini/codec.gogithub.com/spf13/viper@v1.15.0/internal/encoding/ini/map_utils.gogithub.com/magiconair/properties@v1.8.7/decode.gogithub.com/magiconair/properties@v1.8.7/properties.gogithub.com/magiconair/properties@v1.8.7/integrate.gogithub.com/magiconair/properties@v1.8.7/lex.gogithub.com/magiconair/properties@v1.8.7/load.gogithub.com/magiconair/properties@v1.8.7/parser.gogithub.com/magiconair/properties@v1.8.7/rangecheck.gogithub.com/spf13/viper@v1.15.0/internal/encoding/javaproperties/codec.gogithub.com/spf13/viper@v1.15.0/internal/encoding/javaproperties/map_utils.gogithub.com/spf13/viper@v1.15.0/internal/encoding/json/codec.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/danger/danger.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/characters/ascii.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/characters/utf8.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/ast.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/kind.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/parser.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/builder.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/scanner.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/tracker/key.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/tracker/seen.gogithub.com/pelletier/go-toml/v2@v2.0.6/types.gogithub.com/pelletier/go-toml/v2@v2.0.6/decode.gogithub.com/pelletier/go-toml/v2@v2.0.6/errors.gogithub.com/pelletier/go-toml/v2@v2.0.6/localtime.gogithub.com/pelletier/go-toml/v2@v2.0.6/marshaler.gogithub.com/pelletier/go-toml/v2@v2.0.6/strict.gogithub.com/pelletier/go-toml/v2@v2.0.6/unmarshaler.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/danger/typeid.gogithub.com/spf13/viper@v1.15.0/internal/encoding/toml/codec.gogopkg.in/yaml.v3@v3.0.1/decode.gogopkg.in/yaml.v3@v3.0.1/yaml.gogopkg.in/yaml.v3@v3.0.1/encode.gogopkg.in/yaml.v3@v3.0.1/resolve.gogopkg.in/yaml.v3@v3.0.1/apic.gogopkg.in/yaml.v3@v3.0.1/yamlh.gogopkg.in/yaml.v3@v3.0.1/emitterc.gogopkg.in/yaml.v3@v3.0.1/yamlprivateh.gogopkg.in/yaml.v3@v3.0.1/parserc.gogopkg.in/yaml.v3@v3.0.1/readerc.gogopkg.in/yaml.v3@v3.0.1/scannerc.gogopkg.in/yaml.v3@v3.0.1/sorter.gogopkg.in/yaml.v3@v3.0.1/writerc.gogithub.com/spf13/viper@v1.15.0/internal/encoding/yaml/codec.gogithub.com/spf13/viper@v1.15.0/logger.gogithub.com/spf13/viper@v1.15.0/util.gogithub.com/spf13/viper@v1.15.0/viper.gogithub.com/spf13/viper@v1.15.0/viper_go1_15.gogo.uber.org/multierr@v1.11.0/error.gogo.uber.org/multierr@v1.11.0/error_post_go120.gogo.uber.org/zap@v1.24.0/buffer/buffer.gogo.uber.org/zap@v1.24.0/buffer/pool.gogo.uber.org/zap@v1.24.0/internal/bufferpool/bufferpool.gogo.uber.org/atomic@v1.11.0/int32.gogo.uber.org/atomic@v1.11.0/int64.gogo.uber.org/atomic@v1.11.0/uint64.gogo.uber.org/zap@v1.24.0/zapcore/level_strings.gogo.uber.org/zap@v1.24.0/zapcore/console_encoder.gogo.uber.org/zap@v1.24.0/zapcore/entry.gogo.uber.org/zap@v1.24.0/zapcore/error.gogo.uber.org/zap@v1.24.0/zapcore/json_encoder.gogo.uber.org/zap@v1.24.0/zapcore/clock.gogo.uber.org/zap@v1.24.0/zapcore/memory_encoder.gogo.uber.org/zap@v1.24.0/zapcore/field.gogo.uber.org/zap@v1.24.0/zapcore/core.gogo.uber.org/zap@v1.24.0/zapcore/encoder.gogo.uber.org/zap@v1.24.0/internal/color/color.gogo.uber.org/zap@v1.24.0/internal/exit/exit.gogo.uber.org/zap@v1.24.0/zapcore/level.gogo.uber.org/zap@v1.24.0/zapcore/reflected_encoder.gogo.uber.org/zap@v1.24.0/zapcore/sampler.gogo.uber.org/zap@v1.24.0/zapcore/write_syncer.gogo.uber.org/zap@v1.24.0/encoder.gogo.uber.org/zap@v1.24.0/field.gogo.uber.org/zap@v1.24.0/global.gogo.uber.org/zap@v1.24.0/logger.gogo.uber.org/zap@v1.24.0/sink.gogo.uber.org/zap@v1.24.0/error.gogo.uber.org/zap@v1.24.0/stacktrace.gogo.uber.org/zap@v1.24.0/array.gogo.uber.org/zap@v1.24.0/config.gogo.uber.org/zap@v1.24.0/options.gogo.uber.org/zap@v1.24.0/level.gogo.uber.org/zap@v1.24.0/http_handler.gogo.uber.org/zap@v1.24.0/sugar.gogo.uber.org/zap@v1.24.0/writer.gogithub.com/apernet/hysteria/core/v2/errors/errors.gogolang.org/x/exp@v0.0.0-20240506185415-9bf2ced13842/rand/rand.gogolang.org/x/exp@v0.0.0-20240506185415-9bf2ced13842/rand/rng.gogolang.org/x/exp@v0.0.0-20240506185415-9bf2ced13842/rand/exp.gogolang.org/x/exp@v0.0.0-20240506185415-9bf2ced13842/rand/normal.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/version.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/connection_id.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/encryption_level.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/key_phase.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/perspective.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/protocol.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/stream.gogithub.com/apernet/hysteria/core/v2/internal/congestion/common/pacer.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bandwidth_sampler.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/windowed_filter.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/packet_number_indexed_queue.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/ringbuffer.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bandwidth.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bbr_sender.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/clock.gogithub.com/apernet/hysteria/core/v2/internal/congestion/brutal/brutal.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/log.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/rand.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/rtt_stats.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/streamframe_interval.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/timer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/quicvarint/io.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/quicvarint/varint.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/qerr/error_codes.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/qerr/errors.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/ack_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/frame_parser.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/ack_range.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/connection_close_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/crypto_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/data_blocked_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/datagram_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/extended_header.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/header.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/path_challenge_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/path_response_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/handshake_done_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/log.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/stream_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/max_data_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/max_stream_data_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/max_streams_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/new_connection_id_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/new_token_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/ping_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/pool.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/reset_stream_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/retire_connection_id_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/short_header.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/stop_sending_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/stream_data_blocked_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/streams_blocked_frame.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/transport_parameters.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/wire/version_negotiation.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/congestion/clock.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/congestion/cubic.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/congestion/cubic_sender.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/congestion/hybrid_slow_start.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/congestion/bandwidth.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/congestion/pacer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/packet.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/received_packet_handler.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/received_packet_tracker.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/received_packet_history.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/ackhandler.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/cc_adapter.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/ecn.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/packet_number_generator.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/send_mode.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/sent_packet_handler.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/sent_packet_history.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/protocol/packet_number.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/flowcontrol/base_flow_controller.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/flowcontrol/connection_flow_controller.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/flowcontrol/stream_flow_controller.gogolang.org/x/crypto@v0.26.0/chacha20/chacha_generic.gogolang.org/x/crypto@v0.26.0/chacha20/chacha_noasm.gogolang.org/x/crypto@v0.26.0/internal/alias/alias.gogolang.org/x/crypto@v0.26.0/chacha20/xor.gogolang.org/x/crypto@v0.26.0/internal/poly1305/poly1305.gogolang.org/x/crypto@v0.26.0/internal/poly1305/sum_generic.gogolang.org/x/crypto@v0.26.0/chacha20poly1305/chacha20poly1305.gogolang.org/x/crypto@v0.26.0/chacha20poly1305/chacha20poly1305_noasm.gogolang.org/x/crypto@v0.26.0/chacha20poly1305/chacha20poly1305_generic.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/qtls/client_session_cache.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/qtls/qtls.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/qtls/conn.gogolang.org/x/crypto@v0.26.0/hkdf/hkdf.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/initial_aead.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/aead.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/cipher_suite.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/crypto_setup.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/updatable_aead.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/header_protector.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/hkdf.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/interface.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/retry.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/session_ticket.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/token_generator.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/handshake/token_protector.gogolang.org/x/net@v0.28.0/internal/socket/sys_posix.gogolang.org/x/net@v0.28.0/internal/socket/mmsghdr_unix.gogolang.org/x/net@v0.28.0/internal/socket/msghdr_linux.gogolang.org/x/net@v0.28.0/internal/socket/complete_dontwait.gogolang.org/x/net@v0.28.0/internal/socket/iovec_32bit.gogolang.org/x/net@v0.28.0/internal/socket/msghdr_linux_32bit.gogolang.org/x/net@v0.28.0/internal/socket/rawconn.gogolang.org/x/net@v0.28.0/internal/socket/sys_unix.gogolang.org/x/net@v0.28.0/internal/socket/rawconn_mmsg.gogolang.org/x/net@v0.28.0/internal/socket/rawconn_msg.gogolang.org/x/net@v0.28.0/internal/socket/socket.gogolang.org/x/net@v0.28.0/internal/socket/cmsghdr_linux_32bit.gogolang.org/x/net@v0.28.0/internal/socket/cmsghdr_unix.gogolang.org/x/net@v0.28.0/internal/socket/cmsghdr.gogolang.org/x/net@v0.28.0/internal/socket/sys.gogolang.org/x/net@v0.28.0/internal/socket/error_unix.gogolang.org/x/net@v0.28.0/internal/socket/sys_linux.gogolang.org/x/net@v0.28.0/bpf/instructions.gogolang.org/x/net@v0.28.0/ipv4/iana.gogolang.org/x/net@v0.28.0/ipv4/sys_linux.gogolang.org/x/net@v0.28.0/ipv4/batch.gogolang.org/x/net@v0.28.0/ipv4/payload.gogolang.org/x/net@v0.28.0/ipv4/control.gogolang.org/x/net@v0.28.0/ipv4/control_pktinfo.gogolang.org/x/net@v0.28.0/ipv4/control_unix.gogolang.org/x/net@v0.28.0/ipv4/endpoint.gogolang.org/x/net@v0.28.0/ipv4/dgramopt.gogolang.org/x/net@v0.28.0/ipv4/sockopt_posix.gogolang.org/x/net@v0.28.0/ipv4/genericopt.gogolang.org/x/net@v0.28.0/ipv4/helper.gogolang.org/x/net@v0.28.0/ipv4/icmp.gogolang.org/x/net@v0.28.0/ipv4/icmp_linux.gogolang.org/x/net@v0.28.0/ipv4/payload_cmsg.gogolang.org/x/net@v0.28.0/ipv4/sys_asmreqn.gogolang.org/x/net@v0.28.0/ipv4/sys_bpf.gogolang.org/x/net@v0.28.0/ipv4/sys_ssmreq.gogolang.org/x/net@v0.28.0/ipv6/control.gogolang.org/x/net@v0.28.0/ipv6/control_rfc3542_unix.gogolang.org/x/net@v0.28.0/ipv6/sys_linux.gogolang.org/x/net@v0.28.0/ipv6/iana.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/interface.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/connection_timer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/connection.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/conn_id_manager.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/conn_id_generator.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/crypto_stream_manager.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/crypto_stream.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/packet_unpacker.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/buffer_pool.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/client.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/transport.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/closed_conn.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/config.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/linkedlist/linkedlist.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/send_queue.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/retransmission_queue.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/framer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/datagram_queue.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/logging/packet_header.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/ackhandler/ack_eliciting.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/mtu_discoverer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/packet_packer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/connection_logging.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/frame_sorter.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/ringbuffer/ringbuffer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/errors.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/internal/utils/tree/tree.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/multiplexer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/packet_handler_map.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/receive_stream.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/send_conn.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/sys_conn_df_linux.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/send_stream.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/server.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/stream.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/streams_map.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/streams_map_outgoing.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/streams_map_incoming.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/sys_conn.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/sys_conn_buffers.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/sys_conn_buffers_write.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/sys_conn_helper_linux.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/sys_conn_oob.gogithub.com/apernet/hysteria/core/v2/internal/congestion/utils.gogithub.com/apernet/hysteria/core/v2/internal/protocol/http.gogithub.com/apernet/hysteria/core/v2/internal/protocol/padding.gogithub.com/apernet/hysteria/core/v2/internal/protocol/proxy.gogithub.com/apernet/hysteria/core/v2/internal/utils/atomic.gogithub.com/apernet/hysteria/core/v2/internal/utils/qstream.golog/slog/internal/buffer/buffer.golog/slog/handler.golog/slog/attr.golog/slog/level.golog/slog/value.golog/slog/record.golog/slog/json_handler.golog/slog/logger.golog/slog/text_handler.gogolang.org/x/net@v0.28.0/http2/hpack/static_table.gogolang.org/x/net@v0.28.0/http2/hpack/huffman.gogithub.com/quic-go/qpack@v0.5.1/static_table.gogithub.com/quic-go/qpack@v0.5.1/decoder.gogithub.com/quic-go/qpack@v0.5.1/varint.gogithub.com/quic-go/qpack@v0.5.1/encoder.gogithub.com/quic-go/qpack@v0.5.1/header_field.gogolang.org/x/text@v0.17.0/unicode/bidi/prop.gogolang.org/x/text@v0.17.0/unicode/bidi/tables15.0.0.gogolang.org/x/text@v0.17.0/secure/bidirule/bidirule.gogolang.org/x/net@v0.28.0/idna/trie.gogolang.org/x/net@v0.28.0/idna/idna10.0.0.gogolang.org/x/net@v0.28.0/idna/trieval.gogolang.org/x/net@v0.28.0/idna/punycode.gogolang.org/x/net@v0.28.0/idna/tables15.0.0.gogolang.org/x/net@v0.28.0/http/httpguts/guts.gogolang.org/x/net@v0.28.0/http/httpguts/httplex.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/server.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/body.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/http_stream.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/capsule.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/request_writer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/client.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/conn.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/datagram.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/error.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/error_codes.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/frames.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/gzip_reader.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/headers.gogolang.org/x/net@v0.28.0/http2/hpack/hpack.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/response_writer.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/state_tracking_stream.gogithub.com/apernet/quic-go@v0.48.2-0.20241104191913-cb103fcecfe7/http3/transport.gogithub.com/davecgh/go-spew@v1.1.1/spew/bypass.gogithub.com/davecgh/go-spew@v1.1.1/spew/dump.gogithub.com/stretchr/objx@v0.5.2/accessors.gogithub.com/stretchr/objx@v0.5.2/map.gonet/http/internal/testcert/testcert.gonet/http/httptest/server.gogithub.com/stretchr/testify@v1.9.0/assert/assertion_compare.gogithub.com/stretchr/testify@v1.9.0/mock/mock.gogithub.com/apernet/hysteria/core/v2/internal/frag/frag.gogithub.com/apernet/hysteria/core/v2/client/client.gogithub.com/apernet/hysteria/core/v2/client/config.gogithub.com/apernet/hysteria/core/v2/client/reconnect.gogithub.com/apernet/hysteria/core/v2/client/udp.gogithub.com/apernet/hysteria/app/v2/internal/forwarding/tcp.gogithub.com/apernet/hysteria/app/v2/internal/forwarding/udp.gogithub.com/apernet/hysteria/app/v2/internal/http/server.gogithub.com/apernet/hysteria/extras/v2/correctnet/correctnet.gogithub.com/apernet/hysteria/app/v2/internal/proxymux/manager.gogithub.com/apernet/hysteria/app/v2/internal/proxymux/mux.gogithub.com/apernet/hysteria/app/v2/internal/redirect/getsockopt_linux.gogithub.com/apernet/hysteria/app/v2/internal/redirect/tcp_linux.gogithub.com/apernet/hysteria/app/v2/internal/sockopts/sockopts.gogithub.com/apernet/hysteria/app/v2/internal/sockopts/sockopts_linux.goencoding/gob/encode.goencoding/gob/enc_helpers.goencoding/gob/decode.goencoding/gob/error.goencoding/gob/encoder.goencoding/gob/type.goencoding/gob/dec_helpers.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/client_side.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/server_side.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/util.gogithub.com/apernet/hysteria/app/v2/internal/socks5/server.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/endian.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/tproxy_tcp.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/tproxy_udp.gogithub.com/apernet/hysteria/app/v2/internal/tproxy/tcp_linux.gogithub.com/apernet/hysteria/app/v2/internal/tproxy/udp_linux.gogithub.com/sagernet/sing@v0.3.2/common/native_endian_std.gogithub.com/sagernet/sing@v0.3.2/common/cond.gogithub.com/sagernet/sing@v0.3.2/common/format/fmt.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/cause.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/inner.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/multi.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/conntrack_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/addr_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/nl_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/link_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/mpls_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/route_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/seg6_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/link.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/addr.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/handle_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/addr_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/link_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/order.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/netlink.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/protinfo.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/protinfo_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/route_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/route.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/seg6local_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/rule_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/rule.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/xfrm_state_linux.gogithub.com/sagernet/sing@v0.3.2/common/buf/alloc.gogithub.com/sagernet/sing@v0.3.2/common/buf/buffer.gogithub.com/sagernet/sing@v0.3.2/common/buf/pool.gogithub.com/sagernet/sing@v0.3.2/common/clear.gogithub.com/sagernet/sing@v0.3.2/common/buf/multi.gogithub.com/sagernet/sing@v0.3.2/common/rw/write.gogithub.com/sagernet/sing@v0.3.2/common/metadata/socksaddr.gogithub.com/sagernet/sing@v0.3.2/common/metadata/serializer.gogithub.com/sagernet/sing@v0.3.2/common/metadata/addr.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/icmp.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/icmpv6.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/ip.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/tcpip.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/ipv6.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/tcp.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/tcpip_compat.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/internal/clashtcpip/udp.gogithub.com/sagernet/sing@v0.3.2/common/network/name.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/error.gogithub.com/sagernet/sing@v0.3.2/common/network/addr.gogithub.com/sagernet/sing@v0.3.2/common/network/direct.gogithub.com/sagernet/sing@v0.3.2/common/control/bind.gogithub.com/sagernet/sing@v0.3.2/common/control/bind_linux.gogithub.com/sagernet/sing@v0.3.2/common/control/interface.gogithub.com/sagernet/sing@v0.3.2/common/udpnat/conn_wait.gogithub.com/sagernet/sing@v0.3.2/common/udpnat/service.goos/exec/exec.goos/exec/exec_unix.goos/exec/lp_unix.gointernal/syscall/unix/eaccess_linux.gogithub.com/sagernet/sing@v0.3.2/common/bufio/vectorised.gogithub.com/sagernet/sing@v0.3.2/common/bufio/vectorised_unix.gogithub.com/sagernet/sing@v0.3.2/common/shell/shell.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/ipset.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/netipx.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/uint128.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/monitor.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/monitor_linux.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/stack_gvisor_stub.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/tun_linux_offload_errors.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/errors_patch.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/stack.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/stack_run_patch.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/stack_system.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/stack_system_nat.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/tun_linux.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/tun_linux_offload.gogithub.com/sagernet/sing@v0.3.2/common/rw/file.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/tun_rules.gogithub.com/apernet/sing-tun@v0.2.6-0.20240323130332-b9f6511036ad/tun_linux_flags.gogolang.org/x/sys@v0.23.0/unix/ifreq_linux.gogolang.org/x/sys@v0.23.0/unix/ioctl_linux.gogolang.org/x/sys@v0.23.0/unix/ioctl_unsigned.gogithub.com/sagernet/sing@v0.3.2/common/cache/lrucache.gogithub.com/sagernet/sing@v0.3.2/common/x/list/list.gogithub.com/sagernet/sing@v0.3.2/common/ranges/range.gogithub.com/sagernet/sing@v0.3.2/common/x/list/cond.gogithub.com/apernet/hysteria/app/v2/internal/tun/log.gogithub.com/apernet/hysteria/app/v2/internal/tun/server.gogithub.com/apernet/hysteria/app/v2/internal/url/url.gogoogle.golang.org/protobuf@v1.34.1/internal/detrand/rand.goos/executable.gohash/fnv/fnv.gogoogle.golang.org/protobuf@v1.34.1/internal/errors/errors.gogoogle.golang.org/protobuf@v1.34.1/encoding/protowire/wire.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_unsafe_go121.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/proto.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/source.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/source_gen.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_equal.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_union.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/messageset/messageset.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoregistry/registry.gogo/token/token.gogoogle.golang.org/protobuf@v1.34.1/internal/strs/strings.gogoogle.golang.org/protobuf@v1.34.1/internal/strs/strings_unsafe_go121.gogoogle.golang.org/protobuf@v1.34.1/internal/order/order.gogoogle.golang.org/protobuf@v1.34.1/internal/order/range.gogoogle.golang.org/protobuf@v1.34.1/proto/encode_gen.gogoogle.golang.org/protobuf@v1.34.1/proto/decode.gogoogle.golang.org/protobuf@v1.34.1/proto/checkinit.gogoogle.golang.org/protobuf@v1.34.1/proto/proto_methods.gogoogle.golang.org/protobuf@v1.34.1/proto/messageset.gogoogle.golang.org/protobuf@v1.34.1/proto/decode_gen.gogoogle.golang.org/protobuf@v1.34.1/proto/encode.gogoogle.golang.org/protobuf@v1.34.1/proto/merge.gogoogle.golang.org/protobuf@v1.34.1/proto/proto.gogoogle.golang.org/protobuf@v1.34.1/proto/reset.gogoogle.golang.org/protobuf@v1.34.1/proto/size.gogoogle.golang.org/protobuf@v1.34.1/proto/size_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/descfmt/stringer.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode_token.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode_string.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/defval/default.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/editions.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/placeholder.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_init.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/build.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_lazy.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_list.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_list_gen.gogoogle.golang.org/protobuf@v1.34.1/encoding/prototext/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/tag/tag.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/decode.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect_field.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_unsafe.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/api_export.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/checkinit.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/pointer_unsafe.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_field.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/merge.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/weak.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_map.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_map_go112.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_tables.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert_list.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert_map.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/enum.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_enum.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_export.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_file.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/merge_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/validate.gogoogle.golang.org/protobuf@v1.34.1/internal/filetype/build.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo/v2geo.pb.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo/load.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/parse.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/compile.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/matchers.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/matchers_v2geo.goimage/names.gorsc.io/qr@v0.2.0/gf256/gf256.gorsc.io/qr@v0.2.0/coding/qr.gorsc.io/qr@v0.2.0/qr.gogithub.com/mdp/qrterminal/v3@v3.1.1/qrterminal.gogithub.com/apernet/hysteria/app/v2/internal/utils/bpsconv.gogithub.com/apernet/hysteria/app/v2/internal/utils/certloader.gogithub.com/apernet/hysteria/app/v2/internal/utils/geoloader.gogithub.com/apernet/hysteria/app/v2/internal/utils/update.gogolang.org/x/crypto@v0.26.0/blake2b/blake2b.gogolang.org/x/crypto@v0.26.0/blake2b/blake2b_ref.gogolang.org/x/crypto@v0.26.0/blake2b/blake2b_generic.gogolang.org/x/crypto@v0.26.0/blake2b/blake2x.gogolang.org/x/crypto@v0.26.0/blake2b/register.gogithub.com/apernet/hysteria/extras/v2/obfs/salamander.gogithub.com/apernet/hysteria/extras/v2/obfs/conn.gogithub.com/apernet/hysteria/extras/v2/utils/portunion.gogithub.com/apernet/hysteria/extras/v2/transport/udphop/addr.gogithub.com/apernet/hysteria/extras/v2/transport/udphop/conn.gonet/http/httputil/dump.gonet/http/httputil/httputil.gonet/http/httputil/reverseproxy.gogithub.com/mholt/acmez@v1.0.4/acme/client.gogithub.com/mholt/acmez@v1.0.4/acme/http.gogithub.com/mholt/acmez@v1.0.4/acme/jws.gogithub.com/mholt/acmez@v1.0.4/acme/account.gogithub.com/mholt/acmez@v1.0.4/acme/authorization.gogithub.com/mholt/acmez@v1.0.4/acme/certificate.gogithub.com/mholt/acmez@v1.0.4/acme/challenge.gogithub.com/mholt/acmez@v1.0.4/acme/order.gogithub.com/mholt/acmez@v1.0.4/acme/problem.gogithub.com/mholt/acmez@v1.0.4/client.gogithub.com/mholt/acmez@v1.0.4/tlsalpn01.gogolang.org/x/crypto@v0.26.0/ocsp/ocsp.gogithub.com/klauspost/cpuid/v2@v2.1.1/cpuid.gogithub.com/klauspost/cpuid/v2@v2.1.1/detect_ref.gogithub.com/klauspost/cpuid/v2@v2.1.1/featureid_string.goencoding/base32/base32.gogithub.com/miekg/dns@v1.1.59/types.gogithub.com/miekg/dns@v1.1.59/msg.gogithub.com/miekg/dns@v1.1.59/dnssec.gogithub.com/miekg/dns@v1.1.59/dnssec_privkey.gogithub.com/miekg/dns@v1.1.59/edns.gogithub.com/miekg/dns@v1.1.59/reverse.gogithub.com/miekg/dns@v1.1.59/msg_helpers.gogithub.com/miekg/dns@v1.1.59/serve_mux.gogithub.com/miekg/dns@v1.1.59/server.gogithub.com/miekg/dns@v1.1.59/ztypes.gogithub.com/miekg/dns@v1.1.59/udp.gogithub.com/miekg/dns@v1.1.59/svcb.gogithub.com/miekg/dns@v1.1.59/client.gogithub.com/miekg/dns@v1.1.59/clientconfig.gogithub.com/miekg/dns@v1.1.59/dane.gogithub.com/miekg/dns@v1.1.59/defaults.gogithub.com/miekg/dns@v1.1.59/dns.gogithub.com/miekg/dns@v1.1.59/dnssec_keygen.gogithub.com/miekg/dns@v1.1.59/dnssec_keyscan.gogithub.com/miekg/dns@v1.1.59/hash.gogithub.com/miekg/dns@v1.1.59/labels.gogithub.com/miekg/dns@v1.1.59/msg_truncate.gogithub.com/miekg/dns@v1.1.59/nsecx.gogithub.com/miekg/dns@v1.1.59/scan.gogithub.com/miekg/dns@v1.1.59/sig0.gogithub.com/miekg/dns@v1.1.59/smimea.gogithub.com/miekg/dns@v1.1.59/tlsa.gogithub.com/miekg/dns@v1.1.59/tsig.gogithub.com/miekg/dns@v1.1.59/update.gogithub.com/miekg/dns@v1.1.59/zmsg.gogithub.com/libdns/libdns@v0.2.2/libdns.gogithub.com/caddyserver/certmagic@v0.17.2/account.gogithub.com/caddyserver/certmagic@v0.17.2/acmeclient.gogithub.com/caddyserver/certmagic@v0.17.2/acmeissuer.gogithub.com/caddyserver/certmagic@v0.17.2/certmagic.gogithub.com/caddyserver/certmagic@v0.17.2/config.gogithub.com/caddyserver/certmagic@v0.17.2/storage.gogithub.com/caddyserver/certmagic@v0.17.2/solvers.gogithub.com/caddyserver/certmagic@v0.17.2/handshake.gogithub.com/caddyserver/certmagic@v0.17.2/dnsutil.gogithub.com/caddyserver/certmagic@v0.17.2/ratelimiter.gogithub.com/caddyserver/certmagic@v0.17.2/async.gogithub.com/caddyserver/certmagic@v0.17.2/cache.gogithub.com/caddyserver/certmagic@v0.17.2/certificates.gogithub.com/caddyserver/certmagic@v0.17.2/crypto.gogithub.com/caddyserver/certmagic@v0.17.2/filestorage.gogithub.com/caddyserver/certmagic@v0.17.2/maintain.gogithub.com/caddyserver/certmagic@v0.17.2/httphandler.gogithub.com/caddyserver/certmagic@v0.17.2/ocsp.gogithub.com/libdns/cloudflare@v0.1.1/client.gogithub.com/libdns/cloudflare@v0.1.1/models.gogithub.com/libdns/cloudflare@v0.1.1/provider.gogithub.com/libdns/duckdns@v0.2.0/client.gogithub.com/libdns/duckdns@v0.2.0/provider.gogithub.com/libdns/gandi@v1.0.3/client.gogithub.com/libdns/gandi@v1.0.3/provider.gogithub.com/libdns/godaddy@v1.0.3/provider.gogithub.com/pkg/errors@v0.9.1/errors.gogithub.com/pkg/errors@v0.9.1/stack.gogithub.com/libdns/namedotcom@v0.3.3/client.gogithub.com/libdns/namedotcom@v0.3.3/namedotcom.gogithub.com/libdns/namedotcom@v0.3.3/provider.gogolang.org/x/oauth2@v0.20.0/internal/token.gogolang.org/x/oauth2@v0.20.0/internal/transport.gogolang.org/x/oauth2@v0.20.0/deviceauth.gogolang.org/x/oauth2@v0.20.0/oauth2.gogolang.org/x/oauth2@v0.20.0/token.gogolang.org/x/oauth2@v0.20.0/transport.gogithub.com/google/go-querystring@v1.1.0/query/encode.gogithub.com/hashicorp/go-cleanhttp@v0.5.2/cleanhttp.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/client.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/cert_error_go120.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/roundtripper.gogithub.com/vultr/govultr/v3@v3.6.4/account.gogithub.com/vultr/govultr/v3@v3.6.4/application.gogithub.com/vultr/govultr/v3@v3.6.4/backup.gogithub.com/vultr/govultr/v3@v3.6.4/bare_metal_server.gogithub.com/vultr/govultr/v3@v3.6.4/billing.gogithub.com/vultr/govultr/v3@v3.6.4/block_storage.gogithub.com/vultr/govultr/v3@v3.6.4/container_registry.gogithub.com/vultr/govultr/v3@v3.6.4/database.gogithub.com/vultr/govultr/v3@v3.6.4/domain_records.gogithub.com/vultr/govultr/v3@v3.6.4/domains.gogithub.com/vultr/govultr/v3@v3.6.4/firewall_group.gogithub.com/vultr/govultr/v3@v3.6.4/firewall_rule.gogithub.com/vultr/govultr/v3@v3.6.4/govultr.gogithub.com/vultr/govultr/v3@v3.6.4/instance.gogithub.com/vultr/govultr/v3@v3.6.4/iso.gogithub.com/vultr/govultr/v3@v3.6.4/kubernetes.gogithub.com/vultr/govultr/v3@v3.6.4/load_balancer.gogithub.com/vultr/govultr/v3@v3.6.4/marketplace.gogithub.com/vultr/govultr/v3@v3.6.4/network.gogithub.com/vultr/govultr/v3@v3.6.4/object_storage.gogithub.com/vultr/govultr/v3@v3.6.4/os.gogithub.com/vultr/govultr/v3@v3.6.4/plans.gogithub.com/vultr/govultr/v3@v3.6.4/regions.gogithub.com/vultr/govultr/v3@v3.6.4/reserved_ip.gogithub.com/vultr/govultr/v3@v3.6.4/snapshot.gogithub.com/vultr/govultr/v3@v3.6.4/ssh_key.gogithub.com/vultr/govultr/v3@v3.6.4/startup_script.gogithub.com/vultr/govultr/v3@v3.6.4/user.gogithub.com/vultr/govultr/v3@v3.6.4/vpc.gogithub.com/vultr/govultr/v3@v3.6.4/vpc2.gogithub.com/libdns/vultr@v1.0.0/client.gogithub.com/libdns/vultr@v1.0.0/provider.gogithub.com/apernet/hysteria/core/v2/server/config.gogithub.com/apernet/hysteria/core/v2/server/copy.gogithub.com/apernet/hysteria/core/v2/server/server.gogithub.com/apernet/hysteria/core/v2/server/udp.gogithub.com/apernet/hysteria/extras/v2/auth/command.gogithub.com/apernet/hysteria/extras/v2/auth/http.gogithub.com/apernet/hysteria/extras/v2/auth/password.gogithub.com/apernet/hysteria/extras/v2/auth/userpass.gogithub.com/apernet/hysteria/extras/v2/masq/server.gogithub.com/babolivier/go-doh-client@v0.0.0-20201028162107-a76cff4cb8b6/errors.gogithub.com/babolivier/go-doh-client@v0.0.0-20201028162107-a76cff4cb8b6/http.gogithub.com/babolivier/go-doh-client@v0.0.0-20201028162107-a76cff4cb8b6/parser.gogithub.com/babolivier/go-doh-client@v0.0.0-20201028162107-a76cff4cb8b6/query.gogithub.com/babolivier/go-doh-client@v0.0.0-20201028162107-a76cff4cb8b6/resolver.gogithub.com/babolivier/go-doh-client@v0.0.0-20201028162107-a76cff4cb8b6/response.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/client.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/protocol.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/server.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_direct.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_https.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_standard.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_system.gogithub.com/apernet/hysteria/extras/v2/outbounds/interface.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_direct_linux.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_http.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_socks5.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest.gogithub.com/apernet/hysteria/extras/v2/outbounds/utils.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/internal/list.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/simplelru/lru.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/lru.gogithub.com/cloudflare/circl@v1.3.9/internal/conv/conv.gogithub.com/cloudflare/circl@v1.3.9/math/wnaf.gogithub.com/cloudflare/circl@v1.3.9/math/fp25519/fp.gogithub.com/cloudflare/circl@v1.3.9/math/fp25519/fp_noasm.gogithub.com/cloudflare/circl@v1.3.9/math/fp25519/fp_generic.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/ed25519.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/modular.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/mult.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/point.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/signapi.gogithub.com/cloudflare/circl@v1.3.9/math/fp448/fp.gogithub.com/cloudflare/circl@v1.3.9/math/fp448/fp_noasm.gogithub.com/cloudflare/circl@v1.3.9/math/fp448/fp_generic.gogithub.com/cloudflare/circl@v1.3.9/math/mlsbset/mlsbset.gogithub.com/cloudflare/circl@v1.3.9/math/mlsbset/power.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/scalar.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/curve.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/isogeny.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/point.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/twist.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/twistPoint.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/twist_basemult.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/keccakf.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/sha3.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/shake.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/xor_generic.gogithub.com/cloudflare/circl@v1.3.9/sign/ed448/ed448.gogithub.com/cloudflare/circl@v1.3.9/sign/ed448/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/generic.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/field.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/poly.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/pack.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/ntt.gogolang.org/x/sys@v0.23.0/cpu/cpu.gogolang.org/x/sys@v0.23.0/cpu/cpu_linux.gogolang.org/x/sys@v0.23.0/cpu/byteorder.gogolang.org/x/sys@v0.23.0/cpu/hwcap_linux.gogolang.org/x/sys@v0.23.0/cpu/runtime_auxv.gogolang.org/x/sys@v0.23.0/cpu/runtime_auxv_go121.gogithub.com/cloudflare/circl@v1.3.9/simd/keccakf1600/f1600x.gogithub.com/cloudflare/circl@v1.3.9/simd/keccakf1600/fallback.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/sample.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/pack.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/rounding.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium2/eddilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium2/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/sample.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/pack.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/rounding.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium3/eddilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium3/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/schemes/schemes.gogithub.com/cloudflare/circl@v1.3.9/pki/pki.gogithub.com/cloudflare/circl@v1.3.9/xof/k12/k12.gogolang.org/x/crypto@v0.26.0/blake2s/blake2s.gogolang.org/x/crypto@v0.26.0/blake2s/blake2s_ref.gogolang.org/x/crypto@v0.26.0/blake2s/blake2s_generic.gogolang.org/x/crypto@v0.26.0/blake2s/blake2x.gogithub.com/cloudflare/circl@v1.3.9/xof/xof.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/sample.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/poly.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/generic.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/field.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/ntt.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/internal/cpapke.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber1024/kyber.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/internal/cpapke.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber512/kyber.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/internal/cpapke.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber768/kyber.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/curve.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/curve_noasm.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/curve_generic.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/key.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/curve.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/curve_noasm.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/curve_generic.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/key.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/ckem.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/hybrid.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/xkem.gogolang.org/x/crypto@v0.26.0/cryptobyte/asn1.gogolang.org/x/crypto@v0.26.0/cryptobyte/builder.gogolang.org/x/crypto@v0.26.0/cryptobyte/string.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/alerts.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/authorization_data_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/cachedinformationtype_values.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificate_compression_algorithm_ids.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificate_status_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificte_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/cipher_suites.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/clientcertificatetype_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/comp_meth_ids.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/contenttype.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/ec_curve_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/ec_point_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/exttype_values.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/handshaketype.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hashalgorithm.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/heartbeat_message_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/heartbeat_mode.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_aead_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_kdf_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_kem_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/psk_key_exchange_mode.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_frame_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_transport_error_codes.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_transport_parameters.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/signaturealgorithm.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/signaturescheme.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/supplemental_data_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/supported_groups.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/usermappingtype_values.gogithub.com/cloudflare/circl@v1.3.9/ecc/p384/p384.gogithub.com/cloudflare/circl@v1.3.9/ecc/p384/p384_generic.gogithub.com/cloudflare/circl@v1.3.9/hpke/algs.gogithub.com/cloudflare/circl@v1.3.9/hpke/hybridkem.gogithub.com/cloudflare/circl@v1.3.9/hpke/kembase.gogithub.com/cloudflare/circl@v1.3.9/hpke/shortkem.gogithub.com/cloudflare/circl@v1.3.9/hpke/xkem.gogithub.com/andybalholm/brotli@v1.1.0/transform.gogithub.com/andybalholm/brotli@v1.1.0/http.gogithub.com/klauspost/compress@v1.17.9/internal/snapref/snappy.gogithub.com/klauspost/compress@v1.17.9/zstd/fse_predefined.gogithub.com/klauspost/compress@v1.17.9/zstd/snappy.gogithub.com/klauspost/compress@v1.17.9/zstd/seqdec.gogolang.org/x/crypto@v0.26.0/sha3/hashes.gogolang.org/x/crypto@v0.26.0/sha3/hashes_noasm.gogolang.org/x/crypto@v0.26.0/sha3/keccakf.gogolang.org/x/crypto@v0.26.0/sha3/sha3.gogolang.org/x/crypto@v0.26.0/sha3/xor.gogolang.org/x/crypto@v0.26.0/sha3/shake.gogithub.com/refraction-networking/utls@v1.6.6/cipher_suites.gogithub.com/refraction-networking/utls@v1.6.6/auth.gogithub.com/refraction-networking/utls@v1.6.6/common.gogithub.com/refraction-networking/utls@v1.6.6/cache.gogithub.com/refraction-networking/utls@v1.6.6/common_string.gogithub.com/refraction-networking/utls@v1.6.6/handshake_messages.gogithub.com/refraction-networking/utls@v1.6.6/handshake_server.gogithub.com/refraction-networking/utls@v1.6.6/ticket.gogithub.com/refraction-networking/utls@v1.6.6/tls_cf.gogithub.com/refraction-networking/utls@v1.6.6/u_common.gogithub.com/refraction-networking/utls@v1.6.6/u_ech_config.gogithub.com/refraction-networking/utls@v1.6.6/u_hpke.gogithub.com/cloudflare/circl@v1.3.9/hpke/hpke.gogithub.com/cloudflare/circl@v1.3.9/hpke/util.gogithub.com/refraction-networking/utls@v1.6.6/u_public.gogithub.com/refraction-networking/utls@v1.6.6/alert.gogithub.com/refraction-networking/utls@v1.6.6/u_pre_shared_key.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/header.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/packet_protector.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/quic.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/payload.gogithub.com/apernet/hysteria/extras/v2/sniff/sniff.gogithub.com/apernet/hysteria/extras/v2/trafficlogger/http.gogithub.com/apernet/hysteria/app/v2/cmd/root.gogithub.com/apernet/hysteria/app/v2/cmd/speedtest.gogithub.com/apernet/hysteria/app/v2/cmd/client.gogithub.com/apernet/hysteria/app/v2/internal/utils/qr.gogithub.com/apernet/hysteria/app/v2/cmd/errors.gogithub.com/apernet/hysteria/app/v2/cmd/ping.gogithub.com/apernet/hysteria/app/v2/cmd/server.gogithub.com/apernet/hysteria/app/v2/cmd/share.gogithub.com/apernet/hysteria/app/v2/cmd/update.gogithub.com/apernet/hysteria/app/v2/cmd/version.gogithub.com/apernet/hysteria/app/v2/main.go 8E`    9  , &      -   !* (#'(? 33 ) $# &   LLNM6    ! <W< ;b_$+LF...+     Xo NM6    <  cl   ( '('(!     "5 $'.-.)0  0 F $&34+,:>   0  $- 'A !$34  5<  " ~}       9*   < 09    E KHG=I<    6_ mp]ZYZ_9=]ST    ^ ; H; NMNM^gh  mnopong8t' ['9;= #  "2    !    %%        ''   ) 9    &6  ) )  ('($$  (.'( 5     DNM6    <  D     p "%14#D     =  OL  ORYZ        ) C55(   XRD\  hgh h(n          ('((    , 9 -) p1opY Qdc^ uzstM3&# XX X  Jg 21Vsbs"    /  ('( F( 4  21  e ( '(0 8 ('(J   ('(  0/0/0 /0H  <$ H&GHGH GHO    C$      @?@?@?@K U AK h'ghgh ghghgh gh#ghghghgh$ghgh=  '   @9NE    !<&mH  C  ='          878  @?@(  `'_`4 (( ('(#      @?@ ?@?@;   $+; @?@ ?@?@;    D%+;   T#   HyGHT)*#$`        s)1`  T 7  hghghr  Q212  U(k  @?@@  )*,RQM  *.        A < A  ,60 /0@   pop-opfopop#opop*@7H pYRQ5  @wtmn MNM7               _      !} 8 `|0 E    )  @V5"#   @  @M?@@B    "   N+B   J  ('()'(@RQ 8  =,   0/0@%        POP@   7.%<    7.<      7gggi      fffi       ' ffff{ W6        )   ) " #&%()  @+   ( '(@ ( '(   x4wx wx>wxwxBwxwxwx^wx@[ 1RQRQ x "   Za#$  klk7w      _       %$  3o 4 i[    . B ] )    HsGH@ RQRQC              t +C    @   _    0/0@    @      hXgh~}~} Y0  \ .     nka\.     3 *A2 " 56," >7 @= ,  *`  H6GH *)*) *)*) p $ 6     H>GHGH [   *%O.# **@ 0D     )   0 h @?@           :#*3"!:  &'987 "  #&'  ) :#: + :#:  6^[f   ; =   FG  2 3   BC67.  /:  ;" #   > ?  & '* +LK L.  &%#!###%""'65.""%"7>)%CJ G @' $ '!# %    HDGHT      H7  <R<;    <     #* ]#5      g )-#5 hgh(gh~     # #0+ 1 2 Z  TM +   4 1 21 24F   B;4    v1 21 2;<1  2;<;<H2/  &)#   1214 v       0>/0 /0 /08    +2]<$8 POP   I       "-D  I    xPwxR      \%  HHGH:    #X" :#&%(% #  w  _(/ #NM6    <  2 0CD1+.-e5fB$#  ) > J       _ (/ 0+/0  3+ 7  :+    #. ""  (+6 #*# &  0/0#       ('('    ('(    @?@?@?@?@" 9   0   9" "     h '"9   0 POP         '7 8s   `_`_`_`_`?   7   * 5& 7""   $n )?7   POP"        '8 ; t       !     HGHba2 \i   P&OPOPba R #.<9  , 8 78 !z     h 7:  /C p   +d7,-    A(R>  / K   ?    !?   & @9?@ N   B5P,OPOOP%OPdcdcCdcdc8  * 9C8 ('( *  0/0 -   ,, , `_`\6565D+ ,  4 &      +   $ $BaY   ?\6565HG1212HGHG12 HG ;G 65=12 12Y   |{    '.5.    2/  3$ kHD       9:#  W 9:BEX! :-    =@!+&) 'bL   C%        = Y 84787878\"65;<;< 2    7;" "\z yz    7       84    8G78Z\D12h   -.  yDh  \-   "  (('(\"  !"\  (&'( \ & <3/!     \ nemHn  &"V  B  +# ( eH  @?@\"  0/0\  PYOP;OPK\"0/0/ z 6/65%0/0 /z 3650/z  7  > %17 $ <!"  %     3   857878\65 6565 ;/    0  `_`EFEF{|rEF MV[ ^  }~ij}mn#mnmrq tFO<        #    0/0_`E` EFEF   '  9%        @\?@?@=@? B'EF'      $" J   "IJIF EFEJ IJ IJ     '&  %&xw)*vg"        H=GHGH-IJIFEJIJ  IJI{EF IJEF      !v}  $ /    B70%-                 EIF  IJIJ EFIJIJ IJ 4IJ$IJIJIJ   %&   bm F  +<!Z/%%& 3  <!Z/ Y  Z1L%.#S    "!$% (),+ .-401.-43$6587.-() J   "KLKF EFEL KLKL     '&  %& xw)*zk"       H=GHGH-KLKFELKLKLKLK{EF KLEF      !z  )  $ /    B*C%-               EKF  KLKL EFKLKL KL 4KL"KLKLKL   %&   ny R  +<!f/1%& 3  <!f/   e  f=L%.#Q    "!$% (),+ .-401.-43"6587.-() h,ghCgh1ghWghgh gh7ghgh'ENENMNMFEFEN MNMNMNMNMN "MNMNMN MNMNMN MNMNMN   *5z  qt}   m)*rq AJIJ;<  _` abW     ||:'     "!"!$# &%"('*),+ .-0/21 43216565  hGghgh- EFENMNEFENMN$MNM{EF MNEF        %ry hm:)  $ /    N)#0%-      $              EMF  MNMN EFMNMN MN 4MN'MNMNMN   %&   Xc >  +@%P-%& 3  @%P-  O  P'L%.#G    "!$% (),+ .-401.-'4365.-()( '(   (*'( #yz    + #('( `&_`_`V+,;   >03 "    V+,+,6 B1'^V^       /^#& 6&"V<;<;m     S  (  JI3?L' V+,+ , %&+, CD +, -dc"! S      vw  )mC#:        -U; V+,+ ,CD+,         9G>         ('(V+, <;87878V+,+,*  V+,-    @g?@V!+,_      ,Oe _ X`WX V+,<;+,+h;<     C si-   ,V+,   V+,"  0%/0./01/0/0 V $   !/9h @V!%&+&+,x     (# !x8h78V CD&  (($i7           hgh6ghkVCDt     / 5@   -t]V<;+,H    ]H H0GH VI  !V &p}~} *        6-  $LgJ~E  #      C=      M$   878V <;     0,/0R%      %%R !"G7<r   hgh%R<'(5!"Y        7'  1  X<5Y XvWXR'()@?!"NM'(       !T)   R5'((!"^ *)     ~}  1N1*   A3k(5(^ 0 /0/0)R!"!" !" !"& &  &  uv9:9:95po\%& GH9:9: 95po\%& :G'(' (HGH9:9:95po\%& 9:  xJ] `JD AJ     EVS MHGyzy|  pm   @= J%,+0, ,_&%-      :     $"! "!"!!$#(%&%*+, -0/" (A'( V QJ2$( @2?@?@uvIJuv     %# @8?@ PN    *        ()'('(\ 87     #  IZ 0/0  d    0/0 z   0/0     @ ?@   B?!    HGH       P9OPOP C,   @ 6 HoGH T  $  ,)   A0Q  HGHGH ?  rq ! ('( '   `_` \ [       X&WXE w 5k " +    "z (0#,+:9HGVUdcrqPj+`)" " " " " " " " " " " " " " " " ""! $"#&"%("'*"),"+."-0"/ 2"1S4"36"58"7m:"9<";>"=@"?B"A D"C F"E H"G J"I"L#K N"M P"O R"Q"T#ST" ('('$e * i7   # )k7e * $    D? $    $   ]    $ h(   77 ,ABh73}43  JQ)hO  ,  )6Odgh  4 1  + 3?>>$     h(     (_$*) */0/21                   nmnm     6)NM6    <   IJCLJ1R$gp34uQ c \}&-&+  =6            "!"   &%(' '7 878 $) $   < Sr GI  878.78j    1 ^     0 /0&   @5   (I'(&V  5  &  `_`E_`& T  6^ ^ T @?@&  $#   $#  2' fefef[ fef e 6    e# h      (:'(&$#$787$#   eeeiii7#$    @?@.?@?@?@?@?@&    ,         4X,  58& fefefe fefef e !  @?@?@5  \%& e     Ifef$ef e$#  6         B7  Jl;:         a              -Kd)YE     !        " !'$#&% ('()*)*),$+./0 /21436 p;op&H  ' POP&   &   $#$-$            N  9                 $ -$ Z&$&          [<$& 0'/0&$HG     $  0/0J(  &  ee fe-@?@?@5  \%& e q$2         *'(' (1210$#            -    ~dcdL ef e"   x    * J               ( 7  -0  VS    m|  -      1#           J  T7      #,/E(<  4 -      q$2 ! $%(   /0/065B8N78787:  =>=@?BABADC-DCDC~FEFILMPQTSTS VUXYZ Y87 `_`  (D'(&Q     E  #4   &  8,78D78&fefefef efefefef e         4        r(   &/zefefefe 2If y      *      hUZa dY T    +- #}/    2I  XwWX &#$78#"! 7OiaO/7#         &HG  " ~&`HG   *E :  K# Ow +0B+%o` 0/0B/0 &2'       21!   7 7&71 -0  G>     "#!&  ' @J?@&#   7 P#   &$   878&   7  7  ^     @C?@k?@?@ &  ! %*   , !5, ('() VhZZ 2]  $ l@    4&  ' @>?@ l;<;<;<;< apopchgj-   l9    #    x;kl;<;<;<;<;<; <;<;<;<   M ?;<    Eq,=!b234/0 e._J_ JE JI JQ 'UN          M?  ol4;<;<;<$;<;<   _ _o4$     l$   (T'( l=;<;<;<;<;< # &   __] ;  $       l;<;< &MR% XJWXWXWXl;<;<$;< F `Y\O%  P   hwghgh/l;<;<; <-;<;< ;<; <6 |     _ S _ ~E_   & ( ji ji"!>v         > @?@'(G  1, 87878K(!"C zoq5_. 2!C (  7"1        !"1xg5'   X>  71   XYWXWX ("\    0   * \ 8#7878(ji  ' HGH-GH( !"! 7mi   IPOD7iiK       1(S#_ (  tm& "70-    *   " +n  )GS    # _ 77(&D;  :#1 >=>=>5\%& c%"! >=>=>5\%& c>=>= >5\%& c>=>=>5\%& c "'PBXz?= ? &hg%"hwts hg#4('(J&#  0J JJ DC5,>+ * &    :#1  % " $%& ',)*) ./0 1634389: ;( P(%:G!_                    3=%)M%:G  !  _ ( !  7mb     @J?@?@ ?@( "7878787"!  7  ahhhhhhh     +  kh    A( "!  "! " !"7878787   aa  7  `` aa  `hhhhhhh               ! ( ""+$#$##> 9:#*nmn m "AnmW$# #$#$#$# $# .- "5"6      X  9:    s .x   #  # #             /1        . .E ,)3,J  / ' +        *  AW  "!$#$#&% "'*),+,+ .- 0/ 235676 ( T   {     N#(, \(AFEFE.FE>FEFE?     *'  &2h"QX j!;D)G8)G*('  "-*)   sX  I}:A.  >   ? HGH ((D;FEFEWFE  WFA++"  E.  K (W   XWXG(.-K.- (  \9/K a( .-. -X%FE FEFE        'F.B?"!6  7". Y21  7E;A    X  %   HtGH (.-0.+,-.+,-+ > !, CF"   [^ ghgRS};K0   + 878('   @n?@?@)?@?@^(.+,-.+,+,-.-.-.+ !FEFCW                PO /  g   !W hghzgh(  #; ; # "   .   &#N7$W  # ;     W (.+,+,-.+     c\     X/WX(<   $  0O/00  + P0  [ @? )D7IL4+,!   )  ;" [     [       X    6$Y>* (# 6 ' '          ;!) =I_`_L   ^>          " WX @  <C   T YRT R] (!         =I! 0%/0/0/06/0/0-$#*    "VW  mi- *  PO<;<~wT5\%& ^D     : 87  %"J      - ! %>J 45w    D PgOP   5\%& ^       J   h           8=78          F  @]?@5\%& ^   J    5      0,/0 /0,   0,  0^/0-           2[-               -  /         K  &" _`          i^     .5              "    5 \.     .5 0/0/0/0*: 9    3*   @'?@    @"?@?@[   "XWXWX. + #P+ +    XWX.+ #  ++ POP-+ #  ++ PjOP ' 5\%& ^ J  j%     d -.-.       xwx wxd)34343434343434   ' G)     (w'( d0%&%&H      sj0H ('( dr(   7 &   "dr(34347R'(r( 7fi     t dr(2 878d#    popd-.-.-.-.x&%&L( orqrqtst=      T  x   dr( r(@r(/0  r( r( "  7  `_         7        ?      @   "# Q d *   !$#>      ' `_`b_`@d.-.-J  1 .-.-W JQNM0?  ##$+    34Y#C!=J  1     Wd)   (d  d 3434 /0=/030            &1t+       H5GHdH   %  PXOPdE/0/0/434   H E     d/0/434  H/GHdC 7 !  d34  Sd34 T    (dS  QVUZ-&#+  (dL gnmp@&&+ fd7W XW XW XWX    63 v   7         > V    /)#  P?OP OP^  )  R-#  K f    ZI P P7OPOPQ    9 (k'('( X,H GH GHHG AD ? BY ^O XY ZWPi<8b            popopX' ( '('('('(V  ?  7  V 8H78 X'( HGHGHGHGHG HG UP U   @X~ ~'( ~. 77$   n  . " XC   @ p1opop6X'(' ( '($' ('(' ( 3(@ VS  6 'TS N M@JM   *A2   $   @ @U?@?@ X'(' (R  VS    5=A J {WX'(-( '(  '( 5('\%& 3'( -.-,+,-.-.-.-.-.-.-). +. -.-. -. -(*HG ' (-( -.-.!' (HGHGHG- .HG&'(-.- .:9-.-, -. -.  ;.5('\%& 3-.  <9 -. -.-.-.-.-.-.-.-.-.-.-.-.-.B   J! *%&u     X M#dU     R& <    $                  h  [ q%C %,;:  J  ]   M0   M 5E, <&8~r6 W<=     !"!$#&%&%('*)*)./,)+214367 <;>=@?BA ('DC  *FE H GJK ('('!N MPOPORQT SVU&XWZY\ [^]`_bcfe ('hgji lknmpotqrINuxyz {(Nuv}~gh  I+ ('('B % X-.- . ,  @5?@*B  ' X~~   7    #  pXA+. -.,  3           VA    ,    x@wxwxX  5('\%&3'(' ('('(+'('('('(   5('\%& 3  J                     J    '       +   ~X '( '('('('('(!' ( $             ~ k        !  n   D nU    I.  POPLOP n  (     : (('('(nH 4 0L/0nK=>      EK nD       n   XmWX'n,h2h2h2h2CD  71 7 Y  ,   0/0n        n#   (#'(n5   )  /n h2 CDh2C$D  7 R[f  MJ      ('('(n h2CDh2CDh2 7 41     @.?@n;   ! @]?@ *v    j%/ 7* L9*   7    0}/0*xvu            ~qx Z* bab%;<;ba<5\%&a     ba\OP%;<;ba<5\%&ab a  J         7  9$    J    YD.              ! #$#  ()* !   0*.'(' (-.-N<;<; <5\%& aI1  VS    XUR J       7Q FC D?  83 7 * _RSR% '(Fm, w&;I N    I1 @?@*) ! H%GH*.'(-$    ('( *& SV  . *C     =  .%*_ \a$2/0% KXE 0/0/0*5        !5  *43434"!<; + <;<;<; <5\%& a   7P=7  ]^UOVU"BX PJI &%&78        j # B 9 [  B%    "!$#$#&%&% &%+('* ),+,+.-0/4121 678 9  @?@ *0&,+#2          #            sG&    #       6*hghgXhg        e        <=         N&%  ( 4X        e (K'(* <;<;<; <5\%& a  j7L !       `_`l* zyzyo     .       Aki       z   P* 0"/0L*z  #>n4F 0/00*V  '++ @?@*baba UPab a 7  UX [* Z &  #     @?@*babaXPab a 7&  56'  ` ]      (     PzOP OP* 2babababab ahyzy 7  7$   2           ()'('(*hyzy 7 .*  @h?@'?@?@ * baba bab ahyzy  7       7 aV9        @Y?@ *baba$Pab a! !7!    1b3       (%'( * " !7! !,   0/0 *hyz2hyz2hyz2 hyzy #   "7!!" "7!!" "7!!#"7!!!!#!  "%&%()  87878 7878*? "$ '*! #7$= >54+* Q RIH?>Q h_^UV #$)#$"$@WC              ( * % $7%$%2/  00/0 * & $%%7%  0E/03`  5x% 1 `_` `2 a0/430!+,1& ~    c+677c p 'C   & @2?@?@` v$v$v$  78(    1` 61#  L %"S:9 2I!8 1    4      O         }`*,  &   : #  &        ,      ('('('(`56'  78 4+' `+, \ ,k        #   x:     L `E      ,  ,F3<  %    I-%%  % L -|{%3 ~ N    e       c"!"#$#&%&% 0/0K`+,+,+,+,P . "#,#&   P PYOPOPOPR`s+,a                 Y  Bi+  &  1 % xwxV`+,+"                     c ,            >+C0          ! #$% $ t` #$$ 9     hogh ,#feDfe       '* K#D ?,, 4342e4343&   pkn jL+  & < ,:  %$: (G'( '('(^fL     V^ #1Hv  ! #1H POPOP ^   )* gn DA,9 ,34   ZY j5           x_wxwxwx^  4/  23   H!"-. MZ* #7> Ym  LK 7,q{S2LRQ      "%&%(' *H)&  \& b>   *i3 (f'(/'('( b  ,Nt   b5G*H,HH 6=@?(<G #2?.9  5G*H,HHb-I.-(%           F5 >    9 "! -I 0/0/0'/0b` %TA" bn 1     C!  {b3    {3 b#   ('( .4    .dc     .dc     .dc  "  XWXrWX WXWX.   3 "<   7 '#$   Xb_^S7   @F7 Bb_/"Lj.R     31 "!$% () (I'('(.       B ? 7 7 Q2         2 .- |y   )   (:'(.        7 7>#       xiwxwx .1     7 -w$ .  . 0:/0.     7     PROPOP.^]^]2^]^ ]$  yzs  *TQRUEB;s*:2 $ HiGH.%    "   "     "   g%      HJGH."                K=  XRWXWX WX WXWX.       )a .'   X'WX"WXWX .J &    IFD J 6.H  $  z. ^]^]c^]^ ]   <K c   hgh.     7 (       ...    0/0 .&   87878U78. ^]^] \] \]^]       ':          xKwxwx#. ^ "/#! ^ @?@.,,#  b. O          3 O N.[ 47 $78 , `F_`.-h g      *- 4#D   878784    878784   4    (!'(4.   ( 4U  #$&-N"     4[    A ,) POPV4      $  #($G6 )   % #? U   :   _ (2'(4B    xwxqrqr4fe r4fqrqrqrqrqrqraref43qrqbqrqr  8Ti G7  wTvvwuv3 "      "! '&),-01 XWXWXeWXqrqrqrqrqrqrq rqrqbqrqrqrqrq rqrqr  `_ ,_+,I  w-2w}     !$#&#*+.- @T?@7qrqrqrqrqbqrqrqrqrqrqrqrqrqr& `_|Nwejivwrr_ t; 1   "# & ( '('()  878'qrqr% AFMH2%6@.?@)6Z  W Q 2 6   7   Q  6    9! 6   !  [                  !      [   p  p  `,_`_`pW+, +FE FEFEFEF>EF   >?@-&@+J ' %J     9J  EJ MN ( W      >98   !"j i9   (8   /27:      Y 8   v7nk@6323 7<     -N8&787&   fffiiffffi      {             8     ('(8     0v/0/08   ,   fsxqref!$ /,l"         8G78S788#       7   63  , 63 , 23  J  23  8<8       !"!$ #(  +  8(    0%/0,8 ZS    7           Q3     KQ      ,     7 O       %STd !"* t +, @?@?@?@ STD    +3 D !L!!!!!!HSTSTSTj R7   D343!$  J=  4kL I7lM  D\jPOPJOP| 7878G~     7 eQ 7XWXWX|&  #   (%'(|2  |K   ;/ 1H|@12?     QQ' y \   ? 87878|(  hggh%ghghSgh2gh| KL    2   3= + b}>V   ;   0 hDghghghgh|3#    I3#  |   8!78 |7  +   |    X/WX|+,0-XWXWX|  '  0/0|#      |    @|KLKL KL  I77878G H79878G-KL X_L?0"V^]       _M i!#    7 9-  |KLKL     mK  ' (-'(B r  P  0    B   @#B.   @!B,   @$B/   @"B-                     B!    B   + B@  +  EBP      4 @"?@?@B$ wmsy A. $ 7 hLgh\B JIJIJy0JIJ IaPI 8    ,  /7(    a   x3wxWwxeB*JIJI/0JI)JIJIJ I6JI   tWXW 4 83"434/01  783bl *) 6     !   #B0   P!OP^OPB      (6 EBV    ,B B  J  B=>'=>=>=>=0.>  E+P P: !$ $     #$#$E$ B  q,$9K3/8  q,$.-  q,$#+l]   . . 1k#|z 5.  #  !   '.. H&GHGHs=XWX!=>=0.>  %    . . #  5'!..  (%'(M > & CC DCDCDC DCD -CD2               $      ;  5,o #        -2 0"/0EYZLNHP D32T$  g 7 H LN #7` LN T\ 07/0 /0/0E     ! E      #          @9 %4 >A :A 69  #     !.  " Td )[  (  J^      Q     HGH   03/0@ +(8 popuEF:LN      (T wu  0  pop~opJ(7878R PPPKNNMMOQnn    mm   4/lmmm -  %:"   P     ?  J  J+  J  0XJ ( 7X_ WG  J  J h?ghJBABABy8 BAB Aa=BA8   ,952)&   a  =  pkopJBABA78)BABAB A6 BA9 (    7:k8) 6    9J        J   POJZ0 6 J<;  J  = J<;<; Aq *w         XxWX JG^]^ ]  7 ;         R G     J   7   $   ($'(JHGHG 34+  (  $%   @X?@ JBABA &  KL  KL     e1"  & J  !" !" TSRQ.121U  1 BAB A_                      7         !    (  50_      "  &'*),+ .- 011  _  "J+ FQ   ' + ('( J3  '! @?@J#21^]V   7     &  #       hlghsJBABAB%5\%& A BAB A06    J        . .' 0  5'      .. (J   _2_ >/  X.WXJ  PAB A00a06   )3  . .)  . .;6 5&6 5'  -   ..0.. &'J BA PA+  3& +J  7878       0    g!,'            J6&  J 7 87       " JBABO       4   J    .   XFWXJ 6y| ~  &8 & X%WXJ2 hAghJ$BABA BA BAB A          "$    `_`J -J    @?@J   HJ 5\%& A6 5\%& A /X J7_JUVU >  X77   ,9 #? m(056 ^ ( E    6  "!$#&%('*+,+*)'0-2367X:9  hgh J BABS  78 78"5\%& ABAB A K 7_ X_   JAH7      "!$# &%*'(',-. /212 1(#'(J'%& 6 JK =% J    POPOP:J21   . 8    7 {;7 DCD\72       #$# popJ BABABy_(5\%&A 5\%& A" PAB A 7  J       7  QR"V _    (  " ! $'( ' 6J%!  7  "%% XWXYJBABAcB A5'!  !7!B  g  AX  #,5:  "*A5'c         '  J" `_`J <; . 1* 5\%& A#     "J!!! # # (.:   *     J  % ! !!!"" ($   @n?@JS78787  %   !!!! >   $ %o6S  J   5\%& A521   . 1&$J###  % %"  &$$AX$&7'%& !!% % !N6        " !& 'FJ    2121( ##$ $((" #""#""G'#        )J   )% %$ $## )   J  )A$ $#$   8_7878 J BABA 78 78 B AB A * !!!! && *7*&&)*!!!!!#4         8'7878 J783+ ''%"3 0%/0/0J BABABAB ABA BAB A+ """""""""" """";     UJ 78 78 , +7,*+***,+7,+7,''+,**''R?       (5'(J., ,7,+    #J- XWXWXWX6J BABAPABA78PAPAB APAB A78BAB A9- $$$$,7 %c T%[776]B)), ^999,- -7 %$$M, $$$d**%%%%99a  l        !" !$#  @c?@5?@t?@?@?@!?@ ?@?@J)5 dcdcdc    0  / 99,,,AX,)  X  X w' / /. .+,.7X,$//.. ./-/-/%..-/%j + Z     " !$# &)0.-0/2367 :; >=@A `7_`J/780=0  . ..,   . .#0 5. ..   J78 781 ,,,,   G J  1 /X/0 00711101 %       @?@JZ 5\%& A 2     0J///  .,,)=Z   CZt0F[FJ7854  &,7 878    '/      "  #   5\%& A 78  65\%& A   5\%& A   7T5\%& A78  65\%& A[2  0X0.. 000AX0 27311335g0/ 1565f ff/ut 3732233)1K1)133)11 )114444$  1 >=>U12E)*) #22o#22o2   47X332 22&  232 455 557656'  /*r 4K4,46 6j 54t5L477 }6677 77666 655777667755(  50J000.,,) 5jj5- J555311.- 4'  35J444200-E56'  335e0J2220..+C5:jj:) J111/--*+dY4 6 c,6#7 H  ; 7%/" 0 !# & ?%@)@  4   !$%('*) ,-0143.-.-6587 : ='.-.-.-/@CHILKN QTUXY \ [^_ bcf i"lmpqt s.- xuzy|{~}#                9 8 78F787878J2  8 ////5K5.577  . 4 H9      A4J78  @[7 8789 44 6"m77777r q 7 77X677 ,,,,-.#V/ ,+,/ 0f ff5/0]`ef6 ,,,cfST10] Z, 0  ,-7`0B     / 8 8178078 78JT  :  ,,, ,- .--979 8989,X        @N?@J`: +++ ++++1, $  POP9OPOPOP OPOPJ(!  : *:7: 9:9; 9;9:/+  '(!     ( J ; :: ::  &  J < ; ;     ag(J78787878787878787878'5\%& < 11:J9998889q8888(==<7<(ia(;</h9//00/hhhh/88 <7=(ia(;= //  866&X7 "          "!$# *),-0 /67 :9<=>  878J@#78787878,=   zq <X;=7>=7>-2c>&&:c>,+=7d%%% .hhhhhhh:=> <>cdwjk9_ @   "#,J ? =>   POPJ5\%&A7878785\%& A ? =J<<<  ;995::::;$:: =J=== ;996> *    XWXsJ   5\%& A7878787878787806@ =J===== 8899<995:;;:;$:?7@$hhhhhhha$>@22. . .2=  5'      "!,- 0/2../@ J> =@ < < @  pkopJ7878785\%& A )06A /=== :<<:;$:=J>>>=;;8U0 033/ . .30 $ 5'     &.. 8T78J 78 5\%& A787878B ?J???==::=;;5:==:;$:4       3 J 5\%& A B @J???><;8     B  popJ78! =7878784B >>A B   <>>>AA:>>:;$:' !! =    3 J%C"`_`J^4DBJAAA   , CXBCXC Bc^4  J5\%& AE@>>;  0?JJE 57E 5 $J  F E7XCC_DDE#    878J7*#5\%& 5\%& AF A7JCCCB?? FFFB@@=DF/(#     @QJ\GEEGEGA 2 J 5\%& AG EJDDDCAA>    878J$H    H @]?@?@+?@?@J 5\%& A*5\%& A IGJFFFECC@ )ECC@E.  *    JI 8!78J  J  8:7878J J I7JHXGG_HHI!     POPJ 5 6 5  5\%& A78787878787878J F JGGGF I FDD5:FE:;$: J7dIXHH_IhhhhhhhaIJ   ?+-      ! &#() ,+67 @?@JM >>>>  JM  0/0JM   0/0J)M hghJBABA78D \A   5\%& ABAB AN DDDDIIKKM EKKKK9+"K LJLLL I IIINO JHHFFFFF  q@5 D          JO      2/0 `-_`aJ78%787878787878 P >MiL hhhhhhhhhhhhO7PNPIJ1         !  (R'('((J 78978P "OP!P8PMM =iL3D   5Q    Q  X`WXJ'787878787878Q hhhhhhhhhhhhQ7QPQaB+    J7878R9NNAMN & S3650SGJID S  JT TTTTT :J  !T TTC T( RRg ' UU    7  ";   %  !   fJV      )J/    878J%787878 787878SW  hhhhha  hhhhha  VV(S\     NR* 9 JZYZY XVVVVW7WVW 2   BJ 5\%& A!^]-^]^]^]78  5\%& A$5\%& A%C7878X VJVVV TRROXXXXLYXX7X (!   WZtsefXX T.s YYYXX YUUWJWWW-I63 RR USSP.-7#&WJWWWUSSP  Y7ZXZ"!*) &#    !&    UUVV:7  98  5 Ab6f8$(gCV$      !  -  !" #$(%&%*+, -%014587 :9<;< ;>=@?: 9:-9:9B 7& 7 J5\%& A[  XJXXXVTTQ (%'(J787878[WWWWVV  8BJM[ / 6 (5'(J  5\%& A[ YJYYYWUUR     878GJ#78E\ WW6 &  -#E J  \ [7\Z[   xwxwxwxwx)wxwxWJ *> 78S\ YY YY  "[\<9\ \YYs[][]*\]  C[\O  -     G @&?@?@4J$]KZZZ ZZ#[\+.$ J    $      "78-^ ]7^] ^^^ "^^]X\^^ -^^^7X\^^1 7  \_]]^  ^^^^\_]]] k\^r^7_____^K\^ ^U [  UV]]  ^X]_7`]_^ i\^`       $ !$% ('*),-0/ 2367:9:9<?B AD E HG"LINORSVWZ[- XmWXJ [ 5\%& A 5\%&A ` `7` =G `aa a_a_J^^^][[X][[X a`#a?"G)"7 X      !&%$ 0!/0J.b    2J$ b  ___ \!7$  J  6*7878b bbbbb7bbb``aXWa6`` ^^D 7   )*  ac.'__   x bcC"nX&_      6* ! (S'('(J78 d c7diacbbdbc ddh    J78 d ``  07/0/0J;78*f   ib#(%H/   @?@J+H78 )g fddd3230/ 4CDEJI Dbbf f K&+e$            @s?@ J78F g bbggwxyvu xklmpo lf f s i     0/0 /0Jg  dd 8#78 7878J678 7 8 h "   ddd d '06    9C J[787878i   eeeei7iiagi%c3[    ZJ7878j eei7jiahi?"     fJ7 8 787878$787878jf fhhhhhh "hghhhhf     YJ0787 8Ek ,-ggg g *X0 E @.?@?@?@ l    3 :J'HG HGABAABAB!ADBAB"ABq  qqqq ,qq-0qq ! qqqq 0,qqq +qqqq +qqqqp!')( *&mg'    A   ! C   "   xHwx           B  H3GH  877878L    4   /   8E7878Z   43 =  , ;<)         >-!Q'jI.E    7    H GH-    .NRpE   44       :&'(B' +   9-, 6-[a          6 s" a5 7Q78L 7 v8#  Q8 (<'(+ ,+b SV   f \ b (;'( 77 Q7 qhg b,7   77 q7    p?op*    5*          P5PJ@ (7      @Q?@?@UVUVUV UVUV  xw"!ws wV& &     @3?@ U V UV wxw )  (1'(UVUV UV2 & '  HNGH6 KL'"5 8Z78.# /KL0;KL<!I," 878H         ? @ t                        9  8789[\[\8  {}     C(98 VY[\   W &Y y ,[\A  "+,   R   " nR[mnR#  +& !"1. A:y ,A \OP[ %,$% (+'(-- --.97tHz :thc       C    --Pxw x  [ \] fq7/         0'/0&EFTS D   '&  5 4EFTSZ   -&y 5 4 -QRQRQR EFTSTF~ ~uv]qbJ10'      41'{ABABABABABABQRQRQRA)  BARJA)  B#AR  &  "VW?      ('&       "!P)!LO         ), ( _   !",-0 V{|, RI,/{,+ H       5y   ZWD     4-i2PEO   ] 5A*P3 x    4' {      R )  J )  #$%&%R('3('3*)*), 0/0      POPOPW   %C;     2) !* #  e  )/8A"                 8   CAC"     6) "== ?.(F$     =  @    < \]            "     < 87878K2 $%   2?21         G t /0/     342 ] r      fo                "$!&#(%*',).+0-2/416385:7<9>;@=D?FAHCJ     $!(%,)0-4185<9@=DAHELIPMTQXU\Y`]dahelipmtqxu|y} 0./0 z Wf%WF$mF,qZu~}T,V,!  OWFNZYVH xwxwxN2.-B& 2/:9JIVU"+*>Y(2 & XZWXWXWXNB..-   ZB  N    yxkl ! &{, 0  N!   N  wx   8M78N : WX 9    B   y |6        pgopop opopopNoy -+ %( L    oLO   /C F  +878N hghCgh?ghghNi.-N        +''& <.ONyzyij-;<;< yzy-.- yzy-;<;>=>=>=  HG>=  y KL-   :2        L B    8     ,%        B          rg     ESQ         <  !     L Y' X5 B         SQ   CJ;<     " ,+ 0/21 43658=65>=@?BA DCHENKR O\ Yfehg>=jmpo  xwx.NF0<R  ML )    6561         ," F0  <R.N6 +31 $ !   NEyzy-       o2#E E  NV >GB  N+   (oNz $+ A- -N 87  . (2'('('('( '('( '('(N".zy-g 2  3/'S="g('('(N. -. -    H%GHN .-   #   N   8D78NQ  4  HNGHN7. -  J[ U  0/0N"0/0N .-    -$E  !           )+# !   :  B   @i?@ ~ }~}+GHN 7612    CD8 Y <    +  ('(7    %  ( '('('(;   ).1.      (! , nn    ,  n PbOPOPOPOP OPOPOPOP .-.%     /4          PbOPOP OPOP OP9OP "!" 1(       '    xXwxwxwxwx wx,wx!  #/> <,   03/0/0/0i  K %  P/OPOPOP ^  E $&%&%$#$#        K   "  = H  POP+ !  0+/08  0   #     +m H!GH. "  " " H"GH/  !    #                    0 /0  0 /0  87878C Y ^  0     5   % 87878: WZeh $     wz    @??@7L6!"+     " !a6+ (Z'(L !"!"!"5!   )9?     5 8=78L   8 6   @A?@L     !.   @,?@L 7  &    2lL)FE!!"!"!" 5\%& ?)    7>47 >= j$! 5;    7]B ] ?2b(>%        )$#"! &% ('  x~wxwxL 5\%& ? !"(!"!"!" j,Ahg,+?F cv7 9   7;   M& M: L          "#&'*)*) HGHzL  FE)FE 2   87  &#    *i   ) 2 GxL     6 _?       '0-, /0 h   ?L?    ?     8 78Z78L$@      @ a      %- $ %   MLM^J I JIb     X       W%'O 5          L9:+< ;JI [JI    *   |M% ZM  P/0///       )49  3!i  )B Nw&Y 6(2<       +      [L  L  i     !L 9:U9:  Q\OPXD 9:. ! ibi".    R h?gh4L 3 78  j   3 878@78 78Lm    ;2V ( '( '("   G+!*  A de                   9$L'    4!*      A  "zz =>&I5E3     lghS    zWU      /    >     ,)    > +\e(  '% + ' !  &"          &I5E3 (5'(2=>    G 2 F44  (+(+(!    V3>n XWX)x   h#gh0 $&  x'wx4 (*  +8 ,.  0?/0b   !" @     PjOP}      q#! i           ( @@?@]    ! 8W781 _`2`212121 K      @_?@1_`2`212121 2R   ;   21      hIghghghghghghghghghBghghghgh       b     fPOPOP.67F !    xJD(RQRQ   I     <;&           5        = A   4= >%4B@8     {D   $   )2  popD~dc   )      ~ 0/0RDf  *42 0/0/0D  P)OPOP2OPDRQ$RQ       R     D6  .  @?@!?@DC je   7   BzzDHGHGHGH G%THGHG HGH GHGH G * !T  FEF "       S+,+:  kG  O )g 'U8        G<3   PEOPDRQRQ(    B ( 0&/0/0/0D%  &% RDb !+# @ ?@?@DNM   %   H+GHGH         .  + 1   >F     ,F XWX>!    878 >  x u   `k_` > q   ;  ]q 8578>  7> ('(>       77     g      (`'(>a       Wa 878>  =   7   ( 77D=   @?F1HKL1&    *Ww  !  =    "#( `_`> NMNM+,I   PMN M +>=> 7  7ZcU RQNL     (#$ #  POPOPOPOP>!        $ "     7   3"7       $7.>@!    !$ @ ?@W>I       "!   j      7 I   X2WXWX>       c %      t mt     F/ 7      ;>=H-  HG    H   )!-o  \% 8278>       $  xSwx$wxewx>    I            7  / ^-  (          h  cU#  I   0G/0*/0 /0/0 >  ( $    !   7     = '  &$  >r         $       n9:q  ^ h  cUC2121&7 )7}*A  r      $!$'   >      @(?@?@>        @H?@> 4 7   G" 4 @l?@ >        M  H7GH]GH2>  .  '(    n1   >( >  @5?@ ?@?@>     7  "       ` >     7    T       ;>    7  /    8<785B8  cdBXcd  7 w  _(:  BXcdBX 7  @?@E)cdBX BX  28 S (7  #)   +,+7dg "'  :@GMO g `S_`4cd' + 4' `_`    'fc dcdcdcdcd  X  X wq     %  0/0BX BX 7   BXBX 7   pHop"*  -."5OA P,OP   % E+ ! P+OP8  $  p7opD   (!     ' $ MO  " '" * xs  -1 uDC2 O *8Q R Q RQR?QRQRQRQR  )4 CD M cfehE%87:,   <; 4 6    C(U  8     ?       py;KQ R%QRQRQRQR   4   s        8 5, <$.' K % @?@^\ V /##0&\   QRQR   (*'( '('(M     + yj,  (#7"   E"  Y  QRQRQRQRQ R   "[-,+/ 0 -,  ) * -,   -, &5 8 -, 'C;  ?     @ 0j/0 K     SK      ('('('(V     A x;wxwxW    X6WXQR%    -% hghQRQR!QRQ RQRQRQ R  |w pmn k \ B!   0/0/0-    !!efefefKLKfx        bkbkl4  =F ( !x n     $C rl   yiQRQR&QRQR ]QRQRQRQR "   <  T  2       WXYZ3<3,#$ktmn         .A<KJ|st(   ('  ) >T ! 3 W            ]p F&& & AQR9QR     +,5A9   RQR/QRQ R  +        ("G /    0= 1(   %2     878786  8+78,78-7878    QRQR(  ji #B4 ( ('(Y'(      #l     Afeff  C, " ;>    `\8        `E_`    1    "+!   8(78778Kf$ef#   (4$   XWX (! +.32  ;AH  ('( '( '('('(.efQ     L.   x7wxwxa    $( `_`_`% )9   ' $ 3% )9 ef     @+?@?@ef,   '2, H&GHt3x   %!  t      tb8 b8#7^^P    ('(t  $6VUV y~ }|y           ~        ' '  (:'( tb8b8b8A7|: 6x     /tL        A  (.'(t)CDCD  %X_%   F  ; {{ /E  ;     ,$ @?        Bg F+.             @1  5 D               G  <      $ ('("    0#/0uu7 eH  E    1' b4 wELw~ /K0             popj     7:7 8,+,+ 7:7:7 8,+,+ 7:  tn m,nn m,ng       X WXj          `_`#j        &       " 6.-& 12   CDC.-. /03 8      &      j,   H)GH$<   &$ hghcgh gh+        R65 !          )6"+     0(/05     @3?@5?@#?@ ao  opo"X XR 7T  EHdc:tC$          " 08/0   <`:9'_%      ff fgj 6f&%&%5 6565\%& % 6    f56  f5 \%& %    4f     p8opfSV   #  &   @?@f'  P/OPf< ! ( xBwxf *     * !  Lf   '        f!  p3% 2 BG L{;2%1 % 87878&   X;WX7   07 U %  t             14                   $ # X7U                    l     ?-E l xQwx^ 1 1SW!  )2  .        321,16HI X*      )            4  `hd  |+] POPOP h7 8,+,+ 7878O  n m,  ! &3 .     O :hb  %= >h7U V UV   $ L7  44    878@  `_`q  3 ql   7H           VX/      (       $  qqG7>p  pUop v $         [ $v`:`:K7:t 87878&4  +L    + 6-% ]^!!(0^                       /( G-          54  "" V     9z NM6    <     Y-  )  POP]OP OP0/# $#i   W7 & "3f.    i ('(;'(   9K)   Af0, +   "'0M  (!   C&  %-9T 7-- 0  z, 0z%nQS "0  ahNM6  .+ "O F  a< QRC :_^ijNM6  0- $Q H  c< STE <a`  *!vu   8u + !S  !+ $343$34    * h 0* #  @4   6   oQ     0    0Z  b             3/7z       E  +    ~  HGHGH8   ##      POPOP.OPm   p],ASH GH%GHM  4+J85TX      UP ! BXcdcdBX 7_kn      PQOP -.-.+ 7d   5dc\%&  J      :"(         NC. -. -E            (  '         HGHJ7878d RaRRRR7   )&=! [  @T?@JBABABJPABAPAB A<  333337< ; 333; 333!@     JJ  B   DB[ L| p  0 @?@?@?@K K p'op opopop opop opop op opDopop              !   T , 7]^8 B  t         ('(     00/0rC ,$ @  ('(  @   @ 5  ,@  HGHjGHGHc+++1+=1Z   #7^ bn!  Bn*q)%   +1  = 1 ("'(    #2  1   (!'(H     5.\_0/0/  EF0/65656565650/0 /F12>65 651hg2J123656512i0/0 /0/09 0/0 /       5,+\%& /Y "     )<          xhg[[      >Uu1[5Uu1,uJ,     lUs+?   4 ":U           ) J      (q:#"=I"E.+_        %=  %2"!"!$#i&%& %('(),+, + .-2/0/456 7Y   (*'( '( \ ,    / ,\     HGH r     /' I @]?@?@>?@3EF EF<;<EF E{E{        '('T XAE!-       /{|5EF5EFEF E{EFEFEF{|{|{|{|    de X35  RE #;  !T$i  $                 /       ! $#&%('*),+,+.-.-0/2121434343 hZgh$ghFEFEFEF<;<EF-E{|{E{EF,EFEF                  Z                $ /       B$.'R%-       , "!"!+  &%    :               GDl :) x|wxwx%EF(EF EFEF8E{ EFJS#    U>U   27   k|4   v_ v#EF)$ AD   -v2*#.P&qL  $#.vqN  $uvz  #   `Y  * "!$#4(%"! *)*)%"!-,+# 0"/0o/0,5EFoEFEFEF    U    [T"   V   (a'(E x    fL x    878     ('(!   #             K   "IJIF EFEJ IJ IJ~   mpy '  "        @?@ / IJ IJ  IJIJIJIJ  VWZ cfeJOJG'STB C H?$   /            @?@ / IJ IJ  IJIJIJIJ  VWk b_`JO{~'B C H?$  /            K   "KLKF EFEL KLKL~   mpy '   o"       @?@ / KL KL  KLKLKLKL  VWZ cfeJOJG'STB C H?$   /            h-ghDgh3ghYghgh gh9ghgh'ENENMNMFEFEN MNMNMNMNMN "MNMNMN MNMNMN MNMNMN 5z        m]^    W=>  ~= '     "!"!$# &%"('*),+ .-0/21 43216565 pop / EF EF MNMN8MNMNMN  fg zwxwvX  3o5P Q  5PH&Q\]RQ $  &//      8  ("'('( <;%        8,787878:65F #57  87878 %  %    ('( 0C/0/0/0/0V+,+ ,%&+,<       -0 )='   '  V+,+ ,      XcWX"e   v8  L  &?  (*   ('('("'(* babab[bab ababab a bab a ,%        XSWX.`      E X9WX.F  -8  POPOP8   . 7F6323 / *D0      . &8* &#*B8%fsfcd[b_`[ B     00/06/0/08", fs fs B7          {U8$/     7   4;&'6323     )            p`h$%   5$6+ !$ %*  ' .    878 8   (   76323    3        ! XWX  iB+ $# BA  :/     K 5    #/+ B     A J BABA BAB A  H    @?@8?@?@ J  BABABJ PAB ABAB A 0 /// /&'&''70/ /. ''' .0''''13       JF JF     spopop J78-5\%&ADHCC FJEEE DBB?CC9G-    "0/0J .1 K 8 E   P!OPJ. 1 L 9 E  HGHJ. 1L  9 F J o3.JooKFo/0/2AJ  -o o oA   p %    "U",-)",-.   `<_`II  I UV  { UV  {  0/0     )  G H      !6.*     st      8v78 sPbsP  W7     t\ b                   XWX WX+0 C +,       1.?'0    02/0/0CD      ( " 0+/0/0J/0 /0 C8CC     ' 8     = 8   ': &     N8  `N        #$/# *    , 8    ;     :? ;    4Y    /  , (,'(OGH  ( &  &?t_  %q  ( "  -GH, y 4, 2   ! (+'(3~ }~}~}~}~}~}   %0:  POPOPP,_`G` _`G`_`G`~}~}~e_`G`>GH0   I` 6 . c  5+     3     I          >"!     X+WX GH        8b78$_`G`3   P2 M #3  L  0/0$/0/0 Y $  9:-   8 78278\ o pq# "  D    ;)*   ) 8    g[  R   \YaW1 qD J            40 5'2,D4NMV u v   _, 6 P2OPOP OPDZ      B @ ?@?@DNM ?D&  =<D $    , %81\;$  P3OP OP '     0   0Q/0/0><   =   `7_` >L   +7     XWX>$   B   ('( '($l 6      cdcd   cd-.-. -5dc\%&  -.-.-5dc\%&  BX*BXcd+ 7d'+,+,  2 +,cd+,+$   IJ    .+, ` |sJBA_ JVU7   r           2-92 20 4               !"  &%(),+*./2 3'2121656528787 87:9<;>=>AB AD CF EHGJILKNMNMNMPO RQR  `#_`0  ( ` _`_`P_`d0#$# MW7 =&  "%+4/    XWX)WXWXMWXdN# $#     +W7 p&  "+34M    0 /0  5I   = :*%  , @  (''(4)$ H'GH4 '4 '55)% '5 '5 '5 '  5@'@@88 )('8'87L  39QQ  79RR 8 9  R@9@@R9R9R9R9R9R 9  R@9@@R9R9R9R9R0                                    0,,?CJJ?*6`p@?@     0/0/00/0)?@    0$sr0 0 {z  0 3     .   !    #   @?@     "       !       878//    X@   (-'(:"  HHH  (\'(iiL (='(JJ2 MMM (/'(<1 ((22'  ('(** 6'  (<'(I1   8j7878||f ('(m-  0/07  0/012  0#/0KK@A $*0 8          :  (1'('(b`    9 W  (7'('(j    !; _ HLGH GHGHGH  &#  52= &) ("(.FLdj|,:L \  r      878                (&'( + n )? 1   ("'( ' 365.),?? -    %  5 ILKD =@EH[? ;   ('( # ehg`Y\o? )      y|{tmp? %    HGH $J (E'(R-  `_`*4    0/0/0 xJwx#wxwxwxwxwxwxwxwxwxwxwxwx:  NA  =@E  HOD 6wz       $ D,xQ<AW , 0%/0 /0C   * XVWX?WXWX C@7>?8        O\ u popop ">r/(     ">EF  "   n$.$/$$(    $ JCZW    @$!7 zy_  #    :1 "%/%#+%,$         @/?@ #   :&# |%  v'"p' +j+ & %7^7  2 !3V3  . +B `  9i      5  * Y  xuviNM6    <  !(!"em   ('('(    W    PiNM6    <  YZ V   (  A    E> A @,?@  ' K:  '    4     DB          #      "  kli       {|y #  B   kli$34  UP       ;   0  ( '( 6  +  t    {V_R NM6    <  $# ap    #)     #) !   "          4    "!R ('( '('(  ,) 8-78 7878,  C , h7ghwghghghghghjgh#gh-ghghghghghghzghghghghghghGghaghgh0 $   **D     V  q   " M~)!KMN3-"!"'.-VUX  OP!/4 +&34 +HGJ Q,+,C.-.NcKT9  H  ! 8>s0  $ "! & #$#$#$#$#*'('('('(',+,-.-05*87< ?:?FEJ     MHMN  8478 9      - ?!9 p5opop  9 KPKL GK8( 9 87878 +    ` _`B W  !9) ` _`b z   !\I 0 /0/04/0 "(0  %JCZW s6E"%     0/0/0/0 T    I %     & L    *B +       X>WX K (  #84       3Y I) !w4    8   ('(   (,'(= 0//0  $  7  (.kli{|yENM6    <   NM6    <    0$/0      |    H-GHGH*Z & * XWXWXWXTWXWXWX!l         %[@ & ?  R%  JCZW   ^h['K    R  _m   JCZW &!  *Q (;  & m     0 4 (* )   :P deP  $!"!($!"!)$!"!)$#         ' &(  )  )  9< F ? #'4@ ; () )    ?$# $!"!($#    (   @ % 5 ? (  X!WXWXB  7  i%8D 8k- 8L plop "!"! &"p )*  &;  #  &x 12 & #ECCD "!"!2"!2"!0"!E"!0"  < a <+ N?#, % w: pHGB=   & & & & * +& ! =; - - + A s1 = = ; >8 &ZE$  6& & & &&   J:#"!>"!F"!9"! "!    &         g  7 p :    2 I J R !:       PXOP(OPROP OP""!h"!9" &      & 8   8 % B1 A"&B&qq         /% PwOP  $  9 4;2 Y n  !X        q        !_  ' ?   4   3'   .' 3BE.UoU%  U  s      5G!  31 3 4          _[)3  24 2            _Z)2  .d t    094GPU43U4x CV KV GVq"  :UZUZ e A Lc/a?!DF     !8/89(%8/  &%$7878!*  x1wxEwx&wx&wxwx  ! $$'5 C(D2 | ""    &    "       #25! ?XZ   (  &47 "p%$  :          "@.b pop  #G" \ *  xm    )@54/(  (/( $ (7E9      !(= *  hghghS*   #  7- 7 &'G.K2 K      #   7- = :\ B2 0/07  "! 0   #  4          M/8N5 <          @?BAb{ 8;3 n *%    -/1 ""CTzI'  q26      6  XWXU    8   A7 4E   D7HG         H7GH GH Y     N'25 q P8      # 8`+!8-   h.ghgh W  Z Y^ ] XLD   h4ghgh ]4 D CH G BRJ  F  ^ R & %* )0$N I  X f    0|H I  0  e        0        M!HX H?    \[ %   ; [Oni, @           | "| PUOP**v    0 B** h;ghRgh5ghgh!        """ """ , '      K#!W!*~9jQ =!  !  8:78787878Z     O? ('(6'('(]'(&'( '('('( '( '(2'(/'('('( J    d,+ & mn     ]    VQ C     " 3Z# 4;  '$ J POP OP/     n1x)*K#! Y  34-  &%w    B) x>=>7>=    "(   =2      [ %     ` tKM+h!R  "!   Y  )D*W( $Qdc. 1  X cpi  hg dW   F  QXW  NM RE :oL" %# >!     * @?@?@ ?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@+0 "!          65*     />  3:   -+      POP%(    3.(  # "/    +    878                                     8!78!;!                                                                                                                                                                   ! 0/0/0 ;f  # $&/       <  % 4 D* !" ! V8 :& !" ! uL4 0/0/0/0B    # 0*/0/0/0    M/) @?@>?@?@?@p    "-*! /& @?@?@/  ' @?@?@0 ).( %            XS 878  ;" _         R n$z 0/0/0     #$)*  ,   HGH\GHGH ]`_d-"!"#(q| !%" 9e  KY         (8'( wx' . ' x`wx wx          ?# ? Y r )* g+   H): ' "     H?GH GH%      '  0"- $ ('( '()'(   4D' $   1       2   0/0/0/0W     = 3!       &!   :G  < 0>/0 1   (.1 POP   8  `!_`+_`_`Cr en   wbd%!C P?8      Pc  0%/0/0L       A*" POP*OPA. "*)4  *)4 *)4349@185 <-*+*= 49   If#8i>            x{wx'M8 $  S ) /'M 8,7878#nd    * .    czu~     a93  )        S.    $$  1PZ-    p"opop!O'aP    $   )% B/ O'a X`WX+v     )F(  kw     PC h-ghghghghdgh'%   @5    u p o h     "  2   1j Q(,_ %   @ *     5 #L        c&! "4  9  L)  %        '  .       [ 52Z!%    2   2\       Y 0o/0    zp    XAWXN   $        ,.-5/  PfOPD      a3D  xwxF     x*J F X,WX<(      X%WX& (*'(  + $    8   4                2   $    PKNILGJEHCFAD?B=' p   y| m +*4     2$ (@'('('(: :             .3 6(      &!$  W <=2:        " !&%& # ( '; ('(   !     `_`   /$+          ]3+*/$+ L-  x  ..  c1 x F                         #,  cdF       7 %  9G '  B              RQ 6O        +%    (1'(>>3&    *C5   #"  '& ]R *+ PBOP              8+B  "(        0 )+EE8+ .   7_ +B=65     .&)t7  w+<YYL E    ! $&K*%. &4   -        33- |>      m S SI  a             # =#l)  3  6  f  B1( (((  "   * $34       4   4 &(()))M:G=Q4Ef *  3  &      '-    11      H3^lD%Ca:) >J        N   +                                                       #                   L?Z        !   &       (       B  L L   :  > N     ;8 ))) 6()) 65 4 ((( (     ( (((((((((()) ((((((((((( ZYG U'&& &SI((( (  0&6KA  $G  J* L+,(,J !7. '7" R %     *-  " W    T   N   +     " !"!"!"!" #$#$#$#$# ( '('('('('( )*)*)*)*)*)#0-2 -4+.5.-07:5:5<;< ;> =>  ?@ AZ FCDCHGLMJ I&PMNMN Q TUTWX[XWV[V [^ ]B`_LX Cdc:>* fefe; t)              W /0>7NK00>7NK0/&&&&&&&&&&&& * J W P !#%7/ :#<&` <8@DH)*L)*P)*TFE&)*X)*\)*`+fK'0/C((#((      ;#*/    "#&'*+./21:43#43 H,GHGH= 2) 6       `R_`_`  ''((10>7NK X-  H?GHGH  10>7NK 6 `X_`_`)( 10>7NK  @6) H'GHGH8 X7WXWX  * H)GHGH: H+GHGH%  H-GHGH>' R>@)))))) > PHOP (B 20>7NK02(2  ( XHWXWXWX%WXWX7/i:#&K: 9'OP\''#''     ;*/i:# F0  ! 0 t" yz&&''00>7NK00>7NK"  " Y)ij00>7NK-!2 ) q))W00>7NK=! YQ ))(((() hRgh ) + 10>7NK01+<" )+ _ v^    + &  . z u  ((('/   +  ,   . r   9 @?@?@DC  !# NM6  !$ -  FE< 9  R    '     HGHeGH.."   1B!}  .." HGH2GH."  B!J  ." @8?@L $F )" @2?@F @ #" W    "" !6 0             P   "" 6 )      @?@?@?@?@DC"    $$" 0/0B/02-   %' $  Ju   J4&1> @?@    X_WXDWX    MNU  [G (X'( 32 ~   + - 2 d  G" "  ?$zhABAAX%Bs .&g  B_DaF%B_ ~  2= "   ! abA& G &IF!'-F/ !;b)DD @.-%   O/# ~   "-Q%@Q#!   +   m   ~WcR NM6    <  $# ]n      #)           #) !  !"      4"# $' *+,/21R (|'(        ~`                    ('('('('(-  * - HIGH GHGH,;    a    + h6ghghghghghkgh%gh-ghghghghghghzghghghghghghGghaghgh/ $   **D      F  a   " ~!K-"!"'.-  /4 +&34 + ,+,C.-.QCT;  H  ! 8>s/  $   "!"#$#&+*.-2 505<;@     C>CD    #     W  9   ! $     Dz          Hs    +   +         X'%n!GC  k #!%` 21 .)*  ;<      5        2]  )"IeAY   \J$  `  d    + s c 6+ ; 4? c         $34         16 9:9:9:[(=[@C? >!! (      0      y :   P0OPOP OP/OPOP x  ]t {H. B1 POPOPOP0OPOP   $R ('('( '('('( =    ) = :                - ;Z Q +;     :  @??@/:  "    A:   V$)" %  +3-&!)    "         &) %1  8s  4 %L KLK# """"' 6 %  HMGHGHGH9JI# #  #?!D9 B. =#     ,'   !y60!  '88 Dk$ % &(   0   HGH$G2HG HG#E~i*#DCDCDC!$      2  E  ""  ~"""""    "NM6            <           """$#"  !#NM6  !! !! !  !<  !!! !!!   """$## 5  4%%&$&2%%%% +   +++  $    #   t tpkLK ! !''  "   H '' && &&  fe  fe  65  :e,+,fefe     '3 % $-   .  ""'!!#NM6      ! !  !<  !!!  !!  """$#" TF   . "" t}f   .   ""   @M"$$$$$$!X+ %      )]0?-( (#$; D&/'/Fh   B ?0 B7C        ~"#5&%(' *),$+2(' ('#.-@0/6/<;BABAfDCFEFE6H G)JIGLKN ORQ*TS#VUPXWFXWXWXWXWXWZY1\[(   )A`_"!^_ babehghknmnqtsts vux uvuvuvuvuvuvuvuvuzyzy"!~ zy"!  "!   9! 0"/0/0* % n e( 8&&= -A e(%%*   X@*   "" $$$   #g1%2O @3?@?@! A+ ((  ((   F $  =D C(U/  d""9s+  +   % #;< ))))   %&g %&&&b #&& &&****Q&&&&SR&&&&SN&&&&QRQ&&3 ,+L&&\&&`g-    I( XEf  (eZo9  %- = {     (U/   d K @'?@?@-=8=;>* ZL].++      ( &"  ! '#: e5 U.T 74 ]"    /    4# / ,,#,+29:E) >  5$7,; ,-.+'('LK"Q Y1,   21,9      -  C BC :  !R"$#  : @?@+o   !     !I 8)/oW  !z   !        8 78$9 "  # 87878.   "  8>78H789  Z   <5" 6             @ 8;78, : 7_behknqtw "TN   # x)wx$Y ": # " L+   && &*N&$& -0  T 4R   Iy3|DYZ1  B ###!  @'- '-'-"" %J \[rPO     w  ?W? 4;<'-     lklwZ     e&34 +    MvX 1 ) ,Q, + kd  .a   +  """"   H.-. 4.   31  ^? ! ( +0('$;E  3H0  ; * ) + +'*iL$        ! ('*)&*+.-.-*),+ .-2143 65658723<;<;<)* 787 @&?@?:943 2121NFED12 ABILKL$K*)NMPOLQB K&FEPO TS-VUFEPOXWXWZYZY0L C\[\[^]@ ;c`_`_K(#T ba4R I  % O & ( F -1 2   k lklk      ^]  NI!lklI   1;n/4    6     eP(*)&af%;<    ""C1lklklgh  W   vq  @ # =  $ ] [*=.3 +I      %       O &   "!"!($# F &%-1('(' *)*)2   r ( z     v 2b (   z   .1$. {)&    |{   ,          ng( yvzy@*^        <zyl        +3 ;<F &  !        3  {*S    >'!2  4~7k       $ 1$.  {"!"!$#  )   '    ( '( '(%    ('('(\'(&  -                         5         8(784D  "I   #  HGHGHR  G'+ / 8/7878478(8   C>7NK  ^  %  (*'($      ~ )=     p$opfop,L Q    "%i 1     # &$N NM7      " #%~& 3     # D$| '"4 & F# < %%& 0/0 /0   !  ($'( '('(. >  %   !% [4u'     $ ('('('('('(d      S U     8+78$[&& " 9  # (!'('('(\   K M ''-5 469}*"0! F/  0   jwrK  n  E I-8G 0!    &          /  & W 8 7878787878(787878 #$'W  ('( .- "/NM:QF    *     (%'('('(\'( '(- >    *     -   popop4#/K    " > -  ( # /   "K# '6=   o# 8'78""    " pPop>-      -         (1'(<   %"$  @/?@$_  " = (# $ 1  # "  ('( '( "    " (X'(7~    W0    4   Ap $;!"- 8 78$< "  # H GHeGH! & /* /1: u  .. H GH2GH!    :  . (7'(C!  $  H . (1'(=!    B ( 0D/0/0/0/0/0/0-3 =" <5!!!  >;.) *!!9 lZ         `!_`$# "2  # 0l/0 B#      !  !!   $ *(  )  `_`$#       "0 # XZWX5=#   """ < 6    XYWXf$  " """  L$   A 878$G$  5! !!"(   # 8=78,J$  5!!""!" ;   '# 8R78, F$  5!!7!!!"B P      ## 8578$ !# ##1  ) 0'/0I% !# ###   (='(^% !# S8  D 878,% !5"""""4   # 878,% "5""" ""8   # w\D50UW& """""$"$$$ ""$ $ ##$ $$ "2$,"J      +$! "  # (E'(& #%[@  L 8$78$' #5####"    # 8%78$U' #5####"    # @d?@1?@.AL>' &&B?B% &  !% &&=  &&<3 :  )62Q&' 3  *   $ 8g78&DQ( ''.+.'(  "% ''%'' =  -5E 6   0 /0/0) ''   P3OPOP) ((>3: 9 *  & `"_`$) &&&&&&&"3  #) &&&&&&&" 0/0/0)   0"/0/0/0$ 4)  ''$!$!) $l$ 7  4*)) ('('('('('('(k* ))    `Z \ ' +  #:! (+'('('('('('(-  B+ **$$$*))$$>;((0+$),**;) T;&        8V, 7   @?@$M, )5))) )".   # HMGH 0- *'''''''''  AD  0 H;GH$- )))*  *"&$   ,# (-'(>- ,,&+  ,,, %2   K${- **** *"\  B# )<   . ,,*%+%*--+(((((((((++++++++++(((((((((+(((((((((QN0T'  ?-- 90                  ( (L'(41      ((6,62      2 0>7NK0  (&'('(13 00,,    /% 1(3 0      (  3   7C48j%3    2211 2     %u I =  .  O  % @2M'4 '  M' P\OPSOPOPOP4    33+ 33!+  -@   XSWXWX%WXWX(WXWX8WXWX5 33         #   '+]e        K  * c]6\3i5 4  4 RY444        L QR       L Q  R   L    ()6    85                         11      ########    ;  # #*# *'>$2 /:  _      #*       !"!"!"!"!"! $%('( )*),+,-. -.-<0/0/212 145# >.!< 0"/0/0/0/0/0/0/0/0/0/0/0J/0/0[/02/0J/0/0X/0/0/0/0/0  (&+     $%6 33*'334444/G44B45  +441,44444111111111444414411111111141111111114111111111115441,44HG411111111144> 55,,  55,,       55  ,  (&+      "     &#$#$#$#$#* '('('('(',+ .-01656 34343434387:9<;>=@?$BA% 9 ! 8 1155 ;1!  8 11  5555   8 56   @??@& 9 22 66 &  P*OP79    9   ! 9    PGOPh9 888""""""""""]H   POOP9 888) P   X6WXX9 888$$$8%!  9 888$$$8 XOWX9 888##########D    XWWXx: 888) mL    XEWX0WX:  88888$$$8*% !      @: 888'''8)!   P[OP: 9######### 99#qH   PcOP: 9)  99yP   P6OPC: 996655 ,$   X7WXD: 999' 9#  ;: 99* *: 999'  :::  99-4?' - C:; 99  -=?! &- 0//0;  ::::  *  P\OPi;   :: & * &W  PNOPOP; :### #### ::#}C  $<    C  ('(i'('((               'P ^E FB '$                  .)]T .6       @?@&3  8$2      )`. I  #&; $; $34   S $ 7# '  1U&A' * 3.      %  h(q    gjNM6  !$ -  FE< 9  R )    % ~e"2' 4 G  " H NM6  !$ -  FE< 9  R A    A @ ?@  & ""    )S %7= - !% 7A 5_ )"&%:I 3] ' &#:G @?@> !! " '   @0?@# !! T>!  "  " @ ?@"  " @>?@& $34!! L$     @ ?@"  " : *l            +64%<#2GT 4  <      (!'( 7   ! !  +     9   21 2 + 2%       '2/&   *pG  W5# `-    ? P8OPOP OPv     # k' %,I<    D 0/0" B  (P'(]@ HC  D   +    @?@        pop!!(! XWX! ('(#  8'78  (  P#OP$   )     %)*  ( '(  H5GH   ,-   H!GH11"$  `'_`$ 0%/0 (!    (<'( L        @ ?@  (>'(VN  8578"# H}GH a!! /* !!%1<*w.. HKGH /!! ! !&<+D. (C'() !$! !T) (='(# !! !#$ &  0/0" *  0#/0 )))) &   0$/0 )))) '   (C'( * *************S  - +++++>++ "@0  0/0      P&OP       P)OP   %   , h@gh    B,!                   /   $    /0>7NK0 +  - U1 "            $   6B {R 9. #&' b c*+r sB C j k> ? J KZ [  P UD  ) .  5" & E!G=:5y4e      8o6E    ?  ,0>7NK0, +     ? -   E   ?   "2 vw n oJ K./zfgj k   N O ] CVW  >?^ _FG*+ ~ Z [z {:;6D UN !` Q ^ ! u @ N  '"+$e1 WE2#  ! (    0     (            &+ :  ! (     0   (&)  $ '  ,+    u"  0#/0 GFG$   989 8%78 +*+$     Y  ZYnmvs ;K#  d  oHG@ VU IR    (J J $   g <q%V & )E  & :!            ) <  "! $#$&%&%1( '    =  3Y&")!#d  RQfeli M    \     k@?8   NM  @?  21  AJ$#   BH % lkj] %*C +H"+    !        " !"! $%*)0/65 <;@?D CHGHGHLKLK5N"MNM BC  *) "#65*) ./:9>? 2367 *):;*+ &'D             P2OP   ,   P5OP#  ,#  hLgh:     8$:   '  *8     '- 1>         HGH"   ^KL] L c fSTe T 12 ;<e E @   %0-b % $ (1'(O   7@   /           - . hgh4+*     M#  +*  PNOP   P:  ' xwxnwxwxlwxwx  &% D" "!  '  +   ")my [*> ) HjGH} $#$%* ) V#8' .  @R?@?@?@ ?@I?@?@?@j?@?@   - !     oj .%0)  ) QS xwx-%.      yF#%.  hBgh    ) / popvop2opopb| 8 C~9  @GNQ    *9      }XF |      (M'(ZZ7  (#'(((( (='((( 95 ( @#?@     R \l    @.?@z " $ U L I  "+   `O_` e m d4a  & 0# <  P@OP V } t'q  /$ -  XTWX $       052     4 6  (>'( '( [P   @ 7 (='( '('( U f    0 #4$U  ?   (+'('( '( h     L ?$    0    HGH5GH g   C6* # 00 5-7Z      0   @  UG   T@Q) L @"?@ R<!   popop  P  qn O     ;:   !   Q !002a ^ B pop V      "   &5 "3""% 3%( 3'6  i-V  "      %. )!)HWC 5(  5)    P8OPE     -    @?D' 9$=2 /*90! '(C16/   ?Q            $             .-vN        popopopKJ1)          (?NM  1) H;GHGHR     9( xwxwxwxwx)    *)   '  %*'   2'0Y5    p_opEop#  $*# '"  -. - 5$6, x|wxwx wx!    ,+    ( 2'04'    XWX?eb   .    nwp   Vm"e*"  PcOP.            %  )8 HGH%GHGH$#:$#T 3<  E0# XWXWXWXWX]WX    2-4P  hW X= _3?pZ X        #3 ]BQH= N  W X?DZ6     @6?@  $* #3      ?@Z2     8278   % 0*/0//0/0   "-Y 31`P %$            4$R%..`"         2m      $  16MT9Z ?eH4 P,OP  !   NO &  POOP   MR p k   .G  M 8(7878  Bz ,)  > B  %)>RL %               !  0&A&1gj wz       >)   0T } |  =   75' N Q5(38\+7"   1$)> R  L   %  P,OP[OPOPOPOP     !    YQ+^2 @.?@?@    ;ug(I)      s   $ H   # 5   I)JUL  W(XWZA=z %R /  %`,)   )     (  $ 8%7878   ! ()'(   = #  % <  HG  /  [EF E1 M ghk<)  8   8b|SR2  %  "B # # # #L #  EF E  EF E  "   EF E  EF E     DH     DC 'P)SD)0 B         L h # #! #   EF E  EF E      FNv+h    ! EQg #0 #4#,  ? EF E032  EF E;6 )6#  EF E)6#  ( %B7  < uC%'$ g  0  4   , }    JGHEF?;?$-  # # #"   EF E  EF E  EF EJGO)2/                ('(I( uruv $1 k( `b_`uR     )%  %K 5 # #,.  FEF E     @EF E   L7 C5$ 5    , `_`}5 #8   dEF E& F C-5  8 \     s d ))) ) H   H+6 ^ E10 -     s   ko}v#5\-]>P                                           < `               #    s8O ((( (((( ( NM # 6/0) )))))))))))) ))))))))))* :34*W.+, ) HAB;<QR.[.+, ) NGHABWX].+, ) TMNGH]^6M2&), ''''10>7NK0 1 ''''10>7NK0 1 $ 'opij/''( (&S.+, )NCD=>784 ef_`7v/**G 2e'E:  3 '! D6K                !"! $#$#( %&+* )*)*)*) 0/0/4 1276 5656565< ;<;<;<;))))))    +  *  *EX BC VCDcdWAL -C:!D cd  I:(ij QJQ"0M  .W d9 .W d-9 B#***1** *!*`?:S1>5WD      !$:1"     =      < @?@?@  5` 9   :9 T7 &SX+#"%<*)      !"   #)*) &, bI- ('('(   !5jQ          $,   # j, $           "  M X c . 0 P   @ I   "(#   #    O!hV+-L  30 !K  tuTU0  de<=lm, 3wDE( LM\]45$WZ (~ }~Wx wx Nv uv F~ }~ nV UVl mnk89=f^ ]^      V aN MN   "              )")++)#:( A     (               "!"!"!$#$#$!   HbGH3            !23 0&/0/0a  y~ }vyS")B $"  8&78'  @ ?@ rmpxu   hIghp 7<1#7&"  O H1GHGH   ) 6   H0GHUuvij '(  *$     A /     !'  <$" 4) $A/  (2'(       ZI   P#  I 0)/0* * xwxX   %('" c$  GO  ('(     8   ( 8(78 5l !" ``_`F      % -% X`WXWXWX WXWX   !n #      K-Z   n " !T; <W       !`i #    )K    `/; <, m  &4/   - D/$2    ( '(',                  0) %(                        a   "!     | `WD H[ >;  uve LU  HE <; 85+    '!  zG?R#?B )"< * $#" 6 '"j1*9  & 5   \( `3_`_`_`_`         (     a %      13V %  U+    A p,opgop (           e0& @ 8'787878(A    M R1( .  ( ' ( '  B!"   .  < 1.        #  x     !!)%&6B  .    B   , @?@?@?@.   0PZ W  #* #'(<E# E     "    0.T 897878.1    "31 P?OP _X  #<(     _ ,       z            D  $     ^ J" ] u    !!      "!     O$gM   Kq             n8(8bj4%!"> 0-!%   !  b 87878;b           % - ! 0/0/0/0/   # $1   FT < z ,O 7   e  -I=z ,O P6OP OPOPOPg     #75  878 78  @'@@@@@@@@`    QD X    #" p3op+opop  )) !*p)E (=)D:!]A: 1<   {')    6e 2MN) @y<;? ("  (   (  (|.   (| (|   ( N   ( V (|qr  qr{ G (|$  u K (| _ *(K c (| g (| Y (|/XW2A 9 (|B { (|m *4=q *,9 w (|KR   (|  (|O5 (| xw *(  *( x[  *(  *(l[\|  (|  (|{   (|  (|  (| O (|P, U (|,=>' *(m=>' (m*}C (|CD- *(i,} B+$/$.4#.u'Y  X# T D!*p)E         (   >:> A 7   19     0/0/0     /" /0/4302    %$$!&!(/&c'6"+ /$  c           1 PP   %9$  -%',  '  !49 !R/ xVp'U&w212121c21d21+21721)2152121N21N21H2121.212121212121,21S2121-21212121]2121;2121=2121X%.2121$]2121%2121$K212121@2121212121<2 12121212121Q21212121@21212121221#f  DC((V&2 (  V&2 (  V&25((V&2x(  V&2(  V&2 (  V&2 (  V&2(  V&2 (  V&2 (  V&2 7>       (  V&2W*  (  V&2!   @ V&2*(  V&2.  V&2  V&2"CH(  V&2(  V&2 %( V&2 =nm\ gv   (  V&25 (  V&2(  V&2)(  V&2(  V&2 (  V&2 X Y(  V&2 q 2(  V&2(  n&2(  V&2(  n&2(  V&2 (  V&2 (  V&2  (  V&2) c(  V&2  m(  V&2      $     $   $   $$    WZ    WZ (M      WZ   WZ #'     1         )          )        -(  V&2  )*[ 70 Q(  V&2  (  V&2)D)"*+)#x%'4%G//gEy#   O   4 4 \X~p"{TTuo >  b @ t G2Q C)   B   R  5,  D  91843w+ ? 38  *2 ,   Q+&7&& $&!2('&%&%*).0/0/21]:98787<;<;>=<;<;DCKL1IR-OT  BSTS-$Z1W\URU^]5`  _`_` _`_+ . %         #TS\Y &   VI  POPvOP OPOP  \ oz s   h-H#$8 0 *88 i1E33E1S%j2  2      no  .'  0  m v      :   (    DCR)?=O $Q)G $ - 0$ & : ( ( : & *  FAv$ i   1   R-S" %  8   2  2T   NID&               hu  NID cW  ~        ! <8L   _!'  ' &I. $    3j       "    h=gh  !+ 1 878 /    9  6 .    HGHGH  8       P  `_`(_`_`_` 9       X     %9  hGgh "]J  # 5 9  "j   878"=   ll &4? -!:^    ee    SS     )"= #-K6_ 6: #-  pop   $ T$M pop    2  K/O$  XWX   XWX    @(?@   ` %&   J,@  "#&%.*  @#?@0 $ @6?@ 71- @-?@ .($    p&op   8N7878   '(F9dc #(Z{(7aN.   ]/pyv ){(bifG P)m V +Q ^_`gps^  mZ,   oG;+n >KbhsU6AF O/ 88 6 :   N    <      878   T ,@ pJopW -B - 878782 " 8=7878 78$7878 7878    ! 0 % + 5!  POP        WZ   0 g  4  &%       1 1     !9  k <)s  *4X 0 1 0)**2 hu      ; ,  4 WZ    ;  WZ      >   WZ   Q `/_`<   0   `_` e h m p  >R        HCGHP      8   HEGHR       8    7D        WN        2   = !N.#3  N          WZ   WZ   WZ   4~      8v/             XWX&   o]     G %]  >5 G  * T815 G P >    * (> =J - 1 6     ;   I   DGFU  HWJY ( !    ux            WZ =# C k  %  >    "#     |   ;9WZ*   TP u) WZ **     F"R d b  ,;<1[xs  cd5 dC$  $k ]     R> "      0    %    FB @ @?@7?@?@7?@?@ ?@ ?@ ! "      33B 4~]  P                     SC*    -  Ra! {rYnmvu ^]f;<    M@?F EVU  g      wj ip o RQ fa b AL  k^]d ctsHQ  ZO  L ALMR  aTSZ YjiZ}@? r      zy  qq?F-D(   c        '                h+M    '7 J    k +M  [.          '.%T    %        %    t  9       wz} r} P#'  Z      -$                      %IV >?@GD   J#  8; 28; 2       4      (   $. ! &5 .-.%& '1U   k6 8?{ X %:Ci'V/3c    B                b   "  &  #$#('  %,+,  )>*).-. -.-E( 0 /212  /  P-OP(OPc *9 tn 34^[0W  ; <-B  ;<1 4Y y| }   E6 E0&        5 = c - B 8 W! )  !  h "  )M>         O/    "!"!($#$#-&%0('W P7OPOP[  .4' c    Z   :9:9  ,+  ,+,+,+          e^u  (0!8[ 1  Z A/AAjAA AA AA@  b       $   4$,@  b  [c'*: #8;.   #bhD @?@     !   -`3Q HGHGHGHGHGHGHGHGHGH+GHGHGH GHGHGH GHGHGHGHGHGHGHGHGHGH'GHGHGHGHGHGH/   tsC "*DC}  5.KD 54 "y $e g  NB]&p o#b3kN     A ?<?  & POP(OPOP    $ ! *    ?6 ;,:jS 0:/0/0bO 7;i %$) "     %    "'    $)    &+    (-    *    YV (s   VKL[    XMN L KTSTS  WZ   WZ       (i   KXJ            %H! "!(') HCGHGH GH GH       N$6Kl (x'( '(       -4  (^'(kk,4  @>?@?@ ?@ ?@       I&1Mi (v'( '(       +4  78g %$& "     %    "'    $)    &+    (-    *    YV (s   VKL[    XMN L KTSTS  WZ   WZ        (g    HXI            #H! "!('& CS 6 EU 8 0@5  4D5 p*op+ ,! ! -!  (!!- ! x,wx/  h(gh .! ! +!  h8gh!!  !+! @S?@ (*(  WZ  f( `&_`+  0=/0!$!  J! 0Q/0(((  WZ   ^( 0/0!!! pMop!4! 4  '+2!4!!  ! pDop!+! +  +)!+ 25  0J/0(!( WZ   W( 0;/0!!   H! pZop!9!      M!  pXop!9!    M!  @M?@!3 !      Z!   h=gh! +"! '!!!!  ,  ~.  IE 5^#; , &GB]   9; ,   9 '           XC  ' #EC  878          '  U@  & "C@  p2op    % H+GH       (  P$OP RQ  #  ^  efiha h8 f  ; $  h8;c  h8;c  h8;c $ tq +, =D   +,   ry   g1D/h  P                            &b     $.(  3 $$       W$$ ] ^        z    %   6  ll    *  Y       !", p(op5  0/0 6"   =|  % <  HG  / 1 M ghk<)  8   ;TW%  POPOP" #   "        `    U 'Lw@T  POP #       br: `E_`1_`_`  ?# 032 ;6 )6#  )6#  ( H/ ' q?$##      JGHEF?=E$/ HzGH   &O!   ( qnqr ~}$ high|N     ,)  'P XWXWX*        c @.#  @?@]{  "& : ?-  h^ &WX[ZS Z8 X  9"   Z8;U  Z8;U  Z8;U $ fc +, =D     +,   dk   Y48c9I.h  #            +         (&'( '(      /  ! .      ! . @)?@#   " # 0./0/0$   #( 05/0 )h   < v   + &+ H.GHGHGH  ( lijg  n  ( `4_`_`_`  0: PMNK R  0 p+op8    0/0/0.(   H/GHGH GHGH&,     %& %. g"     DQ @?@?@*.$   P~OP  c  @ % _`_2 #  %/c 0/0 | X3WXWXFf   "  0/0h         4  pk \W B/0/ ./0/ ./0/ ./0/ ./0/ .   ! - V O b4     \       bR     \268z|~ X0WX%WXWX*         ruporqr sD>     *" 8"7878 l     "+ `-_`1_` "u        c @'?@      p`opop"      #  B-K  xfwx "|            /-8     "     B  ( " #N 5%!" %   (<'('(($D baf inm z  (X (<'('(($" $ BAF INM - (Z  5e   POP($     (" < B7 RYb a      +K<& <( H&GHGHGH4 )2 /, )4: `0_`)_`_`4 BD HKFE HGH IHB      LZ 250/ 212 3b 8&7878784 'r -, 'z (-'('( Bp 4 8$78   =:y x      0'/0/0  UX/cd*  H&GHGHGH  - 30 -  W v             $,+       wx$  ,1#"            p2opGop    4%. - FEFCDC  W O    Hw    [         ),$    [           Dm    Q       ) (     Q        K TK L     L     N       )"2(    N       H    H      )".$    H            J  9     h t      %&  +$  3&%('.   - E^)U%'    9-       b 8p     C Y          0N1s)+ C Y CX     N!        ) (   N    !         CZ     P!        ) (   P    ! Ef     \$          ) "*   \    $ Ed     Z$          )  *   Z    $             M v    d 1              % )7    d   1  X0WX'WXWX       F@                PKOPOP OP *)/*)+        f) /+ X-WXWXWX  1    7. 1      5.       V[  YP6        XBWXWX!WX WXWX                a)      XAWXWX!WX WXWX                a)      `>_`_`_`$&  9'<;<t #Q  L%E  '$: 9@; < @&?@?@?@$ 'T *$ 2b$       j       VU65 )B#       r h*gh"ghgh$ 3 !92 3 P#OPOPP<     e T%121 2 +, +,#GHG HW+ ,Q lkbi <   -#&X W)24R()12%   # W QT,T&    @?@ ?@V7"   )# h&gh"ghgh8 +,  74 8 h&gh(ghgh8 + ,,   =:   `&_` _`_`8 + ,>  52  F p)op%opop8 +,P  <7 X: # $   `&_`"_`_`< / 0    <> 1 2  >,   x6wx{wx wx wxBF       + 0   GG\!P DWB  K"  %&%( %&%( ) $   %      " Gi B  Y .  opor *8565 *    ah(1*)W )/'   +     .     ('( '(   HGHGH  !   V@   -$12/12< 912!1821 2"  po  dm , `%;b%;   aD& & ] VS.&] 4     5 m     ))5;i!}   -$  /  < 9  !  8    XWX ~ E< e $X   %              3 #J  %/eX-|  `8_`_`XKf " X0D  xwx wxH7R      # xwx wxH6      #    <H>vuv u  ^7 > H    BA\[G\[\ [\[\[\[\[\[\[    Q    `    */>- *    CF cfkp QRQTw~,ghgj,+0qUVmny  -  U,E# E    /  / ( n&  +  , $ G                   Q  BAp ("      #u"   ` [\[ \        @!?@` [\[\ "       b"  0/   )   -#""%2!3 =/$   #" =  56  ,""9 0/0b    0/0b"   POP,n, rAx  @?@?@P  M     !        ,%IQ!    M lghe  @(?@?@  >3412+@=  ( P@OP XWXW      '  P=OPOP  XWXW 3>=@AR GJ ! '   POP*   "         V-'   "%"!    - W#!ZYZY(ZY6    36 <MPA VS  ( B QI  ??0 *'W#!( &!"!"! "!"!"!"!"!"!"!"!"!       1 0'\    "!   ('( '( h6.    " xFwx wxOwx!wxh UVU\UVUVU \FYZUVU \YZ UJ s|{  ' 2       ""'"%  F          ('( '('( h3S T     I 6 23  XiWXWXWXWXWXWXh[\[Z UVU\7S TS TS TU)21#T s|{g  y t o `_ Z'@(&b       hY Z; <  8+78h[\U\     B;5  X9WX t Y  ;<;<;< ; <        ~ ;H <-  HGH$GH 43434 3   #*   LI 43 @43 4 3&   *       (+1& P  @  & X3WXWXWX 43K E* K   h"gh0/   hnghgh 43434 343  ZW  d]X_`a`_ O#'%    P I 43 K43 4 3& "  * "       , )1* [  K  &       HFGHGHGH 43 0 ]`  4 ' 0 @!?@ 7   XJWXWX431  s z'2 *1 8"78 4=>3  A D%   @?@ ?@4   "  PuOPOP! 5     /79   HGH    (   43hg    !  Pm       .    ,C   243    X8WXWX&4343      & HGHv =>=>     N%(   N]   'N=>  !F C   @;?@?@?@N=>8 7.  '/ ) XMWXWXN@ '56 1 @)?@?@?@NB   '   1    @(?@?@?@NA   & 0 _N4 -  '%"*4 -  N 5_             )   JG   xwx"wxN+#$ 41   8  $!    _iR!Vlkl i0/-//76   TSTS /  ::98 U\[ --ARA$91G<!V -7   $  @%?@?@   HGH       P"b  53;L ]"(0/1 5 <-  ? *6(1 `C_` 0=>/2 !-# 2 hUghgh0/0/P qtqx-  7  3P POP OPe &#   '  #=e P=OP &#    `-_`__`_` 0/ /0/0//F _ ,+  +u/!*  F PROPOP 0//7 -4< 7 xVwx(wx)R   )e')R  P OP$OP> %  h-gh>ghgh[ %      5*[% xTwxwxHwxx2[ \[\[lkl .ijijijij .  D EHGHU\[  $ $"!"!   =52  .  H=GHGHPGHGHGHGH zX Z( '%&+,  !% {* X Z L |e*    Z  0@/0/0/0/0Vs4      3 a 8787878b    % :ERVHGH'GH^)])    /, OP r  o I 7(  H H'))V pWopop opopV*P OPO A B       4" )*    Bj &VDCGH3P OPOGHGH      0 Z & ) 3    `3_`#_`~op.  ni $ . * .  %&     )~   0/0/034 &    %  8  J   Hr   /u vi   vq n  q'| y  g     + 0 (<41C*/   q56^3. Kd(9)w\ e f5656 56uvu v56 u v5656 56uvu v^uvuv5? vv .E 6!6 5>'  fm +'!   uvu v'ihg   ,+hQ- ' R7RQ  JCDEFMB :Z4D1"&E&6'4"3T*         ^  X(WXWXH      $ T$ 2  $K    *XW XWXt              $ * t H*GHGH GHPX      3  HSGHGHP @<  ) 9 ,  @V  )   CN  Qs ta    =D  Q a?@V+& XWX4Z>=> =>*=>.     L * }v Z?<"!oKLKLSH g    ( @?@=B d*0!') 2 Q    S / Z"!<;&<  cdc h iFY &lw |I02 6  Il4]^0  43 6 $ /4 popopopRs38787h/RCDCD>8A        (   5^[4.a4 o   1 a(#%V2AM    = h,ghR9P  HGHGHGHRGh    ~ RXCDCD"  ^[#0   *5 "-%8  <  R?*CDCD+ x y (^[gp    3 +U%A  (%% H+GHGHGHGH,R     ' Hz y      878 )   (>'(&  (A'(N"!  (N'([".  (6'(( $"        0/0LKLK&%,+ LKLK&%,+    ('(zyzy  @?@ !  P!OP HGH   +  p)op!!   , !  !    !  L3 h    Y    *  L3 h    Y   ,   @*?@      H-GH      (  %    7FEF EC.    &% < @#  "!          P# s . 'H( A"*7 C   HNGHGHy     #&  Y "> 9%444  4 44@ 5 , +%444 9#444  4  4$ 4 > 5 , +#444    `_`&b              &+  ,%@% "!  &        j%" $b HQGHGH ~wm(7  -. !"&   !(       % + "27 [; @?@2?@Y     > @?@#C ?>A @9        p{opop d; $ &1 & +8 &   & !  &    (=E  Q#$VUVU VUH        &        !)    HAGHVU VU    '       `_`_`_ ,   -< = z  ,  KFE> -  $J5& / $ J5& 9:        F $%W.+I   , (       .   B        I     33 3 `0_`=       P'OP4      hFgh  )   `,_`       H#GH      hBgh )        )          xwx9wx0      (((#$ $# 4K 4 '"> # 4  0    6 r         "+# ##### 2% ( F W ?  "P"I%   "  # # 2%     !  HGH "!*    #    M # 8x78    #)\ `_`   '8? <i+'  HtGH&-  {|     wx   ; b&- |3   @9> 102 *0>7NK  %%D 2 8C&< $4%*)'6 Q Q3 02        & %  %      k      * )& %(!! !.%*%   ;^O !A"$*". A        % % %9 h    Q$      )0>7NK014f    010 $ %X ) . % # " $  =Gu""<   4    !0  $ kE$(D  2 3 N    ' !"[#"       878 ( ( ( ( 6E*      D  (  + (0>7NK0(BC  >? *+" #  F G :;  ./&'  23J   [67b'0>7NK0'  Q'S9H)  * D( /               >                             B  9    .    '    `                                              *  Y          t                         /87sc     +            1         P      .  0    2 \      D  %       ,      1                              >     +          5    2  5             !(         #         #  ( n                    &                      %    )         !        !    $    $ T &4 ![ " * k] - %]g c - 03 &\(_$4  }4-*' "(#) : *'% )) 4+t  !0z t" 6 ,D          +   1 02 " ! $ #$ #&%('('&%&%*)*)*,),+.-.1-0/214 3('( 3438765:9:9:9:9:9:9<;<;>=>=>+=@?@ ?@?@?BADCD2CF5EHG J IJIJIJIJI L KLKLKLKLKLKNM PORQTS=VUVUX#WXW ZYZ Y\[\[\#]`(_ b9'('('('b9' b a('babadcd&c 0/0/0/fe0/fefe0/fehgh%g4lkj ijijijijijijm'popopor!qrqrqnmn!mtst$svuv$u ('()                        / ('$0>7NK01    '     3)          e      R   0/0 /0 /0    ,# pop-    D     - ( " l   -     - gw   ,$ *#$Gfe/0   2.    '(    20 X      Q   D  /3.f$+# 5% "  2M81       7L >  d/ A= ; ^/ "8ALYL6LD" %'nW/,2    K   2    }$##  5"!"%!? %&2%      x* P    +    Y!N*  pyop   &3) "3'& (9'(J  + ?L              POPAOP        +%(  POPOPE  0 ( 2  X+WXWX>   (!'(3    6 !   POPOPOP $  B ? ) $ h4ghghghgghMgh          8 .      "!      wBv/8.        0g/0"  $#   3.Q            HEGH"GH v    o *Tk5  XnWX       @ V   `_`^_`_`D       cH=    @@?@M B?@*  1    ?I6l    ? BA BA BA B5 87 87 85Y%       @0?@ >      ")    h6gh8T #QET 0R/0 /0/0/0 /0            >S   / af |      #   UC0  ? _+' i        / af         US 9 _+    POPOPDOP                   "          6       o>      q2           h7ghRghWZY\ D      !5!` %     QD{   x ". 4 WC  } E : xwxwx<&     %         S  &           %               $; h>"?N&       @:?@0?@?@4 ' "      ,%$)(  !<g  hKgh            +7@)   M            1    '   8             SU  >Z_ . /J" # 2 3  * +6 7    VW& '#0>7NK0 1     0        ( ( (QE $  $1K..b]L       & #  88)   ;k   1' 8K 8"!& !(', '.-2-2389 @5?@E       )C  p3opYopv          @D(7!K  @  -h  % <  HG  /  M ghk<)  8   8CR2  YG"h, ? 4   "      !D9gh, ? 4 Rh>     3 `>  4FhO  ? 0    D$)Oh Uh   #b         ('(7h uruv Y `T_`hgR      %= ?h,.    !Q , #h.     #:. ;#   =-  . 1$&>  )*)*1x  [r  J[9HQ) . 1      -  38"L-&L vqrs!"  QRQR1!EAX    J  {49X%)     8  "  -  ('( '(        0/0/0        !$#&   PCOP#OP }  =>?B 7:9:9DCB  r" -# 0*/0/0  _`Ed Y\[fId !      @*?@$Z       B  #   8   '  #L    :   @1?@A    8678    # $1 X&WX WXWXl  6'E 0q/0 2( $   an  g L-` 2%$  P]OPOP OP8 Z<      @ -&"   2.          pBop           HGH[GH Y    "     8  $#&  X1WX>    '     (T'(%      6/ -  8%  (Q'(%    6/ -8%  -         /            pCop           878  -*143.9:9672 $v3  .B  ( < &  +? 9- P'OPOP * ":@?@?f@?@?@?    @?@?@?      @?@?@?     @?@?@?         W    7     a   5, @)?@     H0GH$@?@?     $@?@?@?@?EU   U  P,OP  @?@?@?@?@?@   .&     J   ; h6ghghghgh9     &%& +HAB         ;@     +%    Pe6 wj  P"OP F?@EFE  FE  &  hghgh  * kv   >1 4 zS)     * XuWX  &     1 X1)   & P7OPOP OPOP,OPOP\OP OPOPOPOP "     i        q  )   Wd"r  D  b  H.GHv  /  X\WX  QR  K J 1 @  M&)     #     1  X^WX  ?QR  K J 1 @  >N')    XfWX ! MQR  K J 1 @  L N')#    pop %'  '%1  (!G pop %'  '$1  '!G h)gh4gh % !+" `#_`9_` _`w     N() ,P N   4QR  K J 1 @   @ ;L<&)'H  9 9F * !$" 6C *! $ Ta ;((9 `-_`:        ( bababaQR  K  1     VU>-!    (    : $#$#$#QR  K  1      >-     :   " -.'$37:10  `2_`!_`_` K BA  Yd]Z  L>P,  6  8)78 JI     H)GHGHGHD    ' P$OP1  09/0(#        b3%# /          *   BA      & N    l   QR  K  1   * ,#E;:6N   l (  "   QR H 1 >   QR J  1 @    n^9353-CA#                 n >=e           &     ' J.{ e 0/0  !  1    !      !      !      !   .%  !         1 Z +   1   QR  K H   1 >        QR  K J 1 @   T]X+)Q           '  ?QR  K J   1 @     >  ?QR  K     1       >  9#:&%: Eg(# &% ,:a < QR  KH   1 >            ? )     !  F        ! F       ) +/ x+++/(' j=3!C' @                 x   `_`?_`)'  " 6N)'   N '  MQR  K   1      L    QR  K H 1 >   U.+%#'    3     S+  9BA9     %    QR  K F 1 <   QR  K J 1 @     /      R     1       QR  K  1        %=)&''i'!'%$#       7              % `&_`  ! "     [)  K  6  BA        QR  K 1   QR  K H 1 >    # S- g'3',G    /     $    HAGH GH GH GHGH|      6 X)WX6 " hSgh&gh  !! &a hghghgh)gh '   /-L!' hYgh'gh  !"  !)k |*D :% # (" *(s c*Z? "%;# *!(*(WC |*] :% ; (" ((s1 c*] "% ; *! ((Z1 h1gh.ghm ((  &G P(OP >   HGHGH"3,   `1_`=_`> />! "/P !$  6$"        B3`U     >5$n9l65 23$#           [Ka$C""  ," #  #" "> 7 "Y  #%4 8(7878"<         `O_`_`"\        9 \  878478(& !#&      J% !# `_`3_`_`&sD  "*#>+  POPOP&Dd (+ P+OP"OP& :95t  #  9 5 HGHGH&C !* 87878&8 +X  (''('(S 1" 18# $#&%.      on[ ^  P ? >1 4  i o("&%0 E  /       =? >1 4T    &,$&*  A    $    P haghgh    *"  %". !   `N_` d  +  (  # #!    -";6-'    X:WX R "  " 8   43 21 $#    ***&*%6 `C_` Z & 0 1 M Z. ,hg Z.A 8      P ST                       6^,x)],: 0      @    -    4  k     $*B?@A'B?@A  E`    Mh "    { )!  _ '        &%%  ")B?@A   ,"% ?                 T   >$G#&#J"T(            * ]    NJ  4 7 ,!I 8]78x      I,1 &    Vt     ? >1 4               G'(:3       5      VZ ; >   ? >1 4                 G'%5!              f!                             &           (.7.,*  -   "  2  8j78           +M  "  hghgh            ? >1 4    #'(&!       HGH              (U  B `_`             5\   F              pop 0 2++    + +           Jp8G0   =     I$G\nBA BA5 b%;P   PO<  %C RG   !     ? >1 4   R      D1  ?211 21  '21HG m !  z 1 " *= "!*+ %           n%%@355 !(9 *!(O   !       "         / $WBA  ? >1 4 $ %   #-'!% f   $M  C    "   P4 41 4J4}"   "    " :5 V     12;:5 .+J?  /// cK- S"!(-%;<U<1  0 7 *         )     21&>    (  %  "$-b   h             K'8)&#P'C5 /    S*            8r780TD CDCO        &Z.    ( W  ? >1 4     ? >1 4  &3N/$!     m       N        BR&u "  !K    F    FE @=<985  $| n}    `aF(A_p   ql ` QT EF8A_p*U* # 3 # 3 # )         $+{)  0 $   LK)65>         <1    cpoXU 49891dk9 u+S+)       L    2$#*gh%434/KL27    '% #    $U :!1')T," 1      2  l.(',('_                    "             *= &12  3F 1  !21"? 1   $ 5wY A>!%-- .,_      "         m <   #   Q 2  <   \D(  4( < ? >1 4"   % &$,   ( < PE    4         ? >1 4   &&$&#              $   `<_`5_`2 12121 2 1.    B2&   . 2?    +        F      . )     "$2-A     +     Or21 @1 21 @10      H;>,s         &Qn[^     f e 0 /\!#:Tr     & dU          %U        6  2e% 8X;  O                 '<'   '<'@  '$'1  q(  '('   JM           !-                                   -                  ]m!:G>O4%g ^pP    6      2 e% 8X;  O     @?@"?@?@"?@?@ 6 0  I0#/!  H a #4 :6    BA    Q,    YZS T 1 J  !&     5     $.kp/3=2O%#4 , 6           I_`B &  BA    (V4S14  <4{*4I)*)7)#^e# *47PE&       *!0%4+>.>.#!1F-&     4: H*GH  VU !          `f_`        ,aE , ('(   POP          T  P_OPOP9OP . & 2    .1O   g pdopopopop IL? DI P .$5   @ xwxwx?wxj  mrc jm v s+.4a   #    0 0,/0/0     B!3  "POPOPOPOPOPOP }tmdS 2;"      pQopop-op op    #   2      E$& x=wx&wxwxwx        %  *  %<f 2.-+ ',!(*$K^  +  +!( * T+  @O?@?@ 2 Q  O-& <S5@ ?:NM         + 55 : c  4" @ ?   dYZY>=         7"/   &   %#-,0  *r\    @!4'3      hA    B    #  "Q5)5 I      z      .      W  I  +  R  *       3  N  _  6      +    @           s &%& %@?&%&%&%H@?& %&%& %G&%& %$#l&%i$ #& %    )21**     4?  (?  ,??B?$0?  8? D??(, ? ,$?'  `             5  <5F=F"!('mnT         7 7  1  6  A" -0  ^       &  {<$0>7NK0$                  dy" S   %   $0>7NK  * #r!$    '0>7NK0'   <? @? &(hVY! * 3o6#@  24   8! $-: B;3 ,#!  ")M,  3P-N @*! H*$ 6!58 ?  ^% 1 (    Q  &   "!" #B& %8('L0$/0 / 212 1G434 365l89i@ ?["!"!&%DC  FE 0 /0/0/0&%&%  $  &  % @'?@?@?@   : y + &  %& %Y$#$ !0>7NK0 5 +! C> < #5   Y   $ <   Tc H/ !"#H7%&'H )H 9H    cLQ\  cV[\ ]^]d_6 $c< 0c045 #% r    ('( '('( '( '(5'( '( '( '( '( '( '( '( '(< \                     u \:F  :L Z ('( :3`  rx  :+  P9OP:J  &  :T   ?        . Q*-T ?:$    (.'(:>      M:_  \ /  L:3434 3 21 214343434  MQR  K  1   L < '<p1 !3 !;+(R         r:   47. -.C$ J     b)7$   $ =: (8'(:R  7: <  X  T:     "   Nj%h}8 2 0K/0/0:5,6$  K,$ XWX:       p$opop:D   %!    :  U4VWZY"d(.V$ 4"1 :  e fkr i(I!$ ),1 :   -  -/  $    1x,L/|!                + ~% 5F*V]@?w,1:    B   $  6  T < <q }56% """ " d8  # $$#  """ "FE"!! ! & s            0 )  # ,ktu nS) 0 z{     "+  ^ F1_"y yH-0) 2 a " $-H7747l       B       $" !"!$ #$#&%&%& % ( '('* ),+T0/.-.1<4 3<21216 56 5 6518 7J  0/    CrUa|%$.}:  5&      J   - ' 5*&             K     KR      Q QR       %zo zy  ' % 7&<d"  $;B'$  $ K1 -" K; -g) .d 9  %%#!$    H>Z^  Ro/0A                J  -"!" !'$ #&*  ( ' K&:  Y '0>7NK0 '&   (:-  Y%   BH|  % <  HG  / %1 M ghk<)  8 !  ;YW*  `_`_`"H (   " "  #$ 5*     m  b'UH^  `_`H (        l@ pJop6opopH  ?( 032 ;6 #6# /")6# /4 ,M7 / {E()' H XWXH "  +Y&    ('(NH, qnqr ~}(5 p, hnghHN     ",-  'U hghghH*     %   q G3&  POPgH  '* C E1 @&?@?@( 0 ++ ) X*WXWX( 0 ++ - .( 0  ++ 1 h.ghgh @(?@?@( 0 ++ + H(GHGH0 ++  `+_`_`( 0 ++ . , ;    :   878787JIJIJI$  P O ^ ]  0*/0 8787878 787^]^]^]^ ]`_ vuvuvuv uxw 0+/0878787$ Y878D787 h& 187 > 0F/087878 78 78 78 7   ;H    87 x8wxwx  -4 E   +%  -6  <   0-F ,+,WXW.#   #"T WXW<-" d n   X1WX|   !(# L$A '  S  e  c.%   - 0  N MHc1E5&                 f4ESL.NCRQ.SCRQ.S@VR      0             2     %        2     %        j c\ RU^UE % fE   L  #C& '*1Q4 7:ACD EHOQR UX_@b cf mr   zy|{~}  c4ESL.NCRQ.SCRQ.S@VR /  <   0 `g    X        2     %        2     %          RU^U         " cE   L  #C& '*1Q4 7:ACD EHOQR UX_@b cf mr   zy|{~} HGHVJ RU^U^UV           5%          M H;G;DPP   ( e   (    e  (    e    RU^U^U    M   H  #G& '*/2 5D8 9< AH S NMPORQTS  _4BAR.ACAR.ACAR.ACG Q              ]                  ]                  ]         ]      RU^U  # _B   R C" #&+R. 149C< =@ERH KNSCV WZ _ d  qlknmporq HUGHb Ub]`[^Y\UXSVQTQTORMPILGJEHEHCFAD=@;>9<9<7:58  ,+$!      *   {t }z{j spq` ifgV _\]L URSHAJK: J  9     !$#&'*),-0/236587:9< =  <    0 - # "   C Q$A '   S  e  c.%   - 0  N MHc6E5&         f4; UK.N9 TP.S9 TP.S6 ^Q     *           ,           ,            RU^U^Um %f;  K  !9$ #& -P0 36=9@ ?B IPL ORY6\ [^    el  wrqtsvuxw   c4; UK.N9 TP.S9 TP.S6 ^Q     *W.5    ,i  v}    h ,           ,            RU^U^U"c;  K  !9$ #& -P0 36=9@ ?B IPL ORY6\ [^    el  wrqtsvuxw HGH RJ RU^U^UV            z 5           C  9 ;; ;8 MN  1  "   U  "   U    RU         C   9   ;  !$ '8* ),   18 C >=@?BADC   a48 UG.A> UG.A> UG.A> mO    ?                W                   W                   W    RU^U^UV   $ a8  G >" !$ +G. 149>< ;> EGH KNS>V UX     q lknmporq b \ \rmpknilehcfadad_b]`Y\WZUXUXSVQTMPKNILILGJEHAD?B=@   43,)('    *   }vs}r {xyngpqf_hi^W`aVOXYNGPQ@ D  2    "!$#&%('*),+.-0/2143658 9 <  0- #" x1wxC U$A '   S  ec.%   - 0  N MHc:E5&     !  Z { P  s w P  p { P  r | P  u { P  r | P  u { P  r | P  u { P  r | P  u x P    y       N                      P          C    yr        P/           "CM    fm      L  P          C            P          C                 RU^U^U^U(             - {  !w$ +. 9{< CF Q|T [^i{l sv | {  | {  | x             Z { P  s w P  p { P  r | P  u { P  r | P  u { P  r | P  u { P  r | P  u x P     y       N                      P              C                P              C                P              C                P          C                 RU^U^U(* {  !w$ +. 9{< CF Q|T [^i{l sv | {  | {  | x            xwx&  l RU^U^U^U^UV(&              %  "!$#&% Q  @  lW          P  d  P    P    P    P    P   w   L      L            L            L            L                 RU^U^UV'     #& -0  GJ QT  kn ux                 g H p P  e L  { P  s L  { P  s L  { P  s L  { P  s L  { P   w!                                                                                   !        "  !    ""      ! "        #  #    ## RU^U^U^U^UV'( ))))))))))))+gp    L"  3{6 =@ KLN  _{b il wLz  {  L  {  L  {              hygh* ))))))))))))    +}y|wzuxuxsvqtmpknililgjehad_b]` - POHEDC<9870-,+$!     0  ~ t }z{pirsb_li^[heZ c`aP YVWF OLMB;DE:3<=2+45*#,- h ! @     "!$#&%(),+./214587:9<;>=@?BADCFEHGJ K<33 0.      F ,+,WXW.B#  ##      T WXW<-6 "  1 J$A '  S  e31c.%   - 0  N MHc/E5&     UGUUG                                       G<= UGUUG                                       G9=  ?1 +  RU^UVF0000000000000000001?              7 ('*),+.-0/21436587( hgh>k2 ,    22,>         % 3,33,4 &&&&&&&&  ,$ .'..(B &&&&&&&  '  P OOOOOOOOOOOOOOOOOO     (Q T nmfcbaZWVUNKJIB?>=6321*'&%   .    v |}l ursb_l ]fgVS` QZ[JGT ENOD=FG6 N   +     "!$#&'*),+./214367:9<;>=@ A 8=78 &:   & & xwxL @A  JS^  LF%#P  W  * )* ) r 9   3 65 8_      cNMN61e hg j  Q 8 + X -Wf4Hr `9-0  P  W   "#& %( '    .d   `>_`  /214',78.       9" * ) "  ("     - /  YZY\ [`  !%&#- / @?@  h,$* )   $   T$%,$     - 0     !m%?- 0                        !!)4              "!$# &%('*),+.-0/21436587:9<;>=@?BADCFEHGJILKNMPORQTSVUXWX WZ Y\ [                    YP; V          "!$#&%('*),+.-0/2143658787:9<;>=@?BADCFEF EH GJ I 8<78         $    k  ,+,+    * 0`    9 <i                               (       )0/"? wm[        & %, +2 18 7> =D CJ IP OV U)\ a.d cj qrui  G '* )Z       &     U@-p@   Z (     /                                                            " jefcXUb_T ]Z[JGT ENO> GDE4 =:;0)23" +() !   !          $9       !$#&%('*+.-0/21436587:9< ?B C FEF EH G LK 8?78 &>   ( &  P II  S] b QF'# P   W      v 9   7 :9 <c      cRQR2-ilk n  U < / \ 2Wh4Jw b9/0   P   W   " #& %( '    *h     3658+0;<"   #&     - /  ]^]` _d  #  h,$    $     - 0                                                     p       / 0e      9 >i                               (       )0/"? m[         & %, +2 18 7> =D CJ IP OV U)\ a0d cj qrui  G '  Z       &     ]@-x@    Z                "!$#&% 8B78&: +&  L ffp}  UF*# P   W      r 9 3 65 8_    cNMN61e hg jQ 8 + X 6Wk4M{ e920   P   W   " #& %( '    >  9"    - /# h,$    - 0                        t     3 0i     +++               9 =  i (   )0/"? m[              &  %,  +2  18  7>  =D  CJ  IP  OV  U)\ a/d  cj  qrui G '   Z   &     f@-@     Z (   " 0      )"      "!$%('*+.-01436587:9<;>=@?BADC 8G78&&: 330& &L 33& J  F  /              &#P  W     r 933 3 65 8_32    cNMN61e hg j32Q 8 + X +Wp4Rp j970  P  W   "#& %( ' &   >&  9&#   "  (#  &  &- /&# h&,$    &- 0   &           &        &    i&      33 ( 0^    ???&9 <i 333333333333333333333333333333(   3333)0/"? sm[        & %, +2 18 7> =D CJ IP OV U)\ a.d cj qrui G &' Z 3333  &     Q@-l@   Z (&!    / ! &       &   r&-A#-F 33 33'( 33% s7  8%Y'   !   !% } zo { m- A#-F  '( % y2  C%Y'    !   !% ]j ZO [ j- A #- F      #$   % r/  ?%Y'     !    !% ru  8   B pu xUwxb RG S h-A #- F      '(   % k-  :%Y'    !    !% o kn Yh    9   m k =      B [_      `_ N ?RM  "#&+./27:;>CFGJORSV[^_bgjknorsvwz{~                         4!               ~`  /  '      ;)`/-       321 ! U p  ;EE       > mV 8      T8DB HGH    $ ACESUKYSc]mgwq{(#  "#&+./27:;>CFGJORSV[^_bgjknorsv{ (O       P    xd [v  " !$%*A' H,GH .      F D     ~zr f Z N  -X`ggg1 a] MS  S   SQ*  6      80 (    "4<ACA1 `\ )/  -   /+*        `3_`@ , (2'('(+*)*)*) |!7+  H&GHGH #   + # ,  ('( 1  ('( ,   [  ,    I44 565 4343     I  . xwxwx.  L' ( H   "  ) /#  +'  G   `K_`_`.X' ( Z  "  /#)X   a .wn       &8  "   `G_`_`.-)*) *' ( jklm# &  F-   .f >  "  1 [^] ` b 34 C@ !C f  >    !$)",/0/ P3OPOP OP P      P hghOghgh a   >" "  a XWWX n    B $ n `_`^_` _` s pqr  no # e$&1  b xhwxwx J  N         &+J J.,$,N*B .% 1V r%ojc# 2303.1,/*-  -          1 .% 1 %# )(+(-*/,1.  -          1  p%  g f  & +*  3gh"%  6   F ' 4   X/WXf    P4OP  :v Gb ;!: a|   D 3        D   %     Ud,0 #  D hghTC      F        /1-QC##  'W   x     b)y'7 (% Wx (#'('(      "   "    `_`*$  w-= #  :  N  p    (4 Q$#J $# PDOP&OPOPJr   L J 02/0 =@9:?@9:( #T n ORKL      n `_`E_`o    !          eY $ C CQR  K J1 @ BEQR  K JFI 1 @FI  FIDGQR  K JFGHQ1 @FGHQ FGHGFOQR  K F 1 < NQQR  K FVS 1 <VS VSPSQR  K JT]1 @T] TSR     QR  K  1  QR  K J 1 @   vUTlXS^t,C/+1-1-I-2/1-&    &)+:)%                                         & &e*)*),+,+.-.-Y0/0/2121214 36 96 96765$<  ;BABAC @?@,?@       C# "0   QR  K H 1 >                  B8 &)!-&d-  C#     "    0 J0       ?5 HGHGH    xCwxwx 1  0? (4'(6  @?@?@?@      x wxwxwx M         W)  #7" M  ppop         # `6_`       P>OP\      k%          $        @3"    $ @$?@ :    H8GH       $| T          ^)#7 T  ,^T                  (      > K L K          F                 /sH' _        (    ##  @$?@?@          9 ** h'gh44*..$ (( ,," & #  h(gh  878    P"OP % &%&%J       0//0   2  1 @-?@?@?@&( '       !&  @#?@?@ ?@;( '     ( &  0/0/0P* )9( '       )uy  7    %  &%&%   $ !&%&%&%    &%&%&%                   !%  E+$.V )p  PzOPOP\OP *2( ' ( 'u  `  3&%").]     % %# (> *  "+j       !     i,&%&%&%&%     ^*9 #T^*/H+          8y78  J      *Qi  N 8R78   E&# )  cx B    l.'       k B   m t&#    Zw  *"    z$ #$%&%&%$# $#$ #$#$##U$#$%&%&%$# $#$ #$#$##Q$#$%&%&%$# $#$ #$#$##Q$#0&%&%&% *  5              #>           #                #      &   *)*  %Z[& 'ACxN> 7N>7N><C z   !     "       !   !0"! "!$#$#$#$#$#-$# ,&%&%&%    S  B      X.!    EEE                                           ( '          _5 {"r*                 #&'( )*)*), -. /0/j214187870 /(    B               n\. n        9  S   ,       `   _                2   %        $! &# (% *' ,) .+ 0- 2' 5  6+ 8      +@_     2%   ('('('('(                       ( ~             26l $#$ ! & %( '* )               XWX  /%,         - d4++/%, \00-   .... 2!!  J                      )2         gJ       <J  "          =       2       0 @  3 :9 ('6SVU     @/  E   43$ "/  cF#=      2006,+21      `_` I$#$ #$  #$#$#$#$        ;'WzI     hgh&ghgh $#$   6#9$   k   &  #  (''i  &9  @%?@?@?@  ' ;!24 3436&34 314 3436 34 3434 " #   .0>7NK0 . ".0>7NK0 . .0>7NK0 . .0>7NK0 .         @{u)oJ   &  1 "$ & %"  p[opopFC   #$   K/9b  @+?@?@"?@  KLCD   EK1 @/?@?@A  ijal   !o > @??@?@    S 721+        .  ++ `\_`_` _`_`    8  y    & 2  ( 2 H('E   & +"2#  Z )4E @A?@?@?@     I T 87878 4 1   87878 , )   ("'('( #,  $ @?@?@ =>78 $ m W434 3=   QR  K H 1 >    (0>7NK0 ((0>7NK0 (% #    X     o)% m  W  = ? Z, 9212,121212 1"21    x              jM:9      " XtWX (  C    &  k   &  XzWX (  E    ( !  m   (  XWX (   I    , $$ #q   ,  `_` (  P    3 '  $'    3  ( '((     0(/0/0(; # (#'('((9    # popop(0        3    4'      #%'>   3[  139(}  u     IJ49@    EN3K# Bk z 08A3  n( @ ,*<[%(9j   2o  31  `6 ;cs b );6w    '       P;OPOPOPH    |  !   4H     (8'('(   " hghgh*gh$"    #       X W P    V s"          # (n'( '( '( '( (  1(' 21(  1(' 21(  /(' / 0++ ,'d " V)        ($'('(    878  %  `_`  HGHGHGHGHGH(  /2 `(  /2 '(  /2 `(  /(`s KbOSjn"tN               s """  >(  /2 `(  /2 '(  /2 `(  /(`   O7:#####  % N,%>        E1:9:9 :  /#1    @$?@?@2 :9   7+ 2  xwx: 7 87 8>9: 7 87 8C9:9           3t~'#' &'        3    v u          !h!      4     hghghghghghgh"(  /2 `(  /2 '(  /2 `(  /(`    $N"        XZWXWXN   !N  2 /       PKOPOP`*     %J  VF# u m v      %m  ) J7; AD=>   svop%   _b[\*/ 0#   J7; x$wx"wxwx C 2  C h% #        =+,%         #  &      (+ 3   &!(  /('      4!  d!c 33  !     \![   !    T !S      !    J !I      ! %  3         e)+7  3  ^T(    F   R ~  \     x              H' _  (       ##  x^wx @ )      # *@ ) RGO 85R QR QR QR QRQR QRQR Q%R Q*R7               #!,$ K5         % * HQGH)/RQR( !N   G./ ( p`op;R Q tst!"sW       >C W     N8R QR QR QR Q5RO  )R QR(QR7         w            %!   +rG    5   )     ) RQR Q  RQWR QR= R QRQ               u% E'#     W      xQwxXwxwx8R QRQR K0R     K , ("=8  0        878       K  1    e    'uMNM L 4J+!  C -      *# G         }              .+!\?#y (*#  7        H+GH (    3     H2GH /   00/0&    e f  &  Q*   pnlj8   *   b  '   O/.'  V0 * ,    ,5(?   2V0 U0 *     ?   2U0 T1 * %    ,+(?  ,T 1 S1 * KE    ?  ,S 1 v/, _e   .*3  / , t T( '     +-    ;<2                  1 2 2 mW          ZgB `(_`5 D )     W a _ b  ADCFE)p G)v8 $  (   `&_` <     '      (  ,   G=    0=       ,  =   XWX*     /IABABKT 1'0CF  5 6   g   _jb  f 4 N  U K .  N L  T P .  S L  T P .  S I  m  $ Q    *          ,          ,          |{t R U^  U]   [%fN  K  !L$ #& -P0 36=L@ ?B IPL ORYI\ [^      ej wrqtsvuxw HGH t J R   U^ U^UV2R    V    L  ;   N  ;   K  i   N 5 "   Y "   Y  R   U^ U         VV   L   N  !$ 'K* ),    18C >=@?BADC  j 4 K  A ] .  A L  A ] .  A L  A ] .  A L  i  O       W           W           W      W   R   U^ U             W& jK  ] L " ']* -05L8 7: ?]B EHMLP OR    W ^ i dcfehgji\rmpknilehcfadad_b]`Y\WZUXUXSVQTMPKNILILGJEHAD?B=@ 43,)('    [   4.nD * Fi %!   #   298 4   .   n  *** -g   *   '   $#  :/'& C> CD)'P   # ::@)*$5+" !# " -g *      ;Id :    IW~ H     @Q?@      cx_     #K          U , ,     , '  ,   ,1  '6   $    `;_`_`D    5 @?@?@?@P    ! &4    Z    [ZW 0/d c badcb14 >h:9412'        3,(            212 nx}z   X,WX 9   p>opcopop7" ! )  " > W     ` d7   )  yO  %     &~           7 )+N' e .  %        &   dEFEN?(   01/0z klkteN `._` "   R/19/,- ;  h     QR    KL  _`     k p = V . ~"") "- ;    =    p^op op" =          b " %  y)"    /   } P."/ <# N -  .     +           = >  ;      ?>=>  #.m 5*A# N -  .   +     &: Y,                 - :2: Y,     ,"!""` aNghg((gM  t(N HCGH*x{zy$* h;gh  /    /,   aba  POP """""" ! " " 9'9 / 6 6 5 6   , +&--,-6  pop op opop      V pq  #  & l = `<_` _` _`_`  X      ! , '+AX hxghgh ghghgh       43 4 3!4 343 oj      Y )Rb  !    XKWXWX0WX  ;434343434343    ! <$ 'ME9h;     `_` _`*_` 5      @  5   XWXWX   P9OPOPNOPHOP        s             }f& \?         s  h\ghgh gh gh gh  #<;<;0     T 83 #0    @ $          g  ! n727  0&      d  v4 3E g43437          4       { jv       -     !a !X_3    :v E g7   K 436 ? 4+5 K  b$     5 0qD(    4 12/   ' M x 4       5   h  - |  2 %&`4ZT   Q ' z     0  8.787878#7878t    ^T('('('   p%op"opU  #" K  E7* - '      %88  3t& 0   B* - ' z.99*  & / /   QR  K J1 @          pa!C-   #  & / /  R"=,+H   /    #>{ l       ^  QR  K H 1 >  QR  K J1 @ 5NI    "  C K W:,&WE)4-7<$ J - =H   /         #>{ hggh     1(  9X h     $# & %& % &%& % &        "H          J  "$#   N   QR  K H 1 >          & '  Y  Y$")&  J "c"""""" "" """"4$#& %& %& %& %& %6&%&2%&%&%&2%#& %& %& %&%'& % &3                     #     8     ?    e XV   Q'& @H  [     6))#   " '     W[ &$( '4('('('('('('-('   y          - + V                  5.NG2d% 4   -   u   <         i `+_` wz   , P*OP      2 8786          5.-&./0#/R    ZY Z[ RQ  NG   @/    H! "!  !"!"YK!07 " #L 6& #    @?            '('(+,! +,/0%$/034)(3478-,78;<10;<?@54?@#! /A 0y  aba3 1& 3    >/$0  y  !!!!!!!&& Q )3" ^  B  PZ, 'A4% ( ) ,  (,  *          8+78 78784N   -$(4 p|op br  #  ?8CF b ptop   -            ?-C>    -   . 878       jo    3 <    HMGH C< $      ;; @-?@?@?@ "      G*+  l% /  $    .    3D  5 0' " % j     W XQ ^WZK +  ;* #  *  e,-             P;OPOOP < 3       '   8     +K I n% B=  <@S(@KL?/0/ r}@oor>}~o034  0585=B 4   = !TE-D '2     "     @6?@?@ (*b    4$(* 00/04/0/0 '         G;'  ("'('(     % 2   (( ,,b( $ "  '   /     )4 (  # ?  B'$$  (( %%.T0a0 A%,9%  !5 8  !9   p''      ) ((+&Jr `(_`(_`^ A"<= II&)>).>).)), %J9 &    ( 0 -q5 %%*"?   *** oT!c  *b ' * **2;E*^im (-g-((+129eC Y>y =)0  '.KX   XWXWXWXWXWXWXWXWXWX@  )(#$)(#$ @ ? ?@9 ?@9   4K<6      @*    X & (  FN" `'( "  '           ? @    ' #3 {0  6_& :&-) 3 $: 5          1, 8j78V78&7878 , 1        $   >*      $           *,      4*V,$#      .        &      !" !/ 8("eEq|     2     a@      1  t  ? @  a"'   *           ? @     ! 3       %  C    *#$ @-?@?@ ?@ "     I*-  l% 3   $    .   3D  5 0' " % j     W XQ ^WZK /  =* #  ,  e,1            -O L t# B= <@S(@KL?/0/ r}@oor>}~o034  0585=B 4      @ !\C-F)5     $    H8GHGH (+b    5((+ ( '('(    "G" **"b*  B     %*  M 3+ <_8  "!"!   ),lCJ EDC@ O C %8  ) +   r 5:7>   NS  QFB     $.7NS   or "!C POP OP,)  !   6 43   #1 x?wxO  2 h7gh! ! 8! !!  X:WX!!! G!   0&/0! !  3!  i!>!       v!        Z!A!   G ! ! <++? + x-wx! ! ,!  ? N  =! S(*(   `(     0'/0! !3 !  8)78  0 878!! hSgh!:!     !   ! . S(   F(  0 x(wx `(_`!!  5!  878!! ! (,'('() 0/0v         0/0)  `;_`   %2 JCZW ,   %   !T JCZW,  ! 0/0/0\ 0"7   "  &! 878( E  $! @>?@?@ O*   : P:OP GN       '    |    < HG&#   1 1  M   ghk<- 1 8Y78O78      JC  8U78   P H4GHGHGH?  ?01" 36  ){ HGH1     0* i    V IJ GHEF?60" ( 8@78 M    )      H@GH    K ~+-   $7D (       W  G   BCM `8_`- q 6;   878-K  %& PDOPOPU*   > P    0*/0 . ('(    1         8378  B GB    &         `H_` _`_`)      +   2")+  z 8778       -  /-  HGH?GHGHGH7 %  8B7% @?@B?@?@%                %   8#7878   x+wx[wxwx        ?mq  + cK+  ? 8478              !   "k3F      4  .    ?   A   ?@   # 6#  %+ (   <    :$#  !"    F4.? A M   8-78 78"1    0$ "1  E        1  (         7  )  "0^%1(    878    .       3   1#      $S .%       Q!/    \ K Q!/ H`GH (                 !  $+(   K 0  @ < 0@/0H ( "! 3H @?@?@1?@ ?@G    `BG O      +  8"7878   POP OP OPOP OPOP     $ +  43      ( $(+-83Z(L %    h7gh$ ' h8gh% ( 8378   )#   @%?@     H)GH   !      hgh     !               0/0/0$/0$/0$/0$/0$/0%      # #####$'       .#            xiwx=wx )   B Bdx- u  AHAB;6    )9p: U XWX WXWXWXWX   }~wxql >) ~ >2 j *+     & B ;)) )    $%    'NL #        Fa  @4?@o?@ ?@"?@"?@    " > !! ! $   !   P      +D ?      "  "  $L ?     "  "  "   X WXWX WX     7 1 ?     "   0d/0/0 /0          [   4 |           &4   L`  :   )'=? L1"@ `j_`_`_` _` _` ;      (!w):5 Z  !                    4 33+"ik *    :  @$?@ ?@  & " * % A ^] ]^ ( V%               5 XWXWX$WX$WX$WX%WX & B ; # ####j i +%      #        T#I   @?@?@$?@$?@$?@$?@$?@   F" a@> w &&#  # #pu#Z_# #<        "        c#H  =  +E  % JM   ,/    ? @7 B? ,  ,)L  9`1GX  W/     V snid[   5 BUV     S < ) 6C0:m2K7\tY%  U,! % A 'g 4$! 6 *# 7 %* S?#  ))' 4 ;5 @ $ $  %&                    $  T  !F*-, % *O  A**'            ))) ) % 6 !   w7 H+&   xwx  X`     Z                         ~   H^GHSGH+<`  JU      2 ":8+< hgh}gh"`I,    - " &    +   <3 l"`I,% hgh2E        R L2E XGWX WX WXWXN 5*      S((N$  "u ;u 6u ;u ;u ;u ;u ;u 6] &d[#` "       ? @   "       ? @           ? @   "       ? @   "       ? @    "       ? @    "       ? @    "       ? @       ? @        Xa Zc \e ^K                                       N vQ/.      ;      6        ;      ;*     )* );4       34 3;>     => =;H     GH G6R "    QR QZY\[^]`_bad cf eqh iL* 02 @?@P& #($   '  87878   ,   %     $! ";+ bZX     3   2B%4 bZ 3=     5 = &  ' -   " X$ $4Hb   C.-.-3. -G.-.-       .6" 7%)"  f\b   C    3G      v +     ,Mv #~:  H          ($:   H `9_`_`_`% . -k.-     t-N" k   0G/0/0 Z4  L h2ghgh )* U  &  "Q$    & h6ghgh I"-.  " NL-  * \   B- ~  *)  u- /0( n E:C *%8\  X?WX WX _  N# !#            &=\    & >N &5           !  5 &%!9     %., Al&  KV   ,    a>- H[GHAGHGHGHAGH GH & 70  & 3  " !  %(   AZ'? 70 3 <&}T ba~}!  baj~}n     '  (  . &# ?: &#!   - &#%7   + ' L   &#  &%        .(; (Z  F),gii-  _C6(   $3 :   d;A=A3 ) +}T !    j n   &    $&2 DA&$ (&6  &#*(&*  &I T( > PM"43 L  7e     1- ,    'J \Z*,8M4IT    j&5    &X  .   9T       )    1)w  8, =   J7  ! X &" "&  # Q&^  "+  ;&y          8787 % E  #&    ,)4G<* <  Y # -1Z#5)3 + y DX&   8/ E_jA  '  A < 8  #     sP&F7&vu      5        ;>  6 Q )  0' #,H  9>6F7 sP&F7      5           6 Q )  ' #,H%B>6F7 $&1 #  Tf<     , z+550  D  $'(      % '(  '(  '0         ' uM6BE?5 /  , z+   5    5  0     0B/0<^ 0 ,2,, PUOP < M   > M XFWX<;    1          *( v GJIJ LEF       4(   xaej(    3'*3 " Y V UHWHt3 " =*   "' g  #%/ HL4*VP O+POP OPOPO&POPO    "%    O%:4  V + & g      "  %  "  N  *J A 0.  ^\7F#&#( D! <   42    %+DH&E  >  J    A _  2        *6 s #        3    ,!.@6 s I      * &       ` & o      *                           '*            8LK@'BM ]    (( C ! c'-WB M  W     `M_`*?  %   I? *5 CD=  C $  -  0  ?.*' 7 "  5  *NM  \*,`  !.          =K? *65n! ` 0/0/0*,   >* 3              /   #, n [ 1 *G9") 3  /    J  ]  *   $ 3 F$,  09# *,0b    0?   Q05<E2 ,0b  """!""["""""""""" ""*M>     #&        %6- ]" "  r""!           >  0  !  C  f<  2  @?F<+8NMNk  El+ =l/M7lklk  g      ; d [ )(. O m$1ng27^7) , , , } <C>F3AW B >            #& !  PXOP*e D    /  X*[   *  #$4[ o*  0$C#!?*    E  *:  #  ! %:  - t  66 *-   .   ^  " #    #  : Li( 5  ) /  . . 4- R~  >]RQ:Q:Q(   '      { "  1  9]  t  w~ h X!" LA/> =>  @ O<WRY<Y^ynKL OXWLWX [dcXgh kts      ! m&)4\ ) ,!`  -M \lY + 30  F  .  ! >]           PC,B `U_`_`_`t     @  & (/0H    N^<;];]R  /fc.<i2!   X?WXN^<;]^]n KfcJ MN'  ! xGwxN^<;]^] z WfcVYZ + % N^<;]^] afc` cd)  ! mfclop WN&^<;]^]  yfcx {| 7 )&  QN&^<;]^]  fc 5 %&  fc%*  fc16N^<;]^] fc=B+  ! fcIN fcUZN%^<;]^] fcaf3  #% KN#^<;]^] fcmr1  ## fcy~ x"wxN           BlOZ   "   FM G* 'K l|{ QRQRQRQR4B|{|{ QRQRQRQRp2  li* *43  1 '    `      sd `  IL  =L & /r,# & ( ;  (  4 B     ]lB (%* &   B ``_`l&QRQ RQRQR 5&  x&wxl  ji   <l@?@<{N1 212121 21212 1 212121 21212" j      4 $<!$                     "   `5_`_`l|{  %  hRgh78?, PK2 3 (? pDop6opop A B6565 hc  ^[ )  ' -   G{|{|{|65 {|:E1 xwxwxw xwxwx w xwxwxw xwxwx(EFc%dEF'>   B?       )"%& + +$'( '*G F3,  )   $"'=NE > :            (  %   ' p;op%op%op%opopopR   "                "GfR" x wxwxA& * UK  )w!xwx w!xwxx j - & 4   n a  R OPIB7+,)   z {|{ C*'$&O    "    *4   !(gB)/j   )7)/'"/#  )! ! C6ij E&    w#xTw  YN  hOPeh gvo$%+  Lw b   }V(%8-  #T   `N_`_` _`_``v       I%P` hGghT    D3  `B_`+_`{ " ,) # 1) " , `_`/_`\   -:  * ,7p *+/" ,     7=2*A.7: p,opKop9op)op * +  *@ 0 (P'  [  I     !    %2 1*&0.  4i l i liji l i lp o p*op   # <  # <    " ]:8G           * POPOP#i l i liji l i l43 4343   # <  # <   1           .921!2121" lg   d_   N JE   . )  'V+;2!v P o     %&9:-:   o)K .>  &21c21  in       qv  p   '+!c  SQ'('( '('2('(V21  ('('(''(" ! (, ( %'('  G 4 ~7+,Q 2V %`@.H        &    a<<6:,>('@.H Vc  2 3}[ $##!     "    "   "5",$ [ C8 0T      1 +  1$ C!2: . @?@?@!2\  04( -   6'2y    T% J   !2V zc b8 '  2 *'2q \E DaL% B   $$2h J32OF" 9  2j     Q!@ 23'    87878&782J   !7, $  2p C\   [8,T B   H_GHGH2'S   b5'#B  /9,S 2~+,q   7 ; %q:O  $  P2OP OPJOP 2 - 2 % ($+ s J#%'$  S 2   / !# % B+/< ('(+'(+'('(2      "!       x}wx2 4    70ykO`                 "2R 7 :1 O    878*78     3 % p G   @(?@?@?@2m    G5   cJS2p f          8R ; &  &   M%2A+,+(4#  &   bA4 w$Y2M+,+(J+,+,+,+,  ! % %   %; &    5   (9'!BMJ             P,OPOPOP0)P  ) ('('(0%f   xrwxwxwxwx 0  &  BP O: ( '( '(0 5<     h[gh gh0t  8 (N h`ghgh gh0  8  ((] i 0 8 2T p^op op0v : 3E#N pdop:op op0 : ; 9=C) h 0 8 ;H+Q q0 >H 2=;F @*?@;?@?@4y  2 4&44   `_`_`42F  4\ $ % )  ;? *A  K 4  )  #  3. POPOP OP OP4S   2" pop op op op4^   ;!& {4o(  & j (Q #o(4%  z4n(  & `W i (P #n( (      j          P_OP:OP(0 /        /2GfX%   (     R $ 31- (  >1 * <) +(   mn  (    cd   HUGH^GH$GH$GH-GH$GH$GH$GH$GH(     .  CF -    [T SN  14 38 7& %  $(-? x  "     )/`5 k      $    ( $!"#@           ""  6  % ;  N-  *~O' &PW >a@ HTGHfGHEGH(    &   ((;R1 > G!Q 7:   !        2?  RP*' G!Q 7 7D $  pGop1op ! bP9  6:Y ,  /BE!b   17 p < =$ BA2 U  %6&&7 p a=1X 8     A /41X ae1Z - 8       !  A /4(1Z - X9WXWXZWX4WX2WX     3 ' l/'C3F  3(XI"6!C3F ;{    $%) 1.m   0    A 8 hgh  d E    &      $  f31  ;J- .   $@ S!.,9 0/0/0    |+L            >$#$ #   $ C< 3&'&' ( 0     e  (    12 ( - 6;  0 J ;"1 +,!,Q.a'e,    U    > A   2 !!! x+wx8%#  XWX!WX%WXWX .@ ""  && `>_` _`_`^  % ! 5 ^ }  0/0/0/*0/    &   *   - G K @*7 * ,y 0 /0/ 0/0/      *   ) ` %*/         *   )  0/    *w    1) b &&/ oG       ; 14G |++,GF   )-  H7    F9(   :  S2 " ! $>?+ 'GF  @))S- /  BT UV "" B  # 6  )' "  "!6~'S- @)) S- /  B  wz" @  # 4  )' "  !6~%S- @)) 8S /  X  8)    ;;  # P     )|N!6U S !9>I  f(        p%<7 I  f>C?2 xwx>  3 0/0/0 /f %&    %*) $M$ |     h:gh > 1 ,\ p 2r E 3  ,  J > 1 <\  "r # E *!&  <  @$?@> 1   r&    `8_` > 1 *\  r.  q 1  *  Erb   popxop       *U [J    -+ P:OPOP { ^3n /!  3 H7GHGH { ^ O.   P=OPOP /  ( 94  XpWX WX   : X x XYWX WXq !$ : ( K a 0N/0 /0e 9<:   G UUX il Z 4 =>=F y| 6   ) C  F  6   6  8F7878 78  6 " C S  6  @O?@\ :   @##  `_`_`   #  ,   8778%78     <  8678678%78+ |     r + |** `!_`_`              `_`          ) *$$1<  P:OPOPP  $   `_      `)_`_`b_`&  0? 8;</0    34     ;< UZ    -(%r| =S Q  H`GHJ     # A   1u47 6  D d a   ,  `R_`_V %  N ~ %d"=>7  C %#   (    +6*( N'     %rHG  'L'!    (   CB KGE(*y x(*w xwxwx w x( z {XUVUFOP     L  IJCB ?@=>= *#    * '  5B 5: D       '$#j;  .BIBh,!%%] " D(      +             &    @ +- 0; CD0 hVgh gh4     F.#!, highgh!G HGH?d     0 '< ! ? pop-opY*,  P8OPOP I JIJ+IJ  + &  + pop-opZ*- 1    XWX     J%%eK  4 0/0/08   # @-?@?@C  "  @s?@?@0?@2 3  0 ?67@  I<K  <A  D F0r                $N   }|}|K a &@ ju  DABA  +  f $          )dS&   n D "-    xwx    G     FL<EO XjWXw    L t                v L XQWX^      3 O  e 1         ( ]  i#8:A @?@$?@M     '/ 87878=    %    P%OP4OPOP  $#J- .- $     DB? !8I  g&       o,  /P6 I  gCL0  n     @J?@ ?@a: 0 %> Q @T?@ ?@kR : %H [j 36:  Y\ 5LQXWXWAY#<;$#$0.   $        . IfcH"!GH F = 6L '*LLY  09X H6GHGH ( fa   ( ,*    `<_`_`9_` _` _` _`+ 9F    WD+ 9CVP  w"&+&     &    e 9 M  ! &+ #BHG I JIJIJI JIJIJ I JIJIJI JIJIJ5"6 I JIJIJI JIJIJI JIJIJI JIJIJ I JIJIJI JIJIJ5"6 dc5!656  $+> $'$S> /&.$O: -.$K6 - .$O: +,$K6 '&           !SVX }  % ,<t%.DE$ E R E$Q (  r              "            " ! 0v(HGdcdc I JIJIJI JIJIJ56  &          #   _ 23V  & &g((( /               vHGdc I JIJIJI JIJIJ56      12 &         .-  _ +&{3V  &g!( /              `]_`_`     ]c J  +%   6  OU &    @  CI +<;,;,  ufct ix%    fci  fc!i XGWX%+<;,;,  fc=i%  !% !?^<;RQ(     9fc46-;< , & 4 %. xlwxwxA<;RQr  YfcXYZ  $, :.A tg B#     $ag V qCUVUV%_ `_`_"`_`Z        '% "%p   xowxwxwx  4  ?GY1DC    `q_` _`  8 \  8  8M7878 789:9:P @  MP 8N7878 789:9:P @   MPk  @   @  @P?@?@ ?@m  @ " M  @   &    X_WXl   #  4  ("'( '( 0C c   %  8E7878 78 U 7   8F78 78 78 Z 8  ! L Z 0D/0/0 /0 F 6   C F x&wx wx 9 0     )   8M7878 78 M 7 (F M Q`CY 5>L *    G4L)`>L @,?@F?@?@"  =    61ijijij8 `_`_`3J  H#GHGH GHP`   # HGHGH8t  P OPOPOP\   J!;-  *  4  H9>Q  +3DQ5  [%  @1?@?@?@X   @6" *G *.  Zo /41 4  pNopNopNopLopop op  @@@ @  ''% D D B M1<;2 ;2  fcpi HWGHGHWXWXWX 3<;4;4   fc ^i   % &%  <   )fc(Bi,  HAGHGH3<;4;4 X  Afc@*iD  # % g H# \qrqr%{ |{|{"|{|`    %v   4   l< #    9 < #(' cj  )   p]op opv 8 *N P!OPOP7     z (8 $%"K uN' 1   ))GN '  08 ,+&Q :    V  !'1 : ;  8    V  ' '4 yfX 5=5HQH5  S54T%EbFH Q 5>L~ *    G2L)qGL  =opopop63H  ^ 2  4/, C @  7     @  >  ;%_   ?   8      @   K  <S\ ?  =-*    &."  &= $(.'." P:)      !;!    '   $=,((,"  popop op ope    =*! *Q<+      "="   1  -h3+*3   D8 3 1 8%  C7 ne2 0 7 >F T $#   YZYZP IPOR@ YZYZP Y`_b@ t  8   8   8 v :  : ;  8 $#   e "7 j 9<8 a SV 6 Y P ux   @P?@ ?@I . )A I =+]^"  ,) 0        (' d 4<X'  $  7j "x     3 ! m  ;<?@78 7 49231  }     [\_`WX W 6"=6?5  P6OP*OP OP OP  uvyzqr    a B3/+Y  pop0op7op        C/A;$Q  A5 >50 . 5%  0"/0/0 .%  dcd  k    878GH      Rg +9-  & @4 Yb/ - 4  XXWXWX WX kli  D & U i&<;%ba&%4  fcZU%  #  <<   G  T    %=  * t<  <'!4 8787878%78787878c x x] * !s]@5%'c  ] G .<   7 /3 %2 #? # 9  ' C  (T'(aF  (]'(jG  (0'(=2   9|  % <  HG  / 1 M ghk<)  8   ;PW!  @?@?@"    "         U     J 'Dk8L  @?@         Zf6 PAOP-OPOP  ? 032 ;6 )6#  )6#  % D(   i:!   8n78     "G    ('(E% qnqr ~}!. g% heghxN     ,&  'L HsGHGH*         X ;*   0/0Us  # 3 :*  0/0 /   8B780/0 / s %;   0 / 0/     .#0/0/0/: X   H+GH30/0/0%/0/ &3% ,ys  *    -',U s pTop?       F@ ?  ("'(                D     &   D     '       878  h$gh /  p$op ) /  4 `_`     `"_` -  878  878  HGH  h&gh#* p:op@G% D R  5 & }  : &      7H    O ""&(  ZS 3TWF 3<ETWF-1<   }t   }t  }t  }t   @_L/(                ( <-$#  *+78        !Y+D? `2_`_`    0     B 1        E9B 1 T* {    (  (;(   :% { H5GHGH  ( - x%wxwxwxwxwx(wxwxwxwxwx  R(   C           }                #J9i  J|!-S D:   R (      C"#& % ( '  Geb 1       &#                  0 VE  5 * G;       &  R  P' g   Y CD  A        !B )&% :!   n'">           + @G?@ ?@?@       @ (K'('(       I @Q?@?@      S @E?@?@    0 xF'! ' $.2""&w       }t                }t       }t"         "  &  }t        }t         q>%3.Q6$6 ,+, ( !u$             " %"!('*  -0  %& &%6 565: 9:9> =>=B ABEF   =  #  % 0/0/0   2    XFWX C$ +         (#             C  ) ,   3            [ 7{  /"2' 3   !     }t &}t !9( &' 7?$! {           &        `@    $3+  2     qt R7(7*  }t"'7(9:}tc # qt7!$&7()"!+U<?,E G@        '  " " &! $#   0/0 /0    PVOPOPTOP:OP            )#<  HGH   `X_` E     %  E     POP= :-         f>           8/7878   2 G > <  6          j\2d+ ! G >       <      XRWXBB0 !+B ('(  !     !   !   @C?@22  2 ('(L[  XWX;   F   5     /C" F5X      t $# -.A+      0    Y )*% ,' .# V!w 1      + ,  ( P X1WX5T %@ ,85 X2WX6n ?Z -96 0/04/0        `_`25 8 1  `((_B/5 `_`25   3 ( b()_B/5 D %   *   ^  #        2     " x   fad_b]`['      U++#2     "  (''(}'('(! #            '( %& #$ !LGJ ? 1 $_2!           qj XWX        ="[ )5$ E  . 2.  5                   "  o"YA5   ('(                                                6  *!                                               9                ! $# &% (' *) ,+ .- 0/ 21 43 65 87 :9 <; >=@? BA DC FE HG JI LK NM PO RQ TS VU XW ZY \[ ^] `_badcfehgjilknmporqtsvuxwzy|{ ~}               6 ' (           POPOPOP d g= %  S T$       # '6 K`_ ` _        ,     * L9             1 x   / WT QV '  '  6     K    4         g '!#   1kt XUWXWX  '' ) p4opop op  NMNSTS TST S                  @.?@?@/ B  ('/  (   #          2   " h   vqtormpkni'      ]++#  2   "  (''('('(! (             56 34 12 /0 -XSV K % $o2!            ! /$+           K G  .  2. G E                   KHE>#, SL bIE      E  . *p`w:9  +(@ OR   w_>1uhR'p`w F 46& 3 p%#%#* n m  Xk; 1!Gn4242p%    #  %#   "    .  .   50 - ,  $. $ .zXWXWXW  |  {~}|   z       /-  2 ) @,A7/%< <6 . =   5  12 9-  L%%:<% MiB .  .  <7     0-<!>WXM  5   9<k M$L%/  !:<-iB  ."!"    .2 .X     < H 1".o  E5: . =  5   9  F%%4<% McB  @8?@?@ ,+ ,+  5   <M ,+G,+,+,+1    #            e*$*! G1    (   @7   g+,+, + , + , +, +eg+(     vu|         8    =  " R:"7      e( `7_` ' $! ' `T_` _`! $S $   F&&U $    .    #,%[ H,GHGH GHGH(GHGHGH    3 *       v PA ,+,+#!  1#  ,+,+  +B%AB0A O  >=> C}t-4>!    md /md}t md md]2Q^  Q" %#0m2-: IONYI*5!$F! !21 $+MA  #         1       "!$ #$#$  '*%)*0), -,+,+0/0  xwxwx      '(. 9 6ELSM#D ; 40 BI ( z 8OPG     >!   1 : A D   > 7-9  < M P . H ]=D ; 40 B   -  (  'c! Y F^ ]q        o h @=,8 x 6 +   ,       ).   o\+5  5G! Y F q   A*^ ] !      7  I*  !  H:GH%GHGHGH^]^]  )     .$ ,w  )    i"" !#$] xKwxwxwxwx$^]^]/         A W$/    iWk0 .~}~} 5('('#           V           9      ('('('('('('('('      ,343                 T[\[6          5hopob    ]v}~}vUVU`       x             d;UO1$9 6  &  6 Q '.IF. 5    #         V        " !  $#$#&%&9%& ) , + . - $#0/0/2121434365658 7: 9 < ;  @$?@0?@      4& G   8;78787878^]^]^]^]                'N     XWX,WXWXWX ^ ]      5-    X'WXWXWXWXWX$^]^]!                /?$!       *   *X      +   HJK-#$"A *X  $) 2  7          %     &j I ) 9F 2  7            99     u@%69J%     F;l;,;fWC^ ]E  A1 1RQRQ-/--/-?  &00.0.-         *.0. *W-    - +].0.^-     +.0.--,(D-.0.]-.   U YE   > A):&T-3=* - 3_*-e-!C #     A  1 1;  qj   '  &^]^]A      ^]P      l   .%<   %<+ 89# * E >&YX   'p ,l       &#         A     AK 3\o     f0 @ X^91@% z 4 ~8  H#)7\%8 5 )X 6A P ( j   '  &A       "!P$ # hZgc .   9 9=@?@3C 4! -9 ; 6  ae CC(."/   R                                                              5      ('(' ;~}~}                                     ?                      5      &                        &  7"     L  U A&.- 'D b#(K')    r (! $=! H(& ! ;               " ! $ # & % ( ' * ) , + . - 0 / 2 14 3?6 5 8%787878        8<   jCDCD 9:9:9:9:9:9:9:9:_c d c d CDCDCD c d c d$9:9:c d-` %& %& %& %&    %      DAD=>- *  n 8R!9*&w      _      $ - j   " A 11V,  _S w P$,$HjpIJIJIJIJIJ i j i j I JIJIJ ijI JIJIJ IJ(ijI JIJIJI JIi j/IJI J!$#$#$:#$ j i j H   $ ' ( -     2      ,%  ST{('2JIJQ 2 1 & s+ !O !23&`EB  *  *'+      (  I / !"!$!":!" % ( '  c`rp:   ^ ij Bij i j #YpoL KrqL KrqL KrqL ij ?ij i j*  + # 6 ih   E       qr      j J"          " 4   j B  1 !   :  . !O  GA*W+ >   & &I:   ^   B        "! ?$# & %(*' * )+, +# @Ep #M    Tc dSD; < @??@?@RL   A 4^ /0=F E*:9&F E/0HB B?  POPODC b WDCDA   '('('"!: 5"!"   8Ee $ :' = *&   H V^}     - Y  -# XBWXWX^)@ => 9   2  ? &)    P!OPOPv.o p ^     &.   iZ$v#EFEFEDEFC+ p CD- C#t          @3"<# - # v **  "{"   **   b0;vOP/EF*EFo p o p)OPOPOPop o p o p&o pJ      w d c X  => = : 9 4 L | X 1 7 E )& j  /* )     & J @!?@?@?@?@?@?@?@?@?@?@"       $ sD" 87     &   '5A*  w"$#J $ 4.*J P OPOP"6  $" )*$"d c   1        (#12&  #     A &   IH OPOP#  < n /8 9  %"vP    #          -,{-2)]'   `B_`!_`_`" v ul   "  l $"v u+uv,v,ij87l  ; 2<xu& %}z,F0  l >!! "     "" : "( OP^="  *p +t +0>7NK0 *   E *0>7NK0 *   >5) 3   3         *   p +  t 4q &l"dcdc40 /m 7    <)  & & \\ P YX   ~8             7   8 Q!:)( #E-A2    =4m     7           j j-.TR "    !    .." -  */ !# " ! "   " "  5  "$          R   )    HG           4     ) &    < 5  2^  Pw 2:..- =$&0 $R) y)"Edcdcdcu dcdc +            &%"  /         &      # t \'B+%;1Eu  "f 5 #  $?&:-"T       1 70     3  (/)3!$T "1"` 65 "v, vue      <+    ",D(e #"  NM NGHKL  -GHGH klu?8 7 1+&"av,+u vu*vuvuvuRvu B  mZ >  < ]         6  !8>.+  P          9   m",87   QR   a D"       k:*.B) * ,;1D 878"78678"   &9; l Om!$'Z,YZoZYporqrqrq'` _`_`_  +` _`_`_[` _`_`_   T@O"((' )         i   |M            2i  a TS N:, ":    J! 0q2*.QJ1I ){'*       + [    T  $-    -  0/0/0$    "   +v\!!$    baba   baba               O 7<.'N{              r$      >//'$Tk nU Tk nU Tk nUTk nU 6N ^,?           ('('('('('($ Vk VU Vk VU Vk VU Vk VUM     ""     zI        M `8_`$E +  $  ('('($baba       hghgh ghgh$_    ,$U $+ $%      %   % 3.U" +   3$^ l 'ji  `UZY               $     C            + ARBN %^  1 ' > 5 D$Q 3"% 8 ">'$656 5` _,65R  2121<CC*) &%&%07C)          )     G)*    ")*1 .56=  r r J r;'K'kK (#': (5~qt  [       P9OPOP$L  wok\cZ  b$` _T` _` _lklk` _4jk  wp1 0# A    =              +       +          , C  d     +  >,E    /                nmpo      +*nmpo    *+nmpo    nmpo     nmpo    nmpo    #nmpo      # 4 (        %% %% $*   * L 9  ,).2221.."a1D1#&(,!-#3 Tmi/   5  % %    !"! #$# %&% '('       )*) $#$+,+ ('(-.- ,+,/0/ 0/0121$> $$lkl  Ckl      3 !'  %'  3      3  &$%$lklk lkp        %%!3%%5H,    $  pop $lkl  Ckl      3 $'  #%'  3       3   pop $lkl  Ckl     3 &'  %'  3       3  $z` _`_#     ?(-    ,$w` _`_             3),A&:5    I$5` _`_   * 2$5  s$,l klklkl T )).,  @$i    #E($BA e f  )> 8 $"  `_`_` $lkl  Ck lkl      3  #'  "$',!  3      )$      ;     2NA#1Z 4$;` _    0!;   <$PVk VU lk VU lk VU lk VU  0 0   $#  ,)  $        .#&$  ?P         0 0  " !"!   $         93  H# 0  F @  -$     babababa     baba%.-.-b` _`_J` _ `_   7    %,& '   ((/.'  /         | WZ  WZ            %     `x&     PA!(' 31l&!7g   %b  J" ! $ # & %7 O      @     $] 0.-I.-.-]` _?` _`_J` _ `_'   %       WZ      WZ    WZ         2        ?&5        =CO(#L!79] 0I ] ? J  ' pGop op op op$` _`_   `_             '4      $5 M        BA.!85 M O$L  IC   ,+,+,+    (# 9         0)8(;1+ L  IC  d@   $ ` _`_ `_?1` _`_*` _`_J` _ `_ `_(    ' -      2    +\     ,*)*)  "           A Q+[%&IJN   % DC     <F+ MN! [(+Z J$  4 E.RQX:*(0);(,$   %Q@!78'-E#&(/   ?1   *   J   (  / $$ "$ x$ /    -!          "    .   777#!^)  "\R /    -!  o$| )   P%OP"A 5& @?@"; /  878": .  .  ( '( 0(/0" ! DC    (!'((' pEop  /  8&78    @?@               5c        P1OP      xwxwxj 'QJ  *   I     =%?",  j ' B  0   ! F1#   I $Ce     H M   >  @   3   : 'UJG  B    e  TU            % /=O '  #  ,    8      8B78 H  $ +,+     !.  x:wx %587: &%  @?@ ,V+,@+rEFGHG))r 9@)   5 V@) ,+    haghn  ihglif_ da^]^]d #   ( '   phopu   ! %             hgght     %    p,op$"#""" 878    p'op a 00    .0>7NK0..0>7NK0 . %%%%%$%%%%%%$$%$0% %% % Z      0 0        878 78  # _Q     '  6 Q               U  , E!'   % 7 !$!    4 4 +   4&5  4 4 o   8+. 1 popop               5' .(  H , #  0E0/0/0F/0)/0H-.-.,/0/"0/    3  5 , /    )C %  '  ' % Q[ 5M@O&*  7 5E3  5  ,"  xLwx  )$'              @?@                   +       !             $    rC-. -    1  3  ,((5*   ",:!      x:wx     & $"  "   1Ee!_>o?#   ".#^9   " ('>0  >$#(#"   g:8    < '   (O'('(     &%B     Zw      !    ('(         (J'(W/  Z    #T& HYGHGHGH       \)h 01    A B ('#b V -  6     .26*  HGHGHGH?GH1GH8GH"           GW!  4 ( a #  /       # 0k/06/0(.h    \N(. N  @?@    w R1?@   + 8 ?:B B hAghgh$gh      )  rd  <   $ P   $    ^ 8<$P q    *  ,       8  mmd'S   0' ,   '   X)WX+WX,WX*WX7WX6       "      /0#  <#  =939  = @+?@   - $  (E'('(V  #? XXWXWXWXWX     &%,0     popop &IJI$  12 5:    OA>D \ !    U\   (. 8=787878787878       ;7 i , "!0         IMZ @I  k a   *,-,% #     "    wA)#?5N3 6 >  ,-N             . -.  9 @ MN  >IJ IJ  )r qr  q##  Z   #S<    v          '   R8'9XE3./-G5E                  S&R 0/0+/0/0 /0 7   # $ ) ,  $M                   4   !A  5   !B     W5) @6 *-#  P4OP    e  +     ,&!"!"  -   T<  #2O   J $  r            , c0    +`73 4       ::~>: e jmj   &z%    } 6)+  5=pst 7=puv s@=:U czydy&)  %  3434) dcdyd#4     cd  cd!j =++x Kv 1&# 8   @ (    !q  L" W$4M 5JD  '!=  8 =]7i>V$2)1  #D1!    +      (      ,  8  0MA  p)opGopopopopopopop  f ` _        r [    &'  #    +$/6 9 K%&5`    0/0$/0/0/0/0 * 6    (  -"%* 6   *  04/0 :      * h.gh %#&%(  1  @?@ V@+,+) * 9 @)5  / V@) 8 > B @?@ V@+,+)F '9.)@*)  6 V@) X!WXWX P $ POP"d  X(WX5n KN  !     }P%1^S?++)z2 1      /84/?0))  7 >   U  -  <%.%1^S?)zv XNWX'4~  UX  0'4 xwxwx V@+,+)= 9~y@z)6 "   <% V@) . hghgh"S?++*&   8~y?z$Zl*Z'(`   I"S?* 0 > HGHf  X'WXp [^   & POP' )      4   )8   X#WXWX AB  'V ?@  # ` IJ    `%_` #IJ   1IJ   BR .   9 q   (. X s^   -#0 &! hAghghU~   $()   * X0WXWXQ  '(6%* xXwxh   5878 0   0 x>wx$wxwxT       TF   2    2         S @  m p '   ++S @        ? ( +T      877878   ! $&   $      * )    >    XD h " 3 *  3        P2OP OP OP o * H!! J &   ^ P0OP OP OP  * h!! H $   \ P OP OP  * !    +      +=3-5!    V   ^   kT XRWX WX     !!  '  !  0/0/0  *       h.gh    0/0/0/0R/0/0/0/0/0/0/07/0                              )           %   'b* pop2op       = %j 8@7878 7878    [  *a   0#+PF &            nH        ,     +(!  /(( )'  $)'&7e " 3 5 ,   4    -   x1wx ) '    XWX &#  8A78   #  -  L    2    6           !(    "     " \@Z30    *) ('('(    8#78 *    h>>J 0 8 B;28F> x]wxwxLV U0    1 ;' L 0  @??@?@   4   )    p0op"02"1." @?@?@94   '>F  XWXZ GH   d QR    #QR   1QR   HR ~}.    9 w    9.  qb  ,#. &! `M_`_``   #6(&  > X=WXWX^   +0/(C4& $ xVwxf  5878 .   / x>wx*wxwx~}Z       * ZF   2    2    1  3   !   "02"1 +4   A>   R ?@   \ IJ   ~ #IJ    1IJ   DR" zy.   9 s   (.  hCghgh"W~   $*)   * `2_`_`"S  ' (8%* "h x>wx&wxwx"zyV     w  V"F"2"2"1 `_`_`$:&x.  <   + .- -     Z-*- :&       $b j t X~WX$    ! !  J*  0/0 /0$  *   `U_`_`$f   4  O$    &&z y0 &'4 &>> &!"R ?@  &!"\ IJ  &!"~ #IJ  &!" 1IJ  ( (0 HGHGH(44   !(>(#$(#$(#$(#$* *4*>*%&*%&*%&*%& AR, po.    9 p    . , `G_`_`,Z   #0!& ; `7_`_`,X   +0/0=-& !,f x>wx#wxwx,poS      t # S,F,2'(,2'(,1,3."  . XWX4   .A.)*.)*.)*.)* ER0 lk.   9 t   (.  hDghgh0X~   $+)   * h3ghgh0T  ' (9%* 0h x>wx'wxwx0lkW       W0F02+,02+,01032 2 HGHGH254   "2>2-.2-.2-.2-. @R4 hg.    9 o   &. 4^  ,# `<_`_`4Pn  # %' H.GHGH4O    4& XGWX4/lklk  UXWX    / x>wx"wxwx4hgR        R4F   42/0    42/0    41  43  6 S 6/<&  / !' E /<6: F"6 0:@ 0#A/ 0: X%WX WX 6DR   *6!12f KL  6!12p UV  6&12 #UxwV  6&12 1UV   }[:%t1s_/4 1      / #! B >  ".1 W  - @ .%1_/x xYwx:i      G:0  0 30 pOopop:c   / +  4 `>_`_`   . 4:W   5878 1 >:ba6/M      /#@) 3  D 6/M:F   :256    :256    :1     H GH1<% $  3%  POP OP"    P.OPOP>B$    2 X1WXWX>QH  #4 A  >dZ& - !C X0WX>&9:n -0/0  7  X2WX>&9:x 7:9:    A>69: #"! 9  7  C>69: 10/ 9  9 @# @,  @A6  @;<J ;<   / @;<T EF    @$;<v #E hgF    % @$;< 1E vuF      XhWXBu" :#   !,(BK6 9 - (7'(BD@     2 03/0BEZ      -lB*r   P!OPOPBR|   !BF   B2=>    B2=>    B1  B3   v Dba`< ]. B  >   *( ;*   D`g `gheX.  @   u?$# # d $%        pgopopD{V  8  B 6D*z  DK 9 D&  D  DR   DF   D2?@    D2?@    D1D3 d )FVUV UVU2    !  %   5 Ff {F5Z Y#dcdl 3 6    $85 # 9F" FVU(V UVUT       # %  ( T h ghgh FD   X8WXF/AB      / ! X:WXF/AB      1 ! X.WXF;    F=   " l )"HTST STS2   # !  )  9 H }Hdbabl     $:d 9N" HTS(T STS\      # # % ( \HDH/CDH/CDH;H=  a)0JL\[Z< WOR QRQ2  -6  >  !$  !!  .   *K1 8  ;#0L* O   |  JZa Zab_!`_      = < efu ! -D  2 $1  !    c J\[Z< W=R QRQN   1  >      !#  *91 -  ;&  * =   NJD  J/EF    J/EF    J; J= L L0 HGHGHL34   !L>LGHLGHLGHLGHN NNN4N>NIJNIJNIJNIJP PPP4P>PKLPKLPKLPKLR"RR HGHGHR64   RAF  RMNZ GH  RMNd QR  RMN #QR  RMN 1QR  TTT5T>TOPTOPTOPTOPV FE.   9 V\  ,#VZ   #VX   +0/0Vf  5878 VFES      VF   V2QR    V2QR    V1      P.OP     878       *!<; !  - !   878  P/OP OP OPOPOP. !!! ! (#'('(       ('('(      h?gh - " 6"  N c?'    0 +       ) ,T)+L&          .   (B'('('( 7       B!       no<       )* +Jy(       #          U VUV OR>"[^(      0     { |{|*ZGsJ      EH'PJP J        CF           m2x4KyD L1S57 ! ! R!!$!R$!%)$  `_`_` S  b                !   jB_@      (        /=T,B*C'R!- ! !#!$    PIOP OP    /L ! MBa       3,K) \ ! !  !$ ('('('(P    M  5 p6opBop      _ -PC! 5Z.B /   /  v[ m]a4 !    87878         O_       pMopopq    3V ! ;            Xd 8*78*    |{%   'L 58)0 12121-6 )  +* -  1 % -,  A @?,J '  * ,  S1 "= 878  pop >+=  * + *  '1A9$ *+ *    & 3 ' $ ('(  m/  ((         -+ 4-6G l/             ]X 0](`YZ  [\[.` E      ,   5V82+ 0(.    POP >>  * * 1K **  '$(  )$   ; } t  } t} t'"&/HQS  '    *O GJ;B CDCDC-H )  .- -   pQop +   + '  6+  ?@!"12  '   3G  } t ! 4 % IR    4  `W_`d X5 "B P?OP  ;   '   1! '  0"/0 -.    PEOP  A   -   1' -  -.   G }  ! 4% DO   4  X `J_`h - * ./   "4; %G! } t } t' } !"! 4!% %7O  '        !   4   `\_`i ]5"G  pXop ,  , '  = ,  %&  c!  l %" p      ,+ &%     " 2 "y    !   1'e"y\a  \      +          +   P>OPK  *  /*  `M_`  I   5   '  1 5        5   '(     M%]:>HH(        3  } t'   *       5     5  ( $ %$' ' PKN8j1? +%3 ' * 55  J??   , z,y ,    &@@7#,,, POOP ,# 1(, `L_`  I   5   '  0 5   5   , ,  " I%+3=!   5  + } t   * ! ' 6' %1&1<K 5+   *  PCOP /*0 /* (;'('(^      5 H~    5 - h gh5ghg'  13 hZghOHG HQ K&        = # pVa 5H    p9opF! p=op % pop C   k  % 0) ##   C k 878l  ,-1      # %K .O HGH          U";AI )*R     #  $ H2' )*& H9GH*GHq   ( /B PDOP*OPOPOP3OPOP   $#  !&'$      LsT $                 ?  $30@ 1'$ )          ),]#%<N +34 QTS <QTS 4      1 9)T   4 W1,0B$0$ #  8  (;,),0B$ , ; W   @$,       $    g  -  ,!H. +"n$, pSop@     R@   .  &  &*+ QTS QTS  `  QTS  &$ QTS/0   85 63 FC  +&)21,KF     *       6    $B(    \!?*;047E 9  r 47. ]4     &  %& O   &"!"!$#$#$*#'  `y_`    %   ,u,F  !! ,5 ,  # $  & $ F&P=/>W( ' ,8'        , 9  pFop, , 1, , , H75  QTS       *      *  % ,  9#(/?Q* [*     *  & +/F*   5 ! +- QTS  QTS - `               )  +9*2v        - '   5 \9%V0  (:   ( %&).      (!  (     -  L  j  + Zu- 3    ,"9%' 0 ( : ( CJ<>aP#S &%w* !" .-"FEFE(&!2     ?*@%    - @  ]  +  $  M  ,7  KQ H C  8/&%)    *  !     g$   'Z '     Z < 'Z ('(EL  (g'(tO O6 ,   (&'(     OP #  0/0   l 30>7NK01     8U lx  XIWXWXz    3((3 l X9WX&WXs 36   U (# e  ((( (   DCDCDCCH ~ 9A  (      C  H `[_`$     1g   %79  //  /0>7NK0 / [E\*% 7  9 xwx9   67 * +./& '$'   0L   "" 5 `_`_`_`     .     ad % %%%%%%%%%%%           '                  .   M-]I ) s c   >JI"QN <?#### "*     ,0>7NK0, -  ,0>7NK0,  ;:  "" :      ) sc           U3?3^?*L $$       +/%  )  " L  """" %     *I3L.2 %                   H2GH   <','=D*); A  "       *0>7NK*0>7NK0*  #)%*% +(a=I     ] A * AD C29 $# !*0>7NK *0>7NK *0>7NK H,9)P  2 9D C  #     . n+V n Y  0    m(2 m e $6^51 r  0 `'& ` \-.  : 4 Jy  L ^    '  &(G & $     (0>7NK     O,) $ ) ! Qp"!V# % ! !. "3  : 4   J  y  L ^  7  0  n     ;XQ :LM" * 6 $ 0/  )  &0>7NK 0&0>7NK0&            ' ! )"# 1 !      ?8   *. c /4&$%O d =IG( 3 #A$ 0  ?n xwxwx wxwxwx m  Y &                  3%0>7NK   'y  < 4       Y  y<:3 :Q*+K*I   qxmrqr   31 % 1!      "     $0>7NK    8-0,+ 5F,-&KDd4k    I `<_`f        E' E `>_`         G' G hIgh           R2 R                     p;op       O))(?2 x   "  !$%  #0>7NK #0>7NK0#   )   '&UP    8 @J?@?@    h_ 8787878 "   " m- L     o$$  ; `_`_` _`             (         , +&M:               !  J8   | 10>7NK0 1(((( "#bM1#& 8    | e3  94/  H GHGHGHGH68 78787 8787:9:9 UTOJOPUXSJ   8!(}6   PNOP,OPOPOP wqts#  O)  7w   9; <6 U9  1    "      3         "'''' ''''' ' '' ''' '' =j 1          3 POPOP.OPOP            /  / ' ''''''''''' &&& &zT   /   / % - X    )    /  E  <;    &&&&&&& &   &&&&-4 &(!  'IX)     /    E r+ (8,         "         #$!%%%%!( $#$! - -"><<!:  "     P/OP+OPOP      /    %%%% pi /   XrP     $$$$0  ; ; .    (- J !  = "$ & y+0    - !     !(<%0 -! hghJr     "U  878"        (:'('('(        U  OKs O .                                 #                     %     '                        9     [   \WXSTOPKLGH  b]^YZUVQRMN ########### # ##########     R!!! !  G<    "    !"!!!!!!!!.-." """""""""" """""""""""       %<= "!! !8 !!! !!!!!!!L &9'FYvE4'@ z1 !$           # !!"! &%$ #$#$#$#$'('('('('.)0/0 / 2  343%876 569: 9:9'>=<;<?@?@?DCB ABABABABABEFEFEFEFEFEJIH GHKLKLKNMN M9POPQRQRQRQ[L  hgh*   m  @   @                               "                           r s       """""""""""" """"""""""                      %(        1    ! !!!!!!!!!! !!!!!!!!!!! 9 "&&&  'GMjR#                 "    "!"  #$# & %&%&%&%&%&'('('('('('( hghghE !  POPOP.   hgh    #& ',+(+$ Lr  @?@)?@ 4 3&      &    ry          !*SV ; P       G" @?@)?@<     F<$  21   X$WXP>  )   &&&0>7NK0 &   [Z > ) `_`_`un }      -    >/<6! D&C42 r<   & >' D< P=OPOPOP  / #    ,$ /   ; < T  0    C  #?-<     !                     MK0 D 0      C 8.78#78 h # ?  xwx AR"                      8I78          0'    8'78       @%?@?@ 0 ++ (     Q,     >   878        8b  3wxx '!3 P b: Q     b p9opopLV 7  }lJ # !%  l cd   !: 9< ,   !   hghl_ `]   '  {1 ] l "%#?# # /## ## # "  #   ploply "$ popl "#$ &#$  l  $ #  Z -      l  ; < xZwxl0_`2    $ 02 @ ?@?@l4  !  # P OPFOPl5[\  *  #"  # l_`   (   l  ## %d  pjoplcd.c d  !     4 .  /l   !8  0   `G_`l4   ! l _ `-cdcd     %##    !-  S   - Ulb   0  `_`_`_`lJ IJIJI#   #lNM   n42    ann@   $ /  `_`_`_`nH GHGHG%    nLK  xwx         10>7NK0 1 $# '' 10>7NK0 0]   ''  h{(                "!"! $# hgh3ghgh          00>7NK0000>7NK0 1y  {'&&& )          POPOP  "    " `:_`     PvOP  P : 7  ,>  C pop    0  Z h gh     !  #   %          & 3        (9'( F    +      0/0/0/0 1         (           XhWX S      &7S             .          0/0/0   *      ('('('( +     K   :?   ")*) &   &  &        '    '  '*   *)*) *)*)*)2#C)K    :?  A                                      @ # 9$A      $# U    pDop op op i  '   & /6 w    ""           .(+   $SA( s $   %    :7 DC     DC   DC  DCDCDCDC  'DC(:C:9"  %  9 46 r3#'&1%           Y   P ]         /  1O%5'5$]             C M.v* ^   ,                      {                  ] ) $  "    f l^         2           ( '(   *      I           "     $  {*   '$f )  *  E ^  +# hlghgh   9 L  7/ %c      ;   ! #C  4&  * " 4  4&  C+  *   ## 3    C  + ptopop    &)& EFEL  W5  5  w &   3 @,?@ >>  4  & hgh  ,- 6-  ;  <\   0&/0/0 9  8%7878 7   " `B_` ?2  pop         5>=@         P%OP 2 "     " `&_` _` #  0 <6 0          h4gh A " @ pop  !<  (G      * sq XX   sqXX      @7?@?@  -   H1GH3GHGH "  #&  ('"  pMop N&    ( '( '(!'('( K &b c8  ('('('( < =B   , + ('('(     0_/0 '        +''         @%?@  *      @?@ ' 0         0+7 ' 0 HBGH * *       POP ' #       #+-  ' #  * *           @?@           4 @          )        8*78   *        @N?@    _ *  *          `t_`_` )"   # e-) "              PoOP             <        p"op/f # xPwx%wx wxwx    & '   X !  `_`_`           3 "     b   E  @  C )"  `-_`_` )  A#d@*_=0y 7 4l k lopklk ' 6`        G%ng        VU           '@3+$ # ;<)i<(+Ba.'    ;~_ j}8V1A G  M .&"\Q2SF ) X<-3 =0y  7  4  " !"! "!'& %&%$#&%6()*)` @&?@ * f      xwx!  R    G 72!  R P=OP=OPOP"!  *  *       "  !  ^]db  tF$Tq &#   d      b'      '   xfwxs IV 2 xnwxwx4wx wxwx  Q ,     ^QL]     >5 *%*NXXWXW%5\%&)*)  5 w` # A&C' H  Q   ,  0           "       * '( '*!  . +, +.!    !    !     _aaa.'  7  (O  &O  &O  &"      HGHGHf e f e             j i j i   ` _    (5'('(G    !   {    a 5   1    pghgh gh4   # !+!  %  p4  pF EFEFE%  %pJI 0r(ababB    * a 's H   8(  b    * a' Srt   hr-    @)?@?@rab  *    r>ijt  $#    ` K!"#  >t Ipr0   "LI0w;!   0 @pr0   " 0n;   0 TrS   ' + S YQrij!abij     * ) "#  # !     t:   !(  % t4  tB ABABA% tFEt  t   `)_`v62  @  v+Z .-  `2_`v?n .'-   '|   v*     x4 @ xJ V xx> =>=>=% xBAmhx4  xn     05    .  >?B?>1    !) &&:!4,    05      . E xk Za   [    0< !&!1k p\op     7+ xEwx R il @ 4 -         :        07/0. !($  . HKGHGH)    (  )  Y! 5VU  WZ   `5(#} #ji jij&k ` _ $&% &%&"= #*) *)*"A #.- .-."<;K  65$87 878"O #<; <;<"S <@  34 HG Z  %S 7NK0 30  +1@ Q  #   *       @W?@        '  H,GH  ( (     @-?@ ?@  *  (E'(F      AD `_` _`;_`_` 0 #  7 # T5 .     !/ &/   '  "  @ 2  """ " #2    L($1 " """""""""  KP K*0 !   %:   !G",9   '        "   !"!$#$#$#&%( '@* )2*)('  /U-X3   O  K     !!!! *0>7NK !!! ! "O        #"           R ] # # & #@#          4 K  "!"!"!   e(- Hh &%&% c  '          >9:# "'        (( 1-)0>7NK0) #"t0/ \&y#$     6]m_n%   p{ ^]x{ bS: -      /          / ! ( #  D   ,|  !'(  g    X 6 %65 5'65653a  4 V -: 9c7l> %  #0#  m#     *B6 +'1 +'1  W ".5#K/K5       N  $   A 7 "! X$#$#8&%&%e('( '*)*)*)2,+,+,+.-0/, +43216 587:9:9'<;<;>=>=  XQWXWXWX  C 01- [tpP a ] T b  @LKL G c L GEEGEL   R2% u&`- b 3 > ?  &     &            #( . ?@214     #                         #        $0>7NK 7 .Q*      7*         *   %      "$0>7NK0$        ^ 2  @  +    "  +    (    +    C   3                 /0>7NK0 # 6G  MkA  = "x Y$ T }TS(z 43 [ ,!I%8#" $0! $6  $"$/*%(J,'7.)5,$+.& 0$/(#D 8(5 J <(9l @(=361 B$A" -DC F$E56 &" &         b  "!"!$#$ #&%&%(' *)* )c,+, +.-.-0/23:9: 9G<;<;*>=>A@?EDCDC*FEFEJIHGLKLK*NMNOPORQRQTSVU ^]^ ]`_`_badcdc2he%l inmnmpo+porq$v&sxwxwzy+zy|{h}~}, +3$   ? 8978      j   0     >- " xwx)          $ o B B" | `K_`_`=_`_`   X WXQ    ' **>$ >*  f4 9     # 4 9 ! 9  \     %'   MZ     +  ('('(:   + $ : `<_`_`   .0>7NK0 . <    (''('('(  )        ,& ) (  0/0/0    $$$ $   XWXNWX6WXDC  -     !<+ .Y   IY/ I    K            *)   .   !  -  " OK&%%.$Av1) "  9  &   8 78    $] c      4  4        """ "   19!$+ #    4      X[e       $  &  4        """ "M/M&M    $  &     $%.a      (  4        """ "   %P"+    (        XDc       $    4         """ "Mf$M    $         BABKLABABA+          YO%4        XWX          0    4   &E#    XWX            0    4) """""""""""   "&M#    j   NMN MRQ POTPOPOAP$O0         R   $ p  Kr@ !(        T $  ~-        M          H  ! !'       '  43( ( % J0         !  7 @J?@ ?@        (           M C( ( P=  )       <       43$!* #4 '2  32 ) $#2)    A: D:=4          N   43 Z*)* ) g  K   H             87  ) 0'      %;% ,   jM $  ]  &Q+$ .'         N  Z    g ; ,   " 0Q/0/0e     *  xwx wx        Y            47- M(  Y  u             H       %       ' ,   5 4  &Qk.   ,    " 8\7878 #      >  !   %  %#>  PTOP    =   J=4     u         h  H              ,    l0 4  &S+.   h,    "   &  @ ?@_?@?@. 8 789:9        <(U.    ?M      .  X'WXWXWX9WX@WX      '                    #           8<c    '               #  x?wxPwx$-+-1 F8 *Y  *      '6, W    ,(   %4     / 6 B0Q+6 J,d  87> 87&+!&+   (' 66 "2 /<0  V5c4&1)#,jf  k ,^]^[:K^]L9 :U :; Utsfe;:!:'-:  '_d_(' ?:C:  ?@9@?:   K: 3edcn,372'%L!4k#e$*"N #   3  . 0;/0/0/0^@    ?9 >j $ 9  lo* *    7    V  )> xwxwx ) D  ( 4.:O     >    " xwxwxwxwxwxwxwxwxwxwxVwx       ,   ! .  D%                ( ( Q    K il  5 / xwxwxVwx   D  (H ( Q xwx"wxwxTwxwx'wxTwxwx'wxTwxQwx      D    D    D A    (     (     ( % T t s 4 ((0O"O!   O L  xiwx  D (- ( O xwxwxYwxwx    D     ( I -;Q  x=wxwxVwx    D.    (m (_Q x#wxVwx   D  (> (0Q   D   D   D xwxwxUwx    C    'I (;P   0         F        xwxVwx|   D   (3 (%Q    <               D   #   xwxVwxz   D  (1 (#Q   D   D   D  t Dq  b D_  P DM  > D;  , D)   D  V& .      D . @n?@?@ ?@?@?@"6_d        . aO/'    * P;OPVOPeOP"     z{ZW:3:34" U4E  85  FC$ R9V85Q n9'; `_` "    X,0+" t'  ";  s   "   /  *4 )1$; s "!!  "      `;_`_`"H< ; , ) H  H;GHGHGH!GHGH"     #& 4  4  "(  9(. $   ` _`*_`_`. 4   "  H+GHGHGHGHGH.2_0/0/7  67# .2_    s :TSTSTSTST S   +*)2  '(   ~}~xw  4nmx(x=9h   %O<(8   E,   ,           i*)* )*)* )  1      [\"!"!ab ! JIPO"!"  $       " C  `O##   $#$#  h t ^ 656/   87 874) *    6   2  $ X#_7 +  !! ( I *Hb 0o/)!NzE (&"] ?E9W'K#.*(?N1i W   `  1  Dv +   y>|  % <  HG  / 2/0M ghk<)  8        <Y    +>   <;    "$$   "  "5$5$<#$;    )*      %       % 0( >     "=:               0_ R>   %&   5 5 ? 30 !4(0)6  /"5"50 /45& $ %           g@L@ > >  4  &  ' #   )I 8  *  +  >Z qnqr   ~}         ! . Z >N       , '  ' >*  &    C0     %  hO>  >   A     h\    # ! !!!!"6LG7< 0 1%W#{n  ,.s&C G,(%p9%*  y +>   <;    "$$   "  "5$5$<#$;    )*      %       % 0( >     "=:               0_ R>   %&   5 5 ? 30 !4(0)6  /"5"50 /45& $ %           g@L@    4  &  ' #   )H 8  *  +    >*  &    C0     %  gO>  >    % ! !!!!"6LG3< 03%S#wn  ..o(C L,0%r;%+"  (S'(`=  P)OPOP 0 ++             vu j ij          -   (O'( #   3H    D,  :,        &  #$)*  '3   J [  y )    0     "  X$WX l 20   0XF">0  2 POP 6   ! ! ! ! -       P OP    ! ! ! ! ! ! ! ! ! ! ! ! ! ! !" !!$ #!& %!( '!* )!, +!. -!0 /!2 1!4 3!6 5!8 7-                               I+VV] [P] ". ##3#W I-   w` jjhjgp1)(=UI# :9&%~  .     %  .     .`.  \.  Z,  ;JIBLEf+"iH"gF"ghiH "ijm DCb,Af!"5"wf! "efwb".   T.  R.  CX(  .    / ' ' &   XWX[d_    agh     D M = = : F JF = : P IF3WJkhvS +~kh~O$.QB *0 '0 O 0    0   .    -    ,  0  !"! (0  %&%,0!$  )*)00 /y2 1~4343436 9:: 4<;<; >=     U^]LI)`_b]b_JI ^   , W0)  '  orq,rqrq r % B)q .    ,  % :)i .   X)WXWX  '1  .        ''   9+V[ 0  P#OP OPOPV  @, #h     `}_`_`      >) 70_  `_`_`_      9@=89456C L 7 "! 012/I"I 8 7878     1  HGH+GH      "  P2OPOPCOP               3 )&  x!wxXwx+wxwx    9+(Q   DT   0Z/0   (4              4     `D_`-_`1_`_` _` 8;<3(,%))      *  0 " &  - !1.A* -[ 878787878   #D H`GHGH    +3T 2# `g_`_`          %543. 6$ `5_`$_`>_`    +3 k( P        A     , 5  8@=8*   )    <aLa &&%;l-Y(  2 a(Yn *JIJ 0"  $#    "!,'250     'J9& " LK    ,+*+ ) =BKL16 5             3 kl G (Q&a< *D '*#*\%'C4+  * $ 9X*2-3\`1-3g=|!D" $ 8=PU3:       Y    z POP-OP                  "     `!6'>2` POPTOP                          $  #**&;2 /  cC &      ,C '      ;@M H G  F 2{PO4 `-?  2 ZY<a2Q/ 72{1EN22 02B32 P   P~   a  s e2M )OE2mFa-2#q     '4 *   w  - ' < /l! = :' ` 8 R%E&-6$ 1K F N    G 7n  XyWX  $"> K HGHNGHGH GHGHGHGH      '     &&T [+ '7"2 $ " #0\Y04cZ- < 5   B1OXW `,m  # s e^ ,  ;6Nf%"+.U     .m           Nj!    POP;  K <70 "Ic >fb8" XzWXJWXWX     = 7ZI4d [         8 L; `B_` _`_` _`c_` _` _`_` _` _`_`_`)_`K_` _`"_`                   0-   M A     ,K  !,      ROPWHE % fk+   I ! o   /  U HGHGH#GH  $<  %! `_`_`#_`    !:, U! ) w      & 7 =0'3) w PyOP  B/ % % .     ng     0=.12 /urkn0/ ej0/ eh0/     /&  &  " SB / 18AQ %w    (@   jjq30/O,+          sp  on s ) L# %P   '[/ & .C~!   , ;u    R  :  5 HGHGH ! P4OP"OP    # N xwxMwx%wx   '     q   P1OP     "     XFWX        2 Y4  "            1'- o:         # +*  XXWX     O) 2 3?  (  5  8@7878   !. 9 (1'('(! $ #Cr  X9WX?WXv  )  $?  g!    .   B  4      #  #    & Q  ) :      5  20   '' F   #    ,9 .D   ,   !& . ,<* 9)) +:%GJ#,!   -,   &  % ,  5 6 6,(  -' 5 E 5 5 5 5 6 5    7< ;>GD C@ ?4KNWP#$ OfCD ol?@ kh <g  ,  ,  -  -\ ,! [  -_d78 c  ,dc , ,  ,  , ,  -  , )  ) ) ) ) F) ') ) ) ) ) ) ) )   & 6 & FW   R 3335 M")E3 B33233           "! $# &%(' *).-. /2 ,36  , - -%F'&'&%&,CJ!I L -M RQTS V , QR     ,  C DEDCD,I JKJIJIJ,S TUTST,] ^_^]^,c dedcd-m nonmn,  P1OP6OP OP)OP OPOPOPOPOP$  .stmn &/"$!0 m lV$  !-87- LK& MX  [P* 96 -6) 6# #"  -U     X MYO* @ W . $,5+ ,((((((:!*HH,I***  + *+| ,     ,%*****8<O           dc  5\E 5 5   e|{: +| k + \[   , ,$%l      8         +O       * ' ' '   <'  ' ' $' .   VGJ:BH    \  6  / n @ ! & #  I,      "!"!"!!&%&%*5).5-,2516565:9:9>=>=BADCD+C HGHGLKL+K|P ,QVUVUV,W%\[\[`_`_dcdchghglklknSNE<@7430'$ XHWX       :!      P*OP*  #* Z>>>>>>)G) +: Y   * *  *  * * *    3   + ' Y!%  '|7<L94_** * * **3"!"! &%&%&+%*'). -,       8 78    8778G  !6 Zd5 .  &#$           *    2 z TE F^Z Sh ]     +LOR  g4G  4)E=%%"?2     )?  !(+/h=:=+ s 70@9+* $ K   \   % ~   & = 0 /0/0/0L       nmns      > -  $  K - $    A$ ( t $   +  =(  0/0        .*$+  0     !>=  +  D  +aY+=}+++Oa2'/2k lk>= l  ~}>=MPx4X>=WZL >=   Y(PIw_Y;$YY/qYH aI z9WIcOBM/ # 19#               & # vt  5 A;  ^ #  + +) #JL  D%c%j 0D      FS@CT9 :QnG*5,# 8!$ 3"!  32      C*GL"  w  3h/E       :E(+ */M:EXQB SZM:EXY :EZ=*1 :  %   ?  -Cbg/6 [  PM   .9< ") 69( AD     i^=(' )')~<7/ N      F   " 'A;     }zyfc t]`_ rE`]  x + udY8 AJ7Pmd)  EPmFG(@ EPm , EPmF=b](!8+'@Q# 2   "w8= (    V   21   'A;B + .  6_I:   B    R  X#WX+WXVWX2121T   NG  8)&=  5650 3= 8      )# >   '       '             !       + !c(Q(W(D(+ZG(%'$$$4                 -.       QT'     "O 03            $8   @(: ""'    D , *)*)r   XW63! '&*  G Y\%  G    2   *  H   H  +  ! j q    A  :z|@@16116a e s%f F) *) l   Txf }"! |$# [ C     "      *g  {  ! H  & o G                         3B?z  & oG  1   ) *     2 6- , + L )      S ) 8786787878#7878A78  "        !ZUZY^]bafejiA U  7  3   3 XWX,WX+"'!  +   @?@ ?@=     ('('('(  *2565 z 0/021     05/0    0/0/0/0A   -4343  # 8:78     0/0 /0/0   "         #&  2 17  " )  7   x$wx % % $   `M_` f  G'   $    XWXU 5HG5D50/9<=H)  (    //gE " D 4 3:  ' 1  : I ''+  # $$ % ))  `P_`  J)   8 >78 1   *5.! -.a^;@a^;+dA@ C2c 3b3G%?/   6  !*  "   4  '  !9     ;<  $ d%Q - .  % !2 121 21           9#$9'    * 09:   "0! ;<;<:56:90   H= D    (I-8F-7!   `_`_`_`5_`H               &1 $     %J!S1BH   *#Y ," :6    `$K )# ,!  2?  3  xrwxO / 9,    X^WXo?  U  *  xowxL/ 9)  p'op  ( ?   xwx   $  / 7 h-  :  O   xwx      / 4 b-  : %              - & I8!     500, ? 40> 0O0000g0,0.    8!78 *)*34OP  XWX *O) $  F "    !          ? 9$ TB / & " Z=&,.'...,D0<#   ""# &'*  =                  *1/4#P   D0 Y4h00/ F eb"|      '    CF '*"B +       0& Ne/ F eb" 6 ( S ? ).)).  8?tR)t    d  ?< >g(S?) pxop opop1op opopopopopopopopopopopopopopop op   .3 :NKFI?     * +  F M& '"2W    8>ET?  u xkwx"wxwxwxwxwxwxwxwxwxwxwxwxwxwxwxwx:wx wx  .;<  :;   * + &'"# > E2O     %  #3 xiwx wxwxwxwxwxwxwxwxwxwxwxwxwxwxwxwx9wxwx  .;<  :; * + & '"# >E2O    #x  #0 p  !  ,  , 3 6 =@A" )^  e DET   [PQ  hoLMH.        #   10*+   #> q" " -          ,  3 6  =@A"  )T [ DE^   ePQ  h oLMH.         %   43--   #A          , 3 6 =@A" )^  e DET   [PQ  hoLMH.      X4WXWX'WX     +%0>7NK0%     -%    H{     ++$0>7NK0$              &X       -$;7 - $ #?""!2""!O $ # JKFGRS :;"#NO&' >? " *+ "  67    23./BCXW `_dc `#95w4 ?"2"O  L%5#     f  59%b2# <)RRVRQMVMBEBA>+ HMBCPQ $%./89  NI" " " " ! <4 " C" '( C>  >  B  >  =  9  B  9  < +;46!4< 6  6 !7 "BEBA        >  + j_ )  Y :   +0>7NK0 +    7*$B<) Y :  [A(     !. -152 [A  "         ! P @6>t   !" , 2n   7 8278@12 CFopsr 2(    87878D . 7'J     ' +  8    ,   .     5       4   \[\[L       * /?L 8'78          H7GH GHP    -     ,%b    _ ,  /     */ m  6$D 0I%(> (*:$"J\ [\[ mb    ) @ K Ka    b   ,7[  ,    '/   #]          % $  ) A  &3"*  K%v4;4t  6*5-d/  HGHGH9    1 ?  !              .4'!       6@  "               #$/6'"               p;opopQ    2Z       K62Z 66   6 xgwxwx2I        :=2I   "              p  #           7,34/0%& 4 343        4 [`_b{t{|wxmr [         "                              8 b[\[\[\[\     b"[\[\[\[\  b[\[\[\[\  b[\[\[\[\  b[\[\[\[\  b-[\[\[\[\  b([\[\[\[\   b[\[\[\[\  b![\[\[\[\         $P &   (,'(!  (   %  *    0  7     " 20>7NK0 2))))2220>7NK0 2))))  FC             >$a"C     T L   ))) )))) )    0"t! M#"   C           $7B"   -0 H   $7B hghDgh<">    21    )0<" HGHGHGH o   ---0>7NK0 1KN          3      //v%   o     ,,,0>7NK0 ,+   .mr  ( _ Z ,0>7NK01 2.-  "#, Y-""" "0!### #0  |  R  P@G: C  .   ( _ Z `         WV !!+0>7NK0 1 !!!! !!! !!!**!!* !!!! ! !!!!!! !!!!! ! !!! ! e  !!!! 55!"#           W  V     %            J: *0>7NK0))  %%% D             >  ! !!!!!!!!!!!:       6  %!            N          # /*          06)<         "!"!$#$ #&%&%&% ( '('*)*) ,+, J.-.- hB       #  -  F: )0>7NK0((          81                 !!!!!!        - +6A       04<N"  3 ,&K     #  "!" !$ #$#-$#&%& %('( 'F hB     F Z #   F: (0>7NK0( '          LE                               - ?JA       04E` " 1 ,&K   F Z #  "!" !$#$ #&%& %F m=         S?8*K A85: '0>7NK0' '                        )8  ?    *(  -  #  0,  7  ))F      S!"?!"#&*   K('( )*)*)A&   hB       # ;  F: '0>7NK0& &          81                  -+6A         046 5  " 1  (&K     #  "!" !$#$#;&%& %('( 'F .          !"!  !    4!  %%&0>7NK0 1 %&&       ,   I9'57      -k     6   "   6      &   @  2    @  2 P                          &      %  3  2      % 3  2 iMi6   T:$"(  * )                  @2 "!  $@#$2#P U6  =       /     "  ,J          #&          :78EMP012%&7  F#0>7NK    #  #  # #### # #0>7NK @  ,   o6&<*&*=$    .%(6&2   =          /$!&'.-.-0/0 /2 343:98 5 < =< =@?@ ?BCJIJI" LKL K,NMJ ,;    * !: #0>7NK01"J   F1     ;D""" ":)dN     $!"!"!"!* %*0+, +!"         V "0>7NK0""   #/)    V U4>+g        ! ]     - >  2 L ' "0>7NK0!!;   ? ( 5   5  Yn            (                 $#    12 #       ' 3 g t0Z"  T 44&- +    $    ! ]  #"!"!"! $#$#$#$#$#& %( '-*>)*2)L,+.+,+  4+        }" D  - >  2 4 0>7NK0  /    NM  5         12  g 0  !%  ## $1&- !)     }" "!" !D    $ %$ #-(>'(2'4 ,        X 0>7NK0 1( (  l+i     ,3 /89  6      &%$ ! ('( '*)* ) X b    aI M  % >  2 9 >  2 O9 >  2  3 >  2  d  9& >  2        %( ]^YFH9^H   0>7NKJI2/('pm  VU123>7 &#   .  *   * ,912  ,912!  0>7NK0 v u126    "CgRH>G=   LK H?  1&12FO.YFH!  g B B 2 Eg 2 Eg K gu/g# %R "&LQA&#  -" $98B/5 8 "  &!CF " #& '&*+!C$*0&("KN*_b A- &  N+zu   aI     M  %>29>2O 9">!"2!$ #, +3.>-.2-0 /d432185<9 > ?@?DA9DC&F>EF2E @9?@3?@  ^u^_hmv<                            C<    0D<  POP6OP OP  #      ,      # xhwx7r   &!1   LNY              %z%9A hgh            ! b">  87878      4   + @    <j   +E| Mb   YE  D 1  $  E P     ; >   P  ( c ( L!+                         @AQ [  n     (?. #('         %&  W: (+   P!$P[  n n v>  "  @5 [ 6565  &=JI>  =W 5n         n      G  n    (, + :                  + 8!78    *'   XJWXKWX          ,*) %   #$         <   *     =  U*    '    ;?,<,) m  " -$ibu  :ef.ba _5p{ !0         ' !$  !)*  +,)   *         ('('(,  R  '  ,  fn 3t  gp 4 : '    <7.' `-_`    z }rspst      P-OP   2  dgd 4          !)  > xuv   y   LK   LM  :"$Z %""        !)   &   !%H l  ,# 7  ,   hghgh    4 <9 DR &  !%     HBRn    4 3:9  4 $ u? ^  `      $B , (_'( ? _ l     &F 0 (P'('( u     K0  N        K0   G       t  C  D         > G        C D        > HGH ?   "   =P  0   @y?@ ?   s     :L    ,   XCWX6      h>ghgh 7 ^      ( #      $%* 7  PIOP <  : @X?@ Q UR(   Q HGHGH"   Q Z"   8j78 0   =  < !%##!"   N "%## # :"# %$    @**a  1"456&"     &-@**a     &-               &#              I   397!(#-6!/ Wd&*         xwxz $ )  PO ?   J, X  #  @#?@?@0      6 0    { r}rt9      .    "%14D     7  #$ '(ORYZ   ?DIm(6W   5  *4 F. @&?@6?@ ?@         6     C BAHE FETaKu   "    & D 1  4 D +B D %P !D  -  $mD D  / q#D T   /---,---,---,---T        9$   lslslsrsrqpqpoloXQRQRQPQPONONMLMLSLS8-.-.-,-,3,3,32321.1        IBIBIBCBCDEDEFIF]dcdcdedefgfghihibib}  /          --  "!"!$#$#&%&%-('('*)*),+,+.-.-0/0/2121434365658787,:9:9<;<;>=>=@?@?BABA-DCDCFEFEHGHGJIJILKLK-NMNMPOPORQRQTSTSVUVU-XWXWZYZY\[\[^]^]`_`_babadcdcfefehghg,jijilklknmnmpoporqrq-tstsvuvuxwxwzyzy|{|{-~}~}-,---             hn v   X3WX     k naf      (='( @      %%4@  &       ,!  )"  0c&  XYWX p ' [ z /  c8% _   SV      ('('(      XXX      7 8  /0 1H$# D   '  !O  '       ' , $\6!  1"  *3a, - PE  < J5  .     2 G)/5. g{gggg-  w#D         u W!- w Q@        E% ,}  ߸ 8  +, T1          f   ' #!&     ((  2    ,+))3w['x1   P    0/0/0    %     - @ &   #           cu 39  - @ ```     m2         & /#12 "   PiOP         Y!@ #   8m78 [^]    T )U ![ " E    ) U( 878     ! #  A           #  n<N  }          ,u O    x '-T'1 17 p (      !t   1!  {`     @p  1:G1F8w& D      D 8    4                   , D    8   1V $ K  *       '$ +    * 8S78 ZWX   a    ^ !A #: hgh      BG ~l JI LK NMVUXWZY \         W!W t[U _        r  HHGHU  $ PxOPT  f  m   P!OPOP/  =7/   ..32j i4j ij i. 2   5 B ?  . /6 / 4   XlWX3WXdG    ?BAJ    "   dG POPOPOP        ~H  POPOPOPOP      4J% D-W/ R c R c R c|% J  . 3zyrzyyyvy  0M > ?DKR   M VI $(#!AjXb /          |% J 8-78 7878<h i       =<     52R c R c R c     ''()   !  >&%#1#P']         ;z vs$  ; .  r o       ,O       2 U !/ ('(Tn &&&&&&&&&&&&&             ('(T ''''''''''''            POPOPOPT^    7  857878     E(6&    @!?@?@TC  "   HGHT:9   @E?@TX K1  "T TTTD '1  ;TH +5T S Ti U>$ W Tm ! Y>( pSopT$:9  +       7 )  $ + @\?@TA (    @ "  A  T  # #T`           T   T  `_`+  I   "$5 @?@?@?@FU    #               12%&     ?     "VE FU  ; <  7&' FU)] I     <  L  '  -     ? 6$2;8' )    R  IVE FU $ #   &  E *FU  FUVU  FUVU  FU| FU    #    <   <    #;  <  nu;\Y  ;   4`Y `c%A    29 $ > 6$! ju!$ EDC/        L %C $ # ; <  ~    /      6%         #     # W)? poopoprqr qr q!       'O  N  ! 0/0/0=   - #h A  S          . +  \ 8 %.nS Bs$'6'h g@h g&R a R a R a5h gbh g4h g.   )*D        W    0  3:9> $ Y 3 FC%&$#"$#2Q(^<    ,  @ &          5 b     $  xwx.wxwxwxwx    ! 0 1    O$h g    +  /-  `Y_`,    0    &1 O     > H    O  878782   PBOPOPOPOPOPOPOPOPOPOP T #        " Sk P)OPOPOPOP v #   J, POPOP L 0r  r%     0/0r88/ rrrT   ! & 87807878 7878 ro        0% %rQ   $    -N &,6,%rj$     696  # :98387:stst <@7   j654) 1d# :W JUk<}+5+45*Ej"SW 2 @sj$   ;       y#ra babab   #&%     dg12>= (3<?<7<;"SRQ   RILKLKJIJZc&    "7>"   }~       % I P)dQ `Q> dOP V/3'".*( #' $0e? l  $$     r  }LLONt YPPPPPPPYPPf6f5QB,rYZYrYZ     Zo2 3mMM*                       %                         .-                    #                                        ! $ #  s57 & % .;a  #  ' ' ' ' ' ' ' #  ' ' >   >   ( P k 8 QWA/']  '  > '8:#"#h  8I11 1 1 1 1 1 1 1#&1 1 16151!1 ? B2,3I#1Z,Y5X      G  G (  X   K   "  ! & % ( ' ,Q+*G%$G. -*21 4 3436 5658 7: 9:9"< ;> =>=@ ?@?B ABCF.EFEH GHGJ IJIL KLKN MNMPOPOP OR QRQT STSV UVU X WXWZ YZ1YZ YZY X1WX WX1UV UV1ST ST1QR QR1MN MN1KL KL1IJ IJ1GH GHG B1AB AB1?@ ?@1=> =>G;:19: 9:G76056 56134 34- \[\ [\[\.[\[\[\[G  - 8178L78r f    * "   G XMWXWXWX WXr           *  &< PAOPOP r .       "  # %  .  `j_`L_`L_`r         4% # q/"% 2 GG P5OPOPr[\[\[\"         ($"r[\    H2GHGHGHGH`r    6 1        7 "W4 `?_`_`rl 4 + ( ' @.?@?@rB    )  _ -r  ij  "   5    @?JIJI $  $#            = H1 Z -,MM4eHK  K 6W .   L r*    U r[\[\[\N    T% $N   pAopopr[\[\[\.  4$ .   ('('('(r    <-r h+b    %     +    7;,;3 O   +1  7R!r   VGHG Z[B7 NO8Qhcd_ FEN    ,' $  #837&HG@C4/&        - ) +1k "3 3  0 0    _8rYZY Z[\[\[\ YZ         `          ;9% l N9BW(& : $            g% .      .  rYZ ;N  %r'ij"[\[\[Z YZYZ. +ij             D "&?*'" . +  pNopopopop opLopr(      ) )] =#)"(  `G v8Pr W6[\[\[\                     R f  ) )%6 =6 1  Q        #   9 .  1  `?_`_`'_`p_` _` _`_`r$[\[\[t+ )  _!  !     21       F 4 )81           +    `V_`_` _` _`rYZY ZYZ[     Y/( [   rYZ    r[\[\[\ 1  $ ?+r "   r   rYZYZ[\[\[\YZ[\[\[\2YZYZ YZYZ 4 [\[\[\   &    %  0 S'  & 8 !  &'+  -P  &(    `Y7&" @2          4  HrU    r0   Hr[\[\[\0 &  * %0 rYZ d  z' h3ghghr@      9'@   837878r[\[\[\  %%  XHWXWXWXWX WXr[\[\[\ YZ              $"b     zb :   >       t    m ?|&%&%&%5&%& %&%&%&%&%&%& %&%& % & %&%&!%&%a&%&)%H&$%&^ '.-65 0     }~{?BA65 0 =HG65 0 W J]  'dc65 0|{    jR OV S?E       z 5y|{65 0 =65 0 J  "  &65 0  C,  k,3       z     U  G*{L= 5             " ! $ #('(  +,  )a0/0   1H.   `@_`R_`| )<;  # 5/$! h[gh gh|x  $ (C; $| + ,* + ,+ ,, + ,+ ,) + ,+ ,"    #   !   #   #     i l k  !$##  !   #   #     " #$# $   pop |  + ,+ ,C      3  '  %'   3      3  |_Q  + %GE-!K>_Q xwxwxwxwx8wxwx|hghgd pmng     >.d ( Cg  33$~  u vuv   )*)*) *1)*)* uv m nuvm nuv'uvm n* * >mn[v#* / 9  g #mn  mn % )Z     "     M    T     xm  ?=       7 <"'y  "    (    "!ju   ~i ZQRQ    {t     { kl  nc2,    ='         <o 8 =;\   n ( # .H <D   =W Y8+$1, t   4-+50?3B658<5 43!          1       '  *"!"!$*#>&'#**)/, +9. -0 /g21 4 3#65 87212%129   A&;9/G~uvm n Z)*)*?uvu vuv] uv)*L2    LU   t s RQRcfk W ~            a#   E   +  #%: .FJ "/[% e_"-   )A  Z?     ]   L2 ~%     k      "$ ~l kuvW)*uv = >$)*)*[)*)*)*)*)*uv = >\q rqrq H*,) *)*+) *   "!    % F "  5 "  $  #       ,! #  $           M4p ; *|J 7$:VR?' ' 3v  W  $  [  \     ,  +  X$WX$WX~V    ~9  efefL  !    !  2          CN &RXw![9  L xD .#$-$*#$#   % * ,;$!'     (q'('(~)*^ ) +    ( 6>D$ ^   g8n%"5 ,~&uvS lklk Ptuv 0uv2uv uv       VS  @)           RABO   !Ri  P?RG0/         W=   Y     (  +$)5   IQ _ c1 B0 0#%S8z' 6 21"%!$ #&S  P  t   0  2    ~                  .-8 3X?7~, 7lklk   ;lklklk   D            ^]lkr  + 4O      T     !    n klk| 9  -,(RT, 7     1        q6~  uv+uv  0        &  * 9M+    0 x2wx&wxwxwxwx~Guv            $R(/G  HXGHGHGH~q       & h~ -  6, @?@?@~?    $ 0 :7 gg ~Oabi uv +, +,Nuv +, +,   v         S\   $(      $)    !# O:1 # 1? N % *   8 \* /(0;' ' "'!$'% Oi   N     popop~    D'    !   !    ,;.@o ?  /  % !     ~4   b~B56%     B,69B% `V_`_`)~C    *       , @  AC    < 9^ T[# $TVUVUtststs># $# ${|{|\  $      wxw LK        o  g j ] `N=>E - !  !R$ /)I{Tg "[ T  >  9` 0V/0/0/0/0/0/00/0/0/01VUVU ?@# $# $ # $ # $ # $ # $?@ # $## $?     8                $1:1         #   l;%<31z# $L tsts# $ts 2# $(rq# $?@?@ #   i/p?@S Tr q/00*?# $# $# $8      D K2m =>       Ky;$P*  b*)O) -t#-$- 4-       !      "    #   (          "!(E      ?IR6  3  ; TO+^y +&2< e% #31U  z L   2 ( # i/p  0"*!?$ #& %( '8 P[OPOPOPOPOPOPOPOPpOPOP OPVUVU4?@?@# $# $ # $ # $ # $# $?@h# $                    ;-B4     h   & !# $ l# $    5     3    # $# $          "    i# "          U   +^^ 0 8#'8cX  -2!  l    5         3             O0  $  $$ .   # $      ## $ # $# $# $ # $ $       /  /  "66  6        )   '   /  /*p, C !(3E<7L  0    $ .                #         >8}%1x .0C# $ # $e#$# $ !                       "  e  6 *$ &- 8"8J !C   e    ]8!tcts tc# $                   l G"PM3 0 !    JU#$        !4    :     ;+/6 :u*)'"+!    ! U     P'   )A# " N=' *wL P' A)  <# $?@?@# $# $?@ /$STST% K=                $      A )  &W    )  /: 9 <      /  $%K= `<;<;< ;6    #  ( `<;<+ ,+ ,C;/< 8   3) %' 8$%'   3/ `L  ('('( `B9AB5ABZ #ba\C%ba\CB5J `< + ,;< + ,;<;<;< ;<+ ,;< + ,;<;< ;< ; <+ ,;< + ,;<;< ;< ;<+ ,;<;< + ,;<;<;< ;< ;<+ ,;< + ,;<;< ;< + ,;< + ,;<;< ;<+ ,;< + ,;<;< ;< + ,;< + ,;<;< ;<+ ,;< + ,;<;< ;< + ,;< + ,;<;< ;<+ ,;< + ,;<;< ;< ;<+ ,;<;< + ,;<;<;< ;< ;<+ ,;< + ,;<;><+ ,;< + ,;<;< ;< ;(<+ ,;< + ,;<;< ;< ;(<+ ,;< + ,;<;< ;< ;(<+ ,;< + ,;<;< ;< ;(<+ ,;< + ,;<;< ;< ;(<+ ,;< + ,;<;< ;< ;(<+ ,;< + ,;<;< ;< ;(<+ ,;< + ,;<;< ;< ; < ;<+ ,;< + ,;<;< ;< ;<+ ,;< + ,;<;< ;< ;<;<; <;< + ,;<;<;<;<;<;< +   -X EC    E  @ 3  U   W . %c qf  eqf  u ;  ;{; w ;  ;{;  1  11  1  11  '  ''  '  ''  !  !  2     2     :      S j     q          e  q    Gh  cSp i   -J  E9R K "   !0  +!8 1 '       '  XG   LG  7 X1!   L1  ]RE  RLKLKL  9 ) r$r$r$r$ r $ r $r ${ _J,                          ! "  ! ! " !( '*  +,  +*+, +2  34  3234 3:  ;<  ;:;< ;B  CD  CBCD CJ  KL  KJKL KR  ST  SRST SZ  [\  [Z[\ [b ad  edcf  ededcf el kn  op  op  u>x  yz  yxyz y (      (      (      (      (      (      (                                        `<;<+ ,;<;< + ,;<;<;<;< ;< ;< ; < ;<  \Wvw  VPOnoP        +'[*         `<;<+ ,+ ,C;<  }    3t `<;<+ ,+ ,C;<  |u   3j{ !'  $'  3  hgh `<;<;<+ ,;< + ,;<;<;<   rk je  dw^]u -%,v     pop `<;<+ ,+ ,C;<  ojc   3Zk $'  #$'  3 `< ;< ;     X#WX`< ;       KD=    34E  h2gh`'< ;   '  `_`  ;4-    3$5 %'.`< ;   hgh `<;<;<+ ,;< + ,;<;<;<    ! ,%+v    `< ;        3     `"<;<;<;<;<+ ,;<;< + ,;<;<;<;<;<    !&!"  '-.)* P,('"         3%    .3:   3E4     QX Y^  _LefN   `< ;    `<;<+ ,+ ,C;<  jox    3p          s ~       U `          3     3       3     3  4 -    3  V I`<;<+ ,;< + ,;<;<;<;<  ;   RRK !o       `<;<+ ,+ ,C;<     3 %'  $$'  3  @?@`  H.GH GH`I   #&%.-( #  _:zZ_SebVt%`0BAB!ABA B%ABAB A'BAB A6BAB A2B!AB A2B"AB A B ABA B AB A B AB!AB A B A BAB A BABABAB$ABAB AnBAB AB AJBA BABABABA'BA BAB A-BA B AB/ABAOB AB AFBA BABABABA'BAB AUBABABABA'BABAB A$d   65 0      "65 0 &     65 0    rqfe856    C D WIJ K XJI#jiO  w i () '.zV~    - \;dxI[g{+m  65 0  9j  65 0 65 0 %6;     ba \<    9IB 65 0  >V[m 65 0    3    4`  WR OWj ,  U5  F\ HITd tN=!@ KD !  d!/ 9 0       '  5 2   " !2&  '* ) , +./ 2 14 3 6 5: 7< ; > = @AD C FGJKPOP MNMR QnV ST  YJTS ^ [\[\[\['\[ bab  _-`_d ej ghgOl kn oFhg t qrqrqrq'rqv uUz wxwxwxw'xw~ {| $W  `  `       7 "  ,                   "!"!"!$#$#$#&%&%&%('('(' `<+ ,;< + ,;<;< ;< + ,;< + ,;<;< ;<+ ,;< + ,;<;< ;< + ,;< + ,;<;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;< ;< + ,;< + ,;<;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;< ;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;<;< ;<+ ,;< + ,;<;<;< ;< + ,;< + ,;<;< ;< + ,;< + ,;<;<;<; <;< + ,;<;<;<;<;<;<                                                                                                                          ) +G,                         "  #$  #"#$#* ),  -.  -,-. -4  56  5456 5<  =>  =<=>=D CF  GH  GFGHGN MP  QR  QPQRQX WZ  Y\  [ZY\ [b ad  ef  edefel kn  op  onopov ux  yz  yxyzy                                     `<;<+ ,;<;< + ,;<;<;<;< ;<+ ,;< + ,;<;<;<+ ,+ ,7; <;<                  &   )&:#2(t                 &      3    3    3      3  X{WX `<+ ,+ ,8;<     ( "  !m   (      3     ( `< ;<+ ,;< + ,;<;<;<;<         ##"q          3     (          3        3      3  s`0BAB!ABA B#ABABAB!ABAB A2B!AB A:BAB A B AB A/B!AB"AB!AB!ABA BABA!BAB$ABAYB AB AGB     65 0          65 0           65 0    ~z i   +HAl65 0 /65 0 BIZ  65 0 65 0   cX   8    z    Q  \- G    970 `,  #VId,K0          2   9"#& % ( '* )/.  +2 /6 3: 7<= @ADE!JIJ GHGY8+L MG   q `<+ ,";<;<; <         %6#           *`<+ ,;< + ,;<;<;<;<+ ,;< + ,;<;<;<;<+ ,;< + ,;<;<;< + ,;< + ,;<;<;<+ ,;< + ,;<;<;<;<)                                                    )&#0#0##%#9%/                          (   '&  '(  '.'('.-(         3         3             3   F `(BAB AB!AB AB AB A?BAB$ABABAB$ABA+B   65 0  " !      ) &#L:[EA(        ?  +`!   `         XWX`< + ,+ ,8;< + ,+ ,6;<    &   &  "!    &    &    8P787878`BABA&B     i  &        ` < ;< ;< ;   1     pop `< ;<+ ,;< + ,;<;<;<;<             &#%q       `        3         3   xwxxwxwxwxwx6`(BAB0ABABAB,ABA BABAB ABA BAB ABABAB/ABAB5  ba \ba \ 65 0 ba \ $+,f\3(                             :`<+ ,;< + ,;<;<;< + ,;< + ,;<;<;<+ ,;< + ,;<;<;< + ,;< + ,;<;<;<+ ,;< + ,;<;<;<;<;<+ ,;< + ,;<;<;<;<;<+ ,;< + ,;<;<;<;<9                      9&##%##"#0#0#I%?                          $ "  #$  #*#$#*).-,  -.  -4-.-43876  78  7>787>=8             3                  ^SS^`,BAB A B AB!AB AB AB A B A0B AQBABABABA(BA BABABABA(B     65 0     6V3  =\OIp  9) 65 0/* 65 0,  HUIA&9"=",            / Q (  ( `_`,`          %h) H!GHGHGHGHgGH`    $   ]:'aa        `< + ,;< + ,;<;<;5<;<             !    F`S   @. V`g  - &D  `+ `,    ` '`4    XYWX WX`(BAB A+     TE(  + ^S `B AB AB AOB!AB A BA BAB A%B AHB     8^Y65 0       @) #4  1M ,  U.M    O       $ H @B?@`]     ,  `0        `< ;<+ ,;< + ,;<;<;<;<       !o           3  H^GHGH`BABABAB    G#Y             (`?           3  @/?@`BABABA      xwxR`                  -3gO 2\1`           R    .    A   /IK - A1USFg        pop `< ;<+ ,;< + ,;<;<;<;<      &#%t            3  @C?@?@?@ `BABAB A BABA B  65 0  W       @N?@`p    8 0`L    "  H(GH GHGH`k           GuV     +   +)* Q }~}~E     *     7 &K} E b^(1  )X--     &$             % @ "u  I*7  ) {$)   )X-}3- p#;U1 Z% &% &-              %           /"     g  !T     () MnDvg 3z z  L '  U1 U    - #"S  #   $4' H0GH      ,   5nAB% & % &ABABAB PM  "          E@W 5  ;  [   r& &$e!^*         ;;[#SqUV ~h% &s '     %    P   50)     ) $:   T  w{q ~  h s J  }     !    - %/=IJ  } #$"o!!AN tsXCDlZ> &5%&   % &'C)DC                  !o!~c       1    !=         G  -."pq = I f   3B<=5D='   8 #)* 2 J N Xl  Z  >   & 5      ') #$#$           . %7#$+rq #$ % &rq0          &     i<  2  + !3!"% -   9- SyzO%& % & CDCD CD               (    G  #M/ Q  i\K+1.c!  2SO          0J/0 /0/0/0/0/0/0/0/0/0W>`    ;QW> <7 Y:dNK on7' (' (' ("  ' (' ((CD' (C D;' (nm0' ( 34 *     ' (A' (' (' (' (' (*' ( . ' (nmn mnmnmnm nm ' ( C7DCDCD Q T u x        (! :     *! u  b&    "     ,8    /     '  ' "  5e) )      W3 A H ( 7P P^"!<?q9!4=# (&($5 9*7   "    (   ; 0  "!$*#&%&%( 'A* ), +. -0 /2 1*4 3 6.565656 58 7:;< ;"!"! @A D C   434365F 3 H 5  qH1?' (tWX %CDCD CD pop_' ( `_[' (y2 #p_   )"  JI     +%    %   3     E  #     ;#DCPODCP P  9  L I[ <=;!5 I "; 7 f* N? t %         [ y2 #    `9_`_`_`_`_`/        +& 6*3}k-                ' 5 H*z  #(}k- s%3;' (' (' (' (P  #" CLEF?<@?                    #c}$$$j1 ;    P 8*787878787878.7878RQRQ RQRQ RQRQ*RQRQRQRQRQRQRQRQ RQRQ   !()018                                    *            2J5 3        =# "          7 hiv+B$'8cX 40 "M5 3  Ap}L8EFE)F{ )'(   G   "  )   ) < 4     3"      3 " Bc H _ *y8T-1 4 VX xwxwxwx 9@?  -0   3M ~   ( n  CDCD r q?' (       2      '    !uD 0`&    ?   A$1x 4r\-  ' (e'(' (b !        !                      "  e# 7  % )- +3!"8  *  '  ]\-   e   b M!pop_  `_' (p                Z=)S!    V^ 2 8 VOMN= $d   %      ' f_> O= $V          VMNE F MNv  EF      C <  (j   5)  v   AV' ! 6  ' V-0  q 6 3 A I,-0 /$4V     ( +JVM N[N!6*5M   MN0 fM N  LK         : U    , DA   0',       ef    #dY6 C#=; 2 /"-2 1!7f 0  "F P !*M  0 f  @?@*?@ ?@ ?@V+65659      ' 2 ++9        (V7  MN6565+6*5fMN=  *M N         7         )  9Q  8 :  Pd  N\57 +*f  =  *     V         ,d878 + ,78 + ,78 78 7 8787g8 L \YZ       $! #  (T+#%        g d878+ ,+ ,C78 Z     3  xwxd878+ ,+ ,M7878+ ,+ ,C78R   5    3!, "'  `+$'    5     3    p@opd"W XWXW   RSTST *,"   p>op dW XWX%W  F GHG D 6( %  p*op dW XW  6 78 )   =   ] dW XOW    \+  O dG "#  Udb  ,   POPOPd=    "d ,+,+ , +     !    OdNM @ 1 $    '(%%  @ 8K7878d      Tmv       1L     xwx8            J pyopb  GFEH I JIJ UBD0    3 I  3 F 7 H #&       p5$          POPOP#OPOPOP^2     1 8>78 787878U       Q!/U   `u_` _`      E 8W 0/0/05    GC T  $opopop- G  ~     21  + p  71A , = )  $-   Gopc\ @'?@?@?@?@mn )      rc )   @3?@?@?@F     2 'F  #1 0= / hWghghghr    ()     dw % %)< `__` _`    "!< yopo pop      V5!!>0 op% D\@+ ,?@ + ,?@?@ ?@ + ,?@ + ,?@?@ ?@ + ,?@ + ,?@?@?@+ ,?@ + ,?@?@ ? @ ?@ ?@ + ,?@ + ,?@?@ ?@ + ,?@ + ,?@?@?@ + ,?@ + ,?@?@ ?@ + ,?@ + ,?@?@?_< ?@ ?@ ?@?@? @C 3   5 A   IFE   I?   A 8 1F 7c   khg   km   wrq   wF I   $ A) &(#N6#C                          " !$ #&  '(  '&'(%.  /0  /./0/6  78  76785>  ?@  ?>?@?FCEH IL KN MPOPO P  \@?@+ ,+ ,C?@     3 \@ ?    H+GHGH\ @? @ ?      *     \@?@+ ,+ ,C?@     3  D C \@?@+ ,+ ,C?@      3     3  ^0??Z \'F!EFEF EBEF EFEFE B E: &   F E F E^   B E/ F0EFE       F E B Ex  F 65 0      65 0   hK N         `8        +5     0+ 8    *      ba \                 )  Y "  "$   F"  9x@i4S  %+3 +F7 " .'           :" !&$ # & %( '* ), +^. - 0 /2 3/6 5: 787 < ;> =@ ? B A 8 7 D ExH G    \ST  V              V \@     P  \)STK L>\KL        : -    +   %' %'+   ) >\   X(WXWXWX\D  % s:\1O   P     +  &   '/ D# 1 1O  P\  PLOPOPb E>  )2 ( >ABAB '(!. hy] 87    ! ,   . .     &m   > o 4 !    . ( A  5(  ( -1 {  / K'- )?U 7) ba 9 4  ba  4  #\[\   ghg   H 9 \[  1       *            &  "QPS   9  # * f2u KXG/=><@% #H d :  9 4      4  #   H 9" !  @D?@?@ ?@ ?@ ?@Q  ^ ]  ^]            \BIQ     zaf "  M `_`` <+ ,+ ,<;< + ,+ ,=;< + ,+ ,8;<     +   -   (&#% %    +   -   (   `L_`T"  +       0 )" +! 5   '  8-78C78         xS b     " p(op!po !  !  *  T m  y            ('( '(r '  (  XHWX U ?& +, <    0/0/0/0>   .^ n  X   pDop$#$#d    w   z      l7)7:  `!_`  !$#$#  ! ]  d .     arqN   3 >5dcdcdcdcd) (  }-    >5 X W ] ^J *mPN.2               G (    09/0#       1# `!_`_`     h,gh1ghPgh      $E#   ( (#        1 *w + )  HGH    l    |{|{"!")|{01|{878?|{F  UX  i|{pqpoxu x    %4 l   ",  K   &+c   P6OPOP $ #2  *   2 xwx5wx  G  '' CG _ fe MZ4(L 0/0C/0/0J/0/0 *     ]^      %`&VP  #(N * L RQ R     5R .  d Y;    yy (,g(,S(,+'       $[\[\3I D   ?  #  U ) !A"H&''  D `V_`E?4 +E l k   PMOP<*<)!   < 8,78 \[ba %     3 878 l                   J I( t c   u  TSTI       ' bXW   "   " "    "24  % J S#  FFQ*     t}ts !+0 \}`_`[Z}t_`} tuvqH}t}|?BED}t}|?BA;le v }t0&/.(a&:;<9? vu $kt  JKLE"}t!"! }t!" !" }t 'OVU FElp& #}t#}t}|{rqQ(  "!$! !'#K!,&3 o $x l #: # s           b "  % ( '(' , /,+2 /210/0 /6 565: &9> (=B ABAFEF% %H IL KLKP OPOT STSTSTSTSX WXWDCZM@;\ ]\[\ _d cd gjeb]8  H/GH#GHGHGHGHGH Tij i      a d o ru l ] Xf      A TSXT STS hy,     T5$#$!     + >72%(    D5,))     C[ D &m  #(  # 00 & < !X  hy     ,       hSghgh ghghgh TSTSh TQRE&  ,$ h    ( '( '( '( D    . % Q J S        t  }}.. 1;4r"Q                   TSjij i1TSjij i~               H 1 ~ XsWXWXiWX!    @G@I !   49<= 49<=    cp,+]   F  D -   .  6    ^i   *   #s       CD - .   P  >r&   @R 6 +J   (U  hgRQY              ) ,+ 0  %"    =EH Q R  8@    b$ Y      LS   2 D CDC NMDC NMNMP OPOPOP O NMNMF be    83:9 )*B"        HGP%  -I=D CDC NM N MNMNMI    8 5    XW'B!     Iz 87878  ! POPOPOPOP>   0/0 /0/0 /0X     2 +x                 !                   li6 ]>  (g     & +-+l7.!IjS \  !"2!a>XO: !         b 0 V0 > 0"40B     *"    |&%&%&% &%&%&%&%-&%&%&%@lk &%popo&%& T  xqJI%*F  zyzyz  EHKPKL IRz       J?zW zy        )A    $ z3PBzy %  ozyzw J     %< c T  :xE   @?2C.,W :%<O! V|Y -      @   e    Tpopo3lk"~MRQT       M- 3" *< F# qplk VU#lk l k f efe+   #       #B c  !.*A(&  #    +      0/0/0@ $  0/0 /0+po  +B    .  G;M  >L  '$" F-G*M @%?@?@:   c  @ %&%&%   L >u g 8 2(c )  G        #G  (  +        ;G# HbGH GHGHGH3GHTGH GHGH;GHGH$#`$ #$ #ts$Psyts $#$#ts  klklkv y       JKV Ydgt s pU   Rddk-  !     "  `_`  | y  X!WXWX>    # /         4( )  $#$# uxD9:9   ^ #!)    ; +!7%4  (%'()'($#$#-$#$ # @EH = :  (%'(Y'( $#$#`$#$# "'*   M m9 @#?@?@a?@?@  W \        3B!  W  7 )   ) h8gh  '  "7  ' :0 (A  !    +( VL" ! 'B  0 (A f=4  =4 I  &       !  +=4 H= ! &=8     ! = POPOP=     hgh%gh "!   /-  , @(?@?@5      5       2     32 /    1/     0W/0 6  EH      ;  H{GH &EF'$%"  % BH :    0`/0 W    *)  ET %  >   1$     G( (   340?GXkyb   $   / pmnJ[ HKGH+ j     l opmnk   *) CD73    `_`_`    ! V ab56/   7 MX,\ $  ' "+&  +H V  f#B  R ` `m&38%  &%  CN   z w  @7 I@ R S  BA %-7#8 1 R `  l    $    6# (L'(4'('( #X    1-M/#X ('('(   -Ys ;0      (    pe  "    ' `.  +!  &fefQ <VZ7/W^&70 UVJ#/ Qx+/ " r;%_  3 #7 +  ts3    % Y               VW )   8 N' &' h $& SZ" n&  % _   3 #7 hSghghghgh#   3I   t q   D    M +3   &%   ) &#  n2E2 #*        2 /          C$ " 59$      &   8)7878    #, ' PwOP!OP OP  A<; D YY'd C ' 9 W.            )  >     -5Bh X 9  ) .       CBC Lw     %      &I2:Lw POP JQ        " JQ D  FL !     % 2 )  6  FE  R Q  #   (  1   C  & }l   Q  &  ,        z#     0/01/0/0 !  $%  !        ' z AD CCB "YTSRi d F "   P"J!_"!"!   a  >4: uxuv 5!c DE P )_ x[wxwx wx1wx8 p   p o  ! " !):?$88 p N8uEH%  3 )     )      :  , L             /A #< 3//Q- 6$$+ !C,! %  35                      -C ' |8   O P    '+ 6  'J$*/ C '   z  .  `_` F   "= J  " F { y l       lb  c(X W X W XWX W,XWXWXWXWXWXWXWXWX WXW^X' 00>7NK00 00>7NK00 ''' &    '&''  0>7NK0 /2 ']'" "' $   ,  ^ h+gh  # 8!78|   -0= ) 6 L D         ~ s   ,e } ) 6 L D L A  , !        ,e Z  +,_ 0E/0/0/      #5/  8"7878        @|?@?@ ?@?@?@ @d >=   > 0%0|@11 k "E d"ABA      h`gh   =G B, `F_`_` _`       4      N';74 `c_` "      %     O@("% /?   a l    >= ,p y    R, 3 9  %  0i/01J    4D.% 8178E   ! @-?@@   .' @-?@ B 02 H_GHGH   A/5I    $, POP    8/  '" '" ' <9: ! [  KI!X %  P  +  ?            )  -&9: /& 36jt./       *    HaGH -1 30      Fa-  1 8%78 8178K78 7878     A<  -^ ,y 87878K  ")  0B/0=/0/0/0       DX   6    f  m n  *   A :(K    f  s  2  =   >=  d;R2 = e  DT % >=K\  _HK !S $ G Z k" 9[F\e  BT 2 wiY9K          w D        ?  }    "C "C ,)(# C*j{`_`YZW 65  2K214'(@  _  \-   CL #             '    n  4   l   0 tkP y 0s,  d;^Z  ) L    w D  3    "!"! $ %&%&% & !       x    &7  - *   !S    P  t8#x   7     pLop      )$   H%   8            r  9   <G   )         , $ ) mmC Y   H | #Ac-ZNE0 8            6r9  u    -7 ) ,   !S   P  {6%hCu   7      v  5 '  )N 5  \    9    C5J x    9     C 3J .  @   < 0 9 .  -'Ge@ (('('('( c   Z  e75,     P<-*!5,.    !-        +  TS0$S T# $# . KT  );-    + % 1=       <  P       3     &NK$CV3! $  &,4+ V #/ O  H) 19 = <P    3   ("'('('("'('('('(/'('('('('('('( '(+           ,e Z 34,           ,e Z 3 ('('(.   (#'('('($'('('('(2'('('('('('('( '(F           ,e Z 35G           ,e Z 3I   B[J      T + , *   !   )* )  .+,'FH  8f&#  ()(POfGC rq fi       63 .-0/ "%&  ABC.?   ) . N  p  '8!+$" d)>#S?fB .      Z Q. . (%'('('(     +   W % 8cdcV75  "   0. 1# !!:?<;8M: %51*9H?/#XWB   '   O4 1'_L>,*&2:>.!7W6aX(D % ('(0'( *)*)&   /" *& P>OP-    /- 8/7878 7878Xs !   " 6AB!  \   4O.X6; P&OPOP1OP+OP1OP-OPOPOPOP%  .:K   ! !     !                  !  ,   & % $ )$%  . :    K :"""""/QF  FG  tOBC6 3  M  R329  R34NS  ` _h gF E< ;4 v   FE     DED J*     $ _}#G*6!        D Ks jc dcdc    lW2C  X UDUFEF=DKb5+  :212125 `GJK141[X abghg $ LMPQ +4 +up UZ  ;& k59. @  &                ,e Z 3   [D       hVghLgh. P %     ] F)-      6 878:)*  @0?@?@   *    mbK     '  B% 'B)#<AB    )*O$#.343c-91                  n,        !f9    v :l z!y z/ ,   (H'('"H      .'" f orklm   $$ t  utyz{   !%'"  !%  %PS   -T[p!<>!}     $   $   $ `@_`_`_`@   ]^ -@ ji DA   , ? xwxL 2  /0HG)*LK)povu 2  BC14>=789GS0'<#!%        - ('&#$#*)('&' *+0/0 +  &'"! !  !MKPM++!( !$'$$. > d  Gj  >#   #"   {|vu    /#"  (% o      7  S.ui   ,  %7   zM  F  ]   $m!-M  :Q4 0(/0/0   ] $  XQWXHWXWXWX    p   '0'      )$0F9   p @!?@?@?@?@ ?@ ?@. P          $e. P  0~          $ # 95'   k  k6 E   >=                  ) !7 -%6)0    +  0/0/0    1 BO       0 KB2   M  C         7 O\3 h3gh%ghgh ghgh     #$ ($3  h]ghgh     &     & XiWX WXWXWX WX>WX WX  J  X  ,d !   PW0      K 0%(   1 )$"  JX  , \j "!" M:      WC Y7 xwxwx!wx'wx!wx  @?   </ "aIj F    36 56 76;<!/ _D,i  -/ P?OPOPOPc  # " `%_`_`4k  3L> #G P(OP ,+  ! !` _!  0/0!!!<;  c;<  8  >e2  2) p*opopop +^   ( $# &1 '  /1 B + @?@?@         %  K <;<K     8'   5<      !;N"!;N  \PMF  1T6&H %  K PCOPOP OP      J p\opop opopopop   f%6   9    /          i /    (@'(&'      B   , ;B 0P/0A    .";A     8^78 _     R       *,2,9 0K/0/0/0/0D .    GD . x7wx/wxwxwx  ." ~'#-0 0   2   51 G* -0  F0       .    0 -2   Q/E%(5d/   Y B + Q,,A   6  - ;F0 t "    c b]^(L  " H#GHGH     "    @*?@?@   (['('( D !&  D   !)!5-!)!<!$'o;#!<(    `0  Ofuf0efex|Z@h2W0XWXC ' 0  &l>     J0  $  $0$$$       %  1 ++A>=>(<             ; N  0W           ! 5     +GBuG Q + m v W d9* l#0 0  0   \ '$#$#21  !7 . .   !8 8878! < 3 333 %! M M  0/0                            HGH           POP $#*+&                        C u * * * O 0/0                    5/ 0F  Q ?\[\[+  0'kvwx  0/I  ( G 7    *7_Eh iM o=    *_h i h i 8      1  "! #=1,UV +.-. -   !% i         ;<-     u;e    @$!&  I+ ;(gi ># !     != !u  *"!_$ % ( )./8  ( @ # . 8#787878'7878U        +# ; XU 5h  .`_`_A      &  (o    +  -         I#"!% #+2.    A J/po    ) /  n m   @#?@:   % `_`_`    @$?@?@?@      jK0?* j ig 4 =   \[\[2\[s         "6Y0=                 #=  5LKL%        ,cA  - $7&%5 =   L  PJ  -   /0  & ' /G2 $@%_7'2* -m0  36&5 7 *  g 4    =z)   2s `d_`W   F   'W   hQ    &  B 7  - 7)  |\[* =T   * !7      3     #= @Z   E B     8*  = T   j i    j = ,)*# #= "'2     =  h:gh     $  mporq 0 /0  -' 3 hdgh ghgh  - 5  +   @q?@?@ p  LT  p 8M78787878 F"     .& " P C     8  C NY{ 4b**    (aO!P*  89:* )$ #= 0* )$ #  ) ,* )$ #       02 5 BVNJ3V> = HP+ (% VDl,@ &( T WZ I ) :o8 69/gjO9z* )$ #LE7 XL$  F , ?GXJ \  o$*2              Y"    6Jb    p $  b84 [hgOP4 O!P4444 444; n!      ( ('CB ( I WZ Tmd(md((( (( ((y h!D " *)!2 $ # "3F!)!*))0*+)     (   ( '"$ (# ,)0 /0/4 (38 787< (;@ (?D (C H (GL (KP (OT (W X    o3++b)O P OP   U  4           TwU      8   8bL *    R    ** )$ #,#$!      * )$ #* )$ #   $  $E#$#$pn2+"L                   @bCD    ,3 ubu <' !4 `8_`_`_`b  )     )bb `Hb;hg^     " De"* ;^bLe f1  D?x5Zd      h(%>5Z xhwx wxwxx.    \ Y 7 " 7 1.    x##  x%%#% xlm4^    #4    +   "#     "   4  J   + B l4x//   x8mn m n] ^mn      H"; 8    S,"xK]=^mnM3"m=^m>^m4^ m nm=^ &]=^m lAkl  "-{    &!     %=    (~*#= 5lk!     6#>A#4  #= $  =       N  o-  "  ; B  D  a )#       6    / %'  $    (5 1DE$H     GP O K% =  + 3 " =`6>4 "=#"! &*=)( +A,+  |  x%V    r  !@   %V    x   8b78$787878x ,FST ` * )$ #   H]      ` XWXWXWXWXxm nmn #mn*  OP$* )$ # 2l  #    1zxm nmnmnmnm0nQ  %  )  17  0Q xwxwxwxwx xmn #mnEF  *      $* )$ # 8'$G #           )0zx7m nmnmnmnm0nQ % %  >)  =17 7 0Q )Q<x8mnefmn m nmnmnm/n ef e$fef %    %       Q  ^   AJL8      /  xe f"  "   P" x-e!fm=^  WZ  #=  #   >  - = x6m n      06  `]_`_`P_` _`_`xmnI   %    a05N&2I *hAlh1$!%xF F                 !      %"  Q  1     ;R   5     " &   7     x  x   0(/0 /0 /0xK    ,& mx0m=^  #= 9   "   0=  XMWXx <    *& < x  6lR     ' 6l F3?xF      * ( *3           zo   * )$ #  * )$ #* )$ #   CF      Cz-   =>=>=> mr     ?xBQv(1.G-                     3  " ! $ # & %x  px"G   G 3"G4   65;"  4yz,    yz  <     "12       7   &   C :D!&.D) ,<     XWXWX %(     % pzop3    (    %        BA -"  $ ! KD, *3   pNopopop    !            &    ''    "!(%6!% s          ,                 BA%   $ $  $ ! D,*   i              8?@)  (    E:7!@  }  "";! 8C/      H      E         K"  E  !  0I/0/0/0/0yzP       )#*P 4     %  -,/ PQOP%      $B     *).+   * 3\)G'  XeWX z       >6 hghJghn /; '/ POPOPA 3 +  6)m 4*!   `+_` ,  - ! ! ! ! POPOP? 1+     @@?@+     %+  g   '   D>"- PHOP OP s t  st      B      XEWX WX\   7!; hghFgh l " A      $  %4*  %? 0/0 /0   #   ,     r   Ns t8 st&      +   C  . D:;  I7*HN $  & }qDa Y E     ,    6! I]I' $ ( a  P    '     #      HEGH!GH!GH!GH       ) ,6R05A    `_`  `_` _`6    p&op opopop ;>   &      &/) !42 !  Sl!0 4 0/0P/0 /0/0/0!            < X C !   0'/0/0 C! $#$#  $  1   "    @   "  -/"   !, # .J)  0*/0/0 F"   IJ #    pop# ( ! "/%DI ( ! # ) #  ) #   ()'('('(`#     # hjghw# )3 # %  < )3 $    HTGHGHGH  U$  ! !! !    #49/#  U hgh$   (v% + 0 " 5   (% +0 $   $ (  % H+GH GHGHGH l$ " "   )  i*] l POPiOP r%  $ $   vu     . F Q  . %   %%% A[  !f &      ) ))#        5 82IQ3\4@         '   `_`_            ! RQ   '     7<  + >H&0 (   B:'# )!     ' ( x>wx/wx!wxK G(  /% %    KD0!K G XWX WX WX(                 '   %    '$- '  %  ('(#'('(( -(   & &  G( - PuOP OP)              .  - (P ,. 8*78!78Y) (  ,,)   ) p}op op)       ,  8  /;    A*   * @@?@G?@?@?@?@b h*      ) ))(        0/ M2[    h   +        !  &7<  $: 6 (   4:'# )!     & +    lk , *   # ,  I*<;7,  ++   AD *7 h1I<; <;)< ; _ <; JIIJIeJIJI$- ++/'*,,), , - , K   .-++  ))& ))!! ((!((2 7o7"` Cb> r  "  /  )  _ Ie$<;< ;.,,, ,   PM<;<; <;1<;K<;<;<;<;.+,,;))(,,'&--- -,,1   -- #,,,, ,,# 4,55 5-%  8" J&#M       "K     -F)6  / /. .....#$)*...:!/.>"/.D/.0 /..../ /:&Z;"D'v6V,<       -  F  )  6         </' q:{0   ((0  $////  4($$-V!:{0! l 1  Y7^cd O#XW11 01a/9S*)   43_ 5 `+"O   Vuvuv73  v 0000        9 V7 8*7878  *4 03(   * 8(78 78  uv4 0300$   @4?@   4  3 !3 !     5 5 * 956 7 7 7 7-- XuWX " &8  . ..   .. . < L" & @V?@?@$8 ... .      )$8889 &98  3 0/0191 m9 ! (  "- B9     ) 0+/0/0/0  7: 98    %7:66 8078 7878  -: 99  2-:76 `y_`_` _`_`  : 99 "     $ <!="4:77 xTwx"wxwxwx  {; 99      4"4I{;;77;; XWX WXWX  ; ::            ;"A*.d,;;88 0-/0 /0/0  +< ::   0 +<88 @W?@?@  I< ;; = 4  (? (<99 `'_`_`N>4 0/0/00>  87878>  (4'('(   ? >> < <      2     ? >> < <      +  #  @ >>< < ) !# % @ $  6_ ___%_ ___',E)?   C  A      51P$;%,24C EkA     [9  B   0H@;B KN  NGH?@   %   rrrrrr----..AD@&& &&   " JI        "7 I;]EAIO  -    7 1   pK+9)w6T0 7    8            C  "!C `[_`hD  "!  - WD 1" $!FFFF @1?@ ?@?@?@ bG    RI 8 JIJIG CCAA: ,' 87878H 034ux (I? `_`_`_` $  7uvuvuvEH   0G  EEEEEE  ## $ )o9  7      <  uI       ++  V S`I `6_`I    !- ? UI    &" + 7J   '    XNWX WX  CJHH       #$CJFF     3              #      5J                   , 87 ,1d0/ $9 $9 :  ./*9 # # (% "+ ( P _b   e+? !X    6]A         P *(AG %i " X e      -1# KKKJJJJJ 3 L    9$   L     # -I !(M ~)stPstL GGLLLL (  GG/_!   )P * M              3 -71 >"    <  N      9( 2  HGHN  [[[[[[[ [.- %--# XJ   u   `wO      ---E 40 -''    k+uP%!"  S &P&'P'! "P  SSSS" "!  &%    MSS " :8G*  '    H#GHmGH Q      ),   .!  }  8)78 &   R !!! !PQQQ! /  R  (!'( '( R ""! !" 3   HDGH ZR """ ","    A 0  @9?@ OR """ "" ?# %  tK S """ "- PGHG  HG  +    ) '$  3"   &MH$W [ $  B3   #0 T ### #>> >?'      "'      U# -5S' ,  P2OPOPOP ^T $$$  =   $ P )  2  p/opop"opopop U $$$ ?*?? )??#$ =0   J  xDwxwx qU $%$ $ % c (  H  hgh.U %%% %          S$% D+      -  2  `5_`_`'_`_` _` V &&% &4 ?44 & " #B    W &&& &! !! !! !!!!!#    & G@1N#  @  Z vW &&& 'AAAAAA' f)   IOQ0G "!"X ''' '8>88$ * CC"CC# CCCC"CC     C: :ByCC#"XA? !B  #! "+  J""    (    "    g  hPgh fY ((( !  ) :#*    Y ))) ) ) J   " 8  Z % ) R ;!\Z ))) *   # """5D55DD  2-   .=S7 +      # " G1*N2 +: O         o   \ +++ +  A+  (   &  \# JV<;Z<;\ ,,, ,6E//#/ ,,///#0 ,,/  I$0 fT > 4(_c4   9   ,     `0_`_`R]    *  xwx] ,,, ,   &&&&&&GG*I . - - -,, '  #   F+ :  ]       a*><;K<;S<;X<;<;ef#uEfu v^ ---  ++  111 11111 ++  11111111111111 ++  11111111111111 ++  11111   &211&111 ,,1^^^!A^] ]88GG       % 1 EMR! 8  c 'CQY^@>_ 3 @8 "                 & #E    Puf$u=fcyzy(zyz uvW* _ ... .vo]  ]]3^^#=^`_ZZ  & "^^  ZZZZ ZY^]]]^^][[  XWJI]* )$ #.       64,   ,h* + A .$ =  c( W     878 ;! !`  VVVVVV  56;! ! `f_`_`+_` ` /// / >  $/ 1'i  `# hgh` 000 0   $ 0 O  .4H  a# EXa"", ;( > a   5 < j  0( a! @"?@Da  k a 111 1        #  1 ^#+%&    5 Kb 111 1 1 ;& !  0-/0 b 222 22 5    PsOPOP*c 222 NNNNNNNMN N   y/ ""   c abbbc '(  hbghgh ghc         , \<d      7X u ve a a ;;; ;;;6n +    ?  B7=u vuvufT u vfm!nuvuve d dddd3d^SLQ --Q--QRQe eKPQLK d e----  >787b WZ b81D       y eeee ('('   @[Rd6 > E= :    D6-Y  4FF uvrg   `geeggVgeeeecc . ... e|    '0'$ 4      2    mnmnog  dd`e+ 4#   @Wo 'm ng  ee 2V  G   #' "mnmnh  ee`e+ 4      @W eh  ee 2Vh Th ^^    %  5   ' HnGH       9     i ggggee eeeeee     $%9 i11   5i     i   }/okuvuv;ufefuvuvri $#*, 9  hhhh* h3iiih(       hhh Y$  ( &4'   >  * !!,  8$j  XWXj  H%GH0GHGHGH O 8j  22  j j ! g:@ ( 8k      70 hO) / El R k ::: ;hI-  kkdd"   k k1+ L kkk lkkkkkkkkkkkkk!%#               #kk!k/ $   > (  ',0+/ 6  0 !  T:)$ Xl R  s!8 !  X)WXYWXWX m <<< < `    < 2   4   r  2m<<< <0/         A (= A ( $   <,& ?  ; *!!8 n# p[opopop+ , *n l* )$ #ll [ii lll* )$ #E 4             x>wxHwxwx n  ! n n% 1  (*'('(o  #  K]o       oooo> tD  !K]p 0/0/0r  87878r  HGHGHr   Qs ,,, ,,,N, ,,," ) l ;    ;C)! %TU xBwx-wx}t   ,     tt @3?@?@    "vuuuu  ""vss  v  tuuu v  @;?@?@      (vuuuuuu  .$(wss (9'('(Jw       w  w 9 #   -' (hwwx  9Y EMNM x   3  w wwwxtxxt tttxNPD#Y         U5O     yzKyzux 2 w w rrrssw     '''' $ ss  ''0ss  '''' C'' ^# 4MG:=E '($ E! %! O "       N / +  @*?@    0y rrrsss @ !  popop8opopopopy B)7F  GPO &-   !    "6B B ,  h2ghghghghlz % xwxz & &&&La   0F6i ] y Iz   ' z z  %#ny I{ /2  28 78787( 6 @; C{       $${ {{{{{eeee r rrrrr { {{ > {{ {' __   V_ sx    stzDy"                 %%%%  hh%% ,  3&  '('('   8B   1  <F    [ EjA C*k b^` J\$i(         D  "!$%Q(' ('('('*)*)*),+,++.-, +Y0 /('} x|wxwx}    ### # # ## #$$&"%     8*7878      }||||{| " }yy       }|||||| Y dYY "  d  W"'* ~}zz      ~|||||~  $#  ~zz @7?@ ?@?@      /~||||||   5# /~zz XWXWX               J~}}}}}}{{{}}}} }}}       :*@  J{{  Up  Nd  um nE }}E   W+E H6GHGH  &'   ~~~      }}}}   8P            >€ }} }}}}}}   !  #    f         } }3 ! &:f  P_OPOP        ;q    A ;}} x                  N~~~~~        T%4  Nځ~~ Y    +   ˀ̀ˀ~ ~ 1!+                        0#*n J $7"  hgh0ghgh ghAu v  1  1 2J [x  807878        %"  ƒ    "  yzqrqru v u vʃ ~~3B;<     :# <!   h% &    s!F+2tD      H}GHGH     P*8I :   B !.̅     0NSM         Y  +"     ׄڄׂЂւ  ܂ {pp{| |}}        $#$      ;D  Ul  H &#  F+ hRO\ (012 ,, U9 '.! xM    ! "?f%  f {        ÆÆĆ          [+.# $n  1+                       ƈ L D0? 070/ % MM   M M      Z'<  *@4K   WJ                `r_`_` _`։        3 7T g         D,U  7                     N                7     \&  Y    V581. +0 f[|| ,'&21݊܊5ЈшΈLj҈5ED,S Jŋ؉ ͋֋Ջ ֋Njʋ  lm  =GJ  l l &[ x    D,5 P!0  AO     .       N   CL    ljԋ!̋!        8 # wwxw w    +4mC  d +H(*  "8 (* # ! ""5!  KEZyzqr όЌ   ȍ  T T } T T(   ' ""1"%0!/n""+        +    M  XKWXWX֐ ! 0 + -'<; F.      ~}~} kx=u ̎3~Eӎڎ>= )1n0 L0 =:     " !( '. 3.43':;<;. T3'n <;  ˏЏ   #Ic2!$ n   \*JI" Nj̋0 -*"          ސێԎ     #&   ) +$!' #& 4    pB       ڒ      % =  '        #                A    U  rrrs  Mɏ+>!؏ϏЏ"!HEF!    @ Ca$ 5                     U   `c_`7_` _` _` _`_`       K  C* 1# !   *+,+  *%      ,-  -   a,-, "! (efg <  efg <"! efg <"!  $efg < efg < efg <"!  efg <"  efg dU  ,J&  ;   U96$$+ $*J-oH   ""  4  ; =  `;_`_`+_`_`_`0_`_` ,       p# ab,     %- "#   na3Bo8<;=   %<;   u vuv,ufuf+ ii i ++  ii+    iiiii ,,i    $#$Dg$#       2 q ,,        . qҀ  " q   "!" ߖ33k {H # 2 %  $n  Sb  '2 **"A.3.: &       )A !\$ %&%,-01#  > K<;;<; rkk k ,,k kkkk kkk ,,kEk05! -   ]d :         X66< Z        W      ژ     ԕ    `aaa ++ `#  J  d 7M 9<kX< Z !       +   0        '          Iƙ ]]]^ ЄńĄ           5 =; '         @  P,.2`        5  V                   w              1         X zzD{{  {{̗֙Ӆ ԅ̅ͅ   | Æ ʆ%|: |HC||HC |:;87S՗З {   Iږٖޖ Dž        T  .|   < a)  2u ' <  { \              !!    " !$#$ #& %('('*)* )*),- .-,/,+2!1210 3434365878 7 2!  `f_`_`    L ߚњԚ ` `    +( јʘ H?GH GHGH    7    4##7     }̜ (rrr̛(sț((((  ͉Ήljȉ)G         XGWX WXWX      >ÛěÛě {   D& ) p9opop$op opop      dӛܛ {   H  eJ j& W 2N!    (/ 4  Ň_B-6 j ә̙ xwxYwxwxwxwx)      g    m$- 1)  /ޚ Ξ  ًڋӋԋc c{( 8;    )          ۝ܝ۝ҝ ٛ ʛӛ ֛ $$    G  !\  !#) x #        g,,      + ' g SK      6      Lҟ| Ј      ;  -,#% 6Lڟ           ! JIΠ  ) ޠ   XWXWX:WX??     L 2 >??   3    ""ڡ    " P%OPOP  & P$OPOP )  ) * ****+6     0./0/0 yzqr    yzqrqr      m n    Ģ     :   3S    p#opop ȣ    -%¤ ʤ ֤ $ޤ        x9wx :$  `_`         ĥ H*GH̥ +  ֥  h>ghghV     < [*JI! 0 -*!ܦ hgh K $  oooo66      $L$K $ 3] %+# ҧ h}gh G "ا     :!G " 3  Q   ɦȦ C* ʨΨ  k '6ڨ  <787rrrrr55r       b4 V$ `'6! ʪ POP"OP OPOP   +  ݕȕA  S  nT$v `  .  ث   = 1. @ U `_`_`%S    $,,  -&% *   % ? .#e'1E XWX$ʵ       !    '.b k! XWXWX       3  -JJa? XIWXUWXUWX   A        ;        ?   **  VV=A ;     ?  hghFgh#ghgh¶        4 ;  30 379 N^ R Q RQRQRQRQRQRQR Q  20>7NK0 2 ))))20>7NK))))  ))) )*  $ :            XIWX E> !?"' + E H@GH <P #<&    < d  v     3 6                    A )          J   ,o#!%))I    y R/[*J  "!  43*  )4 / ,#     * )$ #  '?\R) :/<k R/[   J ( '('(E'(!'( q      K  !^!,f,   (0'('( Fn  6 |F C  .    &   $*5$    $&&Cff_ `%F FV   3 FFb  EF  \   R           o rq f%S 0 Z)31  ^d=UV'7  ''   5Z q;# u      ++@5<7 O> U, 5k . "f %  V   3 b   " !$ #\& %( '* )RfE /, H GHmGHGHf0     3)!(d0  @?@?@f ] ^ ]^       HGHGHf $ ('0/(%5>%= |  '%2 &#f    %2187>=DCJ K X YfABe  "!      +E %             4  ! XWX0WXWXWXwWXWXWX(f      !   '0.]$U 7a f %% 8 )  u  *     / '% hghf ;F } t' 3  % 0Y '3  ^3f^,   145C* W 4fi'J" 20._=  po -0 }t   ! }t&!}tc\3    c!!456h( Li  J       &     !"3 l   (0'(    1 R;!(                                   ' 1$J  \  Vv(;!(         8 7878   878 78 78   $ \[\[5 == =>=>/ #=#=w         5 = =    0!/0/0/0.h g h g       7"4.     pzop opop op op th g=        q 2#0:  t = HGH   =*'"4{U  h gn g"d5c    A *edcdc    +  2!         !  2 !"      >            W    * )$ # "; ^t 16 2"  6 91@3 .1'F!  .U   n  "4     A O    e (*'('(     H$GHGH         HGH9GHGHGH F Y     =  Y XXWX WXWXWXWXWXWXWX)F d         AD) d DXRh g- rDD  9   KN !"      +# +        BIJ         /a""(sVJL J+ - rD    D      9  `k_`/1  ?9/1  hhgh  >/ @?@?@        s !=  #=-     != h5gh gh     %    !  .      ;. $     @?@?@     0&/0  -A  @  ' PdOPOPOP'OP    ) B -U*)6   m. Kh g*. h g6    *=  P5    *).#       !5'  K *.  6   ;J  JK &  I BI R6"! # &Y   Y ^0X WXW(XWh g 612)     8HM3 :L >  .0 (     8;78 78 7878_h g       8) +_   HGHGH,g 27678 ?6?1"  '  HZGH, % $%& -$-   /5  R   0 /0%/0 # 0)/0/0 " 02/0#     EFE2  `   8#78 78 78`U VUV/   3% / V=3//`  & $ Y)Z Y)ZY)ZY)Z        )    $,*# ')))  "  i  Y   #  .H"     & $  )        e )))`   Dz` E>=?,U V    BUV!S     F     !@              "  V$>! f)2% 8 .       3  "     B!S @_`   Er92 (N` N$ (tM TST $]r #""!  !   ( ?2   $ ( @?@%?@?@J ',2Z    @$?@z?@r */     ^;5 E  p6oplopopvAB,A]B ABANBAB ({ z% ; " ^_r#     $ f*1*] 7 h0ghgh#AB4ABAB { z" r!2 p$opCopopopHAB/AB=ABAB AB 5u z:  z6  r6  r D"$,; ,_[ ,7ABs_ABABAB   }uz#$;<! ; / rcG+b445o_ @?@2?@ +lF(    ! 0$+( PEOP.AB;ABAB { z   r9 @?@?@+ 0  &@   xwx/wxj   & Ah6n Nu  6"  5% .q,     +=  /  (  '   ## ## ## { 9 2 )  + - ,/(' h] Lqi #        ' &-#!"1         K L ] Lv] LKLA  #  .# 4)*7  <{ # -   + 2* A 8-7878QRQRQR  !# QR 6C] ^]^]'^]^]^W              +/ `8  C %W ,d        m5))!%   H:GH/     /  &    Y3  S F        !@c 22  -)3  S  F `L_`_`  F  7* D  F PDOP4 #44   4QRQRQTSTQR   ! N)+.HJR Q    !   -,+/ 5 #!( 'F   0   !  QRQR               &Q RQR     hEghghghj   / $7# Q RQR      XhWX[QRQ RQR" 056 R) 5 [ " h1ghghghc    6( s STSTS T              h+ghgh4ghegh5QRQ RQRQRQ RQR#QRQ RQR QRQ RQR1QRQRQ RQRQ 5D        # ,9!!q ) -      #    0   '    xwx wxSTSTSRQRSTSTQRQR"ST              (1 %      " ST  ! $   WZ      !                        N$l     ""L.*  4# ?  %%    ,, 6    *    PU  # $                   +,!   I: !G  %  !K-%(#<ix#H \   5i     #  *  49C# %  AN8  6 *          ,m '/  ?   5+F $     !    ,   8%$ + $ hqOe2 #@$  ;FEJ$   = @ @J 3        $D8Nm 2`          ?"! #  @  $             &  v f STSTST]GSTRQRQ 80R Q  6STQRQRQRQRQR R QQ RQRQR!RQRQRQ  R Q  g h   9RQ !555555!   G=>= ;,+ ,      *)("   +,,,)8)    )*)*  H(i ""U"(C (? .(O (/3 B(' !    'q[' /    . " $7  ( .N   = Bk#  ==3!5$ A36 \    G  80   6 "!"!"!"!$# & %$ #$#$#!('( )*+. -0 /2 14 365 87: 9< ; >=@ ?921 H:GHGHGHM    3  +$M  , * * )$ #  * )$ # {     '"  # "  a1" nSTR Qf  @     D.?   W .n ] ST6 ;*6 ; 1R Q;    T#-    2 <      +  0$/0H .1  | ST STSaST!      )  ,Y !$$   (&'(0'('('(   ! so yi _&L*3,ST  &STSTSTSTnSTSTSTSTRQRQ5 65656 56  *    ST       55555  :  /]  Z 0  &    e  mn   %.   Y     jEX%Z  2+ H+ b&M% Q ") #  !$'8$6)*^*-0147: h &   nj;$ J    !"h!$#$ #$#    3  %   PHOP4!  #4!.   4 heghghSTQRQRQRC!!!          #  %   #C!ST" !!  P,OP/g"   .BI P(OPOPOP/"    .GR"   xwx44G" !3""#4""#4"&A& G    4 4 G# 2P*=,4  E  O P#   !$EFEF   ##=$  '##4$"   $ ;  #$ $$# $$$$$ $$$  $## ! !h  S 5  F  &     2*=, 4  e     %  `g_`_`AF0'     '''    &A0 HGHGHGH  #' &  &  # XWXWX6(  $  .DRzabab (    -((#8 #((  " 9 L /  . % 5  4 Ez/w   p+=)(#=(4     += G S B4 )' #(  ))""))  H)  $5   & 4 A B)'; <' 8 78787878a bab-a* ) )))  )5 -  S B-F *) #) #**** #! -    '86 *(; <( x]wxAwx  4N*  $$*#4* # E   %  3  4N=+ HCF+!!  @+?@    + ))) )2-0* 4   )7<b#Y Zaba SK Y ZY ZELKLS + * *-0   +++  5+ + ** *L2 + ++  C o ,< J 9  &6h ; ( & ' #  S   ES  IO aba:bX, (((  (  +%  :X, STQRQRQR?...--  + +--    E*"   ?.++  STQRQRw///..$+, ,    #~*3"w;<; 0... ;/& `c_`QRQRQR#QRQR0 ./..,,#,,,,   !I# QRQRQR*STSTSTI0////// "!"!"!--- -   / A$s  )  I0-, ?L0  '1   H!GHGH GHST62 52  0" 6  n(cSTSVUVpSTST3*  555662    4 3553   * **"5*%   "   Ac  \(2 0   aR  1  !4! ('( 3 3 3STSVUV?@?@4 5556663)63 333333<33  33 l   6!Y\            P_OPOPOPQRQRQRSTSTST+5444433 555555   44  4## +511 PXOPOPQRQRQRG5444444     "G522STSTST6555555   STST6 5566  6 22009 +' hegh  6 112200 J ,'   x%wx&wx wxwxSTS757    !% &$S7 @?@'7  1)66 66666  ('('('(J8   SVUV : 8999    y&4  ; :#4: (( ((55555 50 +  !@4  ; d5656;  9999    sd><      `E_`_`[,      !+F1 ('('(^]^]   '    X  h    /,K 8378787827878  ^0^]/^]^]        0 #/V  / .G  D  (I3?023@;cN$  G &  ba .  T L [ba &  ba % q  $I,>  P% 8 .-  (   #  1'   P   - ( UV    [ T        ~ wx  qr 8        +  TG L       #'    K : 5 ( s*>  !-+E3   J   *S    $O" =    N  G &  . T L [ & "! $# &%%('( 'q(' * )*)*)$I,-,+>0 / ,+  +P  % b\ ;  2P )F) # xLwx wx wx wx:*      7 * ;:* @?@?@ ?@?@?@?@?@?@?@?@cba+           h-c+ W=b a      # "   &'      xmN   Abaoba ZbaD `5gl  b   :   7  :"^#J" Q3!B! ;!3 >  1  U      J :  K0I    0     S %7 nK0I $./" ba          3      !'. ( D       zy:9 *)"+27ZYJIBKRWjibkr{$^  `?_`_`MpY   "   8 AZ    A   QD-  ,+*Y <&@ ^KK!Y!J$Myb        Y   Y  ('('('('(*o   m  "*o   Vlklklklklklk0lklklk     $         <B,$,#Q ! ' / 'V0  ! =   ('(K'(E'('('('('(  ;$UA Ub)bab aL *,!"/:!   #L     0) +  Jo "%7% (Jb)   L \H @uQ W      % 2    ' &   '#"&%U  O #"4#7!!H +/Q    W  ( '('(6   ` Q RMQ   # !0 MQRQ RQ    8'787878Y   ?      % `-t    (+1!     s!  i0       #PE<<  |  xvwxwxwx8wx%wxB^]^]^]       : "9  d 9 ." + ?0  K! "VUSV)UVUVUFV*U%  L;    3    3 + * )$ #  3  !? * )$ #% ag&h*1 :  ")    F % POPDOPOP!RQRQRQRQ RQQRQ            3^   %" !  7*$R   3    **$R  :)+        ) u4  :)+ h7ghghgh;         *%$;    XWX WX       U #& P9OPOPZYZ YZYZ      7    _ZYZY65 65V6565              D  8 ?G6      + //          :965$#     C I   ,$Q*       8.7878  "#    867878%  " %   @?@?@.   xwxgwx wxwx0wxVU V*U )/)  * )$ # ) ) >P        )/ )  8#78787  xwwxwx   + !!!0>7NK0 !     m+&.    8+78!78 78 78    !  \;#  G     B}~}~}               !"      "    >x*( 3&+*  7BAP  ---0>7NK0 -#### ########    CD -   $$.//<fU *          P     (?'(    !% @j?@?@F&  $#"89,@  &(*   6L  <yzyz8yz ,$ (h  O1h  h  l @ /" " #   #  "  ) 9     "# m m  "K  ) %        mmmmm D  "b!+ D  8%  S49B " !$ # &%J" !( '8    ,    #  B F (  O )  " #& %l('('*)*), +@.-.-.-&%&%& # #:   #    @?@?@ ?@?@ 9y )  !   K 4F9y 8`7878787878787878    b  C l l      O      lllllA'4#2     W  C $       {      % S  8#40       !    $                 ,  8$        ! @}?@+/                  /#!+/ @B?@                          !          8978F     ;   !&$0)      ~ DM.*   '  f    B...---3:9  -    .&   HK, #       (  J + .    75B$S$8-!S     >I  #  8 . $ ?    uvuv+P ( , %# kR GRQFE  ? TS0E   R+/0 -3:9  - S>=NMH   )3 #  !     '%  $V(3a  %J    $ G   @-?@?@   $ S+  - -3:9  -       ""  "l  Z1  $   30) C       #+) C     # f g      3#>&g7      ! 7    e x 9 .-4+G  : Vh /0+*Q FE'c  4 (5'(E  # <     "<   --"#$# $u v#|       <=<= >;      S,J& -0s I     l     %# '  , " #  % '3|%@ P[OP 1   R1  P  F   *  .!        -       #= 5 :`7     9 =J 5 p   H      %19:.       X ;=V! _! !6 ,Q ')2!$ $  N* $=#"$# 7  X% 5 87 87 :; 2  B K; V  ?     )^  "!$*%()*%), +,+.- 0 /Q2=3 Nq3- $ @M        >   .L =3" 1!- $ )M }=n#=   =-   h.gh{ |{|{|{|{|  $%   0/0E           5  R_  I#   h0ghNgh        Q*!'!u 01/0    !          !  HCGHGH2     "#2  XCWXWXWX=          =  t- !               "A  $E_P(('(} '(`}n}n'(' ! $ !!!! [\   $ !"U   # EFE#_      k  1 H$ 9$"3#"3# $     /##  #$ # s  !M!vH`+ 0(>gnD&? ) !' ] : N P          CY`f  5     H6GH GHP#    3!  #" HDGHGHb"   )'!  TBAU$ (%. )#   q, +,+$ $U +)xU'(=  ' ('(fT% :-"  S*)    * $ $     )  9> -b!! eba) ,.#D'U !  G    1 @3?@?@/& !! !! % $&/' ' 8989 :7~       3& ,  A D  &    &.&' E (     % N " ! (&&& ))))#) 8!*} ~ } ~4m4n}~ g}4n)((((((&&&&"""") )0/) ).-"")4*))$43##"#3"# (## "# "")#4*      G=FG  K L  *)  2 K*/        O ) k * nV 5a 2 ) ;     &"#    j    4   4+)))  X!WXWX$X*   ##5*, ******((((   ! ,******  &" ,(( a w,       =% ,   _  ,  ) ))) R      a-,,,+)))))*,,,,  * 1 -     &$! .-** PpOPOP OPOPy-,,,,,,     ! -$#0(4--** `x_`_`_`  (. , , --,,* +*+#  1 6  (.  ..... @?@  W3/ . .....-u? S  -            AF ' 3 /  0D/06        !6               .   0          w 65BGH       U   P   ",  $  >6 >.           p ,3  >.     '( %            >   POPPOPOPOP        0CE;   661)}E?7ZeY 1          ,*   J  )#) ) )  Wm Z  DE3j H     )C *?  7  e JA)) )<  kP ]V^]K^        >  2:f 8&!)  P ]B^   @ # @g?@@?@ +]^]2^]^](^ ehcd     D/ \" 2(  ].^  8 : +O2   <5 !  #    a|      #5  4 5 6    O `      0V/0hd&+   hJgh[f"   &2F# t$t"tABABABABZ `W_`E<!?5 +E '        )  > 0/0 3 k    b a  PNOP<N#<)"   < \sba   @?@           (       8/78  8078   &              P5OP,+7 678 ?6?7"   P6OP,+7 678 ?6?8"      a   a  PdOP,V+%$%& -$-!   /? L  PeOP,V+%$%& -$-"   /@ L  a a 0;/0 )  1) )  1)              X=WX~}~}  0#* ~}   H GH# ~}~}  1!   X?WX~}~} 6666 2#  ~#} 5#5  #  @~ }~ }~ } 5 55 55 5      ~}~}~}((((((~ }   !   ~ }~}5 555) "~}~} ƪŪȪǪ   $~}~}~}  1 1 ~}$  ~}%~}%  ~}~ %  %    ~}~ %  %  %%%%~}~}~}((((((~}~}~}(((((( ~}77 ~}77  `<_`~"}~} d  ddd !"  )<  i ='g    A+  N+  H-GH   $  vuv uvu   ! vuv uvu    ~}   p;op~%} % "  % ~}      " " ~}pp         I~1}  ' 1 ~}~}t ttt +~}   ~}ҤѤ$ҥѥƨŨ        @-?@  *  8478   + )   :: j~\}     %\rq  `$_` `~R}Z !ZN %R h)gh~}ZZ & ~ }L L  L LL L~} 9      V0   ' $< Y;$ 0 K0 X WX W X     g j i       HGH(GH0q   "!* ( P OJ     (^ f  @?@?@( P On      @?@?@(-   ( ( lk   ( P O  ( ( P O      x!wx(. "     ( P O   0/0&P u    & %      A,&% ,  D , & %     & % \ [   d c  @(?@&%&%    &%  &l    &P u     & %        `J_`_`_`L  ,   `P_` _`  #h H #%F <w .   #l S  T |     O 878#78)78 78    K+M  f   ^klk    al          $;<  /$# $#      ' =<#/          a   ]   c               Kr ]c `<_` _` l]   5 VW\[^  !$ 5 H/GHGH GHGHGH GHGH       $ k- POPOP OP  !   [  & !8 $  I( {  -[   78     FX   yz $@#   #   F 7          m1 ) "7 "  0K {"    lklk   >      ef kl & W XWX9      .kl! -3!#!"5 8"$       ('(6'('(]'(&'( '('('( '(2'(''('('(    d,+ & mn    ]   {|wvsr VQLC     " 3Z# e$x pNop2  1   LR\  il!    S TN    %$~      ),    ),$ /E k# '7 \X_   #E , q    %   v 2 ,W"(8$   #        E    ,  X.WX+ +X W;+ +N M ( FZ 5 ) np   "/"  ?!H/&!"/ .M&ER  j!x pRop  WVUVUZ/ $,!  qpopot h=gh 434;  0 /0/0  7 +   @$?@ /4       & / "! 6B'*)#  65/& !+    &$ $   A%'      PEOPOPOP OP OP      3U;B 0/0/0      @?@  )2   8  3</%, W .j     6 8778-78O78  Z [-      7  j # #T  ! H4GHHGHGH.GHUGHGHmGH H Z [ Z [l Z [/ r]^ j2/-14  j    jap'#A\kF   !&     !    ! 8\78 " Z [4    j;\    !   %  E  RY)         '  B  %m    /Y#I) 8Z78 78     / [ 878       !C @?@ S Z [/ (    jm 5f     `_` < Z [L  j"T,{:   $ E0 / -* )L R%     #           %  -'  g*P  +) ! $ * @c?@?@?@j  "    ` 8L786p 2  )36  D3/;CF  cfclk/t!  E%1(% !/& n   '/9    + 6   )$* }    $ # .- )*   (   9 + 6    </    +$ 1 *%Uw6   . !& H`N RU VKLaNQL%]^STEN#  =   N  !> +"= 1 Z/ G B G 6 4  Y_ 7=W3 .N! l?P      9$ .48  - ! (LLP  ..!   V   >G.QT.c   z  %o & 9 5  - 0   **,0%8k7/*3 -@ - -  -! ..!         x[wxwx86 !< p & %  MX    !%2Y 5I'       T  ! ! '         OR    T POP OPOP OP OP&    %] ? (  P&OP4OP OP #$   #$ 9+!J  XWX  )2  "' =G- X     * X&WX_WXWX : T U& 2   V 10  !GB"2  8  :" T U4    V   8P78 78    / Q        @{?@ E T U/ KL V_ y     `_` 9 T UL  V"Q,x7   $ / -%       ?A^   * * /0   & 4 #-  )b$ @B   * *            ' 5 U& *% K  B $ 3  $  @\?@?@?@ZR  " kp  !   ZX5.   ].{ ADAJI.P     <% *<H!*.  :           1E   .P&! &       ! "  "  !     '" &"#       W:k1 0&     .       ) A $lp2A!   '     (@ El&!  k pMopopop P '!I  ' ..]6*c^_bo h  g 4*]  WVU.M ihg.;   %L 3 - ]5c56"! ( !..[ xbY\a4  #! Wno'    sx- 0 5 T   ;             M=   5@\ (   878786    Q  5. -b 20>7NK0 1   A   5  '(")"{"""&   (& )  ### ###(##)8?&'!(!3!!!d 2u    g!,S+,?+, '2 )'  2  8?4)10>7NK01 &$ A1  J -!S?)  pg4     00>7NK!''' ' &}1(1 -4    wDg J/  &00>7NK"   00>7NK  2=>&16:!+! 2J/  [c)  < &/  -     &&& &/0>7NK0 / {* /0>7NK0+&&&& ../0>7NK0 %%%  MR/0>7NK0 %%%  W /0>7NK0+&&&& ///0>7NK0/&&&& %^+. +. +.+. +& RF12Dd3 5   < '('&*121/4;BABADCFENMNM-POZYX U\[fed ahgrqp mts~}| y c\Y    $'0  %$$$$WXW -,K&@   " 1$ "*-0>7NK,  -1` GZM(1D(7!A  H   / Q  !" 9#Y      pKopop   - ### #,   - <  `  \[####QRQ N)@=        (+  A:);$ !F4# B  C    ` .  """ "       '6G/#"7!U  ~Og< '   ***0>7NK0 *!!! !*0>7NK!!! !&19/ ( -<    '            D    *h "!S"!   &%, c    !"!"! & #)&*)M]^]   m$CBKLKR (zyz(' &% /=(^a2'(^*$' 2C(^F     c(^; * ,(^(pen   '0>7NK01WVUVUpUZqpo  ot   A 5a<S<S   BG & O    OB5#,24RW9[i5p +)V !!31.D ^/YD5A  .  !' % 2&1B8#%!1*/1% S4h S    ,          h9gh   '0>7NK0'      H)GHGH?&   @ ?@?@?@0   1 h{gh   .  ) * -\  POP   0#/0     0)/0/0/0    ,0# hSgh < SLOBA N;    N;    !B +0;< ;  0-BA H;  B'@"C: xwx/  '(%L%2=> [D ?21  "  3'M]+^6 (7'(  ;>=> Q- pEopop,     +93#* 87878 $ h[gh Y^]  `g3##' AJ f N  "u    < V  ^] $ N,' ! 5+<  2T7>7*~ "    0-@1 ,#e")"T7>7* %\       dO!:     |  (  SB XW!" TYJ mnmSBfmnmSBf          656IBk!G"5~s,+      +,? ? 4J$ 1 YoS; "]w   2!3!3      d  F"!!$#&%(':     G  !    %  % ^;*+=G) VV  ]6R  \! "#      ?@   % ! $1 m x  (C3\    346R  \ {uS u:  8 2 .     xw tij}nmv         J*% ~Yl   n }v  ;>GJ ,%               k #J@?  ( (    %urq    Y Y HY  v  [1nd)%)'@'W,%1B$ .5pfJ$ !Hu 1      6i  + 2.  ~4* >     % ($# &%('*)*)",A+,+*),+,+*),B)*)*)*)*)*)*)*)  %       5P/(+ @?  5 34KL :I, %    F34I 1 =7F( /%  I    ^]VUVYZ]H7Ra %  baH!   \;      adQf              baH!    bIH!  bIH!   bIH!  $Yi % #  6) #^$0!I 4)<#% 2  $   @     "8"@ x        1 x  xgwx4X            8)7/ 4X p opIop         T ! *      UW . $    # r JIJ  MI%  HGHGHG  T              $ !.%    H$:     N"* *LK   *    ~~ z $*$JI J7r+ q  <   #( d:  :   D        %$  ^ ] T     \YZYJIf    /z  "0 J= JI              ` 2 ""!2"%(    2-B !` ! 54C  & k ,4V   " !v:v     E . !5   ?% k #! ! 6)"f,1 9 V v:v i.41h  #   5 0-' 1h4 W; <T H+GHGH I JK   D Q   HGH GH49     xwxwx4#   - (0 %83; < `+_`_`_`4h    L( 4 PHOPOPOP4,       !3 #,  pLopRop op4  -  . %  ,  =.  w:,<]4M  18    >     =         9 WZ& &#$    ""#  IR &0 V DE $%  $   lu    \u \u \u)D ut[ ut[a  & ut[ uv[ 5":   i V '7fH>BM  *sA5! D37(&.=:&M18  >=    4@       '  ~$"  &1@   @?@?@44   0/h w,P+   "   ) - u1wP  *_&>7  f   "3078+  ^0%,.?7   [ .d>!% &z     650+,+0-    !JO ! z PYOPOP>l      * )l   1#8             1 M @* h4ghgh        $! $#L     %    ?-KL  fZ "   0    ~ )iv  # P@OPOPY    "#~{ '# 4~5  }3  !& &           C4)  "\-D!68m  }3 N$& %&)%   785  "  ' %"!   ]8$  % -   ) )*B)$#$/#$ ;0/0 /0V9*&%&%43B&%&%G&%&`\&%&%&% U/  > ?   x`_w  /- ~`  x` x`Y x`+ x`1x`%-< ;@  `)x`! 2"}        % .`o`qkx`e l  XDy ohJ?+>-=#%H* h( #J$;" %%/    9*BG7  "!$#"   OMW<@  \    ovu|wX c xw~}z !]Z&+h      "  ;%L@  \ HGH GH<.   ^:/<' ' C ),+#P 7 <   0!0!$ ' '   C   HGHGH<-      HFGH(    + &4g%X      By  &f     ?B0/ F  %& to R17 7  # 0#4 * y     &  f 7\           04 . y G +0>7NK0 1((((  8D(  G E)bD2  " t*)< 'r ((( (+ +       &    i  / /)O"\ fc!/0>7NK0/       ? # 3Q+9      *  <"!           8 6- t <"!*)'*)r C !eA+++ 0('9       /1600>7NK0 0~)?  L            (    KA  + hgh"gh gh #  e *)T |w %O% T  *)*)R da & R  $R'    B O C5  C l"     a ,   ,&   P*OPOPOPOP,h<     ('('(,5    ('( '(, YZ/436,  kl?DCF,\        /,<   . `_` _`_` _`$_`,3 ?   m     p&,    ;T         rQ,    *  ;jE   *    ,2    ' )#, "        *"   `]_`7_`_` _`,   POTSXW\"ni&  F.-  "     & $ 6G,& c    " gH& *"  @?@ ?@?@     P$OPOP)p   S $ .%):*)*X"  *&#$- 8LS - P1 -  I"(4/'%:X. `O.4t !   4 X'WX.&~   # &.%   878R.y    1 ?%1 V  %  QTS VU    X   :  [     (P#  `7_`_`_`     ( POP,       -   87878    87878  8678 3    0%/0/0   # 87878      PROP!OP  9    J ? @?@?@      8787878   &       ) !     POP OP"OP    5 @?@?@         X WX WX"WX     7 `_`_`3 2  2 B  2 p#op3$2  2$ $2        87878      878 78         Z"   |_ GK :" R0z  !   IA# :  ]0z9 ?      WD  :9       xvwxqwxFwxwx  !    ! K #   & " 3  &8 =    p&op    Z  4     1K  LKTUPOBGH [ EJ=  * A"   +0(  34  G    m(       Z8. :Z          i,#+    : :    &P# 0  ( $  %4  :s ?0 / 0/0 /0/4343   FE  +, IJ* 5  %5       @%-$   &?     POPOP% $ `8_`   pvop     %'S*   HGHGH*GHGHGHGHGH20/D        7G2D `_`3]$ 2J1  `I_` _`  H  &  1- H 0 * "!0$#$0 tyz{z{je!      O( ?  &* j0    =rv(-   ,ft       ehgn&sngng \WV %] ?   2 (#  ,f 7  "*       6*  ,-      ` _`KL    + .  $J H ()   -0     GRI>  6   1&#J  $t     ' t $: he@0/?  '0?H POPOP5: /2oHGp #&cHGf?Fk0/l !G      :CFHGMPHG POPOP OPOPOPOP OPOPOPOP OPOPOPOPOPOP!H          .-&    /6       P9OP F@  !! XWX]WXWXWXWX ^ uv     .  /]^ pop%opop f   &K h\gh ghgh gh5gh gh /5& +        Z   1  R   B .5& X!WXWX G  + / A  0  5              !(bD1A     0 0 A     5             !(aDA      m9I  C &     5                 !(9^.8C  &          \8  \8 ."  -"    vs   3    3 .'     %= ij    ,;,jH& P& # <(N <(J! -_ -_m <8   < 8 ."    "      y `(_`_`      :  A    +  5  N;,+    ,#          ,7 !(kNrA     +     !  !! X       \Y NST#-   &#     5 J-   8S  d  + 5T!! X   `J_`_` _` /          1H/ `E_`_` n   \ w}5;      $ ,+, 0        &,)*   />=&%:92165*)  6).1- ++Kh"0 S  J;   9<      6     %                    W C('v*;    <   Q!!; #     , ""    K  g5/         . Te.+, 9@?('<;4387,+ 0MR[^!6 0     3.!H|  x?wxEwx!wxwx   1"$ (   &0? d"  *"   &% 9<                           ?r& M& !O-_-_nd"       "    0F  "    :9   ' & ebab   Ep$ "P 4/"   x s " 5 "  C"  R" )  ?>               _`   # -    $ ^$ ?$ N$ 21b(1b:Z9 R  s " 5    "                   C"         R" )   h-ghgh$gh o $ %-B pOopop$opop f # % 4r  ##4" 1   6 ? 1EFSR(!3   )# ! *=E#7  X$WXWXWX  !A pLopop#opopop  # $  1 `Q_`'_`_`"_`    (( # L~ xwx!wx$wx$wx6wxwx!wx!wx;  ZYB G Y2ABAL)"?   +""%6IG68  pfop D2 he@0/?&#@ :  &)D 0./0 B  he@0/?-  *      C ('(='( m    '$; (9'( R     8  PKOP OP OP*       d#+&-O  1{ #           X he@0/?\[     ]^  ]^W^  p /0V@?<& 1\[       ]^    @?<1s ;Q' ( 0 jK5 (!     @  .      on.         4   { #           X he@0/?     ]^  ]^W^   )*  V@?<  1       ]^    @?<1 ;Q' ( 'jI5 (!     @  .      Jn.        4    W0%  6      he@0/?V     ]^  ]^]^      FHG  @?<&1& ;H( 9 (    B  /      )           8F787878  0 PHGhe@0/?  ;%  0 @?@ ?@ Y,  0PHGhe@0/? %b K+.     0  ()2165<;C    ++++++           P%OPOPOPOP"  !$f h(ghbghgh gh gh gh<     . - 3     (l+] D X8WXWX    !   *   "  ;d   3     CFKH U2%  ( ! &H% $ $% &'&'&%=+$      FSTY' (' (' &X )%. AB % u%&%&%$<"+0c !6K&%74        &'& # 3&%2w L   # 2#  #   #  ?6     # '.'&} xBwx"wx wx?wxUwxwx    #  =>AB       % CBP6(% p0opop'opopop&op$op&opop#    -.  .7 $   .-.(!   ->' !'%'" !W09  6564565656X |{  v({(RST +=* (     z     0/ 0/0/65656"5656565656565 65656,56565656565656565656,56565 65656*562565656"56565656565656 5365 x$% 7md65<  OmdNMpUmdTSX[mdZYZY` 987:; > A@?F GFEJMNO&r!_^]`adcdgdcXchmd2X     v00Q  5:%30 ! %3 )  +  * %!!(9)%3 0 2                $ #$#( '('(', +,+0  /4 343 8 787< ;@ &?D CDCH GHGL KLKLKP OPOT S3T  6 0//  /     *)  $#)*EF QT I8  ]^]BaJI N-L'\)C5[i 0436  ,9(& p5opB2 6#  p@opM< 0 # 0 HGH GH+F   t 21) #   = # # H 0=*# Y 1$;# 1$  =[ # # H h:gh gh$0.-.. 2/ 6-  4&  `$ a 00>7NK00  (W=@a gG"RnFB&)&"&&%$ v.&   $   W  F&%(' *)*)@%(' *)*) M2NF    ? {|##  ?  .&&%& %   %%% %       -4%%%%  LK~KN(% % %%%%%%%%%*G%%( 9%%( S5 00%%%%4' #|!y'$$$\ {'!     9 ! 92--v--kZA#OHk*HO%# Z'2 98K$/@(C   ' v.&          W     " !"!"!"!"!F$#&%(' *),+.-./21 4365 87M:9:9:92<;<;>=NF $    $            m1 %#I<)  9 8 @;?@?@6?@?@F?@?@?@ ?@$         $ $$$$$$$$$$$                       k$  , $ ### #     6;O  , $ p4op^op$#$#y  $!5( X $  &0/P565  %&    !"      , -0 22 6  :$**2  $ $       3#    /-$$#  '  m$r   ]j $'%>(!*pX$! $   8        ,     R CC  ,*  CYEJ!E"! E-  )N$   8      )H,#f $0 " $  / s -b'#W  *)*'      &  stH*K>= hw          Z&KPO v6f9N(L'+ =S`2  / s  K     K  F$S , % 7$$.?     Xv)/, $[ $.             `/_`_` $   |    &##      ;E   | {+$ +*4] , .-.-A3.+       D)   !  ! ! !  !   & 8!4PY)$C>2.YS"/  h    M > ! $ .-  .-.-+- $+      $  2;9 26(E/a DW $       8;   (             "          %   3LV;D>             8    ;  L!;$ Q.        '"       R#=  63 Q. =:'$        ((0&%8  $  +               '  &  X^=$9!!$-&/ 54$ `_ZO  J+ 0" $  2+  2+ (!'   # /2+()*.));#!" (($>       x(Vf    > O"6V~  5  4>  0(        L   M3 `T_` (   he@0/?zclqthe@0/? \     @L?@,0 |! , \)  @*n      3> /0>7NK0 1/0>7NK0/    ;)  <    3 > @5?@ ?@( srkl}/*).       "(        DA85"   -&!v. (  `1_`_`  5 he@0/?.( 5 -(f' \  v#  ^ " q `  $$$ $;  m%% %%lkle    "$$$ $ ) -" $$$ $M %$% %     -!clD ""& -) 4 >    v   #  ^ "  q -: ! @  o}   ### #;  E"  !I $$$ $    " S$& 4   & <    o }  N3 W!    15  \ ### #,0>7NK   ####++ #"" " /+  $   Z[ H  **  ~ """ "      ( O ### # ^ @(" 0$#'  *! $(O!7%7        "!1$#5&%& %('( '\ , + # + ? 9 ? <     he@0/?ji   ?      o  :I  121/)      , 9     >   ))!   pwopopVopop    $ %           'H5-    $   %   p*op"opopopopopopopopopop"    "%   !(      #   E:      PHG  /       he@0/?    !   **e A . #           &%E(': u79 #<  $     '    ''&%" PHG % & & he@0/?     h2. ,   7 $ S= '&0>7NK 7>= oM# #      &0>7NK    &0>7NK  195a9# #   R<, $&0>7NK ND#<, xC5 2, $  &0>7NK &0>7NK  3 Jj/#5 2  , xXwx wx  B   %0>7NK0% #>: B c('      %0>7NK %   (  eJJL 3_B@>( 8 59f --+$   '        $0TMNK $0TMNK0$$0TMNK $0>7NK P$0TMNK  $0TMNK0$ $0>7NK $0>7NK $0TMNK 8 $0TMNK     ^':0 D  ' (   8 5  9  f"#  ('-./  -67  +>?  $DCD CFG  LKLK     NMN M' EC   9      #0>7NK + $   9  V  #%     FHG %     6 he@0/?0' 6 q&    o   ! g#P5  z   #0>7NK  /   " " "0>7NK0")   H   !!  W|!         R       H} 3(( 9+m!*$O 69 "     o    g"!"!$#&%P('5*)* ),+, +z @p?@ ,   M$ , hsgh0 /   %(#0 / 3  2      y A  0    2    V ..G_        )7 V _ 8""&%& " P7 0/ 9 %#/  E/ 0// %# /  h3gh! ! +!  A   3!  (C'(8   "*         "")[ ++++++;dP  " "            ]0"" ")  .<   .    ## -2+'W.  (+'( '(  - *.I 7* *)* )*)*)*)   "  c,X*)*) * ,*>0jX*      7 . XW  .% !7. P;OP OPOPOP OP OPN&%& %          / \   hghba>=('('(       #R   &,)+, `_`   * # $ ,8* A:[ ,  ,' G[, pop     y   - 5.x-  `_`%&% }~+1  &    $R)*% - 98 pop%&% ~}. *  2  ,      %OY;$S% -8!8 mba>$a('(' y( +$$$ $u V+1  )m y p\opop  R   }~BK $C R pyopop;  R  $B K $C ;R i   T -0>7NK0 -   V"= T ,1< &   m ! $####    )     L$8<#< &   m   p'op"opKb  !  """"1@"b  *G,f  X  \ +  *  % & ,'""" "+0>7NK0+  8  5       %& +I* "E:;=6NC!  ,(  \+ * ?;Z ,    ,!Z, 867878   !!! !%   SsHHOdCB2!*-qWe 2$UVU/ `      /  X&<&1&!&. 3 2 !  T RD   ) (    )0>7NK0*)   ' $))7  )  '))) ))'-  r    HMs    . .) *  . 3 "   "$% ""<   ZY Z{$% jm twx{|{P   &+)0>7NK0)   '0>7NK0     '     ))'1  ) 6". ?nFX;bDN#/]E&E# wE >  1  C?=  1(  /`         /  "!"!"!" !X&&#<*&'1.&+!2&/.6 33: 72> ;!B ?0/TJQR QTSTST ITSR DVUX)W  ) '0>7NK0 '  5!      ) TN   S^3  ,             ,*1 >  '    S    ^ 3 , +y8* 1  Gba >=(' ('l+   + ('   &&&&>' %%%% %%%% %%%% %%%1         C    %%> +:7$ 47<  '47<- '47<-47<-     +67<%      p+67<   +      k            1)  UAd#Fw !  o /#8    *       1             #$    =+ !$#$ #&+%  878B7878  ) ,8 1  %<mba >=(' ('L  l  rU  ('   ba\a   a  ,'XU$ RK  RK RKRK   XI '   X?+ . n-6    ## )6 '   n X/ 6I X !$    1y  SC!-4 N=y7J j8"   EM 8  %< I $         ! l  r     U     Z W )  ) / )  )  43 . /  ,'' ) G )   = ) 7 )    tC 70M6LZ V)) . ) ) "07P      [0~f      - Y #0#    +!# 87878780R     0\&  B   & (@,\&  *=0  (7 ;0     @- a(9H ('( '('( '( '('( '('( '( '('( '('( '( '('( '('( '( '( 0 :9     ( /XWF    Md       '$' B0n    M[M p'op0opopopopop#opopop6opop8opopop9opopopopopopIopopopop0          XW F#+ @    +   J 4IP f#E PPOPOPOPOPOP )D( 878=7878787878780}     \)6\ `_`)_`5_`_`_`_`=_`_`_`_`_`_`_`_`_`_`0 + @9      *(  M@ / wl&A!0 `_`._`5_`_`_`_`_`=_`E_`I_`_`_`_`_`_`0 , D=  0     ()  QF /@>tk6.!1 XWXWXWXWXWXWXWXWX0  *( #` Z&$ `{_`h_`_`_`_`_`_`_`0 +    )  T!6/ `_`\_`J_`_`_`_`0 ,     ))  m A4!6$0 XWXWXJWXWXWXWXWXWX0`    # 3D C$` P OP OP2OP OP OP       P%.W 05  " XWXWXWXWXWX0   ,       "  1x #1K A0!:   B?@ITJ!   2/09D *  ;6 72  ?};   (%'(|'(02{         o { @)?@?@?@0A  !  @7NK00 'NW ,+ TSB 00>7NK       6-   W00>7NK00  %'''=XU/)2%! 3]:I"8#}         a A  (")m.-N0/87:;<;>) V      X"WX"WX:     ;:   `=_`   3 &&& &FI(  3 7m$S%$ "       /0>7NK      %%%%!%%$% % B>7 (3m$      S  %$  q$        :$   $   "    | {| {<<W$   " 6($K   ##   ( '3($9 +: KLK * '$$ $C    9$0: ?4         ! .   3+ -*d0  GB 3 +     * 5 (  &  ( S & >  & [ & ) $$$$$$$$$$$$F  & S   O  3F  O  @#?\ #  % #\ L#'.  = W      S  * @ E4 .  = 878        D  &($K  8L7(  >L7(L ( '{ +  ) + ` Q;    /2 *   887  8  3   S 8   $. 9 &       ^7 +) +     _ c<0 <0  !   Ll+4G3 4H?c  - & +# &%B('*$(*0.' 0(   8     >L   !{$+#&)% (+'`*)* )Q,+; . -. -   (3    pop( 01 71 71$+( 710 10547 7 7 C2<2<2< #     3 ('( '('( '( '('( '( '('( '( '('( '( '('( '( '('( '( '('( '( '( ( >=    ,    3baP     Wt       $ %N(      $"x/   %V(     <7* BBMP  O       ?H    k;>  E L=}) %b | ^(    3 d9-  (       5B!  ) E$ L[ZM3( &%&%&% &%  *5 6 $3 e$; J b34% ## 53  ]^ ]ji ^     AB                          )- /*$!     ";:"*!!  #   M4ND4H =     3  #       E      E 8 E8 E! R " 8e8( 5       )   16         IV   +s>0  #P  L0L  "  v8E (     )  16 ;. X4m  R0[ `|_`_`_`(     >  8 O2 e87( 5            )  IL          _l   +JL="/  #PT  J0K E   "    m88(     )  % Od  J0-  88( 5              ) /    .      _   1 (^40  8"7M5 V"C    E      FM )      )6=^X-  d8( )   G)!R  Q-  =(P   " A 888( 5   ) r e) 7  6        e9&!%0  8"3YK L-[ " C    E    B\8( 2 % )   #D&N- N-  (&%&% &%&%&% &%  XWRQ"('<a  <! 3   2      7! /$      $ !  7;> T  7 W"'>=77 "+<=J   \ h X'"Y&J*  9\>U     y &            s   g`    r POP`OP(OPOP2       P/52. 0E/0/05/0/0/0/0/0/0/0/0&/0T/0  * | 0$* 4 1   + 6 /# 4      1!&< &FH# K&4   ZK0/0  A$ ) ,98IO8 r4 .  Y T=4    !1  6z#$3 M.4   *  I` $) MP4   '. 5*  I$F G4_   #* % 6> >l 4    <M  #* A  eZW $!9 >I4       BZ4 $: 0=I4        9@  =  BJ "$: 0=J4        3:  =  CJ "$; 4       8        a    2qx W$  ' CS94&! '4>     %    >14       GY  $'      064-      Q   6 @   6 h      `_ ZYHW @G$        .   _$@? J' n[  5-Q6@6h  .a(*y4*       8  3 J     8    $      I  D D Of        $  )_   (  !D*N)E       8 3 % 8 XWXLWX/WX%WX.WX4*                 l      M*((,) 878%78F787878784#            Y  2<K#3() ('(7'(,'(/'('(4"       ~         S    " ((  %X%R.4)    8    =                       q  n   )8(m )   In842       &  "    S2 & | 5. 4  0/             7@U     (!#]()" p:op7opopGop;opop4    }           "       L k   $vPH & 3( ! xMwxwxwxwx3wx4Z           *  ('          %&        %jZ # hgh6gh6ghghgh 4@                        ! @G                 #$          F!      @        4 &  & &  ?-&WA-gd4J        ?  2  Y    3   8    8  3     y      8 / Y   "   !!!!!!!"O7    !!9D   ""   O OqI!!!! !!! !  #!!! !!  !       7  D ^c""""O <5<%%""" "2!  "  1#$""" " .1 "))<$)!"!`  ]    -0 bJ(2   ( +  3883d(y 8/  HGH,GH,GHGHGH4F     6 =  _ % > 5   6;*)## ###  # 7  65 ##   #   6  :+F6=( ,-G$nZ4     9     4                     & UVUV      UVUV$$$$"    B? D$5%$5%5     ' $  $ 21&_Ac=g9-;e6 {%}#!o1q/ ")k536u+w)9?aC][E SMKU WIGYFAOQ: FMZ    J'' +'''  &,'' $       +, ' 'C   ''''&'&&&&    !        )  & '& $$ %$           d)7"$'D   B)'9 ( V   4  (( =B4     4      4    !* OPr*- Rp[^y|sz      ~Rp[^y|sz d)))))  )  P ?@    p$#yt,-   vQ'#rQ'(#$jQ'(# '(Pc P QM(w^ u<-)))))  ).))))      -.?!  !0)  (   VK0 UA44   ( !   47       8 U ,  ****  >?    +,34 -*** *    '*)*bR{ 78U H4                         )       )     >   0 -    $Q (mrq KF\ UhUVl0++++++  + ++,,,+,,++,,,,,] "l   6x (x/0 5"l" UVl" (l,,, ,+,+ , ]plmr ve pq b<Qqkl q]`TluxTluxTlW Xklk,$O -?V.>VlKL?, lVX+  y?VlVl# 7?V:2Il!$5,,, ++++,wz    ,,,(-+!!nxNG) )>6 06B = N~ 6'-. -.-.-.-. -. -.-.-.a-.- .-.-.- .(   Y9 V(-&.8  kcdcl\k [ d   F'(( (@?((( ( _ Z0=B  :;B 8CD                  &' &n/PX/MH</@ C +%1'       a   ("! $ #$# &%&%Y('9* )*)V,+,+(  0/0/04/0=/0/0/06 -.-.- .-.-.-.-.- .-.-.-.-.-.-.-. !  ( ())))))))))Tm                  P#OP^OPoOP8OPD6 -.-.-.- .-.-.-.-.-.-.-.-.- .-.-.-.-.-.-.-.-.-.-.-.-.-.-.-' G Y  ( (((((((((()) ((((((((((( Q('U                    @;?@?@?@ 8aD  !   .9 5 pop opop 4   I   00>7NK0 1 !  V I !4    I  4  *9)*  O       @00>7NK0 1 ' "]3   4&5 "+49   O *)* )*)*     a           :N/0>7NK0 /  I0("    x0]      R     a      *8)*G      :.0>7NK0 .      @pG0%!2     x/  3(',]    8G  R       ; / * PIOPVU21 BA0, w: CVU212$U : ;  ? B     .3!/8+  %  O     P2 1     #.P   X@WX  *0>7NK0*!!!!0 %(     ^22;.  ). )*)j   2 12 121  4343 4 3(43%   ]4 343 43  #  <C-rCwxDCDqIF.D    2.D  a + "DeJ  4$u.D     W     !ijDQ  \@? D?@?@? 5  (('(' 7rq.(    4 hg T%    + ' D 026a  Z'  " .-( u+'- # +$))W-K" ,L ! $   j        (%  ]" !$# &% U4636 X         &D                                          2C     & A  >>=              D  P&OP OP*?     ) h@    u L@j  Y P:OP( '('    5   < 434'343212'121# I' "" " H3GH* *   *   Z\  (d l t |  xZ $ U#0\3> '  XLWX'\@vu8  &9  $!"! /#  k\x    F    hgh gh gh\Zhg"D/.-. 6tsts  1JG HG sCDC " uzyp K &(Z   6   ! .   ('(          hgpo                ;  3FX  P OP OP     xLwxXRXWXWXW= 2 8*O  )R= X=WX,WXWXWXWXWX_.      - E'! %_. p op}opop         ,+6+s HGHBGH-GHGHGHm3    % $>Im3 HKGH-GHGHGHGHb7       $B9!b7 HIGHGHGH     ,- `*_`+_`_`':       J* ': X2WXWX     i4:*( ! * '/]!                    " #    . /  &  '      * +  $OL    &!(  &* '/]!      #   5      $ 5 DY     @?@?@?@ ^    -1 0 /0/0  Mk'sjRk'sj5G8 eSMN  =MN   eSMN  =MN   ;j     ,.#   +  L           '    21  L           )         $ #  2K0    '  Sf0     'q  & + & e  S     =  !" "$ #  &%e('S*).-.  34 141=65:9:  ?@ =@=B A;>+"3<    >   L< 7 5     >     ' *47   ;# #* 7   5 PpOPOP M- ( : .2XWXWJD  2     >2 '!  +2JD  ' 7  '    $   %    !># ? 3% M(   !    $YS [ '          n7)  ' I%,>  %,> kv3  XWXW!XWXWXWXcWXW     W A   2 3  !c 0/0/0"/0/0  E   E   0"/0/0!    U9|" 5 :k  *|lT SOTSTS&T SOT STSTST S: 2 2  2     L)   '   ( l O& O       P#OPOPOP|: 9!b  T K  (  ! HDGH GH GH m   $   ( (L'(Y''   p=op& & $  &   HEGHGH            "  (6'(4  $     ),  p_op " . hNgh=     A= t' 5 8 3>1 >=  (341 >9>  $       *    nE  m(*'*  m2 ,  3$   /= * 7 8  T ( ^ 5( h  p*opr ' ~  h[gh IHGHCD* 2 '(    5 $  $ 0)  0   R  tq  # (,'(  P tqSPO #  :  8D , ()'(   P tqSP  # f &px   &  && && [^  HGH GH %(+ {~ Z  d n x              [^  HGHGH9 !&%() y|{~ ""  "","9 :> 2    >B &J    6L  @w?@<6   e  lV^        = %,++++ Q TST  =yruvuvu,z E??@++ ++) L1 X J + .2 / !p?(+ *  ! H.  o=%, + +++  $(&          %- 9#" ???+  w   }~Z# #7; 5 2(6'."$( + #" h j lp    n L      LIJ I0 M  -  q "W    9    ,3"W  L ,     ! RQeG     P!,  Z  $ # f #1 $# z   3#8 (v'(        AB xXwx3      K             O   P&OPOPi       0-  %    ('(        0    r   ' POPOP-OP    M>C     6 WX L  0       o   6&;T *      p,op              POP         &  6C         (;'( "PZ    0( "   "     .  #       YZYZY  \e#hSV \W_b 0  $"%$#     +"VY ZYVYZY     .  #      ZYZ       #M \ / <  @#"%$         #     "NM    &nTM"   !"   +  - 4&I ?  !   XZWX"g 8 ,, @"M  ) (3'("@  1 K 0^      7 .H   R0'*)*)5d 20>7NK01f<'   5 HXGH 0m  " ! <  I"  "6         *#$#:$#'$"#$#:$#$ :9   *#2;`_lkt mneP    WZ    :A/?X"179'r'+U+,    R *   ,  # " #  0G/0/0 /0/0/0*AHGHG@  1CA@ Y *r/  B  O*#0 /0/5 /0>7NK01c9#   56  #\     # 0n/06{)      K6$  6'  6"   6  63 6  6#       6  1 }    ,1 0./0 /0/06#   " cb  :  8# " xSwxwx6& 4   4 A  "&4 6       "! 6&    6                                I 6#!0:-+"               6                                              I 9&"00=0,":"               6                   TSTSTS  IIHGHCD6#&*:-/2    pop6                           I  6#!+ :-+!          6                         VU       VU           I'(  '(  6#!#$&! :-+, /$+           6         hgh6                     I6#:-(    6                   3   I~}~~}~3 E%1  7/,"  3 6                           I 6#!) :-+          6                         &     I& 6#  :-*/$        &    e6      /30        #I    I666**66 I6 7     , 4  ,  (7'( 6L          6         :       /                           7                         ,     KL PNI   ,"% ,ARq%6 715 %/17('0  :     /,  "!&%&%&%('('(,' 6                                       I% 6#$)!$ :-.+.                 6                 < 1 5 2 1 5 2 1 5  VU  I 5 5 5'( 6#> : : :-    *   5  5 5   6C 5      +   v5+_ C "1B : 5+  6G 5  3    T5 3c = "< > 53 >6   !                                    !                             !   !    ! !1(.!%!%!("* (,8+/+/+2,.;2$!            ! !  0/0/0/0$a        ") POPOPOPOPOP#OPOPOP$         j           POP"OP OP$      3,+      2#  8$%   $   <2# T  H5 % ' 2# \   %4   @I?@Vl !      18z8 ==  ..55  7 6 64 4644//6 4644.4     p]opj  <9   -s     (  - NI 7 -J "(TT' )NN! )M  )MMKK )KMKKK #(M)N)KMKKJK8 J      @9:9<       .-.-:  ) 87& DP)               @J?@@W '0 D 0/0@< 0  HKGH@X      8 `@  !*4 *+6! ]&&%& %&%   (3        04/0&&% & %&%  %      &&P  , &4   (X'(!9 +! \[ T S  "!" !     !  !  0 &)  '4 3  4 3          &4 3  4 3          434 3  43434 3 4 3   4 3  4343  4343           )*4      3+! 4      3-!  %%&  % hAgh$&$& ) $& >="JIJIJIJI @ ?7$#;$4xLq &  B?    f]^]  VY. = ^]\[            C  9">- K  $     8 &  *&% H  .5    (' N XU   .3B  &  - )      '              :   ,           J"1           O%-  ."1  *D ;N65z/*LQLI !JA<9!:34341 , !} L,     8H   O(  *  #"5( &5, ***D ;N    z /@'X  x\wx;  ) ;  @ @  p.op op opT       '  N'  $  z  & #  (%?$*(    z `; <c HSGH .hn        !    8.E U  V(=  Ya0p#3$ #$6         *  )2mp    :1>  -5G R)3833VZ3)Z)V3g(V8V()=VU3<f32BU;-)U).(3.33)2V35V)V=(V3-3UU&>#0#0:F!^KJ =* ) +   6 = 7  ~ y V  W  f e gjk > ?vw    &}  '     b c^_Z [ [2  3 B G C  ]  r o s    ( :;   ./N Q O RS   3   J K   "#n oFGz {           /  - .     & % %&#"& &&% +#+&%    %  & $&&& %%%="/"=]0A5    : " !      . ! %&( ),+,+$. / .3$65658 9 8=&@ A)DG D I+LKN O NS+V WZ[ Z_$bcfefe&h il m lq)tw t{&~ )  & #+   lI  ,'! '  "+ & ' $ 0 !  & &   )  ( !  #  J   g    FL E F >OF^  'I      g 8,78 78J^ %(  @'?@?@?@J      >. "  @K?@>  +   ' + H-GH>: .   0/0>= 1  >       >#              >  HGH>      >      HCGHGH>             HDGHGH>         '('(4 32 <     @?@?@?@?@>N  *$ w>$X     pYZUVU>)*9 *7 *STS   % STA   6 7F9  ;D/F?L7F?L7* >SB GLU*EF , -A.+ % & 0+  >$%=$(' '* ( Diq'@%C!B'' X    ^>k %%0>? _U    f  Vklk P [VIPG P[    lk Ni. m'32    z  '     1  ( '"!" /       $ 9 L#  '7<%[f  #   ('(i 8;8? @CW@CO  @?    0)/0     H0GH  .    *      0*/0   (              x=wx'   ;'           JI .0 :J ^  @?@?@p   &  .-  D G \ [  @,?@ nmts #    H>GH  ? <"$)  =- .    1$  &> NIV E )*)*1 [ G[9DQ) . 1   $ & - 3    8    "L-&L @;H 7!"  QRQR1!EA   x49T%)     8  " &&-&v         XUWXWX  ?>=@?@?B-656MFED  $0,  0/0    0/0             & H6GH     _^WZ_ ! +  8178  <     XWXWX  0I/0   3#        ,  U   .  U        d ]      n     1\ L           :  H            J  w 5&%   "POP   \"   . P OP!OP4  "  T ~   10/0 )@ -2' ('(  B     6) x8wx$ !(<$$( POPOP!OPOPOP"^.     B   ~   : POPOPOPOPOPOP"f      J&;>%v& POPOP4OPOPOPOPP   "   QF 4N" !      hghgh   O) 217 65  0  x%;*  O  2187 '   (('((((! 9 $%*).-21F    87<;"!"!"!$#(' +      ~ $# rq  $ #   $#   F$#$,# :9R a S, @  8 cT  L    !(!>4$n.Y /  | BK  2T  XWX KLK  ?       klefef_`_`                        #      . . .,   @=j'      %      %   MT    T@ !~} a@  '#     ' .<95    POP '   P 9@?    7 '      XWX KL    U@ ! b@  k| .%  !  4      !     ! #0    }zr G  2#.% w  fa %278  BGH$VU   61  %TO*      <    z   B B ] 06/0    ,            Nm  (   2   & 7          h               Rgfa`[\ Rgnaf[b             *        .    4      .    5* / 1 ; 0`           2         % } u  kl         $ 6+    /*     !    $DAB?e<, &  3 "   +]}1:e4B  } u  k  4 * p  '   !! D/Q) 0Q/0=/0785$y   88 6=      @   .   c3Q=$y             &bVo   `"_`5) 8  47)8   : 7t   76    %&    E9:9:$ 49 43  .-wx @)            >H %& $ =     3   : 7t!K  PAOPOP 3%       PhOPS A   \i= F  !._ @U?@      "G   C       +,   f\I f ' @o       !  "%L ~8 % @  A   8H78   > )& 5q    .    1*          E=#gH2   4q     `_`)_`_`_`r:        -      ^O& r: popop 73  KL       7  | 73 `W !   9 + W           y   9) " Jhl y|)QRgfa`[/('* DW     hghhF  !I %G@  R;  Hf'(  QT  Rgfa`[\  2Hy   vf-  gh .5=> & 0  )    f0   ]gh X-.U5>  * )    FfY     ZUVU '! ? N/,fn   qrmlgh !  8    K & &}L  Nj <,ba ^"_%%,'  7"<" X_  +    '    1 1UAMu'A  0u/0/0I/0>/0Cj ba^  _         X_LsB8& p  j0 6jJ C*j((j'    Zjn% gDj..j>  X+WXj=  pGophW       T;h""  h7eh     8hRORgfa`[\   E   fhh+.  '  s 8 h*F* h:  h$  h0f  +. ffff$$f((  n( GhX       ; fhh+.  '  t 8     HAGH*  5  (* (G'($% 6  :   878  XWXQ = *      \  ?6D?=@9;65656     Q=*l x     >D   $   *  >D  propL      =>; L   WZ  }  v P      NK , :7 ;*' 7 {4^C$?d  q  Y  PW !  b_ 8X78B l `MNM`v I#$!       878   uc`_ -  J = cd(    (! !     # X)WXWXWXWXWX  gx      ("'('( C(     ^3d   ' `_`_`I|     ED  7DH@fI7"   DX .  -v < 4 6 *       .  -<4 `f    p twt   A    $#* )0/     6   @ ?@ ?FE C   & V&U $ B      @s?@-?@?@?@?@?@?@?@?@?@?@?@ 0     -       b L      3  $  +1?O&   #,9   - %k2e'/ ^P   8 187>=D A      /JQ -`-   D     N 34    P OPOP OPOPOPOP OPOPOPOP OPOPOPOP3OPOPOPOPOP\          .-&    /6  [b    %Y    "D  -& 3<   u "h ~  >I po5lkD% "   6D## 4   #  @ ?    @ KR3    (B'(0  1;d    l=;   *   S             p   ,   *   <2          DCDCDC    D-.-0=>=         .                  %  &-^*  S(&8*Q)7*<p5 ,  * ( * S                 A  , * <  )%   |yzyxu tstsxuv k    bT>G  C #    2 xwxjijijijij i j ij ijij ijijijijij ijijijij i'jijijijijijijijij ijijijij ijijijijij ijijijijij ijiijij?i          !" FCDmnm*#$ *),%&  /2+,%& "3214-.'(! $5436/0)*# $PI.3"+E9                           `_`_`Zjijijij i j ij ijij i#jijijijijijijij ijTi xF?@9:3 4  F? @9:3 4 "mL"mNGHAB; NGHAB; < ;%2BrDM                        @#?@#?@     9  3  % 9A>< $     0     -     `&             ,)70-.0$ 0 - ` @?@AV UV UVUV UVUVUVUV UVUVUVUV UV@l       &+R4      hgh|       "h 3>Z      -     |"            );"  -=# - | hdghR    4 @a?@,T ST STST STSTSTST S T+d      &9z      @r?@?@,T ST STST STSTSTST ST+n       &-B     `_`_`_`     $G M;m  p,opop )    % ),   @5?@RQRQRQR Q R8   !$N    xAwxWwx wx, w.       !8" :#, w pcop`  " ', @K?@?@"fefefef ef|    4-j "  @??@fefefef ef  '(X   H5GHGH GH /"F   O52 /" a** ^] #*!n  HG BA     GH         '  i @?! FE!P B\!,&)-*0('     #      *!  pbop  bababab ab => ?> ,+2187> = J 4)   popop  vS   4      $*  *Q xwxwx ;^]^](^]^]*^]^]I   )( ;(*I$(x   p +$ 2121    +  * Z + '2 *  %$;       ?\[W  .-"'BA6;J $#   Sn   +:*% 6#        [ 7< ;      ?,    :   $*2 &* xKwx wx wx wx$  ji  (), +    :C  P;D+ A 7 !F >$   `d_`_`_`_` T         U- %8<  \ ["34   " x!wx6wx3wxwxwx      4  /9 %  P OP+OPF   3  *     v    \ [ D           9B  GVUX        O ` a9  OGL&7<!lF    D  H6GH GHGHW   #$ ,   PJOPOP#\[\ [4  j# 4  ,'('! [  ('(H'(!(   jc8    ).A/[= ^A_2W34= >CCCZ[LCCQ :W;6A7 m bCch>g x  :      "     +           #       #       # A U     S)#?  o  ,  H    Z   ,   B  1+0!$? ![   H  !   `3_` _`.         # .?2   .@?@?@?@ ? @@    .9$0     (     <        $8(" ( <0LD     @b?@,0> => =>=> =>=>=>=> = >+T      &:{      p  8+ b   hWgh:dD   ' @6?@:4343434 3 4T   !%O    hHghU>@2   .=9$ N)*)*) *,)*)*) *()*)*) *>"         ($:*( , ( > PLOPNYZ     + @?@AN             @l       &P4      R-.-.- .)R?,   R  :    XKWX WXWXWXWXWXTrM N M N!      H O P U :;3BAr   ! qT=565665^  XWZWV,I'9=6V12121 2(12121 2<"        V     +J      VLR     .9 X34343 4(34343 46      $2( ( 6XLB    X     +R       .EL   L'('(' (4'('(' (;'('(' (_ KE F1  .    B]^]"65 3`.-.- S Z _b        `_`_# &    "_: 07K {4;G?I 4 ; _ @     1  xwxwxLE F 1 4    *' " 8I \8 @?@AL" !" !"!" !"!"!"!" !"!"!"!" !"@ < ;B AHGN K:7>=DCJ I$187>=D C    P&#$R4          @?@?@AL" !" !"!" ! "!"!"!" !$"!"!"!" !"@   $#* ) & %      &&&AW4     $  POPOPOPL/   J  8     # (Dj|(/ J8  L       Z'56565 6JZiZ   X7WXWX\J  % "    * 35g\=>=>= > =>=>=>= > =>V=>=>=>=>=>=>U VPU VU VU VVU VU V^= >= > = >        " 65T POPst{|0A.87f qT :d CYn BAB*'uz  x   i j {h} z B  %  0   S  %+   !   Z s \ ]{ o88BQVj`S]jS +v    V P   V  ^      w)  %\)    C    [=>=>=>=>    i           ) # .=1 e00*':'B) C [         n]72@,  .\      4! ' ''']! -*q6qNI#*   _\=>=>=>B=>d      V       =>=>=>=>|=>=>=>C=>=>=>= >     RO        " "$   *             p6B2& *(+YKJ =f/  b  # @T&a'# M #+Bd V      |C  hWgh\  !     ,;d  ! `_`\   X0WXWXWX\f    !x      \{       \  #    1 . I +E#=%-$   X5dI] ^] ^- /    F KL S  - I  - / d   H   ) !$'   \ B4      1v|  % <  HG  / 1 M ghk<)  8    ;HW  POP{OP"v    "           @_4H  POPv         Z: `9_`1_`_`v  ?# 0 32 56 )6#  #6#  eF* vv ('(;v qnqr ~}] h^ghvqN       'E XqWXWXv*        G.  @?@Ovm   " F0      ( ('(   &  878  30 GJL6"^ , #F21 6;+   !T 0.   &1uf'*#F 0   F 0/0 ,     '      ,E7 0   H!GHGH( or( h>gh  ' ( ' h$gh5ghU  3636 l5%F!   hghgh4 D  H G EL 30GJ#rw(`a%         =       kE   &  1W. lb+  #  >  =  H GHGH  8787 +           '            (    `&_`5- 8  4;8JZ HGHGHj %$   7U1CR|i l  HYGHf( J3 31.*.   QJ   ^  L  B H4GH     8 78 C  -3   (Z'(gD @ j' *5      *%#&P>' 5 *#2   :  B J R  Z b !j  r  z      POPaOPOP+      ! t# POP OPOP&f   %B 8 78P78787878x  R @ hJghghghggh#gh#gh#ghgh_  #$ lkdcdg   5JYZ ' #!t#bafehY  ?)f0 *  .  (>'( SD    DR @R~      !R: ( 5A9#VF   -  "%#^6E%J V* P(OP#VW    "+GV        VM   08 U5-+V   {^ {f  ~  ~#" ~g     xpwxwx\**=)*>  %b#5*= 9?+*\*)*)*D)K* ) \   )  #&&,(% m)$MDK   popop{op \M*)*@)*      ( k.M@ xAwx\R : "\U     R P@OPOP OPZt8     !fE  aZ  /b  fcdede ^m  R%  / +Z t {| ~ Z    *  - $  #!|; @O?@?@Z`  , 3   (,'('(Z 0 2Z G HJGHGHGHGH:GHGHZ  1 ! ,&j*% & eZ+OP>OPn   )4%/: /        \K-2+>  nZ POPOPOPOPOPOPOPOP`8         l xwx^   *3X   1 :C 4]  I *3 ^SGHGHGH  &o Ze|    =)8 ;-S  p>opAop,^   "    " B I?H1"{  0/0(/0 ^M U N U ):    ^6 -,) &+  ^O             _^l_6T@IJN  nmnknors  @?87*)=.      ! " 1219<~  r R#^/J9  2~G%n9% ?_&T   3   E  i3^&IPE FEFk:    9 A    c  O#    JO:  .!   12- , ~12-" % wV'R845C1"2    IP   r e1   @e^&  u DCD       !"##  #  +@ ? "N S#F    5=Hk^&    , =>+?8( =X < \5 W'&  ^7STSTSTDSTSTSTI  C(  [(               7   DI ^STPS"TSST ST=S"TSST STGjF5/0 7S8$     E SF$     ;    9   7         =       9  ww   $ ,$.&' ,-=2/676$5.BC HIEL$KF keXK^CST8ST%"STST}    /F     W       1  /   # b 7!O , C    !}  ^=      (l "%M/+ }   ^S T      - % -  $ d   c &*]- '  e8KH_V#9Jet  !  /^GSTST(  B    .    5    4  "5  I - ,   "  QMc# (I&d&QQ+C E* G( &       z    B ^ ^  ^*   (N'( ^.IJIJIJ        6)8     ^5 3>       %   ,  e ))@)  3>  popopop[opop=opGop^     ba   0 L 0C< 5( : %, 4%  5 p-op^: ' ^  0N/0/0(^%<IJ        st  2!4    0P/0      @  &= ^wW~S T   7   A       , J   "&!!44 wQ}^   XVWX WX^S T7     e 7 ^-   ^     #$   <      ^D  - X\WX brL  4 > (- H  PNOP bd^ "! ",' 2 6+ :  PUOP bRIJn /21219<9 ,08  3   8"787878b<    bIJ}stb PkOP1OP<b:IJ B;F GNO"  >76?HG C!1]w  Vbb T2b8IJW GJC B;:9&?8/0A#   (u'(w  x:wxwx[wx;wxwx 0 '  !" '  34  6   G    g J,5'%,'E  (  k  L K J IH GHKLM& %%  +ZYZ  ~ /N.+21  `  j     9 +  )      } S    D m2E)  T( '.-   b\NMNM\U  +  Z $(  b` pjop  x 212) b{| _   !P   popZ &%&16  D!: Z z      6   FUV  0B !&hz  popopop, $ " !"  "G J  , 4$X*, " gbnfob  9 8 8 RQRM8 +U W c a '  1 = ; "o     (  )65 b12 _ pg   G!   (       )*)*)  !        w xqr'  +21    xwxwx    cnmb L!   15#'>! \ [ x +21 KRS   f g  HG POP4O;$C$   4:      ;=    C$ /R9 4;$CHG Mu HG PO P KLO P R Xc              !'        VN N"(, T !%2/' "" #03*TM((  ZTg( %(  HSTh =V  q)E,M ' T84:      =    /N.4z POPOP OPOP#TW  "G POPOP OPOP%     $7    < Z  W3 ;$P $< $Z b <;G] RMLG YB  9<*B 2 POPOPOP% w6  $< `I_` " (P  N KLC  JI 0 &" ( @Y?@ />t !(!     @    >   i  !  ])h~0}Ighghg hghgh g  +      )       $ 9".$ ])0I      vh~.}Jghghg  ; p     !       $ #.v.I  :)J       8- :=:)JM    ,  .    L, 1 GB T= 878hgh gh g TSZ [\ a    @?@?@   (  #  < "@ q shghgh g "! %    B tA&H$*s s (K @9?@?@Q  vRQs  I ! /<s `F_`_`&[ 1)     & ) h-ghgh9ghT   4&7T d   )       *  825  + :" b       A$ (! " b popopopop9op LKLgK       ,   4\6  g XbWX  BV ;     fefe     RQ   7  7  58   1 6*J9$'+ (   "  Z ;   ;     fefeH     l   5  5   #  5( K 6$ZD$: "  = "  ; H l 0 QO  $*+3.T=   *#    -#                pop op+T       ,'~+T >h g fefe fe        2    X9WX(WX"1   )'   ! "1 `-_`_`&t8 %d0#  _ B"p` !. +,x   @>?@X  /  9        "  ;  O PO I?a 6QQR  300"  '  "!"! #) ! -#   F ! < % J    1 "   ##n R<~}~{|{|y x+    +S"# Q^|   N2^ L&   4 H#GH   0 t qrkpo.    1EF+9:9: 9:9:9: 9:=9m XR]  XW `_      # T   /_%>?7+      =  9:fruEF\ `D_`_`'{ |((     ' ( N:% ' <       % +4 ;i ! +!$ ' <   )}3~'  l  FCDA         8  5 m!)  '    /}3~             .]!/      +}~}:~B:       qhmlsjmn  = 3 *(XdP6" 9+# B    :   pAop?op  5@ $  f  >   F   2 + tX   ' !+     C       p -    "        "   RC        XWX I      # lh  z p  %3!  97)      *    H{GH  C   XIWX&{  %  ;-G  l  '     W0"2  S`  o p,+YZ  & 1    #  - # ,# -  O   s)^ ^$?"N) "    h9,++  u n(i9+ `S_` _`j  A * & @A?@e?@?@K?@?@  F F%'.k 8 8  @Y?@XYZ  -"/!X%  $     [  h   "    0F/0 gh  ;6 `Y_`_`"   7 &   %    @C)" 7 `  ! ]    $!           .]B 8O7878 788  gj   ! ,38* !  !;)* !       !    %F    _                 n    8+787878"$` _b           ,    X%$  HoGHGH"N  %  #  (*N @a?@?@"C  ! +,%& #  $&C H"GH"   mno p q             8t19&    F      7p09P `_`#_`_`   /  RO1$   1-% Q"0/ " 3;-;Q" HaGH GHGHMR   $!!  "1M g9 !^&=@7 65!8$;&*9 ! HGHGHGHh g h g8 D A > ; =    XWX1WXWXWXWXh gPh gR * '      O2%+ P  @?@?@?@h g h g   9    H7GHGH1h g%  3 $ >   1 %   h gvs       h g rq         xwxwxwxwxvrqrq vuh g h g h g! 8  &&  )         @ G qA=U       !     -:     hGgh!      #+!! (     !  X(WX$WX#WXWX.   ""&-V  Z;  1AIH    7  0  #8C7NB9+B        AI     hHghZgh}ghPgh$ghgh @  ? Y @ C      $#+ & y  ^]K 4   ba ba^] ^]%O @b=('# +i@  ? Y @ C   [  I     !    %2 1*%0.  `_`s v s vsts v s v.-.-   # <JE\  # <TO\ " $:8          POPs v s vsts v s v   # <lg~  # <vq~            H GH2.   LB  8T   Jz9/D-.-. -.-.-.- .-.-.m-.-.f    6 0   4, ;D       m     XWXBWX"WXWX  + $  %%#&d/ b<  9!  "L e  D b_      3>i!      Ziv     <!  `%_`"_`_`t #  X&WXWX "' #  `_`_`"_`_`_`  #     `(_`"_`_`_` #    HGHGH + POPOPOPOPOPOPOPOPOPOPOPOPOPOP#OPOPOP "!        21*    /(' (     POP!OP!OPj    "") #  `-_`_`'_`_`_`(_`_`+_`_`_`_`    "    #    POPOPOPOPOPOPOP&OPOPOPOP      "      y%  '  +   POOP!OP~      "_ '++!+:+  ,,",4,*04$  F99 ?::            P)OP!OP!OPz    ""9 ('( H$GH           H%GH                 @&?@    !      8 78             . 0/02                          878 2                %                h : !"!"W eh C  G  8 W  C   Mf J & XWXWX> )   v    # *4,)    popopopG            . -4 3  , )0 /  ( %, +  $ !( '  "1   ,!8G                {d'-  `    ('"% PBOP:   (   #$!F(      (6'(HF     XNWX@WX  GJIVSLKT  +!B/@20        1   H$GH  jgnm    0%/0 /0 /0 8 PM     " 8 0%/0 /0 /0 6: 63     6 0$/0 /0 /0 7T     " 7 H1GH GH GH qrq rn  =>A B     0&/0 /0 /0 /0 C      - C 9<    P4OP OP OP OP O ad    - ( O      H     -qr.       A 2 -.                          @)?@ ?@ ?@ qrqrq r         @(?@ ?@ ?@ q r     !   878 78YZv GH  HGH GHYZ# YZ # kl  }~    YZ    8D78 & - $ 7 ,)     " 0$/0 /0 /0 5,      5 8D     6^ "   }      b  _     0/0/0   . $#R?B $#^CF $#hEB  $#r?@ 'OQ L 1 B3433434t34 GHGH3434( #_  <  &I('*)( I I*Q7F g K=3 & 6N ; !3  3+ 1 C 1 B  3    t     L W3434GHGHGHJ ]`  % "% %5  , ,    > A? WJ 0/0 /0$   X'WX WXWX&LH     ) ) HGH GHGH GH&Uj   ! X-WXWXWXWX4V&      ) @7?@F '"+ @(?@6:$     PWOP8+,+ ,:" :CD %    &&   : PiOP8+,+,:H  )*    2&&  :  H C # H C < H C"!$     H CDC <                 Y   h    Gdr QR|*% QR a>A F B% QXgHK P      )ef   [\  =R&#i4c   h('"%   0/*-    0]/0    dy  ^    ('"%  (   "!    0/0:  B   T  xwx;      \ ~    4:x        (7'(z  , LIPO (:'(  !/ ^+ 0 0v 7 k7,2N :    :4-4         # " yz  38  "  1A1  "                   ' ' <   3, 7  rhU;5#  ("4 7,2 N    9      :4 XWX%%% h;zMT    *         $" {|#$ 14    r    N                  '   (  ?&   6# [;5#[[&"}'L ;zMS       %%.8  J  \ !$#$#  n   7t     $   X + HQH:    T!    3   I =KO  3 &.!$  :"3          N } >( '('(    6 (       O    +    S "   A3a61 "<   p8op op   <      P]OPOP J>  +-*  JTVprt0  PHOPOP(OP\  4   +,@#  <1y \  x ar &   #h  e 0/0,/0/0\j     Tu%   )  +   B G /  #- ) &|      8    % Q   %(  -+J: "/n #  ('('('(8v     DOV/     ( 0  W ` T C#;<5* /  G  F b  +>       hu  !! $ iM^   F b R X   {%&   -    c6R X+   )    05/0 K    -" %) PkOP     !i   3 H"k)        GH   .#                 $"  $  -  98*( -  3 H "     k   ) 0/0/0    ]B8<iDJ    !  vO     RQXW<;< .  21*'(CF    +     Pp"  +*   P|   O (-    &%&!  ]ST   $  ZJ  4       ' CY &_ 5 ,&7:D5=   / 4J D   5 5  8B  8<iDJ  "!"8!$%(' ('     qY            *? Y  |{|{v      L" M( z 8 (  ' |{|{Y      0   %'  Y / !     + * # +5 5            y4 A/! 7    Z $'$=,             ,     $  3654 365   365     Q G aCC%'$=,S       (3'('(  ( 2nmnmnm1f       !"  n.    F@c@O   ,   Igf           ?NK%*`]:  kA~{*    s'*.E ] , 4 9 6#3Qg#2< 3 C @3 *   V)A  1  f        .qTO  !        8 O "*  5    !H   5 ^6%G5 A d $Mq GOW E      %$(2      !  %S)   v     W         K      U&[  5   40(3=;]- :  =D p% .             X     3   F  F % 05?  @ \ 1  J 23 2 %na     -+E\^      -   A cKb ' /% #+ ;0 . " & #^"jbab aba9b aa   *  (.  * d UOF5* )*6 < ! 3Kh 9 a x$5 PO    - -.       *    %$H   ('$ & H2@5  M"}  "& &N%  !D   <  D= :7NO<[\=<;  JIR$#1 9( ["=<[,M4    5!p24>> D   < J  %  2 @ HI () ,+  . 365<&% $#"!89D QL0>7NK0      # J      c %:  &( ' ' \         @?@!?@ ?@M   0  0,%,W $!",*  ,.)   1&12), ?  0 W1L570,%,W @ ?@?@?@     @!?@?@?@;        @?@?@?@     (/'('(  !) =Jvuvuv !   M*-J @^?@ ?@    /     '=X5    /4  _,  1B      hgh  ,* 2   <&k   N* "3 1 >         V       eR  *  Ef   @* '   !E&% @   (@'('(e     -  HGHh   %    "  Uh M'Cjsi/ .  !        5(   #Cs/. popop opop-opop-op  j  % ,   .. <3C     j  Z|{!39    %   %& |  (  VNZ!3 9   [1*u ; (!   #L    E\S  '*''!6 0@3cg ZM@w  ; G  /    365  :( )$PI .)                    B(">V    ! YF2D     2#      bUT J!!*"R,M  AF  2  D   e' +     a'+ kWM  +   +  B* VU=  ? XS : pBopcopopopD "     2k. ' D 9WAE ,  !* $U AE w1 vu2vu    ,     )$y .  2      uH3vu0"vu4v%Y#  $! + )* g!  ,  !       $   8C  ;/-$I?~3      0"4 %  # ;! &-$?") ;#7    "  W * ( " 7 .;#" " " " " "  "!"!'^" !!!! """ i X F'^ xRwxwx # !! !!,!",""@ 6*7 )  \ 04S#  =@?B#  GJIL#   # |"!   `_`_`_`$  W #   " "" "!!   " "!D1VgG    W '  $ # # '  $ $ $ ?$      @$   '#+] bab*9 "#  67$  !)6 #%];b'' yCl           2  4CB{9 : 2 -52#2.A' W\  e . %ORQWT (#  $     .+2 4  '  0 w7 8 1  $<+ , % 8 0-1)W'5 J],C  $,A# 8 6W  &  -,@'<J @],C F<* <;<; .+*)<:   !VV7H   B  B                Wtq!V  V7 d  t   4#A4    # .C   f          p   I 5 8Z78t    -K  P!OPOPJ:  $& xQwx#" )Z      "+(" ) ('('(z    P,OP*OP#+   !  "%a+ xuwx#wx   `  J@;:56  (b   #! m    8?78 7878  ! [^]P    K'!    @P?@?@ $  o.6 A "*4  -   &   D     ,! % ,J-&D m4     `   ;<;<;0        [( 4`   % (l J(Wt  ?%   ,> .+, 5$, `/_`_`DP    EE aT/T S[f   7      6-  FTS   F> h  h a=>hg   *.E >=16.E >= -.+  "- "- "!87 .-$% ?  (  .E >=M=B^l+/wb$#3 / [E       " X;WX WXU     '   @n?@?@?@   1` J} *CD=> =LG    75!   1 lA x2121@1   +  2  6+ "+&!*|    BGH127 .7 6!&    7  43 23  '   C   (.TX(8(&  8]789  uj   /  H9 HWGH- |  #  !"-    l q    *)  C    B?BI .  05S\UVOPI 8 5      ]  dofb-% ()          C      9!             #$    !   D $^')0#    9!   $ 1s MUVUVF  >3"!  (B! :           B  p/ /2 #= 2+,1    @1w^ hZghi   V2 |  ,Z a60M  . h_gh u   %\ a4 . F 3    4Z (   xbwxwxEF^b HS    = ^EFf pPopopopEFX (3     ] *X X{WX    "  18 3:9:9V    ?+ ' T2 3V P8OPOP:9( 5*    -!(:9 ``_`R_`_`:9 E:  - - -' !   h`ghghgh:9 _T  - A -'    ! 1 3 @\?@:9 :91  {p  - ( 1 @m?@z C'    5':9 :91 ~ -   1 %:9;:9V   JO.$    #-(!$%;V :9(:92  :?.  # (2 -:&  4:9:9  * /   +:9 :9    #    Fg:9#:9V:9     5  (     !&#V!  `_`_`:9:9+:9# ? : 6  @%+#g  h           +w B "%,      LL"t w x0wx %  1  % x wx- !     s  D    h J  y  %    TaNM   83D7  8C 8CK  xA rqrop   Cuvu)wo     ZYZY"+  y 0*+fGN_fS  ZYZ_-   8G HG DG 83   83  [ # 47/3R)X:*L-Js$6VM|3W#'&  d B                   B   J            {         U W4   8 #w('Stststqts21.1    DC   C6*= >    )*)    *  -" T )*,%   )cT 'JIJG&%0 "!)> ) JIElkF hg#t Q` U+ Cb$"$,9,"J+j<HRF.S>HBSK92i\B=)3K54@V5  ; R  -         J 3 !4&3 7E1# &  J0    DC Q 0 %,!Td, 0  2  #$#$#$K#$ d+, 0E :I     C =   z      d ~ Y'# 7e$ K Ig !F " BO!0! r  1 )G ) <"A  0!!  $% !     ,+O h       1   ~C /p .T   a,; 8  = 3 "A  cxlWA? 1 077"    $   !=     C +  T   +        IE% V2  4Ce% F C 8 lU` * 6< :?  1    r    M"J[         C <  %0e-# /J(  r   %'E -         .aL M4aR  03      4 %4   < `U2'I2 $&@ <;  .+0,#$!"      1 q*+N 3 E @ u) & #   0F&# 4  2'Op    %   8  9   .A!+$ @  |     ^T DJ  $W_`} " #& %    %&L. W} gK &  #   ) ;P$'2+  7$        "%%"aO =' hIghgh]    ! 4#(]^]^_`y |{|{       $ )$& |K( :2y "6576 565< " !*+45   C%<'  "  <  0" +RQ665RQ  RQRQ65   POGMHGjg4.56s%!&   r!"   ^[:; ,+#$ $%6&%!VS$[0    ;H2 [009   H        /  EM"ApV.s[   [ +6      RST thk   hkgh&%&"%) 3 03 ( P #6") 87865b6 565,  "!()0 '"*  03     ,65/6 565   gd]l  &8    `V_` _`_`_`e  )  2 5 7J @g?@65/6 565     8    8Q7878787878w \YZW   <&;!Q PNOP+OPOPOP!65v      {$1 !!v65 0H/06565 65   !" )  = 6565         POP :  5,5)NKL1C        551  x  POP:OPOPOP OP    J"]    8:787878X  *< P/OP#^   "   &N X}WX  +8%  )5, @8  +8 PJOPW 8'  , F  opR    dwxg 6"%<   h~  G8 &! 4   k>  e "  @??@11D>1   #   3 IZ    &  q /   S ^ = V# &q /  HVGHc       ( @S       5$   &10/"E =+LKB0/LKLK LKLK0/0/( )  |q3DQ  %8g><+J 2G LY   :=LU ch$# (+,1%L'( % 4'(  )X5';L&;L  *!   = 2!?! !           .  .  s`!H_Mb7\.KSNB` ( "w        >    2 =+B ! $#&%  ('*)*)*)*)v(LMN tfi 0/ HbGHGH0/0/0 /0/.         "5,0 . X WXWXWX'WXWXWXWXDWX"       $" popLopop$1  L $         0 !#21  3 $      878#78  ) @3?@?@ Q    "0 9 R z(    '2--8;5 `*_`w_`_`0/0/;0 /0/O  AF=>54# "   !  AVJ   O   8(78J7878\780/0/.0 /0/0/80/  {~uvmlY\    4 !=T    8    8O78780/ 0 /0/    !A      @M?@/?@?@?@!0/y       ~$0!y0/0/ 0/   !"0/0/       (C'(X'( 0/0/<0 /0/         B)%%K              P.OP`OP0/0/D0/%  2     # !":D% (k'( 0/90 /0/       >"V   0/0/    ! 6 X WX H *      <    @3?@?@       3          -.      ' -$aHP     5 +      xU   a ~     = '!         S        M$V XWX ;*  4  \      (/'(6'(         !   i , "  *  , S:]pRo 2  " Rrqrqrq fef ePJh6V ,In '&0z!"    H   * *, 6  c? /(    K?9 ; / *%O$ +<ae>6*0 %  :24;R      PJh6V     "!,$#$#I&%('C' ;AE$ 8@i w        9  "  $  ;*M @      .,U:q*& 8@i  w 9 j   && %   / %   2#8O#2j  hrghghghghgh  G  '"3Q/ G @;&?f    3         g~ *)g~g  )2'         -  { )%M  #T( 9   #  )A  =  %W4 H3  1 #    9    O50L%9 &   "< (-(& 6   "3!"$ %   3   P(OPOP      "  > :            A N *  %     +     -       -   '  % V ( g+I6>2)5  wH0 8rqrq5po1        '    $!*    # J3/1B %! 851  {   *   2 %    '       !  ,  %  = 9 } )DvJM  Z= rq `     *     *#*" m~ 8%.= %  `,T \   g4h   %,  %S  V        4K6=  ?4 12121212 ab1212 3432#(\NBz  "   vNBzabMN  878788  *0   "   <{X.;4 #   #  S 8W, X.&V&Z J      3 $C L A K    ji jij   lk lkl                     ,$ 0$*$/%$C L A K p xwxE   o  jZ 8   4Eb%  "G7 %%   z"2 %%  j"A1 % xawxwxIJIJIJIJI JIJW ijiji^ "  1*! 5  W eIJIJIJIJI JIJ[ v  "  5*!5  [ t{puzm " dIJIJIJIJI JIJZ \cX]bU  "  4*!5  Z gIJIJIJIJI JIJH DK@EJ=  "  7*!5  H fIJIJIJIJI JIJG ,3(-2%  "  6*!5  G 8G7878,7878  01     @  "    0  1   P4OP OPK     ( "@ 7NU   ! D=,   7N  U     @   ! D@,1  D     '@     $ H9GHGHIJIJIJ(   "(IJIJIJIJIJIJ    ! PKOPOP1OPOP24     -.   %&%&%j P+ b$ f *3        :) B *3 P OP>  ! /;=A:7)/)[ \   R Y2  ,8*3     o$T,&T  "  & ) )] ^"   N U2  ,8*3      HGHGH !"  +H  &    :  00/0/0FB       F V   Z  3% 7j  B 5)%  HGHGHGHGH.R-.>-.TD  o7to>pi.   %  R>D X"WX    `?_`<   "  < 8F7878X  3 0 g      8:78 78SR  !  X h  ! n  @?@R>T~  a7fa>b[  R> bK< X     ! $+c f y |  efK)`  787 :!' `6;J   B -   ED ]J#  5 X   ~        !   #    C4 4 *)     O p         ,+ E>  *    AB  ) R%!    #` Z V) EJ>Ad" m C   *      Op $ #(  hYghO;D CJDC $#.+ " Mr    c@ [L :4 J     -VU      '  )&   =0/   `X_`8            " 9 89            " 9 H&GHGH;     H'GHGH<      W X    %   *   .OE ho   E #' v% < 4     xwxwx?wx5*)-   % # @M*'"       ;$"y(| !! x     7'  7" mW Xl    &,T  P    # ;P PROPOPOPJ   P" J :{   &   * !!%  gY2- {  ## f * 5   -   >9 " :# &$!0- pf *         #@  $# o #5 Q "5 "   ] !!0&5) 0  -3   7  # 4   *"  H'GHGHGHGHg    0GH    # )  ) S` K    O&  T K    P'  -: K     ,9 K   C   d y    #     e1;  {i ji ji ji j I LQ RM X/ :e h (,       h;gh.i j  ##.   HGH 1      P7OPD !  ' P     *        : !P230 U  57- P;OPH   !% . ' .  P#OPOP6  &   P$OPOP   !  PNOPOP OPOP"OP OPOP #  !      '0 % < @ + !&(~   %   <         IV BE@C    Z]X[   pop *|& .L\  % i j 2  ; + .PT!        !18!     +    POPF V]^!_ ^ q$O&  Z!  `_`F V]^c^!F  %E4  P/  gt   R!( 3@   hZgh.ghgh  $ 3 4 3@KP  N  & 6.x   f# e(g TghgTAg T  q #st u<8   <FAF H  A     0'/0/08   uO (4  NQ  ! *      K ? v 5" "#:?    G// 7& R> j  !nq g )' "b/! HU   3! `(S)     CL) 7G2"E  X(WXWX; ) zGhk TklkT$k T kT  #>  C<= << 0   !+?8 !'$ -!   $      \' x "      ) K#  / $$(,,x,$$$$((,, *:   77MP   3Mh+.    @  "F"0 #3  ! 9MP  .    .Hh+.   ;  $F$  *  """  *&&    *(((+  *$$t    3   )  """ \i      ?k       C Wd         > Zg      j   C 2?   7 3@   8 ,, , ?L  2+ j\  L   $$($$$($ 9% ( :& )- .         @)?@\[ P#OP# &' PvOP %  8      !i%8  ! !*) !   #365" 7 * xwx    =: '   "" \[\[     "       D "          hgh = = =T #=* #=, #=.             = = =  hgh  bQcd=cdijg ,l`  G6JE=F?    3  Q= , xwx dc=4= =z KN)#=P-#4Z 1#=Z 5#=\"  + "          =4  = = H;GH$   #  a08E^  ]T  DS TST N           $#'  @  D  4^   +        )"i 66 =    .z >  E^S T  ]T ]T  5S TST        "        ?  L.(  F     5  C^   +  $#* /"!( /    2)"i 6 L    @2?@^  /0)*#$  !!K   @4?@^   /0)*#$ &!#M   hghgh(^ z /0)*#$ & ?@=> A$ !vD8      z  L ^  u     0  N#f)8?  u POPOP+OPFOPW^     $<(&    XCWX 1.1 '10 8 @  %H P X   b  j r z & :  N63T 5^ 5 P-OPh ( r |       ##</0 -. "   zq   " !"!"!"!".!"#!"!"!",!I"   w#z, C 1 / ", / #,I 1 ! jhgS g   `/$  Y*!U/$ iI               y"!"Fg",!""!"! "!*"!"!" !"! (    565<765      ?<7<7:1   ,56 ,  T     8 o 9 V 'W7P+U(/ !  V    ,               e"!"!"+!"4!9"!"!"+!"!"!"! "!"!"!"!"!"!" !"! +4TS   +    4 )   5 6J*(i2!=(+42     +       " !"  Fn !"<  : "!"!"!    # "4!"!"!"! "!"!"!H  4  /. +  #'!7+4 H $       !    D       !    S                  "! "!,"!"!"!"!."!"! &                        LE       '4+    +, _|{dc  bcad  vE  <;  .  ~    m 4  A)R) 0$! D  ! S                           "!"!",!1"!"!"!"!"!"! ,- H##! )-4,1 "!"!"!"!" !"4!V UVU   4   ; "%$' 4  ;$  ( xAwxwxN MNM) *0>7NK01 3   ) $    4  W`  \ [ *  C Jabadcd)efe h7 +/$   *  yV "XWXWXW  P7%&_ # $ $$% $ $% $     + $/ Ta\a`a  La  2+"!)8b&ab  S$ Q+>2    . DIVrC'+&*!       P7&_ rT STS RQRQRQ :Q,R b ]  , ` +"   ,  ^]X] 81*:1*):1 , !:1 $%:1 ( :1 0/81*121 4343:1,543656565:1 :,'(# EFEFELKJI%LE\o^5$efefelmjilklknmnmpg\{|{|{ ? N)F5<            "%+ x:wx6wx9wx6wxx   '  '''#  ' ' ''<;  ^]   87878    p>opxopopopL K           $! m'  /- 0B/0(#!$d \ t    ! @>?@?@(Q #  .(F 9< # W^]^    (&  (% (#      (# 9      #Z #   | y      1+ r    5,  0Z  LKV LKLKLKLKLK,}b \ [(        L            ? ?     BL      @? E        P9 ' _E )I". ! , 0! Z     V    !      , ! b          W L   'Y     `L %      ZY *W])[)L! Dv   <+1. X   y    --.%X    / C L        $+!*>Z) / C  L  wZ,   & T5.%-434343,C      "$!   -.-.-.,$!"!      Q  _    #(    T5 , C hghcghgh,$#&%&%& %&%   +000000>7NK0 . ]!43  @ ?@T?@?@?@,   ) D8  0/0/0/0/0/0 /0/0          6 33o,@  6+  (      4       (  ( ,@  &%& %&      ?             L   ?    h"0)<""  ! 9 !    U       x*wxwxwxwxwxwxwxwx+wxwx"wxwxwxwxwxwxwxwxwxwxwx  6 72 3. /F G  : ;JKBC > ?" #    N O & '* ( ! $, h*!!      $!"li !  ),     2/ "$&     }&     e  !  / & XWXWX L  0 `x_`H     .   g   :     . `z_`H     .   i   3     .     . M     .  *T  U ,F@ %/         WZ       )^F6  / (#'( *# ($'( ,  9AO          "B  +90(4#"  &     H ?88@4       +z    #  !Q{?BOV(UV%Udc!!      &%  %     {x$ .P&  L    9"1(| J - :  (     (%   !     2   ?~ &    D          6( \9! =  T :;! W~   "!"!6565       !73&l-#   AL    R 8378     , 0p/0                4    01/0    1 x4wx"     K+(+(48 +( 6! ! )) !      &.  +))  ) """ xQwx wxwx      B   F?  DK"/ H!   @?@$    -25: UZ]badcfkpor} )! ! ! { 0  0 ! ! ? ! l 0  ! ? 0 ! ! 0 ? ! ! 0 ! ! ! ! ! ! 0 " " " | 7  1 " " @ " m 7  " @ 1 " " 1 @ " " 1 " " " " " " =$  X>WXWX       +       XcWXWX  "    4   5 878 0-   M    (/3 "  4  $  B   c !   =X!] ~   )' "I$B  WP 3       WX!] ~ ]Cj  e        .U[8j  e R   @ C):"S k   yz x      Y  C,/:"  Y    G  5 @&            i)$Y  '    H$$6    n g  b 43 Y  H ab   op  !MJg;o!<!% &      -   $$~     -  6$$ fe dc`ahifef  lkpqn g  fibc`_  ^a^[Z[XWXfa@!)!(  -  6$$ M -   7$ ~}~}~yzy ~{xy  xyvstspop     ~~}z{xwxiP#!' - 7$  M9  H      7 O8"! 21 #: @ L 9   3P    1,&3 XIWXWXWX n   '    0      #B   xwx61 2# $#$#$  A F|}|}| '      *P6   x=wx(=>  5( *  hgh   % lg0  E-%?  Z>=>HA  8= > x7wx < <        E#($    # 1  &%  0 ((     $  =  ! $3 ' $ (    # 1 S F    (FL   !    14j[  #    3         &"DH 6 j[ a6DD A V  "f=9N    1$b6 ADA V T@=>   ',@  POP N M}~ &' "+*    @. } PNOPOP POPOPO=     C"= PO  :V OPO#PO730   v87," o  |R _#  )  (3!+<: #73 0  `'_`_` ;    && x9wxwxwx,wx # )4      -  - # )4  JVUVUPOPOPO1ZYPO6Z  " w|  UXz    A     3J-J16 '  ZYZ  kjm    BA ?  ! , &<  #$$>vh & !( V  BA   mJI 3  )   W2 L       mJmnm4 - X   ;(H|% * +  )% J& ( V      x4wx (BA,( `  5   ++ HPOPOPOP OPO POi ,)         &E p*$H  iv0>lklkzs 0-.+,   "! vB 887878v'N\[\[jc  'R P7OPOPv \ NMNMNY  %!   xqwxwxwxwxvr*)*)81 6 "   ,  ("!0#J! i4v0 #   &#             6 ($40 #   `_`  J, &  Dk(',+&3<;@?&.-&GPO&6W`_dchg #   J H_GHGHGHzJ   O 3 POPOPB   DU&%*).-&1:96AJINMRQ   *T  DCDA .-&/6   .`4 343434:   ^?           3 !  <  # ++/ & /#*,MC E  -    .    = E  !! &"       @; *     -2 5% ! !"3 H$   (#! &" ,A    +  7 :3 4-.' 4 7:34-.' (      AW"KA     H?GH GHGH8     7%8  hXgh "   ~ q,<D" "??0     L  6UG.&(&&R5&[6`6565.KL6KLOCLjO=L6565T rqZkrqlY L  -. -.  -.  -. -.1Z-QR  !?k)| ##=6.'' )#'8'  )6' ~  /3 B  /  [.  6  C j =   KL_`ODL'    !@ : '",D' R%SgO=L#     ( #=        +.       -J  F "%, "Uc I g=#     s)  ' !   G:"  -*SE87P*    he ,* )$ # 3* .AE    aN""2   x D   ? A < / *  /",1vH&7<4   x P3OPOP  +1  @?@?@ %      %   @s?@?@ .x w x w6     4B.   6  !8D;82  B ,'x wxw)x{x{f      1     !   !  !        335  !' P4q."5 8     "I6 H   B '   )  f  #  H4GHGH|"P " |  BN d FQ    &%     "4CT N |llo|j|  h gW|  vsb.  0 878/*    0-.!(     , !fC    C  <     $    zb.   | |       NMNM LE"" B5   =  *50 0   =Q j9|" sJ)IJ*      D#"         %B!Q=NQ RQRq| qrQN;    WZ w#=k lkn qvA3|5 $& &  'Z  B =   ; pqopQ RQ=N   #=E    = `&_`1_`C_`_`_`      +.5 !:R# XWXWX WX WXWX WXJ      "   _ `g h w z|{j ib  4#^nNJ      " C)9U Xs5_` _` _`_`_`_`_`_`165        '  9(10  X         1    p4opop(qr in * ( p3op'qr w~,' /8 !j:J  `    8K/(C;)$41 !   & ^q    A(*F'=t P"OPOP5  " $ K;|?';<     ' s,!K'  x8wx  }~}~=  = =;o@?)              $   o)  P   !@?W       q,!W u@ =t  # D <  !, t> =  ; <  @P?@]T *    &b HYGHGHHp:9:9H=    1 "( Ht(      1 4  < ! %E      !     @g?@\?@?@x0P OPO q r P OPO5q r      )- 1&20     5   h+ghxO   -  k,V )7XxfAq rq r?q rIZY|53    $   & #           :      Q   3"6 : 3   ,  = 9    %   $| "!5xfe#  xfefe$ .- ,    C  1  O&, '/"  $ ="xs    & (4x)"  xA& %   #  % $ M1' ,A  !x( "( P7OPOPOPx/    5"/x    (R'(_B Q  -! .                      P  DRQVUP]fejiP.-&qzyP6       0e/0 N  I+      fN ? 8 +' )-)8 1    U +'+ 10>7NK0110>7NK0110>7NK01S\[^]^10>7NK00gjil A ) ,$-*.?1 &%('*),+43656 ( 4)     (('('(XH     &(  P0OP     PPOP!p @? D"C  @?            7&1        ++++++++++++++++                   &%,+2187>=DCJIPOVU\[  *   c7      WQ+ / 0) *#$ &0)*#$   &"       &!"  =5       WQ  XzWXWXWX?WXZ    $3  ",AHJ ! 0)/0 /0 /0V      '& *d {      %"          +  m ; !: $ ,  ++ ) 1^  3""    { p.opop   $ @+?@?@   $ %\L.          !aMp& / 1   @?@?@ #   8+7878      X'WX!WXWX    ("       H"GHGH     8#7878   @?@?@?@?@?@?@?@?@?@D            K  (*'('(~@4    8:787878~TN    $, A&~  "  *)*5      &+  !"-*  "           X%WXWX    ) @?@?@~P     ) H:GH GHGH~27878).  8$ 2~ (#'('(^?H   %  $ aD^j     .I *   "%  ^ ^I     ^;    Q^d jkn kT   ; X>WXWXWX^ 9M #p   A  9^ ; < ^    # '8    .  )!%^F  5 "^ ! # )   !; <~~! 5$,  8! @     $$ @;"$C ( 84, t 5  , l dN   @X     % G[b 7(     +''%       a1 :    W L   Fk+ #N    , "')4 2a C@ ; < f   S #vW <JK   .*" =   ' *)     F   fs   H   P  \! k  j ij6ij i  !  6jiji  n md    > 0/ 0u  ABA \  >=>       ; 'vuvuC8`/ 7O /'       !  6    `e_`_`nmnm n#m9n ]^   )0D 9   ` qrq       $$ ' 'I# "2C     ,            444 J     0 #4#4#4    bg   < * * Y#j #G    - 2   M     4 44  J  h/gh !  ('(  333333333   "# XKWX   3@ A 1 K=1 #=1S  1  &K=1    H$GHGHGHT  #$ @;?@?@j ?B;<+" $fG |x   d  CLEF$ #2G G ehab G,ji  + +   !,,$       "0  popo~w   "        9 5/" h:ghgh$TVWVWf_   -'$X> @?@ ?@f    87878v  #   8f78      !3 C:QL   TWf_I  !)QN x 3r &! # $    #  '   U   9E!!'x 3! HaGHGH!At,7      V !A    ( ' b('    KD   %  M/:'   b 00/0/0" yn  ' " 07/0 /0/03 |     3 9    3PSNSNS        *"J*W] anu    3    ,3 /         1# 0        @ ?@ ?@?@   ?#  S!9 !9 F3# !9  HGH! !       h"gh2ghgh<  $ R *Z   l      "" Y D! ? 1* +RQRQ  (    r ) P+OPOP@   " hghgh(ghghghgh  \iFdc dcf e dc dc, h ef0 !41 21w | .5 65   "+ 1   "6  F     , N " P%OP OP OPV       " P/OP-OP/OPOPr    .,0@b+&   popopopopbQ RQhz2 ik ! !    & 'K zb'<b0V $    b X   b$b   b d  n $ .</ b  Y Z  L% "+p  >9 :5        P       L % "+X    0/0                               B Co|(+'('('    \H$d'?            @1?@A(  *   @?@+(  +     @3?@C(  1, " @?@%(  %       `\_` v(u6( 56 ";:9 (4   v$u a$<  #1$ P5OP  v&uv$u $^$` !'-5&$ =k(+'(+     \(# ) #6'*         H-GHGH h B    HGH%GH  0x   $  0  popop  0^&[^&[    F!0!  0& & # xwxwx  6^N]   N0'  6&(  U POPOOP  %^$[     ;$C  %$  XWXRWX  &^&]    \Y>$#B  &&  HGHGH  '   #  '  HGHGH  )   %  )      HGHGH  (   $  (     vq V  "4     4Z  &  "4  HC  &   "  &         ;@    gl   In 5Ex 5 ' "    7iDb  [baM  sts!v {|{|{+~#d '_!  +(   HHGH           ! ; :      8V78          )  URO TQ       8^78            )  ) '''''''''''gda f'Y       XmWX   \$[\[\[    .JW  $  xwx    "\H[\[\[!  z  ' JX!  "$$   xrwx  _ rqv s 4_       4 xqwx   _ '%% % 4a      4                     T#S EC    gh           q ##  A00            #F ' 7##x  +,    *  ---   1 X      :        X!F$6 $"  "      V         ^  4WI  +  +        #### 4  4 +   2   ## ##&   A   $ &.o &'r !'C K  #%       *4  4+  "!$ ('*+(' b       $            ?@4   }  2 eO :6       #" 4    $  :+     \;<9!HG-F(oL  K!^] #:   8  ", "4W)B 1 + %  4  @+?@"     xnwxwx        6  Z '      hdghgh             (-    @I?@  1   !  ,  ,  1  P5  T,     ' % +       3 A      N$F 3:1 9>%I  878      & w"       ,               `'  " ,  |.       8   (((  . 8  !  +    ;<;<;+>9<!   ?$    7$ 34        +      )K N    QNK R  10>7NKq      'H"..e  C"  `"_` _`%_`_`_` }  (&# $" H(GH   00>7NK0 0   hIghghgh   =  ) B     ;             MK%     &&& (& &&&& +2   ]VU?BAD     &&&&$ 3$  ?t<g(@(4m        +"%  F    {  Z           o) "?  A: )%a @ ?@/?@&?@?@?@ S          % s!%S    @?@  PROPOPc  =    S 9  O ?65:E 65@    <    O65J&U 65P   XWX* 'q  -     pjopop   657 &D0  ) @  )         65 65 . &IS )  E     PZOPOPp   65' &40) 0 8v      ; 650 A  /   /K%&'%,n S(8d       65  65  65  65  65 R# 65 (   +  K 65 f> ; 65 &  ,%   E  1 <   b   E/        en   +0 .   K  0) (   :.!8          vc " !#$# &%(''*), + .-   b aba    0/0*/0/0       pIop op   !  * u 'M]  + f*    +    )   4)# S.  hQghghA      XC!      X3   1   */ 0 65   - 65*%&      A  d   O (    q )   N 2   &b+  / :  *      L  @?@  .     w ++4    67 7 2 w     +    $  &                                *J&      8^7878        (    T 0/0    &&                                (%'('( ( '('(     p.opop        (" x.wxwx      s2 = # @:'#s( a X WXWJ    ( b    : Q&'#      i ; lR' 1#   $ X WX WX W,XWXWX WXWX WX W?-XWXWXW         #   #  >  H  9   bO '3   //R   ,   ? -       n  (!(     "  :8  !$#I  (! Wn=n   *9=    n   I?        C     4 _Y    "$(@|    I?   n   ,   ?-         #   #  >  H  9   n i ;         nV      _     = Jv_kC#M V c"x i0ji jijijN  ijijij  0 G'  (@i0H 0 N       x x   "   CD JGLK  HQ # ' "  [\ 2/43  09  st   !>  J! 8!78/7878 78R      !   (  x)wx=wx7wxwxXwxwx&wxXBpopopopo  [\ QR  *!$      3M 8  4 5B     $$ 'X$G2C  ,       ar qrqR  | ots   1X% &     ^ 5}LE!&!a R ,     A)      pop|     $, CDC:B  D ".|  Bpop op!opo    (& 291  B ! ?po1 ,1 :b anop-opo9ba  .-,(/#+,-9   C        V8  0(/0/0 F       %^ l  j~#6565 z  Q/2+ V$? W   H 6 HGc^ WS{UTHACC/NP  <  B  r| { X9  9    9 > >    *   C>>>0 Q ; H 9 J I  ; 8 8  # 2 E. +  *  #  "   1  # # &)NP    <  Br   !'0X WX W X#WX WXWrXWXW jSfEx  ~}    PsPw6QjT     r     !6X WX WXWXW . ,9;      i~e h)*)*?@W?@W?@ ?@j?@ ?@,  Pd}y U U  U  U 7 + W C c _ )  G 5 5! 5 5!WW j   h@ P  h;x       0/0/0/92 .# +IrqJIp#. Ij" % ' 5rB&( & 2Z )     GD^aVaOGHC&h? @? @ > >>&   C>. =4 9 8 V K V D  =  % # )- + ,  +   %  !1   &   <D    B    N   '0h   # j ZCV5h  nm  ! @c@g6IjT     j    h     )+  v  v  &8,   ! 6 J    $$ ];" (C (,X WXWXW z r\ " L -*$n:        OD  $`   * )  b$& -    n${  Pj  $w  & ,$ M  W $v  "H ' > $W '$) C?$ >@   4    h"ghe  $   ##$##$#X $>   hghZ      ./.-*+ :;:923"#"!67&'  RM  D CBK DC@?H &%#*B!L;      8&78L     !*  `T_`_`_`o0   B 1) 8+7878gP   7!  X +^ <9:9:(;+-$. + P OP"OPOPI  t    GDC J GF "1 3           -k  #  !T   6 3! +"( "- x]wxjv  == !  C    7X` ,B|{|1m  $"    _!,S^B1m xwxAwx /  +.      :/  + P OPOP OPOPOPOP OPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOP OPOPOPOPOPOPOPOPOP OPOPOPOP OPOPOPOP OPOPOPOPOPOPOPOPOP OPOPOPOP OPOPOPOP OPOPOPOP'OPOPOPOP >=         .-&    +6    ;^]NMF    KV    [nmf    ov     {                                  % #%&.  ++ 3 7 0/0 /0   &  J        )D=C)8 % / 'C%   XWX           $ S&(  Tg     B  f8JIJIJI   ^    :3 ' / )     ' (-  k *  ^]^] D]^]JUZU0FG   B         FG7   # 'E+ NMY, P 4 <8  ^   / - xJIXW  `S_`_`_`_`  U     + 5 #  UXW   #       X QRD       *    ! 6  2#  #!&; O +    @?@?@?@    +7 PSOP`         G /% y           *8Y8aV 0 /0/0n%gh ghr   %  X3WX>nAgh$gh gh        9'&A$  6pi/j6 Gr          B /6 G K(p i/j !          :IB,0& / I(p i/j QZ          8L@)/& / z6pi/j& F          oO /& F^    hHghghf <> 1 $ < A\ OPON>    !D  1\MVUVUVUMNMNMNMNMNU VUVUVMNM!NMNMNMN U VUVUVMNMNM!NM5N&M NM5N5MSN2MN M!NM5NMNM!NMUNMNUVUVU!NU yzyE:|>=x   &.5 )       ) "@*0 +3    E  '   <   [|,a,:1>*,=,7 *-      !$#$%('*'(  '&,-.-50.12 4565878!7:;87"        ^H   O ^\ -M^A                    0/0/0/0^    !  0/0/0/0/0/0^5       :5 ^W XWX       POPOP^C    Z*   ststsrqrqrq3r     .'6  8) .  ststsrqrqrqrq3rq rq3r     TQR.M EF.A'3     8,1) .   .  ,.|     / % stsrq rq3r q!rq8rqrqrq rq3rEF )  #:   !  f7&  6  I   A  i hijij kle B KL [\[F GH cd WX 3 N_`A ?@STQbghM    &34787NOP CD!#$'(F3;<% V opE +, FC/ (    qh  <G     #0+    ,*N~   9 /i"SS +   ;A&A&WU @&1 1   . R 5lklk+lk (   B5+ S stsrq rq3r q!rq3rw    - .          ! 0   > B' ,*-+ -   . w'.-,+0%  ""$$     *?'0 popUdcg.-,+%   &5TSTSJ+(]TS^/2iSn aTSbQ. ##%%=:+& Gj!'>!&1$'% 6 -0 &MZ$Rg @?@`&  21    "!* )(-,%$! NM>=<;FIHMLQPOZWb a`ed    6$4 (%;kL^ 2yzy z/yzyzAyz'   ###$ ###& $#[<$C=$?2/A   878&'      !     >(1ds$ 8278(   1  @H?@e(       2$(        (  ' $%-0/( -, !  F# *5x0/ @j?@Z.+0*     ')   ,,A7Z0 @?@/-.+ .+ . + . +d.+ .+<+  "!)*)*( * ( *%.1*)2/ )* 5*)6)*% f&%MM--     d <,  *,*,) , ) , &)"!*'.*,-"!.*,   p!opmop-            B( 9G @?@.+ .+/.   *)+"(-.)* ,-,- '2 * 1PQ / @?@3.+ .+U/  " %&-.-//()*   ' #(8=~1 U @?@-.+ .+O0  ././' !"  % 687L+ O d (. + . +:1  . 0. 0 E r(   : @/?@1   /  `_`1         +  . ? @o?@ 2      3P  2   F !   049.- 4ts ts tstststs ts tsPt2  ..----,,"++,,++++K.=>++X++/.!A4       P @A?@ 3     /& @a?@5          44< @V?@ 5     28 XWXQ5 BA(%-.)*!0 AB12783FED =>9J!  )!l=@N @Z?@%.-.-,.- 7  4444  44 DX%,  HGHGH4   $ POPOPd*  *%#7         3 k",#$ #$ #$#$ #$#$ #$ #$(j         ,       ( , 9 DBB  BBLJHu tur= :F+3 >:===@ A@0C> 8 +--200" % " > $ "  (  ( *(#"  ,p 9=  D DE N E+, 9FCI=0=+-46%'A $ 'p @?@ (( %\  Dl  . &W @?@?@D?@@ ? ::  "dG    =: xFwxS  - 2! ;  *  @??@ R343 4    6  w  EH   M" XUWXWXWXWX ! (O/5  R3434QY4    /C D2%Y  E" hYghghghgh  %    ,O/5 mz   1  =% jZYZYV  <@ d&7jV P!OPOPOPOPOP,OPOP{  f hghgh  21  $1)%(+%     3$ # /6+    ba   $LKLI $>=>;  (  %&%&# $% $    $ 5     / d  E ~ i  E  lA$ 5  <  ' 5% !'   XWXWXWX WXWX WXWX WXWXWPWP  &.   $ %212/K,+,)KKKK     DdH FI FI-@ Z )) " )  "  +'%      PWP POPOPOPOP OP,OP>OPOPOP  $  oT hFghghghw 2 -*# POPOP3 ! bKX/    560   )   cJ1- & /  /= JGOM   #%&!#%&!" 2,     O "4   */)-# /=         OM   $#$#  I$# I$# I $#FsWWG=&&)#  0/0/0$/0/0Q    A @'?@?@?@? F :     pOop op opETST     ?0E P.OPOPOPOPOP  a@   N      r  .A   K        +A   )   !@R3434.,,M1)-,Y)+)()#0000000000000*.$  S!,8,E9X)8" $% ) % )           )05   ,  +  )     T     ) x     )!"   )    )     ){|  )xst}  )pklu  )hcdm  )`[\e  )XST]  )PKLU  )HCDM  )@;<E  )834=   )0+,5    )(#$-    ) %    )    '        $  .2 _dMJ_         ,,M`#(+   /  ,M`  -$  )       4     9)`7<;<E  $      4    )     4     )    :   4     "x   @  !  2    {  H!  !  !  5   0  .  .  .  .  .  .  .  .  .  .  .  .  K  .  "  &     $! ! '  9  =  z(  %  y3  |3  -   X*3"$ .& G  =!.F(.8"8)8&82' *##.%.%.%.%.%.%.%.%.%.%.%.%./%-%-%W+Z;1D7/,K .2 G!.0..AZ#,#]<.a<.#g@   . ,  ,M1)  -"!,  Y$#)  +&%)  ((')  #*)  ,+0  .-0  0/0  210  430  650  870  :90  <;0  >=0  @?0  BA0  DC0  FEFEFEHG*  JI.  LKNMNMNMNMNM$         POPOPOPOPO R.SFE  !VUXY,\[8  ,^]E`_9  baXdc)  8VU"f ijknm  po$h  eZ  9%r uvw  zy)  t  q  %|   )  ~  {             W       .          `S # #R9'R5+R1/R-3R)7R%;R!?R%, CR),GR  A@MR WRKRQRQRQRQRst _RQR_`C H i! A A~L . MH*3+h*0  $'<+<,)*/<'4z7<3<1<o <cb_\Y! f    &%  5<   <     !".-6ABA  => 569:7&%&)*-.12<O2/<  Ev]?2)2*@ (5}'eL  -] )  0 S \ *0 T J         6587" -0 %0   A C ()1*#R AH9  0/0/0 /0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0f e!   JIB   %<  +>   $ K( 3.-R; < #   7"   6 + ? , % ! <  .       H      = --E3( 4  4  4  4  4  4# 4 4TT 4 3!3!3!3R 54gtst  3& !     M&   'DA /Y1 /Y' /xY /nY /dY  /XY /NM /BA.<;.65 /*) . . .   .H.I %    6%#                     /  /               Jt*S#N "Y-,D4131313131 31 6#&12'&16),+5-0+11&123&1,5 8,,9 <,, ,*7F     --E3 ("!"!"!"!"!"!$%&/% ()*/) ,-./- 012/1 456/5 89:/9#<=>/=@AB/AD.EH.ILMN/MPQR.QTUV.UXYZ.Y\]^.]      $        3.Xg =g  Q 1  A >A  a.     j <   (# <"  #(!'(+,+(  &%JI  #           ? @     #           ? @    - M0K0/!0Q4 I,) '"!^/0) aD/1") Y<) ]@U8S2 C$ 93 %0 '07 /,A2 v - u" B%  %  ) %C##OB*@GJxlE%< ..     X          ="   !&%( '(     '( '2 1Q4 316 5 f #$ " "   #   \ "1q/  J*  2  . .  X       F     0o  !      >    /       /        M       /  !        1 $ _ A H 2 1 # H 2 v P 1 # H 2 "3! $## &m% /0 8278/mmR I\ [\[\[\[\[\[ V  67<;@?DCHG  0 0 (\[\[                                 ~}~}VUZY 0,/0\[\[\   C    ('(?W   . 6 , (G'('('('('('('('('('('('(p\   EF          # 3 &  3 , + ROPMNM; > 9C#   P*OP-OP OP7*R  IT    7*     Ow J) (0'( '('(   2/!B J h!gh   y xw         @*?@ ?@  , '  P0OP OPP   2'$ ' P0OP OPOP      2"+$6 P,OP OP!     . )!  _     ?2%#I 0:/0L   46"          0/0 /0            !9 (.'( '(  0 - ; @%?@7      p op; :' p op= <'       H%GHGHGH      !"!! $8     )        (6'(   % 8 <>DFHLNP ^$kv  @> #   \ 2 $!" %NS* ' 2.  .  6   >     | #%F  !ru   . ER   #%Z   1 b  3    hghghj  -  K(#  T $(# U(-  j  $((-    u 0 ")*)  c ^ab   R4    " h>gh            # {0X      3  $    H1^     E ]\      ) 7  .!] < Qu@?&  0" 3BP Y} !  8" fR <!  !n spo  !   T !  !   g!      & ` _`!!XW!! !, !4  p0op!  !<   !   G!!` 3 W L !   ? @*?@=L      -% @'?@7 gfghk'"  @1?@  !#$!6, (,'(      e/c3Q,      \SD*)&     @+?@t .&  , B   j  H &'('   Liji     N:;><;<: .     x:       Z ( Z. 6 Z>  Z` XWXW$#$#XW,+43XW^_ Ar( 0I+0/, 8  LA# #,$/ !  @%( +,  r  "      * 9 HTGHD  $(   H  J"> &    ('    51O"? 4 J "  > 24?p 3$ 4 z  @,4{     8  "' hgh4'   04/0/0    >& 4   4    %        dnmnm > ~?43@? 43   "S    .CV9"84> Zy #  *   } -!1D#     ! popopopKopopF E FE5FE  !%M! .2    6 <5  5  TSTef1ST efefeJIJI  &  G5 1   8 7878   popopopKopop  !%  O  . 1   6 ;5 x#wx 878I          N     OU) <        : ;@ &)              ; 3,n '  i     ,*:= 6  k#) < Z z+          @-?@ ORUR W^]ZYZ &    $X STS           FE :9 ,' 6545- /  5YZ *A %* 7?    hghgh!ghTSX!&WTSa  *               %  t2)_       [  %       '  +  Y:   dcdcd         POPOPxts   ts        *551 x     (;'('('(/tsts     t        L-/      `_`_`_`_`        3        =&5:'        3         3       2+ %2 1 *'&%$     "-0? W o1VD- K ?T 5| Mt sQt stst  #      '+W M Q   ~}~}v :('(! \,/.[    ^j$jiji j i j i    NMXMN U  N y$#,21 ?5 8 ? @-" ' * ER  Z   #,0/ P ^    `__` _`_` _`_`43babaY. )212  NKY ^ z* Z Y #]'YU^ ]^ xj  S]M $  z w&T - +DT    4IE (    U x  P OPl7FEFE     ) !%  7 `-_`    Z%&YZ%&YZ%"UZ%"UZYZYZ!&YZ!&YZY ZYZUZU \% U  \% U   H1GH(GH(GH(GHGHAGH/GHGH>,   &%"! ! $         B "! * K>%( .!%(>>  > B(/0 /0/0/0g(/,~}~}     ' 2'% h ! 6%S+-  #  ( g  ( POPP  B2B 1^]$   )$ : + P         12  KmR-iO   1N '  Y  #-!   ,     &!6 GNx6EO 9G! + XuWX6 5h   6  J h _+ %'  2-_+ YR  @O'0  %'  BO 0w  hgghgh , ;  A tK         91>K 49 (!  .-.-.k-N.- .     + - )!  ' <1 )8' / !+-N    I(\ C  1&  :inD&   &" H./%C   1  )d    W      ;? % d l#5<")6       $    2    3u5<"     6b     + 998, * 3 43   !"!:: 9 -B     887+#IE>     7-% B     . D@  % B ^ u  VU (#'O U 37  <;   !$1 7 Wj, + /   (?j  xwx   %   TS bchgbchg vu| vu|   !0     %   F%# RQX# 2 %# `9_`F :   1?  3 ? an     40  b  fefe41 P !"ZY 7 NM-. xU:   ( JIJIJIJG - J1 ,$I&5J5J+> G3 $  & !uT;U: =Q C `]_`j J       +} $:g  cd        ? @      2$:        a     Y bY dG   w          *&/      z& j\# v   A k ]  01#  v4 .   ^   #< #@ Q# N    J no A    0 X)WX & )! !! . 0 J   ; -! ! .!  (! !  >1      '('   Lghg$ LGHG# Lklk& Lqrq  & & &           @*?@?@?@c?@(?@  " v  =&/ ) ' 'l     ; DE I  Q3LJr/         @?@?@?@B   ). v v   p           % 0 _ L  % 0 m L"   y L.           ' 3 q3 P v v      $      / c        #   U U    ( @ =11&1 o / c   !!! POPOPA$   O\(4 & # ,<2 3  & L & [     3&  &"' 1 J F0! ;3    3&L&[ D & -    & L   D&- y 3 . & L &     ! 4+$#3(&  $ & /$#4- !%*  " (8 J x   ): "3 = 0y3.&L& 9 H   L %A %  ' 9 H F            L  " " B  4       0 T , ,F       E       ~ E  N%/&NMNxw MNM Nxw MNM Nxw MNMNxwxwxw  %K  [MN [MN [MN ZYZYZ 8X4 %&       xwxwx# P%OPOPOP vuOP vuOP vuO!Pvuvuvu  %       %A %    ! & N%/4t   N/4tst  PN /0MNM stN /0MNMRQ RQ  ,N /0MNMRt N /0MRQstRQRQ.Rtwxw  %7  K{  .             L        // 8 ?     *   $#c"(5S>  /i9  3 %    P  !$ #$  #*) ,/.- 214 5,8 78 7>=>=<= @ %& ?*)FE('( ).*   P&t   P& tst  PP 1 2OPO stP 1 2OPORQ RQ  ,P 1 2OPORt P 1 2ORQstRQRQRtuvu &I  &C   .              L      +! $  *  "!F'WW"(:G-  /=4* & &   &    P      &% (+*) .-0 1,4  343:9:989 <  ;&%BA$#$ %& ,,,, N MN xwMTrqrqSN#/qS  N/  "qSTS    q   Trwxw   xw[#7h Kf  0           C+  L L L 0u4g  :  9  - ! ! 3?"$ $ *   #    "&!$ !( ),-, + 010 /q4 58 9< ="  poopNMNMNMbN     2#!Kb , TrqrqSP%vqS  P%r  "qSTS    w Tru v [% %M  0           I+  L 3 # 9 % -  9QPE" %  %  "  "#" ! &'& %w* + pop TSTrcq     B#1Kc $ VUVU VMN/ N#/ N /0MN /0MN 7  #K      P9P9+   #       XWXW X&O P&O P 1 2O P 1 2OP  ?& &       H9$@>0C*   & &       Y  % < xw;<MN/ N /0#;N; N /0 ;N;wMNMNrqrTrqrB rTSTSNM Brqrwxw;$    =7  N8r  N8r[^MN     YH: #j1 i         !"' * "'(&  /238'* ;<;>=> ? $ABABAB U  %> vu =PvuO P 1 2,O P 1 2OP vuOTrqrTrqrT rTSTO Brqruvu=$        *         NE^1C9fe           ,   " !(),-214 5878 !<=>=>=>LU2 "  L%>% DLWF   LJ" - L`   *  :?)/jf paopL# & # &0| 4 # 2 <kpm 2   0 L# &# &  # <Y^W      %< *  "&R    RxU nNMNMNM2NM^  2  2$    ' ,  , ,#2n  <nw    !> XWXWXWX   nGHGH   HGHGHG  ;>=@    " :"         n  _nWqv )   ]%"#Wn K7  n        #/-  n8h78hU  0 0d u|y       3836hh n (     ( Yn  W       {    W /r5F k:nN MNM\817c%d8'78W7GNMNMNM.c%dID CDC87cd& ,       %         4 % )       c&    9SI.   +</ +. &0 f !   #+Y \1%'WG      . % I  & , n'feA !A;  ! 'A n/;<;<;<34;4$34  nots   8! P;/$ hgh!ghnB   #n@!# Knk     '\ 1F n434 343FEKFEF E(FEFE FEF EtFEFE4FEFE7FEFE3FEFE5FEF ELFEF EKFEFE%FEFE)FE;< ;uE ; =        MN        ? @        J              7 8?43!       !*             ? @          "       ? @      $ C `uzy        !+ `AN_ R5      !*   O  Aw              )o     )V > "/  oDOH1 ". EH 4 !E9C"  ! " &    "  !    ! + #' #5 #( #O . O .  ),2*.*T#.#1$.%/* + * *$+#0!$!'$=AF%" >"AF+D.;F/023/35=8303;0#$#,6#5$#" K (      t  4735 L K%  )"!$% (     ! ( 'c21 21*43 43-6565C87: ;:9U>=>=@?B     = B AULK)N       M N MnXWZ [ZY{^]` a`_gdcdc5fefeChghg6jiji6lklk*nm@popo*rq9 an9DCDCDCc%d   % '2,  %9% yn!HGHGHG+c%d       + % I  %!+% @?@?@?@nNMNMNM  % n-DCDC   UVWV" - knHFEHGHGHG%c%dFEHGHGHGc%d           % %  7         %  -!I,2 !A  I  ,H%%       %  n   :    M    #%]   &>L<%  d   %$#$ #$  " ( + a  (  &! 1  %   haghgh  &8  hI VO&   & *  & h 0 j  P *"  "0  f 0    O %"  0  i4343 4343 43434343 `]`a ^[^_   ~\]^_%;oi   0Y  97  ;434343w43   JGJ[  NKB?@ ;8GHI4V ZG; B  8X78'7878O78787878787878787878787878CN>=>= " @K          M 'R    VBN hSghp  ? )   /. (56",;F ab)!" % -;tA8 @NH E&' <T[?5434343U434 3434343      ,  e$D#$ p             :Y c{g3s5U c  !  -L43434343434343 434343 ZYfeXWTWXK      !-.$#IL!  WX )  ;'/_DJmQ!    f          G: 9V      %"'&%&'(  *(CTYFN +DI P yB434 343 43434343 434343"43C4 34343"43 4343434343   a `efe ^A%(6534TO D)""    )@   =@   CD $G`$  f   xB        " C "       @C?@43!43 43   A !  *%0T%*)%: 9h          *  &*& +*  &E0   !9&7~ e 656 5'      2    XdWX 456 56 56 54 5     "  $#$ H        212e1212x1\ =21212[1\ =0                   .$      :5          -   .- "! U L             -     w L,            h"  b ~ b :555 #(* &##("#"*=2  #& *=2 ! $#%&??]ex\       [ \  G  "% o p o]po pgopopo]po p%%  + :    ? @   `_+F"%:   ? @    $    % 6Y +F?@M% +  Z  Z  2M  f .(  $ 0 "   "     g         %%  R  F& " $Q  $   A! ?)1$  F PR]    * + ppopR}    5  H .R< +  6R% 0R>Z -  8\& # x_wxX'. 9      F &. U&X/?!BA@#     +n/#     PLOPOPX   1   ("!   XSLX I D  !    XB?@?@?@A$?@G     k f]^]^Wf ef]      z   8      =#H B     @ $G ]X   1     !"2    X    /0 1  1 $        # "* !  /0 #") XA?@?@ ?@?@?@?@?@?@?@6      t     %  -      $ '":  @    6PW X0?@? @+   '    p0 + X6WXWXX$   *#$pw xAwx wxX)?@   "9) XE?@?@?@A$?@=A'?@'?@t=>=>/8 0) p u~}~}y  zy     ` e dQl     J OF S7$ ;      A       %H  h@z E     @ $=@''"t XA'?@(?@t          C       /  7$ 2      D       %I  hAz <     @ $>@'("t POPOPX.   HGH Z 9    m %    >V     ,    POP Z 9   } '   @Z   0    8i78 Z~ 9 cdc pa    +P0 0c/0 Zx yzw9 W  dU     )L,fff~fx 8?. "   R!'6  FUV        ;# D      :$%&%""    -4  5Mf9  jwv  L ( / v   [   ;'fP @ Vf"""fi     fk     fd      ~fg      h (j'( f    "  $X8 0d/0 fy yzy |m$   &P0$$ ;fH3:9  4  $f f+n  `)_`4h"$@ @=DE      F)"  =h$.    $   h h  xR*: < C      *&  RD X4> /<   1Z> RX  X*X""" x)wxX66  0X,,, CXPP!  2X440 X!WX.\Z"ZkZdZgZZyZ$ZHZ ZZ+\"$\$\\+ZY++ X$WX+ZY+   ++fe+fe HAGH   /%-/  V0 G# & @ GP G` Gp G G G     ,   ,h     ?F        !"-:'   n\QL !,  ,     $$ ) K3'H ,,   ,/   ,'    ,     $*$$ i A3!H   ,P'' ('('"('( '.( 4      ,O" 7- ( " .   ,g   ('-  a  a ` @   "$a$ g  - ,#  , 0/0/0  ('( '(  FGJ X  &   &      7H    ZS 3TWF 3<ETWF-1<   }t   }t  }t  }t   $#  *+78                       (  (  R(   C           u                #J9   &#                   R  V- g   e CD  A        !B ) &%  :!    n'">           +                           p '! ' $.2""&o      }t                }t       }t"         "  &  }t        }t         i*3.Q6$6 ,+, ( !m              !$#&  ),  !" &!2 1216 565: 9:9> =>AB    (#             C  ) , ,vp  /"2' 3   !           }t     & }t !.(  7?$! p           &           J  _h :9:9HGJGHGHG;HG HG HR-0r   ,ns B9 l  q+C& $@5/     ;   @?f;6  2    J  `_`  N   !, +X  ,   @?@  (          ~ D  X.WX WXWX    !(  XWXWX WXWXWXWXWX?WX WXWXWX     ,AD    .UH?o 8(787878   1 pop  ~}   rq          dc          TS          BA          .-           V5MQ%                              6.   8/787878     < @!?@-?@   2C  @ ?    0                                      /      POPOPOPOP    3 POPOPOPC   0         POPOP OPOPOPOPOPOPOPOPOP OPOPOPOP&OPOPOPOP :9*   !  2' ( # 8  'B   + "   2/ % :9*   !  2' ( # 8  'B   + "   2/   ('(#'('('(   =     % !"      !"   2  P OPOP  p&   J&  hsgh gh  N,"'+ X WXiWX   mr XWX WX  *#74; 0 XWX WXZ  +(/ / XWX WX   +x XXWX WXo    /@ XWX WX  &  /,3 - XWX WX *) "':9.3F WT [ 1 X(WX WX?  ) XVWX WX    /> X?WX WXV   ,* XWX WX  # , X=WX WXT   **     XWX WX   )x    XWX WX     ,    XWX WX   &.;8? 0 XWX WX     , XWX WX  # , XWX WX   )t XuWX WX  )c XAWX WXX   ,, XsWX WX  +_  )a     XoWX WX  )]       P%OPOP ;   "T  aN0W  ))4_8      \     *yP1 XW XW ZY Z 9 666   HeNM26H    _ 8       !$ %&    x!wxhwx%wxwx  & &< >   *)   CP#  !5j  ,8 0D/0/0  " ( GT '  #     0  0x W  &#3##  HDGH GH&GHGHGHGHGH GHGH GHGHGHS     F$S pRopopopopopopopopopopopop)opopopF             <   ,F 8    HGH  , HGH  '     HGHGH "   ?- "  H$GH*   L'  H GH  `4_`J , J   H)GH  *B              PBOP        P)OP   $! "%  !  . $! "% !       =     HGH+4 X4WX)  N-&  HGH&/RQ HGH%5  H5GH&K , HGH %6       @.?@?@6?@?@L &j   PO : b$ *   &  ""   pdopopopJ   ;&   fJ @A?@ $^ i    ?0 P#``  #  +4> ?Y^$]sda "^$]da f ababek #  $   $  & / D      2 P (!U @5 C /  > *, # '1.   #- *&0 $6N $s " $    k &  `^]^]^]I." m   ,`I Ofhghghgd gd ghg      > 4   $b*+f        BY(')((1N  _Ada f eb  # NG R ?DE>A? B 7( ('    * 0   &))))%))    J '&('';,;<+  !  % '  A   ` _; <   "             $  (>'(dg:  8: VE N  _[^$]' #    $ '.    ,%    [$'; < @9       }$ JI*       M}  | <7 2   2 e G  *    "  9  +  "  ?9   /    C   "  &  =        Q  < )" ?  :  A # .\ $!`&#;*'R.+J0/A21434 365#8787:9<<==@A) S ,    $ ; - 4  I?  ]  I  O   $ ( ?    B@UH=9EEW=88HW&-  D     [  U  ^  >  E   Q   u / `!"!"`!"!"m G  _  >   E  ] \ L A >  #   &  ?  ='      #  &  ?  >  ?     #                  ^              _f_ `            }$                      -4- 0                             wzsv     yx               KNG J            c       }y |    J )   ! 8 * "==  {gA ! % < $%A2$#A1A$"",A[U@<G]QC&! E +/ -GKcIK@+ +"L!$<#&+%(+' *A),<+.L-0+/2+14+3 6F58L7-D [  U  ^ >E Qu $!`$#$#`&%&%m*'G,+_.->0/0 /21E434365]89\<=L@AADE>HGJIJI#LKNMN M&PO?RQ=TS'TUVUXWZYZ Y#\[^]^]&`_?ba>dc?fefehgh g#jilklk p5opop*K       *-   `'_` _`*@      sS E*        F9'(  ? X[<3%*      s .*.'!"$  &   ")>   5 C D$# ## H .'"  *L/'($ ?W-*hS   .  % .Qt*h  S >**^  sq     $  '   %   '"$$. * H   hgh*& P !. = *)  21 2-.- 253 $"[7'")   :h* <9>;     $ ; /  L@% :     : #4/+"!"! "!"!"!"!"!  -  #  :   '$ R  :9*       A VU NM2' ba      E%ji8  }$f ++AH      ZY-'E"fe I     !  ^]    R $lf ='(6(7B6C.h W/B K ?.l   '!& G  !(~<+% :     : #4 $+   "!"!$#$#&%$# ( '*-- 0/2 #3 6 :7: 9<;>  ?'B$A>  >k44   $2           H2GHGHGHT   * xwxywx44  ]`_b   F+35 [   4 2 0D$C .        $y 4 "       ! & XKWX*4     p 9 o <5*'     0@/0(M$"  %# H^GH(#&',#F  ('('(8L"    "  hcgh482    !3G E 8J ('('(*  `"_`!_`_`,    (B to f]< ( 8U7878,H  l  "    . H?. H  ,-t X;WX;WX!WX,J B  " "&JB H,         '%)  8\78,    #   -    1   # p[op,M 1"M POPOP&OP"OP*OPOP(OP"OPOPAOP.OP#OP7OP%OPOP0OP,OPOPOP.1 " "  !" !"!".!"!"  "" !" !" "Q  :9*   !  2' ( #8 'B ?"     06f ='&#(>)%1      . " #&) .-0/2 1458  ;8 2  1!" 5%(' % $2% *4 =  b  ] : e Z   10>7NK0 110>7NK}  F#  Y      * )> 10>7NK    D!     HX      HS   I   K  20>7NK0 2))))120>7NK0 2 ))));  NIFQ DS T9# !-/B'   "   "     1 b      $#$#]& % .-.- PAOP >   10>7NK0 1 ''('     1 / /      p o                                 <%0pm#0- I*  ")  6    6 0"- 666C=    D M]#rOm=?8U-8- $  B   6  6  C     a  , F &&1, #C C#   A A @IL       ; D $D_AAA 3"      ('( '1nt &.    %% WZ% %%%%%%%%% $$  IL     ?st        &$$.% % 8]0G("#6 D# /  <3"             "! !1nt   .  {$ #$#^  >  F C : '&  ^ ~  NC   <* @?@?@ &%6 7, 6 P*OPOPOP % 5 pop  . ^ 5   h ZT!" ] [ z %)$  %  $  $    %)$ XKWX  )'*)      . ' H[GHGH=0      B.=0 &% & &% -! D   ?f  C"    " QRQ F5NKLK   # $' (; 0p<+  ,/ $|0N73 (x46    .  i7 ,t8ghg \B "32 H'J& ' '@& " ,3A KG /U3Kf?4?.91115-7F('5I  #[     ?       `r_`*_`*_` " " r   m"f e"R    &   Y " " "  X3WX *  0 `}_` 16$1 ]7< P(OP  8 f eLKLKLK      -0 KF 3KL  )=/GG)G(W   `4_`7_`:_`_`  , , /  * * -&22'  , , /   uL  _   '( '*+,+'9'7 0,8 0 %0 4H_3+B+'L_ | 2" &%1$4*/$Iv   1    $  %  .  $  0  (  /  #  $"$!N X   dc ni 9WX >=~{ K     |"! Om Wi ; FE|y /  `s9H  VUxu  NMzw L$n1  $%.'0)0$< `=  *P v 1   $  % . $0(/# $"$! s)   4  <  F      " "E             /        &    )"$!             .-*  ""   )XU    : '6$ 5 #)M*D 2 %   "  " E  /&)$        $#$#          ?#$.z0    6                 xewx      ;&C xwx     170O R 13/X  &@"Y Z      &)                 *)*)*)*)*) uvuj  !    "!                            21   $%  "#  !        #     !   #            78&   " 0'/0 .' H'GHGH     >.      ZY   HI   FG       DE   ? )*                           H7GH'GHVGHGHGH  )# %)!&+   ! . (%&%   b,`_@"a,bY Za9`>_            R =B'] >,, 9) g  \ U/!\ cR  @"aNbY  (Z         (3=X4 %Q!R N    ( x7wx wxwx wxwx wx wx/wx wxwx wxDwxwxS5          -           \[\[C      &%"  -  *         EB, -    -   " \55    -    C  8 *- b[\_hq    '']"11[: @"!X""!"!"D! ""!"!"D! "!    $P^ XUvq (' #   ^]% e /PP    ^]% e +PP  T   $ d   ]{5H#4Q[D ]a1'  ]W#!?X  >X  |w z ;X  w GOXP  '                    !      e6/fefJ1 +1 (B58V87[ 9&9(9*9v #X % %    }     ,   *K> ;   .  "Q  OS#)K> ; "!  "! 0/43 % 4!           n9 (-D J3   "!~ "!   6>Lcji`8ct[3 BSR $e' ts6L RQ L u2$U)R !!0[L <Ets6L Q  $[L E                  )?= :):,:;v                   )   .#$   +$! $%  F  _3&B  ) !"!"!"L!"! L"!     /0 *  e+,  '@  - &129, f1 y(*%&7+ K  *    L   )   .    '  TK ! F  V3&9  ) u"! "!  ;  b/9  u   (    &= 6  0/  &#% &#$=>;2/ &< K 28QZ2+=  *&t@ v        5   2 347W4't@  xwxV&   ' M- ;/!$&             2-(               2& F    JID I>5  3892  % ef  )*)-2 )2 ?2  E2IF   G FW2; ( CF f/ @ <15A69_ Xj 69 %q ) O _8+    t& E  N4 /)&   D&!H    0+ 8     -,  -.-   &%   )  ) e  !,       (   f  d/ ( /L G42>.6:7 2 #" K))  7 8 <   xfwx&W    :W  &!    &!4%  &  !&   # "  ( )"JC: > 5) 2   8  &"D     8Y ,>=@YZkRQ8  "Y3Y" -k.  (# %(''C.'Y@?]  % e 65Q,21 M91+ 5# (  (    f%{% A=0 ( 6 M_B6=a 8T7:>D); ^8 8%  *  V8   xowx&L      EL      & G $#$! $  ! $$%  &7@ ]   G A&! '!H#"J 4 "!"!H !   ~_lklk.   41  ?l=$5 *A  ) e l9 l+  #O  M I  E%@#&  -  _loR    &  e     ( fNfe5 -/  a2 $  #)<+ Z87?6>'   )*  4 & #7  8$   & )   .'(   /(% JGFCB?()$ F  h3&K  ) &!  a  $ -     ( )C:   5 )    8  $&+!H! "B / "!"H !    :9LK:9:7  4#'  /  ) e" A:+:  ) /0:=,9    &  e   (f (fh 2/ 2 %  '3c6Yb 876 9!+)  )  / & 68    <&   0/&%  !~  zqx ({ x  u ?3.F" L )  38< 2& "!"M"! R "!"M *] !"!   0#> /  +  e '0  #0 *O0 +  e +0   - ( !R!( (+ 3, f f2  l2 Y5CA8+ <  * 8+"L 51 +  " )  +  *  "!"8!8H0 L$  0R /4# `"_`,0ZT  3& ]0>,$+n ! I$JK  >$ 0"" 847878  RQ ='# X83@0^9. !) 0( # {;0\,$+,$+    $$ i 0 7 " -%$$0 +/   ) $)" 857878   >' #9  ;7:0w,$+,$+,$+,$+   T/#R1LMJIHG $$PO $RQ $ 0 , / Q "  ! .   %$$  $  $  0,$+       $  V  ;     )$  ,00j   ) # )00    @"?@0E  "       0#   XgWX0  !!!             n !022  e0u#  *  06  1HHoJf0  ('('('('( & *( Sb( ( {( (    {|{|r efefijijmnmn@\ STSTWXWXW&&    ?@?@CDCDj: -.-.12125656x&  ) ( '$  *F3%`++R*:-< 0#91  x  -0 0   D% 3<,0&W  0&/0!/0/0 !96:  0/0/0".@  L  " T -2 X#WX"?@"C  @"Y DYZYZCV  8   =  8 X *EO?         ('('(    f*%D X:WX"U@"C  @"C DY ZYZC          Y 4 [zU            |w               _ h"@"C  @"a     !    DY ZYZC 43                      u 4 < /  4       !"!$ %*)( )"! "! ,+                                                   8l(     W hQgh)8e6    # I0.0e +8V ( 96+    '6#(/V l2#Dj `L_`#8{   "*k 8 .+,%  #, /#^  (  $F pdop+8    #U P3OP%8d   $ ,/D:HJ:RTVZ\^`btv (: "Y . -Zx    5   z        :  2     ?  3 /@"Y  Z         .-.-87 XW    ZY TS VU   87 @?  \[ ^]  2 8 "Y  Zct  !? ~}  |{   ! 87      !     &&M   $*+     &k]   * )*    +m4 +0k] )J-4&  /["    * 0/  "$5  M,) >;F/     /["  >6 &/** 0/ ++& _x   '# ,,C  ,*"!/ _x -&"  "?/>  ": 8  "!x s  {   PMjgji    }$@&Q \ o  O5L 3h c@*-8 ='<7%o " 1S $S   9    "J"  "? $ > ": 8  & _2   '#&C "!, _2 HeGH&  T$ #"0&A   &_/ S3`U'#* $  .(#.  ? )14 ' "!;]#!!_/ S3`U* )&K[ ;" ;/"/P @? '5 .- 5%**  "5m | y #)W#+"!O  "= "4 5(K[ ;"  ;  / "/ P =?&n,*`((     GHG  '#  bJJ N   2+ "![ $n,*`(    ( 6  $  &+  7&$IJIJ#%JI&$I JI&$I &(M"&$I&$IJIJ IJ #% JI N? B.A(ABA ('('@M B  /       H#+H##$$#$# '2  =,+('     !      ;N   O`   a r   i z   q+          :!"  ,+  !}A 3 ,V07      " $#$ !"  "!   &%*%&% *)*)   " !"!        #*** *   : .-5(# $#F"* 8 *  25G       8( " " . ^bM7 F. s{! )  :  &! !! $      M  #     46756AS<;<;<;<;<?@?@ YX++++++++++h_ !"!487          +++++/0>7NK/0>7NK                                &%,+2187>=M@?#BA FEFILMPO7POARQXW^]dcjipqxyY        #$ @?@1?@ ?@f1YZYZb  +  ,1|  +   0/0/0f*^ ]  S X* f   `_`2_`_`_`f    ,B POP OP"OPOP     e?) H%GHGHGHfYX +#fYZ' +'  ('( \    !" . Wx\      61/2      1/24 \YZY DA87n $0-  *7J $<g s =  >   &  6 $   $ U\D=F  * $'*D X!WX0WXWX\/! ( (6/!\ $L U \8NK    \! 8\  J G 8078 78T,('('(2  !  ,( TKLK LKLaN      )5,d& a h/T    )*)*)*) #$ 8A F    '      5  n $ ## t8" T  T4 T9     T2  T882 8D  "!+Klk$  !!5    )    --)k2`8,   xwxwx 8-   )*)*   3 6 5 6((((5 8q(JCH = $>(-         8@  8+   popopop08 )*)*)* )*)*)*  )*) * A' 7( ((( ( 'ov!)         08 )*)*)*)*)*)*)*)*)** <A'r, '8765((((  (  'lBp;       *< 8788  dS   U!    '~ 48  , ;    3N   D    ,;  8 ,-  ! 7   !  & ,- C 48 h  ! 3 . h 348 Q   3  Q8X Ww| 81  P      3 -40 >8    8  /0      ` 8 B      . B  ]   8$\       K&2$\  p/op8< 8F 8*     ;8H  XDWXoWX8  ,%'<      $ f   8 )*)*)*G) (@" G   8  p>op8+  + xQwx wx8+ % ! $5+8    8"+    "+ _   8&\       M&2&\  80"8/!88 /0 GH)  n 8 V     , % V    84) * *       k+`4  *8 !    ! `__`8  /0   & ;      8 ! S      7 % ! S    867 '-   "   b1 ,G67 "-8         xjwx8 $/0        T $  8y          $  %y  }#8@        g:  & 6@ XDWXWX8W ;8 6        B 6 8r           r #8B        i:  & 6B   <        %82 # !  hOgh8  #      &(  # u8 ) (       `      ) (   887 '-         "    d1 ,G87 "-8 "     " xKwxwx8 Q           Q w 8") *              ],V"   @?@?@8 ) *4)*     4 (2    8:78 78 78GB     # 04+G P(OP OP    %    PYOP OP OPW!       = 4JW!         f  CRLKL)KF*L J     I      +BAB('   eM>i 7G7CR)F*    h&ghCgh53       E53 H#GH    ><   H/GH    >* 8E787878;+    3  4>;+ pNop$  OTvuSTSZMB&I$ d,-    ij  ip iU+,-  f"eO/  4  3 $&%   G K09JIO/ popIop+   1.aG;c+ 7w4D   QN  c:C?*)D   wx:8      8* 88787878E    !*   /5E pJop%  ?&F% ^Z        O+Z  L"X[1  4  #3 $&%   >D,#)F@[1 popEop,     D;`,  7m6E.      `4D<%*E.      8478 78 78    # */(    POP%OP    (     HOGH GH GH     6  /E          `  LKL*KL J    I          ('    F?c 2C7*   h&ghGgh64       I64 H$GH    9=   H.GH       7*      ! pOop%       ?%K%  cZ        O*$Z    4    #3 $&%      popJop,           D:e,   7w6E .                `3C<%$*E .   !   ! 8478 78 78A    # */,A    POP,OP/    / "   " HSGH GH GHO!         6 /IO!      '      )' d  <uLKL*KAAL J          I      ('       J?g 2C!7<u*AA      h&ghUgh6           X6 H+GH      @   H5GH        >*  88787878E     !*  /9E pVop%     F%R%  l+1            X*$+1   L "\[1  4   #3 $&%    >H,')FD[1 popQop,       K:l,   76E !            g<CC.$*E !           #    POP$OP                 `  LKL+KL J     I       ('   F@c 2C7*         H!GH    6:   H-GH       6*  8878 7878E    !*   /4E pLop$    <%H$  bY         N*$Y   L"W[1  4  #3 $&%   >D,")F?[1 popGop+     A:b+   7s6D -         ]2C9$$*D -      8:78 78 78     # 04*   XWX&WX        PXOP OP OP     = 4I h5gh     "  h  LKL*KL J      I      ('   M?k 7G9*                     8>78 7878K    !0   45K pOop$ !   >$J$ !         Q"\`1!  4    #3 $&%   CI0#)J@`1 popJop+ "   C9d+ D -  "       _2A;$$)D -  #! #    !  8:7878 78G#     # 042G $  XWX-WX0 $     +!0 $" $    !"  P`OP OP OPW"$     = 4QW"%' %     '  p  BvLKL*KFCL% J     I      "###('    #U?s 7G'9Bv*FC&  &     !    ' "  !"     '  " "   "   8>787878K'   % !0  4=K pVop$ '  "### ##E$Q$ ) 1  (       # # #) 1   Q#"d`1(  4   &#3 $&%   & CQ0+)JH`1 popQop+ )   #$$$ "$J9k+  74D !  )  !#%%% % !! %%% % %%$f;AB-$)D !    )##)   )     # *$$*    *%%+   +     +%%+      h  LKL+KL, J      I      ))) )('   )M@k 7G9*- ''&&-     ''  - ) ')-  ) )  )-   ++ !.  (())) )).      ) * ).  4  --#3 $&%  ,, /  ))+++ (+/  **+++ +  +++ + +++0 0  ****    0*** *    0 X9WX WX 0 ++++  6 1 1  ++++ *  0B/0 /0 /0 C1 +++ +    )  16 C1  1  ,, ,,,, 5"   S  YN fLKL*K NL2 ,,,, ,   +  ////  ,,, ,   09B K =ZV7 f* N 2++  x3wx0wx@   2  ------- --- @@   3 P?OP  3  .// /---- . GB   3--- -11     3   x& )  3   ..      /// /.... /N?'& )   9$G  Z  14   ... .22#  ... . 22 +!3<+L)  Z  1 87878%4  --% @PM   4   ./000 /// 0aE=!M   55  //// 5/// /  55 0000  66  0000 6 000 0    66  11 1111  S  ZN fLKL+K NL7 ,111 1   +  444 4  111 1  59C K =[V7 f* N7007  2222222 222 88  333 32222 3 8222 266     8  8   33      444 43333 4 :$F  Z  19   333 377#  333 3 77 ,!3<+K)  Z  19  229   34555 444 5::  4444 :444 4  :  :: XGWX WX:  ::5555  C6;;  5555 ; 555 5    ;;  66 6666 < ,666 6   +  9999  666 6   :<55<  7777777 777 = pPop   =  8 8777777 8 Y6    0+/0/0/0 = 777 7;;  :# =   & )   =   88    9 9888888 9MR&& )    <" K" U 2>   888 8<<<< 888 8;;;; .57)@7" U 2>  77 @TM  >   89::::999999 :`H<'M  ? xOwx  ( ? 999   9 @  ( !?8988  -!? xRwx wx# (? 999   9  L# (@ xPwx! ( @ :::   : @! (  8V78 78 78F@ 9:99    ; C8F@ b   @  :   :  :::: :5    f  YchLKL*KRLA ,:;::   +  >>>>  ::::   >KB ` O[i9h*RA:: 3F@  A  ;   ;;;;;; ;;; R@  B hUgh  ( B  =>> ><<<   < = ]X  ( VB;<;<@@ .   B   & )   B   <   <    >>> ><<<< >QR*,!& )    L$W Z 1C   <<<<AA#  <<<< AA >!DN+\) Z 1C  << @eM   C   =   =???=== ?dU@/"M  DD >>>   > "D=>==  ."DD >>>   >  EE ???   ? E >?>>    EE  ?   ?  ????  f  ZchLKL+KRLF ,?@??   +  CCC C  ????   CKC ` O\i9h*RF??F  @   @@@@@@ @@@ GG  BBB BAAA   A BG@A@AEE G  G   A   A    CCC CAAAA CH   AAAAFF#  AAAA EE H  AAH   B   BDDDBBB DII CCC   C IBCBB   @?@?@I  II xwxJwx ( I  II CCC   C Y!@ ( JJ DDD   D  8W78 78 78GJ CDCC    < D8GJJ  D   D  DDDD K ,DEDD   +  HHHH  DDDD   HKDD@   K  E   EEEEEEEE EEE @   LL  GGG GFFF   F GLEFEFJJ -   L  L   F   F    HHH HFFFF HM   FFFFKK#  FFFF JJ M  FFM   G   GIIIGGG INGG M* N GG G*G .*  H.GH GH GHN      < V*%N GG G*G  .!*% X;WX WX WX WXN      * = OHH  xMwx wx#(O HHH(H  .#( xVwxwx wx#(1O HHH(H   .-#(1PII N* P II I*I .*  XKWX WX WXP            2 W*%P II I*I  .!*% XTWX WX WX WXP      )  ">  QJJ   [  " Q  J JJJ J"J 1  "  hXgh gh ghQ  =   4  !E i$ *"R   JJ J*K  -.$ *" xewx wx wx wxR  ?   A  QR  KK W*+ R  KKK+K !*+  HGHGHGH6R   QP  @6 j*+/S  LLL+L ! '*+/ X7WXWXWXWX3=S   RP (   E3= `O_`8S   LL@8 & :# S   L L    LLL#L $& :#  X-WX(WXWXF)S    SQ +#F)TMMT MM M*M  xSwx wx wxT  .   >  6 Z*'T NN N*N   .!*' x]wx wx wx wxU  7    H 'BUNNU NNN(N   xPwx wx wxU  ,   ;  6 Z %(3V OOO(O   .-%(3 xZwx wx wx wxV  4    E $BVOOV  P PPP P"P  z  W  U   P   ] m$*$W   PP P*P  /.$*$    W  ^   Z  'i P9OP*  W RPV a)'   k*-  X  RRRVVVQ-Q V  !'-   pFopopop@.X     WU5   5@. g'$ X  RQSSSWWWW ALE$$  *& (%  X   Q Q    SSSWWWQ%Q W M|&'& (%   bP:X   WV E   3P: pghghghgh:             F?%.  * /  +  <#Up     )p ababa bab`ax$ !2111** A "  `p !r, )! !l2 / 3p aba beb ghYZYZ&  ghY     qvuv cA     & ?    >pghghghgh!ghghghgh8gh       `K.-   KhgXghgT9hgX+7hgX 0  /*Y\ / 5  J6 ;5GHLBK&M!8 I    )p  ghgh/ghghghgh)gh|       n]:U   :):="!:A-. 9>=. -> 9>=.-. 9: =:#  C  X  I?D :  8L5t#Z/)|     2p YZYZ  gh]E F1YZYZE F!Y1 $      3    1  / 6D4" i ] 1     !   T X p aba b34eba b   ,  6%       p   ,   7 3^mA.~pabab ababab a babababababa bababababa bababababababa bababababababab aba bababababababc dT dababab #$ )*'$ % %%%&%&&&&&&% %%%%%&&&&&& $$$$$$$$ &&t7.                     "!  $ #& #  2@"p'('(abeba babeb>      .0!    > ,p  ababa bababababababe ba b3a    ,,  "B0             3 ~p  ababa bababababababe ba b-ababab.a ba    ,,  .-0>7NK0-jB=(            -. ~p  ababa bababababababe ba bB   )*a   ,,   r)             B  wZ    =  QRQ R  QR  &QRQRPQRQR+QR+QRZY    Z YZYZYf /056     => ~} " MHAB    &  -   6      7',,    +=0-     4U   8&C F   z,&lUX.\E =    &  P  + +   X9WXZL   ,  Z* %Z, "Cn"!I")-"!5"Cn"!++H"("!I"!n7+8"$+`:L    :9R  C  =bO N  I     'S   Z  C  ~ :9R  C  =bO N  I      S   Z  C  n :9R  C  =bO N  I     'S   Z  C  ,,} JI*@' &  m( ) L  M    ! Z  C   rq:9R  C  =bO N G n ') M"!,, k %B7 6 ?  > k,_!Bm! H!(,! 4!Bm!  H!'! H! m+ 8!# h   N{   $ !  & H?*Y:  :9*   !2'( #>'H1"    " &%   7 & '  .  !  . <; ,   !!4'( #: =$)J1$    $X@>)`   8$787878l   / jO]SSv#VR7   "!* F F#" F  FT1F% F&1FE @ = F FD6& 2 &=>5 ) 7 - 5A (! )A 1 , ) `B_`?     +  ''' '<78''+' '6F8     +  X8WX    00>7NK00S9(     0*/0   ''' '      hXghR    +  ''' '\'+' 'OZLH    +  X5WX    00>7NK$J(    &&& &   h\ghR   +  &&& &&+& &TYPH    +  X7WX    /0>7NKTL(    &&& &   h^ghR    +  &&& &) ''''''''''('&+& &VYRH    +   }/0>7NK  &&& &   hdghR   +  &%& &) &&&&&&&&&&(&%+& &\YXH    +  P M/0>7NKT  %%% %   hMghS     +  %%% %%+% %C\&d    +  X;WX   4 1 .0>7NK8P!(     %%% %   hCghS    +  %%% %%+% %;Z&Z    +   .0>7NK  %%% %   hPgh?    +  $$$ $$$$$$($$+$ $&H!X   +  h3gh,gh G  -0>7NKG  $$$ $   hugh gh?     +  $$$ $$$  stsrm$$+$ $L  G+d        +  XJWX*    C-0>7NK r5    $$$ $   PcOP 0  <   0% 1%0< ### ##+# # X0WX    ux,0>7NKqK(   ### #   _               +  ### ### ###         #+# #E.::          +   ,   + (      ,,,0>7NK0 ,,,,0>7NK0 ,^ _""" "        """" """" ""+" ""     (  " "\. ?6E %  ,          !"!+" !#&'('((  #  '% ,         +++0>7NK0 ++++0>7NK0 +. /""" "      """ " "\  ,            """ " H/GH"GH  %#  J   pYop;op7x  6<6A*>. # # v?x iji jijRa`ij+i j< ))) ))) $O))+) )NJ%X  R+  @N?@?@xijijij#ij N ^] t;:#  8=7878xijij^ )))). xiji jn )() )x=a`v 1  /= XHWX xklkl/a`k ~  /   6/  pVop?x iji jij2a`ij+i j ((( ((($ ((+( (.Jk  2+  878 x1 % 877878xijij (((((  ((( ( #x)  @I?@?@xijijij ijijij i +,12?0  x8 ,xF 6x^ N P$OP x:       `4_`xA 1  (4'(xijijijiji efDxi j    j7r(  6O;     & paop?r cdc dcd=[Zcd+c d> ))) )))/Q))+) ).Jv  =+ r1L %rcdcdT ))))rcdc dd ))) )rcdl 11 r)t rcdcdcd $#r+cd   +rM  rI   pFop r[\[\7  "  ;) % zrcdedcdc d[\[\*[ #$  2 F8 * rcdcdcdcdc =>rc d  (@ (()Z   x1wx ($#$#(x   32( '   c 0(   ('('(' (' ('('('('('(' ('! ('  (' ('R    12  12 '   .('ZH)( ' !$#~Y AsKm W/b   WX )  X\&    \\& XK  '*R. EX\&&>r\&  <,K( ef+Q38 3 2 34+WX QB  i  G<  'g ^ # ,&  '7UG5Y<C#51-          !          .ZH)     (+,+P$#, +,+,=;, +A  ?B *$  m*b  " 5 J  -O  ! -9#:+P$# ; A<, <><D   $ ($'( '('(<    ^ 2/0)#*'(*'   @g?@*<   )x GH$  VU cdmn!*3)?L$7#       `._` <%   0% > 1@<    :    / SVUf.-eh   }!"u lkp! k>>< :     / Z7NK  %   |) 4787   .121|m n (10>7NK0 1$   |(m n "%&%    |+    |m n  10>7NK0 1 $    |   |121212OPOPAH  , B #q|12| ^b8zyz9?1z,       , 81 pjopop opb\      2e$) hZghghbQ +  #   % <6Q +bb b+S T     +  [vb4S T STST0            "  P   ( 4  0 xwxwx$wxb    $      -   p8;1) b.ST @?@?q   /0>7NK0 /&     (+K" .     q j=R QRQQRQw|  $-(' ( w3>? =Qw ^~/ ,!& f     k    >=      &9{$+> :  <  3 [ Y    & ~qrSo p65!wxwxqr%6 56565op8  +   R       +          8     Tj$> *% ^G }=S   !     %     8 ~~ $< x w    ~~$$$~ - *2 #X   W   ( / 0 B(*  hEgh#ghd UVU V:wx wYUV0        H    7     A" " V'"'+(   )5      Y0d8d:    $':dls dW XWX/>=UVUVUVUVU VUVUVUVUVUVU VUVUVUVUVW XWXW XW XWXW XWXAWX{|{^W X WXxU&VUVUVWXe         *     ^QRQRQ "PO*+    $ "              ef_      -       &POPOPOLMLK+JK)   U4 " !!C3% )n !F9 g1 &  7+ZM"3=]. &L^:.H>U /                    A  x   "!e (9'('('(dV       $ P?OPOPdU V1UV     0$.  1 d < ^{|{^C U VU Vt <yz[] |]^r]yUVfUV#]y   #-   ef_  :Ba       @3 Dab 9            l ?: ( 4 ' >(lH2B  0"   C    t  "!r$ #K#  X~WXd=MN(MNMN +*U =(d2 & r0"d9$:, (   $   ,& 0+ +$, pdopop"dD9$:= ( $  Q =&  "D$= XZWX9WXIWXWXWXWXWXNd '           $1 :!  -   H+GHGHdT  " : d   `l_`_`d U V UVUVUVUVUVU V1UV     !!" "  C      1   8!78d UVU V !!! (  d UVU V !!! !   HQGH-GHd UVU V UVU V UVU V !!! ! !!! ! !!! !R       d @)d4 (" @?@)dMN< (= 6< ( ( ( (dUVUVU V d U V  &   u   F      0     & <z#         F                   %            Z (      /0     %    J FCD7 0-('(#$7-.$! &_`73      5% ):   1    4K( $,*"32#*         %Z(   "! "!$#$#&%('('('('*+%F  F /. -0 -   +   hLghFY   / 'F:-./0/0/.-.'-   OJvo 658 = /k $5$:' F2/0-.5/0   pm]Xpi T25  H9GHFF & 2  F        78 78787878?7 #$#$y zkjy |  ( J         3 F    (      %  '*   .- 2 %    (      FK ;. FB +%   uF  VH  1A^".   > 9, !(LT`   ^Kp ;!*~    ;^ ^,    ;    ;     ;^#      ;^   ^3  ^S C6 !2 H5GH GHGH/H9 :W9: p      Q  W  *H    + FI# :H uHC^I ; Y1; <;<.;<;<,;<;<; Yw9:9:; <#     FE  BE <;  8;      ('  $' ( .1  !   !    '  "   $   +           -? % @   :1 % TF P*'G 3=E! ! C^I  1  ., w"!"! # H2GH GHH9 : 9:'9:     $'   'H9 :     HF 8 . cH  5    * HH ($'('(   L8RT  0     $87A @,?@?@ LF & - L~}~ }~})~} n  0/ "N 6 6  66'!: -  HH   |# +=0        8 I` ?    ! ))) =9A  !) 4 >))  ('(L  . / / L        !  (5'( L5     /5L  L st    L gh   L? @*=>=>?    "#89  *%$%     +0   :=; ) d'       *  LB Z  {|{|"(6B Z e2LH# .  "| H#  QL?  0"=$?  .L Z     )-{ &1 # Z {+ Li= -0  LZci= @+L ?@W +**A"5 W L$=>=>= >=>= >= ,,,0>7NK0 1 ### # 4 $    =L!   9aL    ' 14+HH,+2-)               N@ '            POP!N78-p  .-N,jd^NXR N*A B;A Bm    go2067OP@y C 58?# ! ' )/    Ht+5  * ; mN$ \N?@?@?@ ?@?@&?@?@? @0?@?@? @787856.?&B-onoh[dST ''''UV[\VUVUuv&l+!Bj.7H    &    0 . - 0N?@?@?@ ?@?@&?@?@? @U?&B ]^YXKN=> ((((?@& Bj%5    &    U   (N ?@?@?@ ?@?@%?@?@? @U?'I >-. ((((%/0'B'DW    %    U  `_`_`N ?@?@?@ ?@?@?@? @?B 561 &((((((( ( ?',&         `_`_`_`(N ?@?@?@ ?@?@%?@?@? @?'# ((((%  'B'd    %      9N8 I(&.80K 8&   ) !  = 0 8 xrwxN ?@?@?@?@ ?B  // B*    mIN  ?@?@?@>?B    , :+ >  pAopopopN ?@?@?@<   3< PAOP N   ?@?@    ''''     8)7878N ?@?@?@     BN A BA B8   C(&.80E 80   ) !  ?)0     8 X'WX N         oIN  ?@?@?@@?B    , 4+ @  p>opopopN ?@?@?@<   6 <   &&&&    N       w4.&0<"y%  + W 4  N ?@? @F?@?@1    "(>   F   1  hjghghghN ?@?@F?  MG F   %%%%  P 2gN ?@?@?@?@?@ ?@?@?@ ?@?@ ?@?@ ?@?K ?@?@?@3? @? &&&& $ %%3% %-            3  N+  M(&.80O   ) !     01+ N ?@?@?@?@8?B   a* 8  |IN  2?@?@2?B    , =+ 22  X/WXWXN - -   ####  X]WXWXWXN ?@?@? @?  D"  N_^J ' 8 D((59'G_^J XWXWXWXWX(N ?@?@?@ ?@?@?@?@?@(?'  """"'?        (  P[OPOPOPN ?@?@? @%? 93 % pPop op4opop6opop,opNopop(opopN ?@?@?@? @?@? @?@?@?@?@?@ ? @?@?@?@?@?@ ?@?@ ?@?@"?@1?@?@# & +" """""""""""         (bU                    "1#X      $   X   *       0*/0X=0 1 0/0 X  6       X  <  OPO   X  R     hghghgh X  Z   12  !  !    %A[     P)OPOP X 0         0  XFWX X                   X/WXWX X <        <  XLWX X :    0/0    :    BAB   @-?@?@ X 3   TST  6 3  \MX Q*    fef' %    # Q  %    0#/0 X    vuv    v  t  XX  X      0/0/0XE  . X    X   X   hghghghX                  ! !   CU! !      P&OPOPX        =    XDWXX        niA        X,WXWXX       I    XJWXX        G     @)?@?@X 3  ?- 3 Y7X 8    + '  &     8 (X          X P@PP  P PA B     PP P= - P   (&'('(P8     V     V.]' 6, POPV                     HQ < ?  bNd7MN  '( 7d  0/0/0 4    0/0/08  L    ZZL ('(' ' &%PO (('(&%&%& %XWXWX W*  (*'(&%&%PO@E:987:9 8 /  :9D C$ # NMN%M%')!%  NMNM(N M     NMNM|{NM  NM NM<; @?@!RQ!!RQ ! dc X!WXdc     |{  |$<   ! ~ }       ba   b a    H'GHba   "b a        bU      p op   ) +++++ + + ++++++++' !                ,,,,,,,,,,,,,.  &%,+2187>=DCJIPO VU)    &%lk\&X}  ~/i     V:9    VUVSTS+ ^]^[\[+ 9 *,9    \STaW+ 3vA3 "  %:  *  2  "  !& !"!8 (   $ 4      0   , %&%< DC+        :q % % % % % % % % _ Hl!&!{!;!!!!!!!!!t $         3   $ # #/&%i  (('('(  !"!"!"#@+ ()'('(  1212123A, #   0  @?@  L        >      _ G2 50Z{  ? .!>  l  0/0x              '  (   @#?@?@  2   *   *   @&?@?@   1                                              \ Y      4 +      % 4     ~ }~}  jk     B @  . x(wx,wxwxwxwxwxwxwx wxwx6fekfef efe          3        ,' ( 7$ !b6k  )P " _ " @ 3"W. 9tsfetsfetsfe;f eL/)f eK    #     #    #/  ?'' 5 @ !  4%2 %201&E 9    ; L/) K \ fefefeI  1 ( I2 *B " 'P"r q1vuvuhuv u-vT  =>=>>= >#9  1 - p$op8op opv    C f%  =r q!2        K" = !   0$/0/0/0b     Z6 Ln md1O~  $/     " !  #   "     3&  oVNE(--6 L dO"r q  u v ("   o p  %G0j i)jwx w(xw     >-B 0)   (   7   9 #D cn m   FE FCU XWd2# & 1,  uZ    !" )  %  ,+. 9,E,+87 @+: I @?@?LK|('H('%-&#  K, G D E 7    *   -  *$*" . xiwxwx J       E 1   VUV Uf        D! \  $ ,'   T!: !@:? G, !:  (Q'(,'  xdwx ,  livS    Vg -$K   MFEPOP ?6E>OF1>Y<  8w788   W ^]`781 2 afef 34- .-.-3T*+#$FQ(     H@GHgGH9 3%&  1)(      9 c8<$a7   < \   )    `A_`  4 , !$ hfgh    ;'?5 ! P:OPOP  ('(  a< !  !  @{?@     hp !  6' 0/0/0#    (#   8.7878787878       A 8L78     # @!? ;l        &*  R20 N'64  6)       22^O  ,    xq p'6 K /  L              '   + N C  ea"> "   %     #9      '&    STcd =>  *)+   *' 85 7U"  > bP ]3*G#     XWXD     6"P0   I    !'   G:%8 ' Z ]\Y5 D  C   4B  /B  )B  popopopopP  O  >        !    E88,1 1PO   Y*P    ~~zy jipodel idejk D C>$6%=         * & c | NMTSJKR OJKPQDELIDEJK$#>=D C " !        5    /I  lS&%     =       " "& c    0&(*^   *                #6 = #%$J.    P OPOPOP^[x   +< P5OPOPOP`QRQRQRNMNML^]^]le   9$  `QR 0/0/0/0/0`@f     $ `3_`5_`_``    ?6 ' ` 4 @     &##Y2 iw; `NMQRQR QRQR NM)NMNMotP( ' 123$W^OX     #   o)z'S %  )     ('('( &  ( '( '(`$   P'OPOP`: ' m nT bab_ 2    1n oUE$/ j i< ;j-ji v        itsx)*/6 lkn   *    #  /    <     ; -  hmghghghghghN O     ? @   C  "(IN O          , \[@       % ux   i\ @#A    @`   h8ghgh`+   +   )   6 . 0\/0 /0 /0      * T-2 7 N         1$ 5:96  A&r7 N    x0wxwx'           Z'  8.787878(  C      C+(        @   0[  9              vN.%)[    9 8   Y      F)&=CY  pKop, ,< ,    O "B > H          !~@?>= |j pklkjngY( "K                    tyzyx{vs            n{|FO           "!"!$#$#$#$#"&%&%('('*)*)*),+,+.-.-.-0/0/2121B 02/0/0 /0? f      I?  @?@      2     2 popopop >A           > $3k`    I sU #  >A   8U  ?      L  @?@   $ . tq (U'(b0'  & &&  k    /      | ,+,7    5!-'/   paop    *          0!'*          Tk   iR      tM& 5  -!B    , Y ZW    $ X0&  - !  tV LKLQ  4'     5!)$B 4@ St   :'<3     !! / !!! *8 , 2121D    $  $ *:'.8  <?       ^  - pop#  <    p$op&" H " ! Kr qrq<    U#Jxw#x wx"^   >9 T 7 6 &>) R J# " 9 )  Jd   E4   F/83,/  &    +)$  ,   4+% C.)  J! 7   -! .1t+"    @ M   hg} r pYopop?opVop     0       , >k,#  $N  /   ! V   }        b "  & pKopopop   M #  ' <"%* M     XJWX WXWX h    /   # # +! #; < hPghgh   @ # $!- @; < # $ # $; < `L_`A_`  6 /0 587 0 /074 5678 5 '       6 /0 587 0 /074 5678  XGWXWXWX   / , #   n#;  / ,; <r  $   `_` @  G 1 6    6!9L $n     >= =44  ?4 Y#= a#=i#4e#4r    / , $ # "  >= = 44 XIWXWXWX  KuKL vuL  0>  L w+18vLKL vu   6(2 7 8       1(4 %V2 D  !@'3 +(2 D ! P1OPOPOPJ    "  Aw90|{ | {Lts44==1: (dcdcdcFkFh  #$       &   #4#4#=3333#=#1%         >%   -  !@ !?% "6#@?@?6 ! -   Yp  8   ;*< ( B 6''"\) %    !  "! $#4& %(-'*  . 20 *  <?BA/>.-GJKF MP 8  0c f m    C  44="#&'*=+.1/:21 434(3658787: 9R<;@?@?>F?kDFCB 3h `7_`$_`_`dcdcE    L(Edc  0!/0/0/0$ $ pKopG'vu xw j*  3  Z* )$ #,c67'       @/?@?@?@ 5    9 5 $     $  %. ! .0      9'"03): $ %        ('$      1X{-jiji ~( hghgh ghghdcdcdc         +   >  '%K"  @3?@?@?@dcdcdc+          1"+  @5?@?@dcdcdcpo p           3"   @7?@?@te   i     STmwXjG!|{1|{|{@|{:   %   3      '" &    "   "$$%W>! VH_ $ F% J (! ,#C !! ( 7  a m P  % %   2 .   . x4wx-&     1 &  (Y'('('(   ! K \,'; (              A  2@*      m #' #I*{ J  C #K*}  2  E P*^J  @ H^M* ' ' "'3>]L &D< |*c /0'    ? (@c /+  2X  $C %%>& } So px &     T2(A S x g    : $!G {)=W,+,+1 / " >#  0#&    * ,^( 9-1 =;= W h  *  J 2/  &J0"I  43. 12   0+,# #%  $ 4<  "+  N G n  P   _ r 0 #*9 [iR| %*),@ 12#& / LMrSJ C *74G.R i}    .) d    &3  <3}0  !A  0 0/0/0  " % xfwx wxwx^       =$7^ v ?6 + +,H      2 5,B,9 0 @O6 5%    TO % xgwxwxwxwx` 2   * %*`*1 817878780   6$0 =7 4X xwda       h E9d  C  nwx: 1P R@1.  7  YJ%%h  "+03    ,41  $ 4v    #      A  Z  e  H      S  I tklk SJ#4  T  E^ Y   &eB Q24& o!   " 8  ,!k I O , M :@.      G+"/    3  4 $ v#AZeHS @ ,=1&%       ,+,+3  P   #=e  a d c f j g he  ( ; "  &  s  0Y  $() =   3P =    &Z        -    .V')% @-?@?@?@, + $       $ h>ghgh gh gh, +,+S  #  D  2 S   &r       *{ # $    &   \ Y         !  X4 /# 5   &, +,+  g\]\     ..    3 7 LE    % %    p_opop&  &%%'        xHwx wx&a        *  (&        )1[(   4  5&       t4h 1&G  7 ~eq r@0 &} ~   A  (Qe @ ?/|0 .  / &q rqr r  *)*)=q rqr1  (   0 ;lA H   '  . m z%  4   r-G`  r  =    X;WXWXWX:WX$WXWX  #7$- 4#+% +3  ) Q 4 55dt')   f 5G  +8     ( ,0   ' , ( (! ! !  /! ! "!  7$  #-$ B 6A  ('(@[   P"3f      Q"  7#/? 0       $      #    :  $ }x{| '   -  + v9: ' 0I ^ z y-A0     5  N QF  ]& 8 { -0$' &E;[8'86  '6  L! `q$  /!V$(+$)",4A3  0       #,  878787B  [ &/0: 5&4dc7 b- ),   I `   4<)7IxYPd |     &  !  :    @5?@6w    P   Y )0 % #Xcd_`u #$  4      ,+-PF 1 $  X.  6.  6  5    _ -   1$#2  1 5    _    !W xV  C(IZ2}HZ+X          F          $_     _ !!4@   'U2>@Z a Z.F       }=  ]  y    c    F   F    F % U    F ; +B BBH  &B,5)A*)A & )A"B < *)A  =  ]  y      c  f =     - "       2   V     p  #  # ae %G-(# .-.-&   +46f .d 2 2  Ii2.   6   lf  V "K*-  ! 5LI    _HAB=      _F9  F{   F  + 5          X !Q L BR;AF(JZ$PZ=L)A# (  0i2     _  F  " ! $#V&%&%+%m E E @ hbgh  UVOP UVOP+,  `N_`_`_`    %   1   4343H   1 LUZ  '      ( B 3   -<     m9 "$ L!F5 m1       5  B0  .   1  xpwx  N   UV  OP UVOP   ,+/   ? *   *   & L*  @?@'$ $ $ $   @?@?@?@?@?@?@?@=^]+^     -4   B-=+  F E B A  adcd      A 8*B/ #Y     hgh    8  \  nx  Y ]   @2 %     B       j@=              5>   < 565             ,"/ , ) N      0%GH   "x.   ZP 7K;V/$C %G ||   @       " ; j@ < Tl      '.    1      !  -       ( "   / " mAP F  0     (X,,1P   HO   5  &9r HI   v  3KF&$D P OPOPN 2   WXWZY WX WZY !WXWZY $WXWZY EQc\    +  .  878"   $#  ) ,+  E @ %04 % $ _  ,                 9B S     878578787807878   7U H   #.7K .'*At7GN  ,    "9+2 N0Lz_P ^..       <    "t          EF @ AJ KD E      F G    :               :::::  ::                                                                                                                                                          :  <  v 0::::/H",#&,'*),099 9  9 9 9  999 0/0/0% $&*.0248:RTVXZ^bdfhjlnptvxz~ POP b                    HGH     4 121212                          0/0'('('(                                      POP@                   HIGHPVV   $ 0J/0/0/0z*   '   $    elDlD lD Z    EB;  !  cA$G 5      Z "+ail $!%0'(   +,   $    & $2 2      !']B,A*         Qn     # 7-  9B      "         ~ i |}~{ d 9K0   p2op op0opopop1     : -.- 4-S $4   pFop op>    &&1 !  PHOPOPOP&popoKp    ' :&K  ) $#.%{ |{|{|#0 1 #wx:  &D pq pmtsjJ8 >D-2' /V" 2  8 r7      !" )* J  N W8 6n[%5Q +)& R33333 VUVU^ ]VUVU\ [V _ V5UV,UV,UV,UV,UV,UV  (;,3     1   ' !   . (   @ <"  /*           # ( #%*"   ; HM %% !)HGD  8HJZ  6 > HPn KNM%>?& "+ 5H ~HI   XWX H       . HE  6 zH 4 N*H; jg -/ $+; '    . ( 02/0/0HS   9 #( x~wxwx  : l   #2BH'   0/0/0/0H+        2 +   @?@4?@?@Hc "-      ]gH ^ ]^]^]^]  -     2@Y%8%     HGHGHH% ,% X;WXWXH1 .1 @?@?@0   `u_`8       8  88   z8 / 0h$         ZY B)S  h$@]@@@@@@ 3^   +2 3^ 4 pE$          % %    D   > pE  E    &     W  Q 0 /?                      G L=B " +!%(  JQ  ? C j   hQ     * 7      ,   <?"hQ U R  u          5                      # "  & %      ' 1      `)MY| i  )!  5  RQRQ R!Q RQ RQ6   WZ     WZ           7    "6 [O            7454   F GHGHGF  :A% I+p -  '                  {|{zyzyx{|{|{z%34 b&%-  '      HGHGHGH 6     * <  hXgh V    *V  v  h 9  2RS  ./ <= NO$% VW 89  DGJK  !   (+ 25 @A                U       C  w-1 h 9 hghghghghghghghghgh 0/0 /0/0/0/0 /0/0/0/0 /0/0 0 /0/0  0 /0/0  0 /0/0 0 1 ? `_   : [  [  [  a   b=\[\[\;!d                     ? POPOPOPOPOP 0//0 /0/0/0/0 /0/0/0/0 /<0 `_X     !^0   < !,K?          Q @(            PO s K =  B* $=".     J  4 p opTopM   -  B   M  887878)      )  y#U K8    36 #UP  .    `H_`-_`'$  $ " ! ' xwx wxwxwxwx1wx wxwx wx wx wx wxv u:          !    ; - I  k  .+  "*'3(' ( &/# "! %*3.3Md, )/=/+% &.+    l9       S:! l9  cR   >  '        -cR D  % #   =ZGPO+#   !  (& "F (5 }I2      >  F  !1 5'  )2 ( '('('(N   -': " ?<;<;<;<;<;<;<;5<;<;< HGFG$ -$}tA18     '1 l?   5    Z2( '=('(' &%('('('('('('('('('Y( '( '('( 'G* X  _l}               9>   Ib *07 1 A  T+  )3  y'4'2 =        Y   G               4D  .# 3&  " D4^  ST  % f2/&) >A &%  BE "% :=FI *- !69  25 .1NA21++=+++4++0+++<  ,  $'#1   H 4  E HGHEF      4  4  4  4 4 @?@ ?@4,    8G78 4 6   9*  # 4((  C64rqr rqrq      Vrq r  rqrq?rq rqrq            /  2          +)n N R         V    ?      @I?@?@k?@3?@?@ ?@4 rq  'rq <         7 [D,4)   '   <  H?4r q  Crq    ( 8  C  40       (4884!! (8'(4(       1(  . 4      0 E 4     ;   T  4    ,OVk     o4}   q    / 4) 4-.-.-.!4 -$. !0 $4H    C,  H 4** !   * !    *  ! ('('(4&    & 4      0 /0/0   \ 44     + # 4-.-.-., ,@ !.,  ! 4     POPOP4& " &4N '  !   ! 0  pOop4-.-.-.) )= !+)  ( p  $- g    4         0*/0 /04%    ! %   (4   $|{(  %* D CDCDC%D-   % 8!7878 78K.    0  ?5V     .=     m5   O*# HGH@GHdGHRd      .( 1\<"  -_  VW DCheFUP cT XWXRWX    >; -( 9*#_1  POP H 7* '   <Q"K    2t)~U   Vvw  },    &/!}k% }k% `Wk0=#kVE.+kV=5 S7f-T/k (! +&c 7   /  " x #v)\Or&     80& ")./"+   b    !IQ     VQ  Z%+  A  V ! g L' (Q& RQ)  Q& RQ 1$Q& RQ% Q&rw7X# W C  =:s!IQ  `_` _`&_`_`       8E ('(_'('('(   &% ~w  &  \?"B    \ `  &% <5FCDC!" & ] A    9 fs    R *%$ @5?@?@     1    n   k@ -       U9>ck@ , " < #<  21O )    NT#"'T 6O             J !,$< popopL              C  L  POP  h0ghgh * ;   /--, , +         _  v           q uP  %||,+          ;   S#AC  ),c "  F  l$                  TONM 1 :           &% :9          $                 g               '] g @?@% -:-     !*- 7  :  {xwxw|G 1  :  }ry~A ANZ:34343'(+$      , md,    ,md}t}t , mdS      ;I;Q:$F7  W           +    8'7878:P   .&  & 8:h     )     P3OPOPOP      !  H=GH-GH:"$    ) 4"   H.GHGHGH:^     !  XWX WX      :,       ,    { [S(7,  :H Y          # > 0H Y [ :   `] ' h ;0/ /(   ;6*%/(A</(GB/(MH#/("!$SN)/(('*YT//(.-0_Z//(5` -%P /     :  1$#.'   $ #    '*OS1(   :/ (   &%   ]  ]  %%%%%%%%, & ^]^  =3u"                          : 3(4p#  %   a  a    $bab? w M (_    %W :9 % "X :       $> )2 x,wxwx:@    P%OPOP $  [D:lklk1 / l :   a   a      .        Cbab .5.A                         -  R     :      '       #'6/; j< 4:, lk*lklklklk    ]                    P     ?^>k^.  t  *          :0343413434\                 1A:  .#   @ pop:            &?94%  0 = R0IJ"KLKLKLKL<   "!%L ('       3  %/1c 0" @0?@?@?@RJ        #' Jzy,~}6~}#   }   !    4py     ,6  #  |`    #  !8 pZopopopop}     DD&@?>   sv_`_^' )! 9 D > ('('(D-  DN   - q  D 6  $    s e^=+BG  fDC+D      '  UV LL K          aV V K4        +%   2      )            % !N'9 Tp?@ ]  !       !       3   z?`3  \P   7f3* Irc+ D HGHGHGHD2              G Avuvuvu vuvuvuXvuvu$           !              c'$EJ#G A      X   ^ 'S. G =:vu vu vu vuvuvu{vu@vuv u vuvuv uv(lvuvuvuvuvuvuvu    nm lk ji hy|{|e $  |k llk    @=* 636 3 2MP78 /0  [  78         5 P  125?@ghijklme  Dv&f+!:   {  @       (l     1  8%787878?.      @?@?@?@Bp  4  \   !  } 5      !Z5 '  h(ghEgh " '       `6"" ' pPop) )> !+) ^.X"WXWXWXW"X"WX(WXWX"WXWX4WX4W WXWX1 }t   }t }t }t ( "(     1)DA,VA. "        ( (     yp             &&2p    xwxwx{ (        =   P 70{ () )A !+)                       V5+ ,% +,         *-5%    NO  a    !  P1 ! 02 a h[ghgh-+ ,B+,       * :)!1-B   ~'=  B    - '=       ) ) $ !  x_wxwx 9+ ,'  +     39 '    Nf +,D+  +,            PH 4! G=!  D    h\ghgh,+ ,C+,     + 9*!0,C                           ! ,       , q      <  *q 6=X"WX(WXWX"WXWWXWXWX   }t  }t    }t             C3=          1? xwx-wx wxJL            ' A      p3opopop opJ,aa~ iji  eED,  `+_` _`JE   -  H%GH GHJ<   ' J#   X              S #  X   o YJ&ABABdAB ABP$         {|y| s|    F <14'&d   P       RJ"  [ VMNMN   I "  pVopopopopopJ~       N!GBBBBB BB BB J,    >9:9      $$$  ; <   ] .!+ " ,  B  5 S J1   #            !         U1  XJ     WZ   [    hghghghghghghghghghgh0JAB    1BAB A B-      CABAB  a  [      E a  a  a     bababN\b~          -       C   P     >U   ' > 4 53(  XEWXWXl  ](D   T T &$ y1. 1.  (        , T                        H ,TT F   @U?@2 1214,3        ; ,              ( X 3    W   ' 3 a 3    `   .  3 7 9      '   4 7 9 ~B1     ' , B 1    /     [          6 [2 1214,3       > , t    0     s   / 0 *  W              R * W F* 6! *<         <     -!     |            1 #   '"+2  +'(0  h T     g ( T- xt    .   :t <*        *    .    -- L4  4K  ( 4,  ,22$ //!# ?  ]  # ? 8C782 14*3      9 *      " }t _!<!      """";<;$4 ) qt}t}t}t}t:  (  )'%,"p ! #            !"!" '(    * () . -.-0  %!   :      "VU,VU VU     WZ      ",    ,         ^w popT U  #$,T" V  #%, p{op8   7 1 %H Z  Pr  P pzop   7 0 %G   P U pvopT  :-  %D XWXWXN0  (W'('(N    XWX STSN M^ ]L4 -    hOghghghN 30  a  bb/" 3 lN   BH    "I)   BNjp  X#WXWXN  P^OPOPOPOPN        u"4*    POPOPOPOPOP N   <  a}     Cb/`6   <  aUXY   }  Cb POPOPOPOPOPN    <  a-01  a%() [Zibaba^ U  nCbab/l9           <  h ghgh  X~WXWXWXWX N    7 p [!r IPWP aL C  b=\2K/    7 POPOPN.  " a:76$         Cb hghghN3   aron <E.56569 DE6=>=>A J  1Cb = a; dmV]^]^a lm^efefi r  YCb  R  N -  /21,+   "/ 0)J -   9  N    u [u v\1    PUOPOPOPOPN $ #$!   4* P;OPOPOPN    # popopopopopopop N    w     a   b"F    w hcghghghghN O  a b~/* O  N    c      "k;    c      a     Cb  a  b XLWXWXWXN 0  a  b_/" 0 PJOPOPOPN .  a   b/" .         N             >     : [  [  [  \[\[\; "F                    >  a  b     h8ghghghNT   hPghghghN 4  a  bc/ " 4 hghghghghghghgh N    K  a  a     bab/D               K  a   b     h3ghghghNO  XWXLWXWXWXWXWXWXWXWXN       f    a       Cb"R                    f  POPOPOPOPOPOPN     K    a     Cb"A            K  (;'('(N     )        hfghghghghN R  a     b/6* R   a                       Cb h6ghghghNR  hghghghghghghghghghgh(N              w    a      ;        ;      :     [         [         [         a     b=\[\[\;Cb/u                       w   a      b   a      ;        ;      :     [         [         [         a     b=\[\[\;Cb POPOPOPOPOP N    <                         "^3    < hghghghghghghghghN=              @   [         [         [         [         [        \[\[\[\[\H=                    @  hghghghghghN     A   a         a         a      babab/}<           A  P_OPOPOPOPN   5                 y"<)   5   a     b   a                       Cb  hghghghghghghghghghgh$N$            a   [         [         a      a      a    a      bababab=\[\r$                    a             hghghghghghghghghghgh/N$-         a           E a  a   a  a  a     bababababN}$-               a       [ \ P!OPOPN      POPOPOPOP N      a  a         bab/I+                POPOPOPOPOP N    <  [ =    \2`6    < X^WXWXN 343H "   M0,  " pbopopN 343H #   Q0  ,  # PVOPOPOPOPN   D  ]   ^E$,2   D pyopopopopopopN      \     "c 2BI      \ X%WXWXN9   PlOPOPOPOPOPN   ,0       8+x   ,0 XWXWXWXWXWXWXWXWXN         d  ] "*)     ?^G,oN         d  ] "*)     ?^ XWXWXWXWXWXWXWXWXN          d  ] *) ]     ?^]^K,{N          d  P#OPOPN7  XWXWXWXWXWXWX N      T  W   ]   ^9X82NB      T X'WXWXN; #  ] "*)     ?^   ] "*)     ?^  ] "*)     ?^  X  N 8    K! 8   =  N    W  X2   PaOPOPOPOPOPOPN  ,>? PBOPOPOPOPNd  1 `_`_`_`_`_`_`_`_`_`_`N            :9 ,+ ]    ^U_          XwWXWXWXWXWXWXN   s  ]   ^E2,:B   s popopopopopopopopopop N            >= 0/  "! #    Q\             ] "*)     ?^  ]   ^ XWXWXWXWXN    343H 2  ]    ^+,7<     2 PMOPOPOPOPN   ;  ]   ^,)   ;               N                    k      W   W   W   XWXWX;                        k  ]   ^         ]   ^ POPOPOPOPOPOPOPOPOPOPOPOP N         ]  ]   ^]^xb,j         ]   ^ ! ! !  XDWXWXWXWXNf!  3 XWXWXWXWXWXWXWXWXWXWXWXWXWXWXN            +   !    ]       ?^;w{            +    XWXWXWXWXWXWXWXWXWXWXN            q "        ]          ?^W\            q  8G7878N   !#   % *   !#  # # $  PuOPOPOPOPOPOPN   q$ !!! ]"! !  "^E2,:@   q$ $ !!! ]"! !"""*)""" """""" "   "?^%   XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX*N                       % """ ]#" "";"po""# #";"ba### #""TS" W #" """FE" W #" """87" W #" ###*)# ]$# #  #^9XWXWX;?^,'                      & ### ]$# #  $^& #$$ ]$# $#;$po$$$ $#;$ba$$$ $$#TS$ W $$ $$$FE$ W $$ $$$87$ W $$ $$$*)$ ]%$ $  $^9XWXWX;?^ XWXWXWXWXWXWXWXWX N         d ' %%%%% %%%*)%%% %%%%%% %   % CmN         d POPOPOPOPOPOPOPOPOPOPOPOPOPOP!NL             k( % W &% %%%% W &% %%%% W &% %%%% W &% %%%% W &% % %XWXWXWXWX L              k)  POPOPOPOPOPOPOPOPN           `) &&& ]'& &&&& ]'& &&&& ]'& &  '^]^]^L,N           `  XtWXWXWXWXWXWXN      V) ''''' '''''' '   'c2F@      V* ''' ](' '  (^* ''' ](' '"((*)((( (((((( (   (?^+   XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX(N-                ,  + ( W )( (((( W )( (((( ])( )(() ])) )))) ])) ) ) ]*) )  )^]^]^]^9XWXH&-                ,  , ))))) )))*)))) *))*** *   )  XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX4N-8       ,          - ))) )** * ]+* ****** ]+* *  * ]+* **** ]+* **** ]+* *  *^]^]^]^]^@3-8       ,           . . *++ W ++ ++X.  0/0/0/0/0/0N        0. +++ ],+ ++++ ],+ +''''  '^]^}3,          0 .  XWXWXWXWXWXWXWXWXN        d/ +++ W ,+ ,",,*),,, ,,,,,, ,   ,XG2oN        dP        P     P     P    P !    !P    P     8,78P     P            P      P       P         PKOPP #    :1 #P     &7     P                    P (  $  (    P                  P      hgp    H7GHP &  "  &    .-6    @>?@P      $                      P /     /         @,?@P                                        xcwxPIJIJIJ=       =:!!?=       =PC 7PIJIJIJU        :  !WUP3 ' P>I5JI3JIJI JI JS                   1    L'G0>   S xgwxPIJIJIJ=       =>!!?=PP    X _VU  ,$ d kbaPG   PA 52 xowxPIJIJIJH       ;  !JH 5 & -$# 5     5 ,) ,P6 * 'P[   PN B xwxPIJIJIJ^         > !`^ 8578 PL @  1 xwxPIJIJIJd         :  !fd B   7 xlwxPIJIJIJF       F: !HFP: .+PB 3 7 5 5 5 5 B 5 7Pl      ] . 5 = 5 5PIJIJIJK K;!MK xwxPIJIJIJb   ; !dbPI    5 qPIJIJIJJ A#BAB? !($# 5 XlWXP|   1   . 5    5   B (O'(P\    7 O # %&   '    I =  PE    X|WXP     >   BPg    X  Pi     Z = * 5   5  H ~ )       5 #  1  3Q %  (e'(W <   (a'(S 3    '53       6 !   !   $ C!${ pIop jCDCDC% ji9         H7GHHGHG   "   @(%7 i           )   >=> ;H  ) & 6 * .!74i         83 m'  @?@            M:    @?@6?@?@!8  0 !!8 L   <! ?:'  (['(h6'   D  E!o,052   :9: , $$               V%*  ! oR0 ,( )#1   d    )  &'/ 'U ~B H% ')' "PB H . ,&) '#) 0V   4   0' ?S!V 3/_B# # 0#' 9% 5+(= 0w   '<s ,T9 XWXWX21212 12121.21 212121212121 <?F7:9        A  )      +++ [ .         3 | {| {| {f L > ?  : 7  D 2=%?*     f &0|{|{ 58;>/  | {3K  L > ?   DVE#E  K "  $ 0   W   3     0 /0 /0/0  .   *  . C           (:$!"! +3w\O*>?$  8 Z!!  @-?@    H"-3.F    TM7HP O POPOOf  6508-.43     "! 000'J  <+; )  1 @  9 H]z*+/>d&!)=  O   @H/ c uc          SXW(`I -212:99POP$" *a&   d/ f  =) 7$ 'B63,  9$" / R~   u        Hq  _   k       Q TS N_    c fe `_  $  112 *QZJZq   _     k HGH N)  ts            '   B) ! ,I  N811  "!  1  R 10! 811 0-/0/0N   "! Nmf 0*/0/0N    yr p9op3opN  L     !%    L o# N      \1)\[*)*)* 2 1  ] 6  D N    !   C  M  v""  N|    ] +  ,xSDS       E          E!      E  u $d'"W@,G@ + I@|            ]N(   KN,'         '& -,' popopopF do   E     J  "  FE<  n *5   K 25     '   #1'&%%  "   <       FE '(' (' (' ({FE '(' (' (RQRQ 0+NMNQ     B ]    { 2 M   v %  @% /"  = 11+/7 ))q?     {     HGH       % A/  -Q!  )   Y4     4        ! #  )    ' 8$ G  )  1 4 36^] cd  9       w F   B0    X / 2 "a6 . " 96rY 4      4       " !$ %( ' kn4       !   )  u x wz 34  /  <C &   X |%!*' n 4          7|   )E  "    **@7 |  r #  #. " )  r ; <   #  *:  #-"$  ; < Li  S XWo OX &Q 8 Fo =J >  4 8 6     0   (  =  PE   8#78785    TaN -4 {*," $   %( $!{  *D " %GL   E,   $ :- $  >\[b"  6,9 -  >' $> b"   D,    $ 9- $  ->   < =5, ]\[ m,    N $8   '/*"?!]    m ], +  .] t    %, @ @ @ > A ^ O F G 5 .! ; A 8/  7` /  "/ (  6/7  .F "'()   0/0 ^ ]]^] ^ ]        v       0/0&^^ ^]^]^ ]-^  2            -  ' WX       XaWXP,# HGFE=  # X"P6<;9 (%$ 5A+ <' 9P'  '  * /F?      c     W## $ "       (,,   $ '""!>\A 9b/G  G\ g\E Z"  }:' ,/G  *L  ] '   E+P+87: *"M P. 5  cdU  3*%-(  q ;'*+8!  Ts  *9 -r5">   WO       %  & &." !   %  i   + '   - +  L" &  ;&"? ,'b i sXw$9  8    n"c T TU + +*       po   ,F=\E4' *  %NI        ] !  -   - +  9%9  K+* K&     hR   ;3 && ( G$ %  CX&&# 58?5<&$K     8 U     ) $ E  nck +    ] ([ 0&IX$ E   k     0/  8-.i  U S-  +D/   -N  }    +' - +   T`&  ; & 4N ,'b } 3km(a  D       n"c  '   D    0 8     +  DZV)5X?4 %RM       ] "%      -  - +  ')*G.; $ 9@   X        rR    ?''1?,G&( Z?*-  CX&&# ),5)0&&$A! a  D       d      -  +   ]  Q%O/P5f e ?DCT+(  N: 6        $( +=+  lI8| {|{  I:  ~ e5  -$[       6   *L.   `5_`B    -     # q     x.wxwx&  #     &  x # Q      n # G     , ` # 7 4 "!  , h\      -I  ! ;*  +( 1E  [ #      ?&% &  [ POP   # $   '   Xx 2@B M@?>=>=        2  C. /7* @ V   $&* .  z'    2  M ( !            (   y  U( 0*/0/0>     !7B@?   K"B       _wx~           A'Q g _~   GwxH         3Z:5GH U.        -    W.  nM nMNM]     \ !9    ^  &%     E      D  q  t;  *%?Y ?@6.r =.     ]     IRPOd%%>;,%!  " %6,/5 !J;(3:d    9 < :  N#M    NM.N#M    NM  r q+ x w+ %$h  D-  B ?     < 9 :E ))  Z W     T Q R] ?1D .+-?%+-?   &!&A?_V#_V9 < :            .  "  #& % ( ' *) >    L -  #'{  O   3     zPOPOv    3  nM^    3     !     $   ) - &v E$*  #('  < + *   3-   )  v 1   D   )  v          ( H.  4% _# #$%    / '  h_9!4=q1BC ^(4=qL?4=q-2!U#3O   3      zv   3   #^&( ) ,+, +3. -&0 /2 14 36  7!: 9& % <;<; B3NM'   ) ]          -"LXCB 3 `&_` _`_`_`8_`"H$  !  !2 "H$ (55!ZY @ _Z    "( )    +   y!9-  L9  3h4 %  & 2& A 5!"^   @   !+       &   p1    nMS            '(v     D   '(v&      (((  7:7:     O '      )             e(qM?b (q (( Q.1    S       (G  T : ~ZY$  :  Z ,    '    D@  ) ]  #J )      )  An"-  -$   R9  *   .4X%5?";X &b!MK "(  T    : ~#^$   :    $ $   ,      7 nMvNMNMO '   1,+li,  P  5-Y 5U 72 - #' (43)R?$*&=*& 7 v  O    8F/$ ' JI  NM  8        ]   6    )]   + d  l    $:\X&+!*X(& I        8 >.   EF )   Y  ('('(,   9  K    EM0:9 K+P O   /@ #   @?@?@B   0H/0/0/0/0& LK(j z ZY s3   LZ9# nIu (  : E;/  &N@(9  u  %WCR#$# $# $ # $# $  {!<;<    A :v  e" %) Pq  %C       7 TS8  &T  (       ? (7 )  + " ; F! ,?&  7  8  & QU\    DCD 8&  I QU     TSE TSb w  F!'  TS TS   #@|&%@|&?&%@|{|{z& H&$  ,kP &Y]   D,2` _%&?M7  +P&)   D^& $, l&d <\*?*?$v WZ k$    D&   D     D !G&E   )$ (' 3 5* "   !/  "%  #&<#3<B? < #& B?"*B& U@?DB?)$B?       E  b w F$!'(  ), +. / 236 7 :; =!'   #" WZ $    Dc6;  ! =  U@? Q  ='    e@!( H#  WZ %    D0 &<  "* L J UA? "@(   H    TSY  \ TSd c TST  $  #DDDCDCDC ?@?   * ( %&  L    /   D6* <il       DGW  (], o7      *(   +5mV +''   D&< ) " " =   *     %5    !, [   &3]NA:B? PB?EA(X8 $)A#&?LB?     Y \  d" #& %('R&%&%&%* +. / 23T 4| nSg TS  )F   )D      ]    D85U'    '    &&0 Q   0 !"*?,*?# UX 'E? -# |    g   t           ] @4Xt     c19SSTST_ `_V & *8[$"80 '3 0[ ~J  Y4 0<*$S  n=  /_ B3Z-K $H2S T#ST(!    ! 6-49+ !  d! O      !!  !! !     {  N  x$& m( +  - #&  H2 #  (  !   &O(      95"   PtOPJ@     9   &' J J*-3   ,  /B# %    [&B  )*-3 J1l    #   ,  )@1A J   p:E   "        ,$2+Fj##    V`_ %%%&t  &   7!  4V #          $% F9   3Bn -t+   mb% x    f  -   ,              3!  (,/EYA! 3BF    t+  =`_8    F(;=8!! ` 3-f e `_$`_      @@5-  $           $$ F8 y,.   -3 -  - a ;! ),  A   _. ^]^]-t^]^]     .)  + X  - ; )% 9 ,5-t    $ 3F%  2+&&. , 7%% pop` K   $ !#=`     .  19,"2   %     / #'(  |  1  +9$5 )S +,  _y + %25. O\   .J(   .  0FT S T S`_K PO "    #:1R ]& F     K/    i*    )    (**  847878L   C   B    !), C )Q ), \         ?  C*     ]8$ . " `*_`7 +   ;H  2    2  2 JW    N\1[ ('    1 g   E&N1 > PaOP! E B    $ ! PPOP!   Y V   !  T@`_    I " @        @@?    @TSp    J@    '  " !!~} & 9" "  ,6"  ( ' 6 :     (h'(:0           {vu4 q) %#4     L E !5%? ( Z{4q  ^vu4 UV3#4D  \ E ! '%  ( >^4U 6%333|  3  3  3 9   !      y   %333   7         T3   3 '  , 80    &  ]q,?  ).  ]T3 _;;+= baba#ba^]#=      << 4   9 ,%  '"#7+=# 2 &|{|{  p    $    v +5 3"-&      p  @ & ) } O K&$K@      u  8 *#    "  G _4   ) o) ;n *       /O    o?2 ;h  *  FEFEFE /F 6 /  O& +FE, 1 J%&  $-   j v\R #3 ;$  *  HGHG )")/K#$+/H$#   %  H ( !     ^T<";?L?D2 ('(Gm  ('(N  (o'(=4  d'}~~}&    :9:9  ),+,+ )  + $ %, #,  r 32&( !GQ5: D ~*  % .##   , @  $ '  T%5"  m 83363,dcdcdchghg  Khg#hg     3  3 $   3        >   4     6    " "[ B 83363,      K    #   HbGHGHGH  @  J  S   @  XWX WX(     <      3  &L3 Z      3  'M3x      3 6F  !    A jxw4 E F )     ! #$ '  8 /#4X   ze E -%'%'##D  ( !8Aj4 E" T ` 4 xw*(% F  %J9  P#4       8lk  z gX .%')'  ! >$, (  4* UVUVGJ   + !   % V9, 9 )G &3@HP= 4 ^]^]5^]^]bavbaL/!#=#4    A 5  *  c O- L  5 '   8P=4    5      v L |  h, *       >8 #* , 9? t *  !  !Z *  !   *  !  -'     N' 'n  {nF4nmnm4rqrq9nm rqXrqrqrq|V"ZWT    ?!?b/#4X!orqz   KVG  p ^'[\V' }t  9opl$ *      $ . /( 0 ;+    W = 'l  F4    49   X     917un {n{|{| {n{| {| {xw1FCnmnm4rqInm "rcn{|{| {n{|{|{|{| {n{| {|{| {`|{rqrqrq|%Z YZYZY       1    !?!<! 3   : 14121 14>/ 74    *    ;#%- "0 0) .7/E   4 7u  !   1$#$#&F'*C+.-.-40/I.- $#"2! "69:98789:  ?>=@ 3^>!210/0/ 1  % /(%1  c   ["7V|{|{6n{| {0FCnmnm4rqnm rqerqrqrq|{"|{n{| {|{| {n {| { | {|{| %    65  3456/    !?!<!    0 4   t  su4C$! *   #% 0fA' 0' +   !$#& %$(*P' 7V    6 /FC4  "!e"!  "    ('   #$  & !  &'  p?op9opM     !  6)+ s_     2"   , ! 0B/0/0    $, RR3       .!%]0     87878F      Z 14   `_`5 . Q R     5   QR "1  5 . h S ( Pw     7    .7 XYWXP    !1)  H     . 0&/0  ! !   " ! H8GH (    (  0//0  !  8178 ! `*_`_`.   r$ tdcdcdc r uxwBhghgvQ! < (&7@ %%  B    l ( !p!  u   dcF BK" dcdcdcr Oxwxwk Si)  (( (#P   o <1,  ,\O    k  qK" dcdcdcr {xw\r qIxwjABAB36 )  ja( *  (#'    <0,  + $7[{  \  Ij |  X_WXWX(vu nm/  GH  % / &( / pZopopopop=!0  4 =!0 [ @      & O!'E[@  @=?@  & `7_`po      T#dk9nm     E 6 3  ((9 ,     @      33   "R-2 `   3,   "R-5~      33  zy   (m'(;4 1  H0Y=   A POP:OPOPOP0DT STSTSTS      ,(D   `%_`9_` 0  +      5 0+0  (   - (0  z PHOPOP0  ;    );jq 0QXG4 _4 5  (%A    #4  <) 3  3 M G 0D       3 (   74   T3 3  0    ,+ $#       ;E+ lQ  0 F5)8GHGHGfKL KM / +            *  V U%                                  :9>87               * NS%  G"])"-,g ? V%  )  M / +   * %  |10 &(2   ";  5  @ 3V)  &     ] Ui5@3 W ! `v        WZ 6     W` popT3)    3    ) ! ! T3) =/F|{ 4 4 febababat s   r vu    #4#4   Q H   dYI + H * F < .  )  )# D^4 4    r %  3 PE<; 6'  %$   3 #$#  &#$           ! ,          #=    ` ! !I( y  3    3  3  3     $  3  3   3  1          X ! ! 333      3    3 1       !  3 hghu 3 )  Q 3 !     ) ! u3) 8O78  ! ' @   '    $ +      5   /"!,   P^OP OP OPOP   G      4,%*&  G HzGH GHvu^vu +,+, +,;"    ## 8 07/0/0/0/0/0h    R Y$ = Y#=-    $=  hghJghghghgh*d        '    *d 3s {  bWl   _- {  0`    .    G"%WE; &(2 ~ B  >O %V=E"'/  E , ' ( 4N U'~H ~   ~   ( (d'("O& (b'(04  . xJwx  @++  A pBop#opopop   F 00>7NK0 1c   $'    F 3# P   7      a' 6C@C%&& FBSC #''' ' $#$#    M POP 00 -$' &''%'$%    l,%&4&&& &0>/ &&&& &&&&&& &   /6 ,$&4   (&Z&%    C    C  43   /   ,+      &         B        $* C    @ [?.  2.   r. '#,C(8I@-$"'42 8(> +r-%(8 # P     7        "!"!" !$ # $#H!(%* ) +,+6.C-@0C/21 2+,543876/05:9 :349< ;478743F>=>=@?>=>=>=@?BABB?BC4343438747812743SDC 7874781 #\vf%1   &  B    9 3 > 3  J %%%  z 3   wxu   v srqro   p m        z $%$%K%l 5  9  #C9 3(CU"M:               "  * %. -.-.-5  H;GHGH6GHGH]GHGHGHGH    "      EB% %%%%%%%%%%%                      "    0   )  9 8{78 | j"   7       r 0R/0  RQR)Q$R      )' )$   h1gh gh ghgh( &      8( & HTGHGH   #"'     ,, X"WXWX#WX31       k%1   '/ B&     +"*6( B&  6-}%     %< Eb TS LNW    &58:7U0 ++  @ 2 !d1EJ'0,$%   !  \J(  -      - *8 (  -     ) @3?@                H+GHGH     " p9opopop     "    0R/0 9       6 9     XWXWX!       .! 87878         /T2ST MT3ST MT3ST MT3ST Mx  233 3  :#CHHH'%%%%%%%l23 3 3x `)_`Q_`< A    h< A  _  (. +$&#1 " <2 O  "POPQ PO&RQRQRQ    *          :4-  i  &%     X  ,)(%$     &!J9F=:      ?Sg5r:\:,F:x:  "7,;:r:S:E:Ma:E:M%  K@.1  />?=<?I@?S.   +   - -"*=P;J$ )=BB!F Ts D! (4[*3), .- ,4/O  " &            o-     ),  _ " ,0" $'-      k*V=[  #= 3     =        P9OPOPOP   L 5:3 9 H+<56 A :9B5 m.      TS  TS TSTSTS TST S  T STST S  TST S H4GH,TSTST+7 678 ?6?6"   TSTSTST+TS  TST W a T W HcGH,TWST+%$%& -$-    /> L TVST+ aT S  T STS  T S<;>=  x` # +  #  #  #   b ,5 6 )  , , #   ^   #   * o %* B 6)  %*  #    Ac #   %*             t    r        DN ,:_   t    x9wxwx[   x6wxwxX +         %    7   xpwxwx wx wx      .  H "; xSwx wxwxs   + /" " s  :  K / " Nh 6 $    7     N  H "; ~  E  V / "   H  Y /  " \v D  $  g5D6!5D6] # DD + E    /B)"gD!D] d  (   9 </ a  (  9 /" l         ?N ,: x[wxwx wx wx        x>wx wxwx_   | #   ^  #  ` #  #   ^  #    . #   i  1   " l  1    " Ln 1  + 1   #    #   1   1  ]  #     \   #    & `  #     * #   #   #  #   #  [  #  ! #   #   _  #    2 #   1   1   1  #     a  #     . #     _   #     &p 9   j  D   Oq G   n D 7    _   | 6   ~ =9   W  ` 6       6  c 9  6   _j   t   [  X        W w|    " &  "c &+  t        FN ,: hghp       !$    # 66 p& -YFRYCRYCR    H C  !?!<!< { * *   0-D& -FC  C  =h -%p   ) Ud X W XWXWXH&  et   *       h ID 542%3   ) U   H  &p*  p/      p( p! p  p I5=p  6 ,<#  "  _   | #   #  ` #        # # # #   , , , Bf #   \{ #   #   #     %*  %*  #     %*  %* #     c #  %*  #   p %* B 9)  ? # , #   #    %!  9 R ) " #     n 1  #     # #   1 # %* #   #  _   t      xSwx wxwxt   + 0" # p  7  H 0#       9 ` 6 6 9   7      ~  E  V 0 # m  G  n D  Wy :     +  :    7   xPwx wxwxp   ( / " r  7   H 8+ 9 t   | #  c # ` #       #   1   #     n 1  1   #     H #    _   | #   %*` #          N    S * "t    g * : 6) X         x?wxwx wxh     .   L        6MCNa      C  !  N  N )%:6Ca       \       HOBPH  B  %_  5  )%!HBH_    #  | #  ` #        P p    " %* #_z   tX       _f   t   [  X       _t   | #  c # ` #      _x   | #  c # ` #       _r   | #   %* ` #      _   | #   %* ` #       #      #  # !%  (V'(&2  (z'(0L   (t'(!U      2  (W'(d2'   ('(;N  ('('(  64  (w'('("T (c'(14  (p'(1A  (Q'('(6 (F'(!'  (C'('(6  ('('(  ('( 1'  ('(E[ 6   ('(5N  (`'(;'  HGH*@%*      ' *@% {jijiji@jijixq  *' '       (  %( ",S3 ji jijiji$By"!"!0)  gji (      #+ e&By x[wxwxwxjijijiV       0+ !V jijiji$Bx'('(    (     '+ e!Bx wKjijijiQRQRCJ  "      $  $ ' ,+!  X8WX WX  %6    # $ G J          0  /$. 3   ;  "U/:3Gj          P  OD. 3  2     of      v~}uj. , n  ;  "U/:62 HGH GH     @ ?@?@$?@'?@?@?@?@?@?@?@?@?@?@V        j* #+"    @(?@?@    " h&ghgh   POPOP    @I?@       P<   `U_`_`_` _`B|      @ %$ 878H  44& &c  G>BZ2  )D  SB/Nop M!"\  5" / L2  )N   8`78Bmt  $$ C B,    x  hghghgh1R"Qn< TQ   '7'&' %1"nG   !!      DA    N"0  rbEFEF7<        78      {  x f @ EACC3#7r hgh~@?@ ?@ ??'`]X]V]    ?*+ ~   ( '(A'('(c    ! @Emn mnm nmnTmnm n m nm nm n      (          ,     $     (  M$7,-U  3  1-C@' c! #?+ <' E  T      #m n   i j     P:OPOPOPf        H# H:GHGHGH    N  ) @?@?@<   +   t"!>b U  D   !( 2"> 0//0(/0  '   !   `%H       N  %H >7h*  c ABA8 x         2   !"#$   c    N[      1"0  %(  > N[ @E   .M    "& h\ghgho   =/M    d< X d #    ,   < 4*2& c$% < X     XWX d% d  #" <65     "%  % 7    h7gh,ghq(    I!  d! # c d; < 0/0/0 6X   $  0/0/0 9X   % 0+/0 /0 KX   (k +  @Mj) 8 ) 8 2P  $ XWWX '5>#   "#  j X('P !>     3 .j X$   02/0 >      0      ?* +  I2 1% J3 2%   i    i & .- /.'  x?wxwx >&    # > 0U/0 l<    1 r1   !n          'T . ! @6?@ ?@     ('( '(v."   `9_`_`_`xT.      POPOPx  F     R"P     '* h 8T78VN OPU^a LMT  +#8    o1=  %1#=X :      1=  @3?@ :'  (-'('(     Q" 8^ x2 shghcCTSCTcdijN     !<<      1 F )  | &,-+< 2C C    N  J h gh&gh&ghgh&gh8gh"ghghghgh ~,     )7:/b"  * $0 B-% .W ~$   Jn; <;<#; )$ J  ~3t nmE  Z  :3t H4GH~- "' - HDGH~3    7- 3 `_`~_      :          h %h_      ~s  .+,+(E  !2+ P I2A='"s c#$;BA@?B#C    ,op  ) 0     E JI F<C ( ,#C  P OPOP*    % (~ D          A3<-M-*|          )~        73<M-*                             D Q E3               F    6&z.    , 2    3 \<)*)43"!xOZ aZYDaDCD " !  $    . U4    3 7 Hm1?#.     1}W"7&   CD9  6       C]S "U#0 *$   qH      + L L  + 1o5 N  7  H       A];#06  +      K @    2     pPopop op op op ' 6 L         2/ ' 6  PLOP-  '  v   0 -'             67  45 X3WXWX WXZ    )!      ,/*-   !$       K# 0 T 2   $  _ 0 T  p6op.opop&opop/V  /.-0 52   &   !(8F 62F+J              E W7 o(44  kJ  : ;  - `_`"_`d !# popQ t !6 ?$.      & "  $AQ  kc_ ]      ' / #<8<_]         HGH r"jiji_( po  r]      ",9"_ rN   .     A# !;  Q r/[0\[\[\r07&G/0 r#r'[0\[ \%[\b0 /QG('0%  r'   ]4 fa    %CbH RK   *Hw^ <5   /] `E_`_`"~   #'"#   $'# L 0N> =>=N l       OV U   N y5 N 9$   L NN> =>=M g            {[K M  9   .     M >K     .     '   *9q.   " $ ''D N  `    `G_`_`_`     ( )  p`opopopop         % ) 6 `&_`_`    `K_`_`_`     * / 'n1   ('('(2'(      /[ ^ U X 5      i/ r1Z       *]  !"  $ K 5      G! yj  Z "FEFQRZ "FEFQR     GLK   CHG #   (   ('  "   "      XWXWX  &&    #!&  "   xwx,     Q<    2 -< hFghgh2ghgh6gh,gh2gh,gh1gh,gh2ghgh1ghgh ghgh            '?C%+%*%+>O)-(B   ph : ,      ) [1    m W)/7, 0V/0/0l   )!H @8?@?@N$ #  ' ((   0/0 /0 J 2 /  H]GHGHGH 9 :9iLZ  iC #      Lf @  ASdc !dc+dcd crf ,    )  776!E##8' hS ! +   r q6  SP, )6  efFk    !?i 0  ,/ eF *i 0Ab a`baba 6 . h g 4hghgyba    ;     > vu Z        )   G sc .W  3 8"A `  .     4    y   #9    4   `x_`D  *a  )`" )Yb  Y ;       mf ',- .  -       " s .    b  Y O% - ;       U38   /3 ( z|   #$ /3 /D (     #$  /D `L_`_`a     % x-wxf e%fe  E&  % `M_`_`_`o     #  !  >=<=@ ?@ KD(&c&;1  !   vs/ /?B;j  A\'(+[8[4hO>CH/        pop/ 0* iO  KL ^(^4FK# # *           8%78 78>6   !F      e)/ 5< /      1h/5  3    #$4<o    hgh 3    #   i < 6  W     3        #  <         #$ klef<  %C             *    $E {9      4 1 *!K.+^ e {    &$ +   ,x qpor  s|   $%7+,x    y S T   $$$'+  y peop   3 #V +*),  5 <1. " %0       ! #D)  <A,    @M)  o     $+ r9x %$#.    0 , &!F.+Y$1      ?#$1       0>/0  yv%6  (/'('('YZST#' 878780    8w7878&Dzy?     Q%  l&C GDuf ?        u4Cu b[P     .   7[  mnk/ K:   X     <u: 0  ab_/ ?:   L      9u: 0 i$   K=N)  X& ,(]** != X WXWXWXd  &  +88 p#op0d0""&&&SS' (+S$$&^^%  6(2( S) S00  x $$ XeWX'3    4 #O3&&-klef"   "SS& O\#$)  -/#$'  Sf0 g ?     $:: 00\   $ +f H  <"<0x/#  ( '43    /& 3(= =  =&# V&' 1  1 !* ] # ## $ )x/# XWXn "D  !H '6  )      0$, " R">  174"n -jinmrq           >=  21  xswx s$#$# *%&) i s XWX478  > &7 ( !"!" "! ! ! ! "!"!"!" !"Gr       <QR  K , 1 " 9E*#$ PMLM   A')[         G    > ),4 ;    h$h = ddhhn  |~66 nF7g  #"#&'*+./4167:;@=BCFGLINORSXUZ[^_dafglinorsxuz{~ $ ~vtxpqpfgf\]\OTJKJ@A@38+0&(#   "#&',)./2385:;@=BCFGLINORSXUZ[`]bchejkno HGH        7                                g     @     x vv tt rr ~       xvtr{nylwjuhs            HGHgg18   T    KJ       k8A4?2=0;     "  )$#&%( '* ) HGHgg58              3   "  )$#&%( '* )     ooF9HyMyMo' )    23    *                        FH)M,;M> M' ogLj!                     g         'L* 5! HGHg7            w       Lw$7              L   # " !$ #( ' ('      B  0 /01   "       0/   c,p8 7V         &$H p )" " =            ]$q43   b5))? 9. -43   (  "  +     *    !St6U   )> =  9!  "    :'m  ! &   zS. -0 /        !     AB  }M9  '      C 1DCDCDCDCDC4  YB1 _BCAB9ANBABAB? 6EFGHIJK BsVUV    !Uzk bm do fq h{Vm-     1@    " !$# &%('*),+ 'BAJ 2/     S ' X  BAB A@ ?@?@? 89< ;      j =@ ?@?@ ?@?@?   y =   [+ >=L>= >=%  &-.' sr er   "+  #      %     $#  &'  #   ,.-"  .  ;NMN; <J  NMN;N;N; 8 (&(   >9     x:wxwxwxN    >"% 4 "N;N ;N;N;NMNMN; n  SPW VOR/2r v| $6JE  SVSF  ) "   #&%  @z?@N;N;N;N;N;N;N;N;N;N;N;N;N;  T    "#&'*+./23<; <;  $N;N;N;N;N;N;N;N;N;N;N;N;N; x|t)  2  $  "#&'*+./23 A    06-N; -NMNMN;N;NMN; (D"   NMN ;N; N  #   NMNMN; %   02  5 B: 62  D &" B     F,&"  x3wx #`   5# 3      3 0)/0 /0   +    BAB'('   0!/0      * @0?@  "   (0'(JIJ I ('( '2       D *a:. 5#    X D   _  x| ",        ,    |~|txtjnj`db`X\XNRNDHFD<@<26+0&#  "%(),-2589<=BEHILORUX[^_bchknorsx{~               o    "                                        )  "!$#&%('* )           X        sraH cF_F aD]D _B[B ]@Y@ [>W> Y<U< WH             0BM@K>I<G:E8C6?2=0;.9,7*5(3&1        7   "!$#&%('*),+.-0/2143658 7 p#                         )/&3(5*7,9.;0=2         S#HGJ ILKNMPORQT S p#   Q       `a               :    S#HGJ ILKNMPORQT S "   c -                                4 )*), E FE- Mp                 M            I>=@ ?BADCFEHGJ I #!  !  !   nh      Mv ! $7      >#      4  '?!-] M2Q      i  A  d1C #.     2b $ )C #.@      ( p opop<{X 7@ #       7     9#    * D7 D9 D9 D9 D7 D9 D7 D7 D7 D7 D7 D7 D7 D7     "   R  *   "#&'*+./2367:;>? * D7 D9 D9 D9 D7 D 7 D9 D7 D7 D7 D7 D7 D7 D7 D7B  :B BFHLLNLNP   V  *   "%(),-014589<=@ADE W>   3 6  D; D 9 D9 D9 D9   D9  'X   34 !     bhj "at   -.  2Mn # #P]E       "%('# DCD9c\ P}OP. DCD9 D9 D9 * fkm   > W.   * U ^ w z@ J  ^*             >             ['   R     j'    \'   r     k'    hbgh$1       ^$  1 I 0". < ?BADA 7 D= MNw!    MT ?>?^_ @C <[ ' z |-OY      -v %$%     $#  sABE   .- #    +-/-" =n.  = `& T K,  7 D=DCD =D=0 8"b &. /   D=D?D?D?D=D=D?D=D=D=D=D=D=B  >FHJLNLNP\     #&'*+./2367:; >=n ]`  $D=D=D=D=D=D=D=D=D=D=D=D=D=z rx|xz| - -D= 9 + DCD =D= v` n DCDCD= b >= t +     5> DCDCD=D=DCD= $:&     H& F E    $ #  %& !-DBe       H"  j1 4   l EDABE  D !  03/0 "#p  )( . "# A   hEDABE  # +-$  ! fefe( ji     d cdc                       v  (>'( w ~}~$     @I?@     3#B! hgh#     2%   /(  -w!]T X\WX  (/ J  .E $ A  d 63  B ( $   BP(  2 : /        ~          @657 x       "  ! #   *   , + " =           l  $     1X*3)<0   9F D Y  2#   0          )o%.  O>F ( Y    ,       "    9,       Ca %2  !C      C R ++ B   ! T1 ++ B )! b  ! D,)!  3    $#$ # ('( '    .-. ~  *   *  >v  s H X '  # b nmn ! # nUX xQ"T   MP #  $!  MH  n    ( #\ H  ,L! (   "  8y ! (  b%    !fq" U0 ,+.-       R Ur &%,+   $R X%      ig" G 8   Z V5 N B   t'   Q 8      "%14D     7  #$ '(ORYZ   ?D (/'( _b     %/   U'3   g (Z'(%E       /0# tH$E 0'/0/0/0/0+   YRQ0%TU8S-'+ s      '     @        H; hghl          5 N&   l     > )            5 HDC 9:>$7     )t>;B" .     #   )@K@@  U) 0 $   `      )         56$SVv;U#&oM    @ `  Y! 0W$Y       "!& ), +)*    ߥG-      (         .              5P UoMv%vq0%v>oM% oM*  Er  E `  {-  @    "   " ((   G-      %('* "!$3658) ,+.ADCF3 65 87 :9<WX OL   A>  &%& %30 656 5> =DC!@C@@    (       4           4 %(g       %]/?;9  '-)     j  3v?+4> m;)  z-  * -d       * &$V &   04" &-     L> 5 & /43          43_A2 5 $#('       0/   Q2 Hq    SW ky  D  ?      5   9' , zwx\K  43:7       1 ~3=Y  D19' J  / <    9@?D 1RP. U    N     &0;( N      &]    H       .0  n  $4  I    &/0/.- *' C8'u4I   $RQ"     4NM    B   N 56 b 0%    z " Q 8    %       8,78 >  #      kQ"oM  % Q 8 %*'   ! 343 434                           $     U      .+,  +     ,   #        ,   %    0   "0   adw n7!$  '"''''  mp  H%GHGH &    !          !   X%WX WX Z   %   C1Yx     587   ;Y`    .$    0$CY V% 9F X # % xDwxwxwx ED   P' @$&  [^   *$& (H(('  e       ' C  " ;+, 87 >   +  " (B(( mp ; < ; 6$   0 Y,  X0R$0 L % mO N%MO  % U 2 Y,  X& T$ &   !/    !/  (!((((      "!"" 341  0A/0/0 #$#$  $#"   H%GHGH %       % p#: A   8#:2 :  P0OPB    2" H&GHd   (+ `'_`    ) ,    .!  (,(( ((   k   /0#   YRQ4%PQ4       (i'(\9    )  )     i {  zYa9 )) hghb9    !   ,  ,     q E   1   Dlx\,?9!     ,, )() > )            1 HDC 9:>$7     )o>;C" .     #   )`M``  U)   0 $            , %       12$SVv;U#&kMc n   @ `  * . 0f,a       "!& ) ,14 3,2%  &%& % ߵG -           (       %  4              1P UkM nv{%vu4%v:kM{% kM*  Er  E `   -  $           " ((  G 2G   -     " "-0/2% ('*;>=@/ 21 4ILKN9 <; >= @?B_` WT   IF  &%& %;8 656 5%% D CJI#`C``        %)i         %^1@;: f  /vC'0B m &         Y B   5)h S| 8    9b \  D  ?(     *( ~{|`O  43>;       1  <    9@? J  @ ^    ahg "E1_P?   H           &/0/.- *'  VQ"0RM> J 12^ 4%#v &!$Q 8 !      '   )   {zL')  2 '   ,   ELG DAO',    gQ"kM  {% Q 8 %*'   343 434                !+ % %   n;I%%   $ U *'(  ' (    (    " >">>>>  C1Zx     '*)   AZ`    .$    0%CZ a&% +8 c! &% V! 98 !  b! @$&  QT  ?H??'  [   C  " 5'( 21 8  ?B?? cf 9 : 9 0 S(  R0 L % c|M L%K 2 S(  R&   !/     ?!????       )*~ !"!"   %    #: 2  '  ,  ?,?? ?? K L *    >  $    /& 7* 4 & # )          .    > J*    TQ   z  #1 34  !34$  !+J#1          3>,)6eh   2   &    9&)        !"?B  ($74*'   @?@?@  6   g                                                                             r s   Ds 8       *#       >`6 g              r5   Y                                     N O   ,O       OQ5 Y                  A$   @   `]  %*  &%             #+%dJ $ @t *)0     !  8 ' x  1(       }         ! >(           ` 8.7878z78(        C         C+(        @      0[  7           uK.%([  7 A 8 u G           <45 G  _                                                                                 S8   b]\ZA )Q6                tyx{vs fkjmhe             :N               "!$#$# &%('(' *),+,+ .-0/0/ 214343 658787 :9<;<; >=@?@?S 03/0/0 /0@ f      J@ , '  -0     ' hghghsgh< (             > &5a`<7:A          W sXZ <2  (    @ ?@z  0%n r   g^       " f"Er g&& 4   ,  , 0%/0      B , ,  ,,  *    TQ     TQ   m     2 J d M@AP I. AL C4z r   84 'e"  !  L M   (  *=c5"  !  d'$   6       d}flxz+.-6   @ c     PP :  ".I ! =   %    #@ HGH   $     "C   +     |w= HGH              % "1            } Y # 0$/0 $      $Q   :  @      zwv y   dyX "" Q : {$O   3        634 5  "5V  "" O 3    >0   %(' C@, j c eh /8-3 !3BD1>0       " . =H-   K-l ('(  >  (.I . A+  0?/0 ( V  .I  . AX'  ( 000i    0    f      QR#.IB  QR IP K.Ih M. A/H'$. A \ ci      0   000'D  "  MQRP KM@A CI. AN OR  eG,zD   "xxxjH 4      ( 7  yQR|2M2M+,  M@A# $    .II. A . A"@A@A u=E8L{oH  4   "!$ #&'*+. 145(2   0/87 .iF "+      .FE "E 3<5 .TQEF[ 2       "    .,>   5 .+!0, X2M @A  j.I . A v +, QR  |y *C$=   456361>  9 Oe$= E&?  HCH IS\&? @J?@ c &%*).-214 %2>  3    X"WX   @?@   0 /0        ('(      ('(       6 =8   %1>z     I J     %S, ! %1> X%WXWX     (   " V     (           7 l*N'' V ---  j$#$#3           2    C +&   j3 H\GH  5     K  5 HqGH# "8       M@# "8 8"78     $   E & -         9 & -     (-'('('('($'($"!$#$#  4 d(Y$    (#'('('('($"! ($        0/0    h9ghgh   ;  " h@ghghgh   B   2 H,GH GH GH    .  ' 0/0/0    #      :  (2I. AR  2I. A   {i    *    b      MN#2I>  MN EL K2Id  I. A/H'$. A Z ci      *     '  MMNP GM@A ?I. AR SV  iHHHj yMN|6M6M'(  M@A      2II. A . A"@A@A "+      .FE "E 3<5   +D        :  $!1 *'T6M@Af2I. Ar '( MN  xu   89:7:5B  =  LGL M &%*).-214        2 94   z     M N                 0  (((i    1    f      QR#.IB  QR IP K.Ih M. A/H'$. A \ di      1   ((('```jH 5      ( 7  yQR|2M2M+,  M@A# $    .II. A . A"@A@A u>E8M{oH  5   "!$ #&'*+. 145(2   0/87 .kG "+      .FE "E 3<5 .URFG\ 3N          %%%      C   > ;<9 :-),38!#SFU  C   [    T     MX  L     x cf    S          0             .  $&""&$&*,   "#  %                H  <>>@DNPFHLLNV\XZ(@0 %  "#&'*+./2367:;>?  D7 $v ^_`_\U    BQ@;<?4[8$YD  8          0    C  D !    =T  7876      !     ?    8 5 6 # 5B IN   PRQ!    ? b     j    cn     S      y|  W          4             .  $&""&*,#   "#&'  &                H  <>>@DNPLV\XZ)B4 &  !$'*+.147:;>?BCFG  s"v ^_`_\W       $3"![8$Xs   +".-.-.- =         0 Da"  C     - :T  5654       J G, F                  <   ) L T  \  d  l %( t -  |       <;<; <; yb     '      X"WXWX u    3 *     K**  %   ! ? `d_`1A#  ('        % ,-#  xRwxwxwx        T   ; v PJOP OP OP OP  0/         V  (<  g PHOP OP $ ,  - D 8L78 78     $.  C  62@    Zdh   6     vefef W@ 6 &    8` (!'('('(6     65     XWXWX6C ux     4 Z 6t $     1 )' e ! 6O   ! @ VH6       ! !! xLwxwxwx 6       N  ) ; u XEWX WX WX6l      G  )( , 0C/0 /06\      # N      ppppnnL VL      /      t>e#         "5  4Hc,:UJ  Rf !  0 !   >  /  0  / ! !       >  $   3 $ L 3 3 $ e AL 2L 3 L 23 $ 3 $ ~ e A3 #3 #  $ 70    6,)0/*)0/  ,      X5WX,B$   h)gh 2^)0/*)0/3?`        |    ~ u 0/0 \ [\ Y 2 /9                  2"4"6 <"FFB  P  \  d     Fp #      #"   F !%  $   ). M  Fn    '  "F?   %FJ !  % K  Fl   '  "    F       ''& $ FI    # hbghghghF   H! 3   D   F      O '# V # "0%+'#  LKLKj   2!   LKLKLK          3.    ,,   9   -')  9 ,(   5   )#%  5 - .$ )6 *$ :,t   Q%+            ,(  ;       G     ; 7 e  B%"        !    ," /       S     !,&  (  +*,.6 HPGH GH+H8 "&%   R (-(+H k Z 1 . !   3 UTMN k bab   :*&77%R<C  F 2        ",@#' ,=     |{   .'' C.   XVWX WX WX{ ,   "#  *(2 2!  2,    8S78`  "  !   8[789  + 90 Zg   3J%& 3 8I78D2121 21  "! /D   1 (  8 \D   ,&/  D k^D8     %  c[ @4'  Dp CJ IJ5 UV     ">! ?%-  eA XDO1 212  kl2   *1#7  xhwx wx wxD  }5    #!14? % xewx wx wxD  2 0 -   !.4< %D00 CDP  7=7D        0  7D     D ; % Jb" "%  \ e   t      z   ~ }    v,c                         )    <%93 B!"!"+9!" 85/ >!!'!                  ' " ; "" " (-"  A "  "  (8 " !!& %/!  7 4 21. 2  $  =     $4   1!!* -!  0!" -!( '!$ - 69 !2 - @?@!BA!*) 2!.- 0!&%!,+!(' !BABSA! }&5   # >1&! ?  !BABPA! ,2 0 -   >.&! <  6!21DCFERQZY 8fe >!DC !:9  4  t' "  -$'     3 (0 @ -: ( T ?6 T 9D T 3R #T -  Z  /---,---,---,---   @ & V   LF-n/      % a  . 3,,+@?TS  Da > ? `WHGH QN    *a j] $(#!AjXy S0&# /          % a<n o                 st]^)   !     V //        I{  VC    V%   KV VVD 'VH +VVi Vm ! V" +            VA (     V V# # # V V      @?@?@?@Ra   #                 9:-.    K      "bQ Ra ; < ' Ra)] I     <  L  'bQ Ra $ # Ra  Raba  Raba  Ra| Ra # <    <    #;  <  nu;\Y  ;   4`Y `c%A   $ # ; <    /       )* ) "N>    Br$+*&n m@n m&     5n mgn m(n m-   )*D        W    0  3:O>$ Y OFC%&$#]K:"$#1Q(^= +P  @ &          5 ;&   !   xwx5wxwxwxwx    ! 5N0'1 8O n m    +        P)OP OPOP j #  G# nPOPOP O4   nPOPG HG HCO/P 6   3) J nB9AB5ABX !ba\E#ba\ED  nP G HOP G HOPOPOP OPG HOP G HOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOP OP OPG HOP G HOPOP OP G HOP G HOPOP OPG HOP G HOPOPOP OPG HOP G HOPOP OP G HOP G HOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOP OP G HOP G HOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPOPO POP G HOPOPOPOPOPO*P 7   9L 9O   4 'a   c" w   y         $   ) :    ? L           [ p                     ej  kqr u ej  kqr q _d  eklk  MR  SYZY  ?D  EKLK      7  Q,GD                      !"  ! !"!( '*  +,  +*+,+2 14  56  54565< ;>  ?@  ?>?@?F EH  GJ  IHGJ IP OR  ST  SRST SZ  [\  [Z[\ [b  cd  cbcdcj il  mn  mlmn mt  uv  utuv u|  }~  }|}~}                                        *                nPOPG HOPOP G HOPOPOPOP OP OP O P OP             )&W(         nPOPG HG HCOP  !    3  nPOPG HG HCOP      7 nPOPOPG HOP G HOPOPOP              3 nP OP O  nP O        &   31 n!P O    !  */6   3A0  >CJ   3UD nP O   NSZ   3eT     nPOPO P OPG HOP G HOPOPOP  ps y   p H$ 'u      nsz   3t       3          ] lnP O   i j   nPOPG HG HCOP     3  K R    3  + 6                  3       3     gji   n  J =nPOPG HOP G HOPOPOPOP  G   FF?     3 n0BAB!ABA B%ABAB A'BAB A6BAB A2B!AB A2B"AB A B ABA B AB A B AB!AB A B A BAB A BABABAB$ABAB AnBAB AB AJBA BABABABA'BA BAB A-BA B AB/ABAOB AB AFBA BABABABA'BAB AUBABABABA'BABAB A$   65 0      "65 0 &     65 0    rqfe856    C D WIJ K XJI#jiO  w i () '.zV~ - \;dxI[g{+m 65 0  9j 65 0 65 0 %6;  ba \<   9IB 65 0  >V[m 65 0    "    4   nPG HOP G HOPOP OP G HOP G HOPOP OPG HOP G HOPOP OP G HOP G HOPOP OPG HOP G HOPOPOP OPG HOP G HOPOP OP G HOP G HOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOP OP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPG HOP G HOPOPOP OPOPO POP G HOPOPOPOPOPO*P                                                                                                          +  y . GD                         "  #$  #"#$#* ),  -.  -,-. -4  56  5456 5<  =>  =<=>=D CF  GH  GFGHGN MP  QR  QPQRQX WZ  Y\  [ZY\ [b ad  ef  edefel kn  op  onopov ux  yz  yxyzy          *         nPOPG HOPOP G HOPOPOPOP OPG HOP G HOPOPOPG HG H7O POP                  &        3    3      3 nPG HG H8OP     (      3     ( nP OPG HOP G HOPOPOPOP         3     (          3        3      3  sn0BAB!ABA B#ABABAB!ABAB A2B!AB A1BAB A B AB A.B!AB"AB!AB!ABABA BARB AB AFB     65 0          65 0           65 0    "!  k   9VOz 65 0 / 65 0 T  65 0  65 0   ujU  @  @ Q  \- _Hk    9IB `,  "VIZ,J0          2   0"#& % ( '* )..  +2 /6 3: 7<=@A DER8+H IF nB AB AB AOB!AB A BA BAB A%B AHB     8^Y65 0       @) #4  1 @R?@ ?@nx      A",&  -n?           7nN           &  fXG HWX G HWXWX WX G HWX G HWXWX WX G HWX G HWXWXWXG HWX G HWXWX W X WX WX G HWX G HWXWX WX G HWX G HWXWXWX G HWX G HWXWX WX G HWX G HWXWXW_P WX WX WXWXW XC 1   3 ?   GDC   G=   ? : 3H 9a   ife   ik   upo   uF I   " AfXWXG HG HCWX     3 fX W     P,OPOPf XWX W       ,    fXWXG HG HCWX     3 "'  !$'  3  H  @0'. Wnh  -!&D n+ n-    n         F E fXWXG HG HCWX     3     3 f'J!IJIJ IBIJ IJIJI B I: &   J I J I^   B I/ J0IJI       J I B Ix  J 65 0      65 0   fI L         ^8        +5     0+ 8    *      ba \                 f@   f)]^U V>\UV        < /    -   fD   %c:f8@   P      &   '5G 1 8@  P  lz B ! )  D C D 3(Y XWXWXWX ^&    >  v           62}/    >   POP"`E@  ! '4 8    `         X  ZUE       N|HK        h 6  5                 ;,  /   6B& % 87878h.     h h h# h,  h<    )  h'         n PG HG H"=>=T T 6> =>=@$ ;<    uq .Ug  >8  %          5      $`;U4 #  0 / $1 /&    ^* ("  % T 6 @$ & hF> =>=    q&3F  xmwxUwx    54  (' F ?'!  `._` / `t_`_`_`l       A <=,"p PWOPOP  Z     @!?@?@  $ H`GH.GH:GH1GH3GHGHGH"!"!"!  klklkl/!#! !/ M7!_&)  Q= ^{ ^{|{|{="4'$ 6= i # m <0+<   1     #4   < ' #      Q=       =4$  ^{!"4'5 #   #4  P 5    !45|] ^{I; <F  +(     notsxw|{        /214  ! ))U7%*!n ) +  (              B.  0%$ .    1     .k%   *;#. y9 ^{F ^ " ^  "4'^"4'   #  <   #4@#4  1Qc I / S$4 C+  5   C& F      4^4  XVWX%WX%e    "  -*  %e XsWXWXWXWX   .+, )  'P      y +  R  Z qnqr   ~}         ! . Z N       , '  (   ('(Q[   , Ph<e,        > l-&A.  $& %3  #cz h  z]^r   ^#z      < A M/  ># z/!  p #    (' (' ('    $        wB)H ( E  2'19/!  p #z z=+  #z_HG" 1    " B( " 9_" 1 ^# z0       m#8=0     X7WXWXWXzr  $" z9*33* 3  5  *33*3 87  I      !   * 2 ' #' 9*33* 3    5 h7ghghghghzL % CR>^ '        7> +N0M  + L %    R  >    [zo M  z=[Rb a1&g  6    6  6   ,}|srih_^UTO      7   &  ' )                   +'.   ,'''G'*'+66666663 '&!4 = [ R 1&'2 2 2 2 2 2! "2# $2#& 'g hghz& #z0!z$z! #! #!z ;z   2  =  T''4 z#    #zb aT        ,# *!Y"D'F T  8-78z: !  #zb aT        ,) *-Y,F'F T  ! ##zRb ab a  (  ,+  E;  (W n  2@'"X R    (  zK "  ##z_b a ba  (   .-    E"  *Mn'2@/"X _    (z%  zO &  x#z@b aR     ,  W -'F@ R  |#zDb aR     ,  #W 1'FD R     ,  #z' b a8a@bb a~   )       ,^ &a.'$$  ))0$$$$ , O  Z"    :('6)>'t'  8@ ~  `O_`_`z#      \#z         z  p|opopopz$LYK)        8 + -0$Y) zbab a bal     ^; PY    l szb ab aI   E3*@  I z b ab Lzb ab aI    j  EK @LY*@   z  Izb a0  ,!' 0 z b Lab a0   Q ,9 .:@ '  a 0   E    j  E   E    j  E  ,  Q ,  ,  Q , zzb ab aI   E:@  I z b ab Lzb ab aI   j  ER G:Y@   z  I   E   j  E   E   j  E kzb ab aI   E+2@  I zb ab Lqb ab aI   j  EC 8XY*@  q  I Azb a0  ,!' 0 zb LXb a0  Q ,2 'G@' X 0 * ,   1=@DK   L J  _  ; 4   6 6  6  6    E , )    E    ,  $ & . 2 3%-? ?+''''(' , '5@'17@7' 1 = @ D K   L J  " !_$ #& %;$       popDD  D"!D$ (( %.DD hgh ^ ]\ [,,%&  0 # , `_`  Z       Z       I?!   Z  2Gk 2+E O`      $ &   B#( 42G k @?@?@Q=   6=>03 Q= j  [1|v .BTA\         I jNF' *4 ;v .T\ F#g#####l     ]  '  1            #  X         ~ &E 0 '   %     $          r   N    o / . ( ' L Z    #/%$  & B # OS G>8 q U $4%+ C7)l     ]  '  1   A1$@az4} z=}<O#4 #= !   %A"   f   O @"# *, # %   a4 =   < +%,%g?0@ ?0@  ! 2 !      M0Z  Y0Z       ! n% BY33 4g0 0  ! 2  !   `'_`_` -  5 - X\WX#WX#WXi      !N,Ei   ltmMj### "  C ` <5-   &< 7 "  v3   -$D? .+   , /@?  ?   '  ]C%64i    y xy     fi&( C ?   jQ'J$8 3($> ( E b G;  (  ;B *"  C ` <  5 -    < 7 "r   PkOP#OP;OP#OP9OP#OP4OP#OP#OP#OPx U S N      , #           ]JHCrN. &(6'2ix U S N    xNwxh5y    !F A0 5y# # F#Mm##N  C c     e ,2  . )      ,  L    ] Q@?92 0$ AA PN  C c   % %  ~}z=}-    #=  +  -    =-        { l =@BDX W5X W@:     6 6  6   6 . ,  6  & . 0 +) ) ,''','*''''' = @ B D 5 @ : X W::  , 62 !' &' : : m:  " "  6'  &''m : YX WB , #''  B pX W,!  ,!  ''  ,!  r4!C&   X WX WI   E T: 6  4': X WX WX Wb    ^E<Y   b X WX L%l    hU YY   l    ^  X WX WX LX WX WX Wb       ^[ R\r<Y        b X WX WX WX W{     wTKr    {  X WX WX LX WX WX Wb       ^[ Q\r;Y        b X W XW XW X W X W      dC)        HGHGHGH.   4 ijij> &#$!  =?M $H  6 6  6  T IZ & -    ''''+' ,   = ? M $N klklklX    d =@DKT S T Sf  6 61 6 ; $6   E        & . 2 3-  ,'''(' , '5@!6 = @ D K   /   G8mR j8n6  6  C +  "   7')' '' G8m  R T ST SST S@T ST Sb   E @  ^!.<")@0Y   S @  b 86  6    E @  ^  oDp (    9  D4  R Q RQ RQ RQ  CR Q RQR Qq<      w 6   * /^  A L\r) ('=Y       C   q x7wx n 3*(3   z$[z  *  '9$["r (R Q RQ RQ RQER Q RQR Qo &!     w O 68    ^+ N  Qr*'?Y(      E  o$  ,     f %B  6* >'  B @z8 Yt     $$        ? @    3??  ;     @*8 Y       +      " p9op$ $ $ $  ,   $ ,          xw x,w   xw< 0 &= ##  L0 |ȪX <X0T|̬lLT8lD 4 |0 İD  \   <  ̲ $ \\ 0 D D\ tܴ4,8|TĵtdDܷ,|4̸\l|  \0H\H  0 x !ȼT!h!` """D"$$48$`$Կ|$$$t$$$%d%%%H%''0D'x''(d0(X()L)))<)*H*,p*|*++`D+T,h,H,,,0h-||--.d./,/TH/|//D/<0T00h0x011`12$2H2X3l3,3|444l585 l5\555L`6x6606778h48H88P|9994::;$@;t\;;;d;<<T0<X<h=<|===$=l|>>>P??@@@@\@@0@@A AlAAATBTC\J<JJ>>?l??d?H@@0@ 0AxAABhBLBC$XCCCDDpD\D  EpEEP F \F@FFHGG4G8H H<H %(Ix&tI'I)J*\J4-J0J1DK3K5K8(L:xL,MLMMNLMPMPM4U NXpN[N[ O\XO(_OH`Oa@PbP,cPc$QflQfQgQtg@Rh|RhR@jSHk`S4lS nSn8TqTuTz(Ux{tU@|U| V}\V`VVLWWWL\?@ġADP K(LP8|PtSģS UTXYZ4[0]ԥh^$_l abb4pf8lԧopl rLttLxTT4ԘX̪,d`PLL|Ь8ṱԭ4$tX(<< xH xDX@T|`D̳(d x<x<ȵDdH,l|ķ` T0x̸DPhHl($l h\H(x  X@d4\(H*Կ*$X,t(/L11dX35L7T8: <@BC$(EpFGOXhP(Q4T<WlX|[,,\x]T_(`d`cdTdd(e fTpfff4gii jlkl,nXnLopp@qpr s,t|vXwxhz{p}X~ DԂ̃Ȅ0`| d  ! P!!4!<"""(# t##p$L$<$̩$p0%$%Ĭ%\&Ld&&'T'й''(<(8(()0@)))p*l`**p*PL++8+8,p,d,-T---h0.l..8./\/D//0Dh0x0181h112l2,23$<333x4`44d5P55P5@66<607778X8<8d809x9 9 :8 X:l : : 8; ;X ; < h< < <8 H= = =@ $>h l> > > D?8 ?` ? @ d@ @H @p N4D hNG N\M OP XOLS OS ODT @PT PTU PU $QV pQ|V QV RV PRV RW RtW ,SW tSY S] Tb dT ؔ<> d> dt> ? H? H? ? ? 8@ A ؗ@B $B txC C D \4E E  ,? | B B  D l\D D XE HE F G 8I ,J HJ J lXK L TM XTN P DP 0P thQ Q pR dR  S S T(T HT lT 8TU  V dV V XW @W dW $8X pX X Y 4H[ 4] ^ _ hhd e Tg Lh j j ( k l$k  $&B t&G &O '|S \'DW 'p] 'c D(g (i (s ,)hw |)@| ) *P h*l *x +ܕ P+< + +L <, ,0 ,d (- x-D -x . d. . / P/p / / <0 0 0 1 X1 1 1d @24 2 2T (34 x3 3 42 <43 44 46 $58 p59 5<; 6< T6= 6x> 6<@ @7D |74E 7lE 8DF X8`F 8tF 8F $9lG t9G 9hJ :K T:Z T>[ >D] >] ,l>\> ?\?4??L@@@?(?t\@A AXPBBC<DXE,F,G|GH DIh I `J JL L  M M8 LN N O LPh Q R ST S `T TZhZ[ [4D[x(]`cddtiqL(s4tt48z|} ~p`TTȊ ܌p ďX<Ԕ Жl< \\P@d,T|h$ddX(D  "4 $$ <& d' !(l!)!*"*P"+"h,"`-8#,.t#/#0$4d$p5$7%8L% ;%<%D?<&x@&p>`>?<\???D@@@4AAAX$B`tBXBCTCHCC4DDDX$EpEEPF, TF F F# @# tB#H C# D# F# I#p 4L# TL# ,M#T N# N# PR#@ W# Y# Y#,Z#|_#b#c#hHg#h#i#Pj#j#,k#(l#tn#p#t#ddv#@{#d~#Tp##́#,#t#D#P#Lx###4L#ԙ##$#tp##`#d ##h#L##8#0б#|T#ܲ##`(#ܴ##D@###(,#t#X# ܹ#Xd###<d### #l # #!p#T!P#!\#!X#D"L#"#"#4#L####l#$$#t$#$$#%8#d% #%#&#T&#&t#&#@'`#'#'#,(@ $|($(X$)5$l)H7$):$)0;$@*h?$*?$*,G$(+PH$t+I$+K$ ,L$\,(M$,HN$,N$<-O$-P$-Q$.DR$X.R$.4W$.W$x$> $>$ ? $l?$?$ @($H@\$@l$@% A%pA%A%Bl%TB%B%B%8C@%C%CD%D%XD%D,%D0%HE%E!%Ep"%F#%lF *%F,% G1%\G2%G3%H5%TH6%HT7%H7%@I`8%I9%I9%$J@:%tJ:%JH;%Kh;%dK;%K<%L=%TL =%L>%L>%+6 B+6 8C+07 D+|7 E+7 pG+8 H+`8 \M+8 |N+8 $P+L9 Q+9 S+9 0U+<: LU+: xX+: Y+; [+h; d]+; ]+; d^+L< _+< `+< a+0= d+|= f+= h+> pj+h> l+> o+? q+T? 4t+? py+? }+@@ +@ +@ X+(A Ą+tA +A ,+B ̐+`B +B |+B p+LC Ԝ+C h+C Ȟ+8D \+D x+D + E +PE Ƞ+E p+E +@F +F +F +$G +tG +G +H +dH @+H +I l+TI +I +I +8J +J о+J + K +lK +K d+K p+LL +L +L <+,r >,r ?,@s $@,s @,s @A,$t A,tt |B,t B, u C,\u D,u D,u E,@v E,v ,F,v F,$w DG,pw G,w H, x LH,\x H,x hI,x J,@y J,y J,y 0K,,z K,xz L,z M,{ M,\{ \N,{ O,{ O,@| 8P,| P,| TQ,$} Q,p} pR,} S,~ S,T~ DT,~ T,~ U,8 V, V, W, X,l Y, 16 >16 ?1H7 @17 `A17 A1 8 hB1l8 C18 \D19 F1X9 H19 I19 K1<: M1: @N1: T1,; V1x; @W1; ,X1< `1d< de1< |g1< l1H= o1= Lz1= z10> {1> {1> (|1? <|1L? `|1? |1? $~1,@ ~1x@ X1@ ܆1A 1dA 1A `1B h1PB 1B 1B 18C 1C @1C 1 D 1dD С1D d1D 12q ?2q @24r A2r B2r `C2s D2ls F2s F2s K2Lt L2t N2t N24u O2u P2u Q2$v DR2pv LS2v hS2w T2Lw 4h `>4 A4 C4H F4 \G4 L4< O4 P4 U44 ]4 a4 b4, b4 e4 i4$ j4p r4 v4 w4` y4 {4 }4L 4 4 4< ȥ4 \4 4, 4| `4 ,4 4l 4 4 4X 4 4 04H 4 L4 4, 4| 04 4$ 4t 04 4 4d 4 44 4P ,4 4 |4, 4x $4 4 (4` p5 5 (5L )5 L*5 +50 -5| .5 x/5 l65h 75 @85 85H X95 X;5 ?58 p@5 lC5 C50 4E5 E5 Q5( \S5t D\5 ]5 ^5H _5 ``5 Ta5  4b5p c5 d5 d5` 0e5 tf5 6t; ?6; |A6< B6d< D6< F6= xF6P= (H6= J6= DK6@> K6> 4L6> L60? M6? \N6? 4O6 @ P6p@ P6@ TR6A T6`A T6A U6A V6@B V6B X6B $Y6,C Y6xC 7hl >7l @7l A7@m |C7m F7m F7 n F7ln G7n H7o I7Po J7o K7o N74p pP7p Q7p 4Y7 q b7pq L7q L7 r 7\r 7r 7r 7Ds T7s L7s x7(t 7|t l7t 7u 7`u 7u 7u l78v 7v t7v 7w \7`w 7w 7x 7Lx 7x L7x H78y 7y t7y 7(z 7xz 07z 7{ 7h{ X7{ <7| \7X| 7| 8| 884} 8} 8} 8 ~ 8\~ 8~ |8~ L8H (8 8 8 P8p D8 x8 |#8\ ,&8 (8 (.8D 78 78 B88 C8 (E8 DE8$ (F8l F8 (H8 |J8T tK8 P8 $R8D hT8 H]8 _84 |a8 Td8ԇ pf8$ h8t j8Ĉ l8 o8d o8 p8 r8L s8 t8 tv84 w8 x8Ћ z8 |8p ~8 8 p8` X8 @8 (8P 8 8 84 8 8ԏ `8 |8p 8Đ 8 8P 8 8 48< h8 8ܒ 8, 8| 8ȓ 8 `8h d8 \8 8P 8 48 8< |8 8Ԗ 08$ 88t 8ė 8 8\ 8 8 9@ D9 9ܙ #9( +9t 4.9Ě 829 49d 79 ;9 ?9H K9 L9 N9, O9| O9̝ P9 Q9l R9 PS9 T9\ T9 T9 T9H U9 U9ܠ V9, V9| W9̡ Y9 Z9l T[9 [9 \9T `]9 x]9 D^9D <_9 _9 |`94 $a9 a9̥ Lb9 b9d c9 d9 e9L e9 Tf9 g90 g9| Hh9Ȩ h9 i9` Tj9 k9 k9D l9 tn9ت n9 s9P 9 9ܫ 9, 9| 9̬ x9 9l 09 9 \9T t9 9 90 9| P9ȯ 9 9` 9 9 l9L 9 9 98 9 9ز 9$ 9t 9ij 9 X9d <: p: :< : h :ص :$ d%:t (:Ķ +: 3:` 4: 6: 8:H :: B: K:4 M: @N:̹ (O: P:d Q: T: U:H V: LX: Z:, ]:x d_:ļ `: `:T a: c: \d:8 d: Xe:о g: i:l li: l: o:T 0p: v: :D t: : :4 (: : :4 : : : :h : : :P p: : :8 $: : :( :x @: ; d ;d p; ; p;T "; (#; x-;D @2; \5; 86;0 @; A; E; J;T 0c; g; g;8 h; h; m; ,r;d s; w; x;T \z; pz; z;, {;x |; |; };X }; ~; ;@ ; p; ,; H;l 4; D; T;@ d; t; ; ,;\ ; X; ;L \; ; ;0 ܉;| t; @; ;d ܔ; ; ;H h; ; t; ;d D; ,; x;H \; @; ;, ;x D; |; ;d ; ; |;P ܺ; ػ; ;8 ܾ; ; p; ;h h; $; ;L ; ; ;0 `;| D; ; ;` \; ; ;L ; (; ;< ; ; ;, 4;| ; D; H;h ; h; ;D ; ; ;0 4;l $; < <\ T< < 0<L &< p0< :<< 4D< E< 4I<, T<| (X< g< l<l Ho< o< Xp<H q< (q< s< t<l u< u< Lv<H ,w< w< x< y<d |y< Pz< ,{<4 p{<x {< t}< D~<X T~< $< 4<, <x < T< <L < < ؃<$ <t d< H< l<` < < <H ,< @< < <h Ğ< < $<T < < << \< `< <$ <t t< < ح<d < 8< \<T < ij< <D ,< \< Ը<4 0< h< <$ <t < < <@ ,< < <$ t<h $< < <L < ,< <0 <| < < L<` < < $<4 D< L< < <T < < H<@ < < <0 < < 8< H<p = = $#=` .= p4= 7=P 8C= ,R= Y=@ ]= m= dy=0 = = Ю=  <=p = =  =X = = T=< p= 8= = =` = = =H P= = p=4 = L= =$ T=t P= = =\ = = =L = = =0 =t D= = =d = > >T > > >$ >h > > >@ > 8 > >0 @> > D> >p h> >! >`! @>! >! T>D" ` >" !>" L#>(# $$>x# $># d&># )><$ ->$ .>$ 2>(% =>x% @>% hA>& xB>d& C>& (D>& D><' TE>' XM>' O>( O>L( |P>( Q>( Q>$) R>l) R>) S> * {>\* P}>* d}>* x}>,+ }>x+ ~>+ T>, P>h, >, >- >T- >- |>- ԓ>@. >. >. >0/ >/ >/ > 0 h>p0 l>0 x>1 ط>`1 t>1 >2 >P2 >2 4>2 $>@3 L>3 |>3 @>04 0>x4 >4 >4 >,5 `>x5 >5 >6 4>d6 @>6 >7 H>L7 >7 P>7 P><8 >8 x>8 0>(9 T?d9 ?9 ?9 ?<: t?: ?: ? ; ,?p; ?; ?; ?<< |?< ?< ?= ?d= ?= 0?= @?8> ?> ?> t? ? X!?p? !?? "?@ |"?T@ #?@ #?@ %?8A 4%?|A %?A &?B &?`B &?B '?B \(?8C .?C .?C 3?0D 84?D 4?D @?,E DA?E A?E B?0F D?|F E?F G?G I?dG J?G N?H Y?PH ,Z?H `\?H \?$I _?tI a?I Pd?J e?\J e?J e?J h?8K j?K k?K Hl?L l?hL Hm?L m?M pn?LM n?M n?M o?(N D` ?D @D |EDH FD GD LD0 PMD| NDȯ PD QD` RD TD VDD VD XD 4ZD0 ZD ]DԲ ]D cDp dDȳ fD hDh hD iD kDL 8lD nD oD4 rD \sDܶ D, 0D| D̷ 8D Dl D D G L@Gd AG DG `KGT hVG d_G xcG@ DdG eG $iG$ iGp jG kG lGL qG rG PwG( yGx {G |G d}G@ G \G G0 Gt tG ȋG Gd G G 8GL lG G ؘG  Gp 4G G ȚG@ ܚG 4G HG Gh G G GT \G PG `G,! G|! LG! G" Gh" жG" G# GP# G# G# G8$ G$ G$ dG% Gd% G% |G& HGT& G& G& G@' G' G' G$( Gt( G( G) Gd) G) G) XGH* \G* G* G4+ G+ G+ 4G$, LGt, dG, G- pG\- G- G- (GD. G. G. G4/ pG/ G/ G0 4Gd0 G0 `G0 GH1 G1 HG1 dG2 XGh2 `H2 H3 D HT3 HH3 (H3 8H84 H4 H4 hH 5 THl5 H5 lH6 HT6 `H6 H6 H@7 0H7 1H7 h1H8 1H<8 82Hx8 2H8 h3H8 <4H89 4Ht9 5H9 (6H9 6H4: 6Hh: 7H: p7H: =H; pAHX; HH; MH; NH< PHl< 0RH< `H= `aHT= bH= dH= lH@> mH> (nH> nH ? oHH? pH? qH? qH@ rHT@ sH@ H@ H@A H|A HA HB @HlB J ?JL AJ HHJ IJ< `JJ YJ؃ ZJ$ `[Jx ]JȄ \^J p^J\ ^J @_J \_J8 `J 0bJ؆ bJ$ pcJp eJ hJ jJ` LkJ XlJ mJ< nJ (pJ܉ pJ4 J 0J J JP J J |J4 Jp lJČ J Jd J J J4 J JԎ XJ$ Jx J̏ TJ Jl J TJ `JH ȧJ J J8 J dJؒ J( Jx Jȓ xJ @Jh J J JX hJ HJ JH HJ LJ J8 xJ Jؗ J( XJx KȘ  K Kh K K `K` K K <KD LK K LK0 XK P"KМ "K `#Kh d%K T&K (KT d4K (8K :KD p>K xAK EK4 lEK GKР IK IKh dJK JK RKP TSK SK $VK8 VK pgKأ jK( pKp pKĤ `sK uKd vK yK yKD \zK 0{Kܦ |K( pKx dKħ ؄K LKl dK K ؇Kd `K K 8KH `K Kܪ ,K( N( NNx ON SN 8PP>P>H'P>'PD?1P?\2P?2P@@3P@4P@D8P8A|:PA;PA Ql>QLm@?Qm?Qm?QRL?R@RT@RhARBRDBRXCR8DR,DRxER8FRFRhGRXHRJRT|JRLRMRDUP.DU.XEU.FUD/GU/hHU/LJU,0JUx0OU0PPU1xQUd1QU1RU1lSUH2xTU2UU2 VU,3VUx3XU3HYU4YU`4ZU4<\U4\UH5]U5^U5_U06d`U|6aU6aU7cUd7dU7 fU8fUP8TgU8hU8XiU89jU9xUX>$U>0U>8UVXQAVQEVQ(LV@RLVR MVRNV SOVpSPVSRVTSVTTHVVThbVTmVDUhvVUwVUzV4V {VpV,|VVTVW|VTWVWVWVWfFW gTJW\g(PWgSWgDVWLh[Wh8bWh\dW]L>]>]>8]0?]|?\]?]@]`@X]@]@\]LA]A`]A]`DF`G`lH`(I`tDM`M`|N`Hb>bLp?b8@bt@b8@b|Ab$AbPBb`Cb Hb LLbP 0Mb Nb Ob@ LPb Qb Rb PRbd Tb Tb UbH Ub ,Ub Vb lWb\ Xb \b P_bDl_b\`b`ab bblebXfbfb8Tjb,kbkb tlbllbDmbmbPnbHobob4pb|pbpbLqbdtbubwbLLb8bb$bhԂb(b b<bĉb b ЋbpbĐb b\bbbHHbblb$btbbb\bīb@bHbbܵb,,b|(bbLc>c?cT?c?Pc?xc@@c@4c@c$APcpA\cAc BcXBcBcBc0CXc|CcCxcDclDcDcDcHEDcEcE,c,FcxFcFDcGcTGxcGcGix?i?idd@iAiXBiL$CiCiJi4 ,Ki Ki Mi(! Nid!(Qi!DRi!SiH",Ti"Ui"dVi0#j>\j>,j ?xjl?H j?#j@-jT@,/j@9j@:jk?k,@kh@kAkBkLCkdDkHEk00Fk|FkȂTGkGk`hHkHkIkD JkJk܄ Kk(KkxKkȅtLk$Mk`MkNkOkDOkl8Ql@Yl8\l`lظLhl(xjlxtllĹll @olXLtl~llHxllؕl4l@lԼpl$ltlĽllDl``lpldlLllܿl,lx@lll\Tl ll@4llLl,dl|(lll`lpllLlxl,l4ll\lLllllpl4`lll(lpl|llT@l#m<$m$md0&mL(m+mT0-m-mD.m08/m83m5m 8mp:mP=mEmX,Em,Lm8Rm<lRmUmlVmWmlWmXmYmT^mbmdmDdmem4fmrmTsm(um{mDĆmmԓm0m| mmЗmdmmm,m|mmmdԣmm$mLmȧmTm8mmm0mxdm̰mLm`m(m\mHxmmm mlmLmhmHmXmm0|mmm$8mplmmlm\HmmtmPxm|mm4m,m@m \mPmLmxmHmpmn@hnnn8 nHnnnhn<n$nPt)n*n,n@$/n/n@n,Cn|Jn NnPnl$VnWnWnTXn[nfnDhgngn in,ln|lnln,mnDvnvn wnp~nnnTn nnD`nؔnhn0|n|nPn nppnn$nLn nn,nx8nnnlno>od|?o@o@oH4AoAoBo48CoCoDo PEolFoFo|GoP8HoHo\Io< Jo Jo @Ko$!Kop!Lo!,Mo "MoX"No"8Oo"Oo<#Po#Qo#Qo$$dRop$Ro$So%0ToT%To%Uo%(Vo8&Vo&tWo&$Xo'Xoh'Yo'Yo'0ZoD(Zo(d[o( \o()\ot)(]o)<]o*]oP*h^o*ao*\bo8+bo+co+Xdo, eoh,eo,xfo-0goL-go-Lho-`ho,.hot.jo.lo/qoL/ro/ to/uo0vod0~o0Do0|o81܇o1o1@o 2Pol2To2o3oP3o3|o3Po44ܠo4Ho4do5oT5o5o5o>o>do4?o?o?Ho@|oT@o@,o@4o8AoALoA,o B ohBoB,oBoColCHoCoDHo\DoD8oDlo8EoExoE o8FoFoFoGo\GoG4oG(oLHToHoHo4Ip|IpIpITp0J pJ pJ pKpXKdpKpKp@LpLpLp MplM0pMpNLpPNpNpNlp4O$pOpOpP<pdPpPpQD!pLQ"pQ%pQL'ppW>pWApLXBpXCpXDpDYEpYIpYxJpDZNpZlOpZPp8[HQp[Qp[Rp\Tph\Tp\Up\@VpD]Vp]\Wp]Wp(^xXpt^Yp^Yp _HZpX_[p_[p_l\p<` ]p`]p`^p a4_pla`papap bapHbbpbLcpbdpcheppcepcipd,kp\dplpdlpdmp(enp|eoperpfspdftpf8upfXvpHgxpgypgH|ph|phh}ph$~pi~pPi<pipitps$>s8>s$T>shh>s8?sL?sHh?s|?s?s?s`?s?s@s<@sAsAsAs`AsAsBs4 Bsx,Cs@Cs \CsPpCsCsCs$Csh,DsDsHGsHdKsTMsTs4Ws8ZsĐs spԗsHsСs` ss̴sHss$s,нsx ssshps\sXsTpstss@s4s s$,stss @sXsss@ tptt,txtt#tP0%t&t)t8*t|+t-t(-t`-t$/t41tHh2tx2t$5t7tl9t;t;t@=t?tBt(DttDttItVtTethtjt<Pkt`ktptxtlt؀tԁtPtt̄t0t| tpt tl Pt 8t 4t\ u u uL +u +u Gu< xIu Ku Pau auh cu 8duduD fu`gudhu0iu|jujuludPmunuouTpu ruTsuDtuuuvu4vu|4wuwuxudPyuyulzuH|ux}ud~u u\xu8uuH0u u(u$DuhutuPuTu,uluDuuu4Luu\u$utܟuԠuu`ܢuuDu@uuԥu up0vX>@v>hv>v,?vx?L v?h v @ vX@( v@v@vv\FAvFBvF0FvLGlIvGLvGXQvy?yPdAyCyHy4tIypIy`Ny@Py@ RyRyȯXSySy@Wyh[yذ[y,t_yt0`y`y8ay,Haypayby cyTcy,dyHdy0dey|hfyȴlgythydiylyxyH,}y@~y8y0y\yз(y yp yțy@yTԞyz@z BzXDDzlFzHz<IzKzLMz OzlPz{(?{A{PB{C{xD{P(G{G{pI{HJ{dL{ M{HLO{pR{pS{ T{l@Y{[{p_{X|a{Xe{Xg{Dm{Dn{n{ q{Xr{t{t{, w{x x{ Pz{ {{L |{ { 0{ {l { { {T { P{  {8 |{ l{ {({x{`{{d@{@{{H{{(|4p| | | x|p0|t,|H/|\0|(4|8|HH;|=|?|0(A||B|\C|D|PG|G|$H|4I|K|L| 0O|pR|HT|U|`\c|Xd|\e|H0f|g|0h|0h||i|pk||dT|||P\|||<||| \|p0|h| 8|` | | |L!|! }! }4" }"}"}#}l#}#`$}#80}@$41}$6}$:}%;}P%=}%@}%@}0&@}t&@}&@}&@}@'A}'A}'A}(B}h(B}(B}(|C}@)C})C})C}* D}`*D}* E}*E}@+,E}+HF}+dF},,G}h,G},H}-I}X-I}-I}-I},.DJ}x.XJ}.J}/J}L/K}/K}/HL}00L}0hM}0M} 1N}p1O}1 P}20P}X2TP}2xP}2P},3P}x3Q}3Q}4Q}L4Q}4Q}4Q}5pR}h5R}5DS}5S}@6S}6S}6T} 7T}\7 U}7U}7V}@8V}8TW}8pW}9W}X9tX}9X}9Y}4:\Z}:lZ}:Z};$[}T;[};[};P\}4<`\}x<(]}<<]} =P]}P=d]}=]}=^}4>D_}>`_}> `}?d`}\?t`}?`}?`}4@`}x@`}@`}ATa}PAb}Ab}Ab}4Bb}xBLc}Bc}CHd}dCXd}Chd}C0e} ?и?8@h@8AALHBBpC<C$EػPH(NxPļ,QUl`c eXmnyPd@8x hDDȿ0ؿt \0H0@8t0(@xHlp< P0@``@d(hxdpT $ tdlT D ,x0 \@!D$ %D'()4*0+,$x-t. 13`X455DP6h790p<4=> ApXExFTH`KN,PLQDTW<ZZ[ \l\l^`XddhfHh,jj8Tkl@m$Dnpnto lq\qrxHy{|8,~ȁ(xhЏXpH8䡀@ Ĥl0ԧThh$@80$ 0pĀ`ŀŀhǀPȀ$ɀɀ@ʀ|̀,̀0P΀,Ԁ<Հ `׀p؀(ڀۀ`݀PH@p(tD\lh(H8l(x@x ,hlPdx<H$PpL@, ``!"`$P8&h(,@/2\30P456 7p<849H;`;$=`CPpDFG@ \I  K M0 hO T xV tZp Z [ ,]X ] ^ ,_D ` a b,cxijxlhmopXrt(yHh{$<,L|,``ԃpD(dx(< ܏\쐁HЗ̘8ț|؜읁`4L`D |(px̪\l|H\X8<TdDlt P  < `4!!Ł!4Ɓ$"ǁt" ȁ"Ɂ#dˁX#ˁ#΁#ҁD$Ӂ$ց$ց(%$؁x%Lف%ف &4ہ\&Lہ&܁&ށ@'ށ''$(t(()X) ))D***4+,x++,\,,,<@-(-L-$.t. .< /P X/H / /4D00d0`41112Dh223L3T 3D"3h"04$$4)4<* 5X,p5l,5d.6/T6L06(36|7@7x87;7<08=8>8@9HBh9B9`D:\FX:F:8H:ID;K;M;tN0<P<R<T=\Vh= W=X> ZX>(\>]>h_H?a?c?d8@le@Lg@(i$A`kpAkAxmBLo\BXqBsBtHCuC8xCDz4D}D~DX E$pEE䈂F `FDF GhPGPGGP@H8HH0IԷILI8‚JĂlJȂJ͂ Kӂ\K@KpKDLLxL((M#tM`6M7 NPG\NINKNKHOdLOLOL POpP QPQ QhR\QRQRQU4R(WRWRX SXdSXS[SD]HT]T^T^(U^lUbUc VdXVdVeV4e0WgWtiWiXjlXjX(kXmDY0oYoYp0ZptZpZPs[$uX[u[v[v8\v|\z\|]|h]`}]}]}@^x^P^0_4|__<`hT`Љ``Daa8aܘ0b<|b@bdclc|c d$\ddldHele(e̬0ffhfgdgಃg䳃h`Lhh0h七8iiXi|$jXtjjk,`kk$ƒkHÃHl ăl|Ńl ȃ4mȃmɃmXʃ nʃpnʃnX˃ox̃Poڃo߃o߃@p߃ppqhqXqlrXrrrhHss(s,t|ttlulluuv,Tvvv4w8w wD x`dxxx8y|y y zhztz{ X{*{*{+0|+t|$+|,}(,L}8,}X,}h,~x,`~,~,~(-4----L-.Ԁ.(.\8.H.X.(p.l...8.|...H@33@40P4t(6ą\7L<`8FGHL8Iac@drt(utxĉ{`<0܋(xȌ d0@8X(Ԏ Ȏl@4Hؐ((tđXD4`Дh԰|<̖ز\Ĵ䴄0|Șض Pค,,pܹ L<h0tľ Xl4Ä ńОTȄ Ȅx`لȟۄۄhۄ܄߄L߄߄ԡ߄dxL(p<ܤ,|̥  h X<@!Ԩ$ %hh&''<@((Ԫ2$`3`3:?<DHܬK,Q|dRTWXY[[H,bbԯc$ftthİijdp0qxt@8wx}0 HDtЌ8Dصܖ(xȶ0h\PTģHD`4xԺt$Ht,Ļ(dLpԵT超p@8l0пp p Å|Ņ0ƅ`ƅDž DžH8DžDž,ȅ$ȅtȅȅȅ@ɅɅ$Ʌ 4ɅPDɅTɅdɅtɅ`ɅɅɅ,ɅpɅɅɅ<Ʌʅʅ$ʅL4ʅDʅTʅdʅ\tʅʅʅ(ʅlʅ˅@̅DP̅l̅̅ͅdlхׅׅ@؅4مممDڅۅۅ$ ܅p܅8܅H܅<݅L݅݅ޅ\l߅@$p,X H(X8@$t$ ,X4<@H$pPXT`8hphXX`<h plxP<@h,Pxh\t  @  H $ pt   T <8HTh`Llx0|` D,(8tL X`t<  l<  X!P!d""4# $$(%d%D&&H`''t(,(x)**\++,,@,4--$@.p.@//T@00D181D22H3h445P5 6<787T88\9h9T::L;\<=<=8>> ?pp@AATBB0C8ClDE EpFDGHTHII<JLKK Ll LM N NT (O O pP8 Q Q R Sl S T UP U `V V4W >`?X>@>@>AD?B?8C?(D,@ E|@E@4FA$GdAlJAOB [TB[BbBd>>P?4?p @@@$XA`A(BةBBP`CCȪ0DD@E|hEE8F0FlGpGG @H\HIԭxIILHJJĮKK<KxPLL M,MhMXNN(OXUXбb 4jHm8rsxuHvz,|4|pH}< \8LD4$Xt̷ؔpЧl HP୊0̰|ొȺtdԷPH캊車t0LĊнŊ @ƊpƊNJNJDɊɊܿɊ ʊl̊Ί ӊ\ԊՊ4ۊDފ4 dX| P(@0!|#\,7l:0= A\DD|EJHTX`g4Phphhh\h i i,DR>R>S0?T|?tU?V@$\d@`@TaAbPAHcAdAd4BgBgBj C(llCsC|u D}\DDDLEEE܎?\@@AB@lCDذD$|Ep|F,GGTHIJ8|KMгM$Nh?$CtJpOXR\\l(rxyD   4 Ȳ h  p\  Ó DƓ0 Ɠ @ʓ ͓$ ͓| <ѓ ѓ hғxՓ8֓P֓XדדXړ0ړ X$x|X`@|$t@,h(P`$  8Th<($t@\(!$##D$%&((tt),-\.@01Dp244$06l6`8 9L : 0; <(!`=t!\>!? "8@X"@"A"`B<# C#C#E($Et$F$G %`HX%T:`>;>;?4<P? C?,E?xH8@LK@L@MANdA PAPBQLB(RBRBS0CT|CTCUDVhDlWDWEYPE ZE[Eb]\@$^|B`^D^D^FH_G_,J_@L,`Lh`8W`XaZHa[a\a]b^`b_b`bb@cbc0dcedlld(ndpelXeee葖DfdfPf< g<pgXg< h(\hPhxhixTiii48jjPj kОpkklL`l衖lmlPmmȤm\4nnnodoooHHpppD4qܭq8q r0prЯrd sXshsܵsxHttt\8uuuL$vpvv@w伖TwwHw쾖8xxPxyĖdyŖyȖyɖHz˖z͖zΖ,{@іx{Ӗ{pՖ|`ז\|$ږ|ܖ|hޖ@}ߖ}h}X$~hp~x~xT8 Ѐ4hxHL`00|@ ȃ  `  \@؅ $p<T!L')<+.ԈT0 1l35<7P,9L;H=4p?A̋\CEdGIKHMOQ,SxUĎW$Y\ [\^@`bؐd$fph klTnq s8,u(wГPy{h| L|0@|0Ȗ̎`HD䔗(ܘ(t0 `\@躗8DЛȼH``d—<ėƗԝLȗ ʗl̗͗ϗP їӗ,՗4<ח̠ؗڗܗdpߗHD,xģ\@,إ$8pTP   8Ш|Lh4LH!0l#|$ȫl&h(`+-00D13ܭ5(7t9< =Xp?`AB<lDG԰I (Kl@NO RP8UHWX4Z\̳x^`dpc@edgHhkl,xnxpĶ$thv`yH|}H0,tx4Ĺx\t@ dػ$p|T<,88|о觘htL<0||l`0tD8ØĘPƘ(XȘt`ʘ4˘ ̘XL͘|Θ(И<XјtҘӘ Ԙl`֘|ؘ٘PLژݘݘ4ޘdX08H(,x(\p@`|$p,LT t08 h  L40|Lx`,D$ ( t!# %X&'(<*H+, -l.x02P345479X: <d<=?H4@(BXC,ExFPHJ\JLLQHQV WH,YY\^@^Tbb@Xd4hl0optqydHz@{0|L }~,|xtT8쌙0̎x\@L4̥4@ঙl, Tкh<|( l™lę \ƙ\ ʙʙ`͙Pϙљљ<lҙxҙԙԙp8ٙܙdݙ\(ߙ4P4ldL`D(4@ pL \DXD|,|D dDLH0|h| LP0( |   d H  L|0l| ` d  D t  , |  4 P  ld>m>4q?sP?u?v?w<@y@|@d~(A~xAAB쁛hBBЄCTCXCCԏDDxDD,E`|E虛E F؟lFFGlTG,GGL8H䦛H0H|I hIIJ䬛LJ0JȮJ0K԰|KTK䱛LdLԳLlMPMMM8NN躛N O(lOĽOPlTPP P$DQQ›Qɛ4R̛RhϛR\Л$SЛpSћShқ TқXTӛTӛTԛDUԛUT՛U֛,V֛|V ؛VTٛW(ڛ`WۛWXܛWݛDXݛX(ޛXޛ0Yߛ|YYZ``ZZZ8D[[[,\|\L\]`](]]|D^H^^(_t__P `X```0د?$AtGİIXK`LMN4\QRԲR$8StSijPTUdUVWLXYZ4 [[ԶH\$]t]ķ^_`x`pahbD`cXdܹPe(exfĺdggd`hh8B D,@F| GHH`HHH,HpH I,I@ LI I K$!Lt!M!Ϡx>Р>Ѡ?xҠ\?Ӡ?l֠?נL@<ڠ@`ܠ@tޠQt@RGXRGRGR0H4SHS@ISITI\T4JTJTJ@U0KUMUQ$VQhVdSV`TWULWUWTWWPX(X4\tXX]Xp_ YaXYaYHbYc>T?8?\@Ȟ@BXPjdjxj0j|k̠TmPplrstXuw0``У p@ H,8|$Hا$Țpؚ<LDܩd,$|̪lФd,DHdԦجL$p0H,8@\D¢<¢hâĢ@dƢȢرȢ$xӢtԢX֢֢L٢ۢܢ4ߢL̴|`hT<D $4 Ը #$#t`&Ĺ(H)d+0,,/T124D47848D;Խ;$,>t>ľ8AAdDDF,GTIJLD MOR4r̖$@t(dܠTģTDD4hౣ$`tشH<ƣḍlΣhϣHHѣңpӣ,|D\l$Tp$8`4lh  \ (D$LdXX>?$@<@\AB$LDtDE8MX$NOOHpVWP`8Xb4cf$\itnuhydl|(}L4̏ (tx오 ``|LНD@ģH0$x$t<Ǥɤˤd<ӤޤL8@8  l< D DX(@\!$#,|*|l2(4Ih`JJK8LtL$MM(,NdNO(PSdDTTXTY,^_<de4f,k|lmplsv L\L@<,|DDl\ȩ \LԾ<åť4ʥ,l˥|Υxϥϥ\Хlޥޥ(dߥdߥ8<L$`\T@T&p'l4*< >XlFtIJLV`WY@Z]|f, i| k m o\ q s HuH w { }8  0 @( hx  LDę$tp䦦`@d貦dhl쾦h|æHæ˦̦ ϦpϦצ xצL(ئ٦<lH(t0\@DXx,|Lh L,`4pl$<0|`4`,D  8  !@l!!T"P""d"4#x#\#$ \$h $ $( @%8 %`%4$&p&&'T'' / -)<49<JHUh*<CZ_bZhu)<qg zd)<q  #,)<)<)< )<<)<X<h*<TY.;@\*<$7G.;@\*<47WZ]kn)<D7ux{\*<WZ1kn)<T7:\*<d7L3u\*<t7M  \*<78m $\*<7l 2\*<7 @\*<7 N\*<7 \_bf)< \_if)<0 \_mf)<D ?q~\*<L d>KN^kp)<\ \_{f)< )< )< )< )< ?)<$ fWZkn\*<7\  )<\q0 \_f)<D )<\  ).)<qtERUkx}\*<74)\*<\8:5)<T^D)<7tn(+<8 t)<8 y)<~)<)< 9>)<\(GTW)<4B  \*<!Y jw|\*<X\ 4oXfu]'S \*<$8\  )<0]q' (+<P]7|3 <)<48 CLOR_)<-d <)<D80Mm <)<T8m v\*<\)<dqH  v\*< \\_f)<   \*<d8 !   )<t8T!)\\_f\*<h!K% ( ? n q \*<8 "k   \*<"\\_f)<"   \*<8"  h*<8$   )<8$&    )<88$L    \*<8`$u    )<8|$   \*<8$ + 2 ; )<9$  B  )<9$ M   \*<$9$% V _ b e r )<%D + w ; )<49%h \\_f)<%    \*<D9%    \*<p]' \\_f)<'   \*<T9D'    )<d9x'2 \\_f\*<'Q    \*<(y \\_f)<0(    \*<t9X(   h*<9)   )<9)    )<9)    \*<9)F    )<9)l + 2 ; )<9*  B  )<9H* M   \*<9p* V _ b e r )<* + w ; )<:+ \\_f)<+%    \*<:D+H    \*<]T,i \\_f)<h,   \*<$:,    )<4:, \\_f\*<,    \*<h-\\_f)<|-?   \*<D:-b  h*<T:.  )<d:.   )<t:/   \*<:,/   )<:H/  \*<:|/9+ 2 ; )<:/XM   \*<:/zV _ b e r )<<0+ w ; )<:T0\\_f)<h0   \*<:0   \*<]1(\\_f)<1G  \*<:1j   )<;2\\_f\*<$2% ( ? n q \*<;2   \*<X3\\_f)<l3   \*<$;38  h*<4;4Y  )<D;4z   )<T;4   \*<d;5   )<t;85  \*<;l5 + 2 ; )<;5' B  )<;5DM   \*<;5eV _ b e r )<`6+ w ; )<;x6\\_f)<6   \*<;6   \*<]7\\_f)<72  \*<;8Z   )<;48\\_f\*<H8% ( ? n q \*<<8   \*<|9\\_f)<9   \*<<9F  h*<$<:l  )<4<:   )<D<;   \*<T<@;   )<d<\;  \*<t<;5+ 2 ; )<<;X B  )<<;zM   \*<<<+ w ; )<<<\\_f)<0<   \*<<X<   \*<]h=:\\_f)<|=X  \*<<=z   )<<=\\_f\*<=   \*<|>\\_f)<>   \*<<>%  h*<=?E  )<=?e   )<$=@   \*<4=@@   )<D=\@  \*<T=@+ 2 ; )<d=@  B  )<t=@)M   \*<=AIV _ b e r )<Ak+ w ; )<=A\\_f)<A   \*<=A   \*<^B A A D G *<qTCJ X \   $$0^\JC% ( +  4 ,,qJd uux,,qJ7 7 :  T'D$L$`$}$ :\s$$$$P%^%+<$d%q%u% %%Td$:&C&F&9f&s&4 4,$z&&&K&&&DHD^$& ''-7'D'M'*t>x%T'a'f' '',,,% ''''')<LqXl% ''' ( ()<t"q(%("(B(!(()<H % (((i ))))<$%%)/)c))))@PqD-& )))5*C*55Q&LP*Y*k{*~*-<_&******,> &***++*<0_q&$+7++,,,H\ {8' --'-S-`-g-<*"X+' x-}----P*<A' ------: 4$>W'---"H-)<o' ---N-: 4q }' ---\.: 4q'...m_(.#, 4'-.-6.zHD.#,' I._.|....q(///e/s/~/ WPP_](///130A0N0 q8u(g0q0u0e000,WPp_#(011-1214 44>(91>1A1G1T1,,(Y1b1j1}111*<_q5)111(11146 4_)111<^1)<!2 2232)2.2)<D>l)52S2X27224:XLC2 22x2)2.2)<T>)222|2 34 4)33"343)<)93B3F3h3u34 4)|3333344 4_)4!4%4!14)<@ *64?4C4U4)<* \4_4b4t4#,5*w444u95G5Q5<)L*q555}7727 # +t7774h377h*<T 7+777l38@8E8,,Hm0`+^8g8n8e/88<)d>{{+88858))+888S99+<t>ql+!9$9i%2\*<+ *939:9^9k9r9*<_,999999,,LU,:::;H-t*$m,':0:3:;:H:<)H,M:Z::#3;A;P;0 ,;;;;;;:D`#,;< <k<)<-"<,<F<<<<DWSx] 4#-<<)=g===;D <&->>C>>>>;\5, 4)V.*?;?Y????;3` +i."@,@1@s@@@PWP0`q(.. @@@@@@*<#.. @ AA/C=CLCcl 4/ D DDYJD*<6K/YDjDD EEEx)<0 8z/ NE\EE.lFzFF\WPT} </ @FF@@@*<d#</ GGsGHHHhWD HA/+I:]0TTTpTTT*<>q]0TTTUU"U(#,^L11UFUQUUUU#,q_1(UUUUUW<Ia2(UU V9^VfVlVW<T$TcM2VVVWWWXhЛ #\h 3ZXlXXY!Y*YWPm#jC3aYjYqY.YY,,P`{tka3YYY3YY#, (l3 'YYY ("Z,,ql3/Z8Z?ZZZZ-<p`#o3ZZZ[%[.[|;5(n:p3I[P[`[g[<)>hq 4Ln[u[{*[,,`qC4[[[(\ \,,tb4%\+\<\0m\s\,,D#Pwu4\\\1D]K]R]WW$:y4]]]b^%^6^hNWt# |4U^X^i^^^,,L}4^^^^33q~5 ^^^'`5`;`*< qE5 v```}1``<4 4qd_5```U ``,#`>Hs5@`aW@ a'a<)$5:aDaOaaaaD5`{X5aaa9bBb<)D%6Ybfbqbbbb<)`Ď%6bbc8W;cBc<)`(n6UciccQdeedLz H7eeeeee,,aq7e ffGfLf,,7[fdfgf&f<)7fff?f,,7fffIfgg-<0a  8 gg'g14g;g@g*<>q18GgPgZg<^ggng)<>qC8 ug~ggKggg)<>S8 gggqggg3DPac8GgPgg^ggng)<>qt8 h hh*h7huGuNu^ukupu,,$?( ;wuuueu<);uuuuu,,4;uuuuu,,hM;uuu, vvv,,4?n;+v5vlvvvv<) P;%w.wWw;ww,,l;wwwE)x7x||| |D4,h> {\,,H-> #KXaD5T?.>hqt|,,.>$4W0>uuGuu,,P1 ?KR0R`n L79?ރ)xBQd@ |9@~)<a:<@̄ل-;N4Qd?@K@VdPKYc<)L @D@Ά D(8%E@(-0 <A<)t?@FlAFP<*^ HA 1CG *<a58NA؈d )<?8OA  3ztQZ4 4bPB mz} )<?hQ9B ŠՊԅ(_ VB4 sv)<4&WB3*h)<`XBˋA)<ZB=JUo|)< ZYCR|)<&d\C 9)< <_>D: N,,|aDenqw;,#`bDŽώ֎)<0btdD ;;& jDƏϏ[4WPbkE&--IN.<?:lEUb#<) nKE#/TA PXq8raE"GВP%:N܋t tzE7KX,,zF 4hÕ͕4 4(F4AF,,$'̀PFWh," FN_"06,, Fy3|$В q>H /@DVHśқ$4<9qHS]vK4 4t' H Ahuz(.<?:HǞgt; 4qHŸ˟Ubi(.<:3I%_,,AI3$,< 1ةI"i PPn+5PIע\ch,,P qID8رIģͣݣq)<4H^J ~8Fb,c@c ܺJͥ2ަTchcl JfzVިHH $tJ)<dX#K5i 4D_ }K 9B8$4 KOXtN4\5LKͬ֬]ucl4 4oKs;ҭ٭4Dpb#LŽ?D)<bQL [n ,'PLGXpIد)<?L SӰ$DD {L+338GL,,?LS\x 4 4bMñ+V"߱<).M B-4=4 4bd]MLU_^kp)<?Mwe4 4bMʲӲy4 4cq0M&cųγ<)H`  N| ,,0c"N*8X,,<:Nִߴd)x)+?oN*3AYfm)<Nz@޵)<xoLN ]۶4 4I N+4E4^e)<$Ot~@@Ϸ׷)<-O#)<@@O*36JWD*`)#^O\ehp<)pO u,,(\O&tt)4 4h # 3Pr7ĺ,,aP~ֻ̻4 4#PaY.D*<PP +P60Ӽڼ4 4{ Q l))<@Q09R{Ž)<d(#=Rý}1)<^R+2)<@qR=FM]b)<Pc4R=kr)<pc!#S $tȾ;)<$@ BS ؾ5 )<4@<S(6J_)<LJ $ %S e!4 4x&T (59mz4;'0T D*<D@)TT7K,,*mT#0?a,, 4-T 217)<)$0TNWvU,, 11U]d)+ 3AUO)<q5cU`^lt<)` 8U,,$:U 3H4E{,MYW8Y,,cM|W<)NW<)PW $EJ,,LP XY_X !<4.d 4U(XR`Q_kD`4L qXBX;HM,,o[XXpy|d)<[oXq)<q\XM[5 43(_Xhux)<H`XW)<T@aX  38+)<bX2;>PHU,,,cY2;ZVHU,,c,Ydm` <+`` f=Y6?ByJ<)fTYO;XHb,,geYO;gHb,,tguYq~<)hY,,hY).,,Xp@jYKXx,,HkZ^9<)4l Z FS:5ȋq n3Z\_j,,(nFZ,,d@quZTTxM quZ5IXXXD _zZ.,# x{Z)Y@E<)T@|[PY\Hhm,,t@|L[t},,c#}f[j,,@`[Q@G<*@[Nbtld 2$\&0KfK<* .D\Tg<)\qZ\ =Fu;<)$ v\ +K<) K \ #._b,,c\ox{,,q\e,,qD] B< qX] ev< {n]dtK :(]ANS)<)]hy0)7FxSPL ]{j xS(Xp]@I\}4 4qX] +<) @] -% ,,LM -^+4Go p},,K^  <) e^1*;D#ȵ^ 3=be P|Op ^-:R)t* ȹ^ Q#,A dENU ej#,A dqLP, t6e`m<)  qe(/[`,,deox<)Ļ $e 4yPW4X|0eh|,,f<*q%f*7Jw<)d;$OV R|)*4$AD#f*D8d$g4)x#*4 4d&&g =G[U7\5)BgE)<4A)ngI)<DAq)gM)<TA*gH)<*g$5f;3d 1,h )V_5`9H3.8hpy|}1,,P/_h}XXOdAH 1hV" )dX\G9x2h   tD K D<tA3hR U ! ,,qP4h^ k v _  )<d4h   }1  )<eq5i Gh  ;:  )<A6,i   -- *<q6Gi 2 C F    )< q8i   6V"  )<Dq9i   P   4 4qY?j    *<q@(j  J J   $̊ q|C=ly   qx4 4{ Elh 4Hm8.\*<HAm x38$))<AIhm47Nw",,Iwm ;DGY`)<`Kmen\*<LLm%!(-)<tMmBO~)<rQm14N)<Qn<IL`g,,ARAnn|ft QpX UUn ,,Vun /TY,,rxWnr{)$43 qYnaj!)< ,[n `ip*+0eq[.oH)*AqP\Eo7@CKX,,\jo$BPW<) _Vp n4|XL} 2$crphqt ~+<<ldphq ~+<< ephq ~+<<ep !)<r gp>Jxv<)i[q 1Y<)Peqjoq$9_/4<)A$kq;LTCmv{,,Alq`JXb<)qqv>)<pePsqQ)*qsq"ZY*<)tr1HKamz,,u+r454w`r ,,xxr)<4\5)q}r ? 38,,ALr?HKW%U,,rZcf_z)<g#rK,,s,,eq4s  , 3 8 ,,edHs C L O [ b L.<]sg p s &{  )<qTms   `!!!<*N ܉s "")"\O"W"]"<)es i"r""8;""+<eC#s"""J")<s"""q-",,qPt"""w}1",,qt"""@#,,q1t ###ku,,qpKt""#@#,,q,dt ##$#ku,,q~t"",#@#,,qt ##4#ku,,qPt""<#@#,,q t""D#@#,,qȖt""L#@#,,qt""T#@#,,q@ u""\#@#,,q)ud#i#l#^t#,,&I&NXsxz&"&S-&<Xpl-x&&&ik&<Xp,))|6 43|y * * **|#,y*%*(*%4*<)y;*D*G*7Q*X*)*y*%*]*:4*<)yi*r*z*U***4 4Bz***4g+,#܋$zS++0+7+<)B;z>+G+N+f+m+r+)`)$BNzy+++^9++4X4B|gz+++  ,,<)|z,),l,U,--4 4 zK-N----,,Htxz.3.6.zH.)<TzM.Z.].`i.,,z n.s.w. k<,,p { "~..@#,,,'{ n.s..k<,,G{ ...o.,,f{ n.s..#k<,,p{ ...)o.,,4{ n.s..-k<,,{...'$/1/:/D8ha ^| g/z//i#111@1dt |1112!2WWtM$d|@2I2M2._2f2<)|k2t2x2=H$2,,|22&3k3334\5D #HZ} A4J4Y4'444)<g#q}444AH44<)0f>p45K55,,Pf(} "535=5Ue]5f54 4DBg#}m5v5z5i,,}m5v55m,,8}555q5,,}555y_6m6,,@}s6|66-6,,}666*6,,~666 ,,( ~666m7,,1~7!7%7ut)2)<F~7!7-7utt,,H[~575>7P7)t*TB}~ W7`7d7p7w7)<dBg#~ ~777 778<< 4D*~\8)8K8 99+94XO tn9w9z9|,,9999,,x$299Dutt,,3999H9: :,"Xy;%:.:1:_9:@:,,IE:R:Y:qm:t:y:,,tB_:::%;-;:;5$<(utc;m;;.<6<A< PXu91n<q<G1T1",91n<w<G1T1",4}<9<"ut<,,<<<(<,#`<<</<<),<<<;<<<,,Bh'<<<@<=,,7 ==+=RU^=e=4 4v======4 4xv >)>F>S>\>4 4 k>t>>>>>4 4h >>> ?-?4?+)*, K?Y??@@@D`4 %KATA_Ay;|AA,,9AAAAA,,L AAA2B@BFB)<a $q mBvBB8CFCUC, CCCCCC,,  D D6D]DDDp $΃DEEyW8E=E)<$4& NE_EEFFF4 4@ *5-aGdG-lG,,+N qGzGG kGG)<pfh, GGG'zGG)<TD-GH H3oH"H)<B. )H2H;HYH^H,p#fd/qHzH}HYH<),0HHHh3HH<)f;d1HII I,,1. II#IA/I4I,,B2E;IDIMI*h[I`I,,B;T3] gItIJTKbKyKL :,L LeL{4MBMSMd\ >MMMf+(.,"\?MMM2N<)@N&N)N:7N,,A X4T<Bh^EXRXqX h3XX<)_"XXY wYYY<) aNYYY5 Z!ZD5*b\\6Z9ZJ f,,bn?ZQZZ` {[[[ĺȩ pf[\{\ T]b]{])< 8l]]^7 Y^g^v^dԆc o^^^S  ^^4 4fp#^^_e 9P_Y_<) r3v___ _`` P|O4+{LtC+`z`Cb ffO{T{W{_{,,^O{T{d{_{,,X~O{T{l{_{,,t{}{{{{<)+{{{"*h |<)Tڍ|n<|G1"|,,'|<|g|_|||46` m5} }w}<)`*}x }x2}43M{{7}*hA}<)vH}U}p}C}}<)}}.~~ PP (y[ )X.C \_o<)xnH))ԓq.,,5kXf}I$IE ;<F؁-;dD\HQ-4*< q9h)0855` Q i`Hq<)HvWH<)ƄsCPU)< lǏ̅Ӆ؅,,܏n<,,C` V&NT&+<)$C#91n<6G1T1,,0=<EHLY,,xM<E^LY,,c<EbLY,,}<EfLY,,P<EjLY,,<EnLY,,ΐr;IWx<D$,:hސqz~$/ԇۇ)<Pgql%))`8d (V!k!!,,| $JY`<)t,w#3CQr|cc ӑ2;V384\5,ʍ̅45`pgh H$,,&As|+)-ɎҎ544CH/َ$,, !E3Q"4BH,#`F  WHu4 4L! o"06,,x ~ ѓۓ)9 (D5 {-<)@)<gdS8TT \(ƒzT ,,Q H*ޒOX_>qv)<DC* }ޘ(6 4DqX,0)<v(/ę͙ޙU29*)d-L1!dqx}1|#,TC1: (5 4gX3J'V*,d #5^ śΛR|OV4D L7s)<Xe 82CNE*<dC#:H$ϝ9 4 <֝&]Ҟ,4C)+CP_JW_@rw)<C `~ͦԦ)<Xw`TajhNXHbpʧѧ<*L"Hc)<hqd*37B_:i+<qdCLZHjx<+<t4fRu˨Ш,,"gi(6,,k <IS,,0hs!-ft}<)du֪ͪD(Cv ݪ/dt1#0|ǘ 47:tB#,|EHKO,,|0RdF))`D}ìP14X$~-&Qe)<H̭! <3PhEhX,29*<phEj DMl>A85 4q ͮ&y 2L- Qșs I,,$ߙsų I,,ɳҳq!)*4qD 7@CKX,,0b-`p <<v ҵ9xGT` LT:5C#`n{ YXhqК)26`m*<qh)2r`m*<q0:#+)<Iȿh 8<^9inD*<  Sj)<e %-r<*"wȼټF ,,h-?C,,Cl $,,ʽӽM_,,CUKR5DR qZ y0wˠMV]q Ix,,C$+$Y0YLd-T=k7EX$` #FPs.4Dxf # @G,,dLaou+<hq ԡ e,,d7,, ?+< K,,,#U=DK+<Cqh>RwqL.<hOg ,,i8`!2YMR,,0icloG1y,,<~KD<$D+ ,,$'9GNS,|#ȋD^gn~)2)*ȋ$D G!',,8x}<FJut<,,5}<FO ut<,,XOT]y&x ##Xewz *<Pi4y)-c^9ID*<: $NRW],,V$,,#6;X"(,,pịXuz0&5;,,x -3,,i Xim=,,4D8  Jm,,DD *$(-W,,i9vW[,,TD0Jluy,,[ 1,,l(,,Tz $-1-7,,q  $-<-7,,q $-B-7,,q| HQU@a,,q8 HQf @a,,qä HQr@a,,qѤ\~5,,<ߤ\~5,,\~ 5,,T7%K,, )%t:,,! 7-K,,|41%t:,,G5Hb,,TZ 6:,,m ?K,,,D%t:,, I38,,  GTXSf,,t!kx|]A,,i\"ϥ Ti,,i0#EAF,,$8%U^',,T.{'&h3?D,,.{P(?W`y%<).{)Y8'.<)D/*r ARP4PT$D$i><) !\C,,qĪHU^-ry*+<DqD \*<F-)<ؒ\-:=[`)<quq4WG GW|#,jWJ)+<D1#@« *-Tcj<)0jȟ٫},,Pj+5|},,pj 0[)<jC#8_  -&P*<s+<GTyhN`PDx B^k\*<Dq ~+*E<7@CKX,,*<Eq 5^e))܋ $07|KX,,tUGU\)<! )<$E(<"YO( 5IXq{r=KXH 2,8 N Cir,<40qet,LLS ~ u 4 4j %6k8C4 4 T DY<T Ǯ (yFTd .H)<jlR  )04 4jPz;DW<)L$yNSqp~NSqů  )<91G1T1,,#f&AH43܋(h <7|s3KX,,3{<C4 4h PJ=av}4 4pc<)$ d||| |D4*9OQ_ll,,0ܰŽ4Y0L"0h \a4Ļ$1vv4Yk<<*pͱ # U",@ v)<_hN`P$"$}1'hN`P$`A 6?Q`y~)< %1# e )<0k1#x< 4Pk+5 }1#()<4E1#)/8<38JQ)<DE+5o X1#()<TE1# dmq_{,,Lf <DdEQ(f+`\y ^v-D Q0S#`is4 4tEFD!)<E`QH$ 4D3  0 l   <6L%Ɂ|      Y<+5X ( 2 iS Z <)pk+4*c k + ,,E   e )< %    0lt ;   % , )<E R3 = ] Vo  <)t1<\{   . -<#   7i w  Y%?;    <)  KK  _$е4,,X 7CO4 4k + .*5D<̑1##RXdhItD8$hQY4DEɁh%yY-$,<FI@&c?DM<)%( huz~)<*'`cp PS1/Ҷ43ԓk01CKR)<22gqvM+*+5 5!7 $,,5@ 9V".3)<D{7ZDQU#UwNYĔ8t=|܎k:0[)<E;#08lPU+)ؔE3< \eh;A}(+<Ex=Dh*)t:=E.<) &>4 S4M(+)tHi BTJU<)Cܸjsv,,(E^9,,d2qF-KV"<A,,2GTbt<l)yO(,;N,,hP%6?Skpu<)L&(QAĈU 4T =y9xh*<" S7Ww ^u9>.<tlX(Q[YO3|[Y1QT}1d)<1#,\!(kt~-*<EWI]?CB P Y : 4&T_Wx   s V`P=(`{    NTk`  ^!+!!P# qcD"M"u"d ""Ԉ\dؾ""5w",,dV\""f,,d["""`"#",F(e# #'#^#a#",T3f ~######",Fpfs7 \"#f)<f6 ##j#)<lf) ###/ $$4 4$F1#gb$#$0$6 J$Q$4 40li ^$g$j$?_r$)<1#iȿw$$$I$)<j$$$T$$4 44Fkw$$$_$)<l $$$g %%hN`PL#,nT^$g$%n_r$)<np'%0%3%{^A%)<Lo F%O%Z%v%%ԈPl1#pp%%%%%4 4DFq%%%A%%4 4TFpr^$g$%_r$)< s%&&'&4&?&Y`P tlL&X&q&&&&4 4v^$g$&_r$)<Xw &&&' '43dFL#x&&'' '43tF7z ','5'R|Q'Z'4 4pl+5{ c'l'' ?'')<yp}'''t((hN|Ol~- k&()(!-9()<L#K>(K(j(2f((D*<< i(((S()<:#Ԃ(()X)()/))<F̃ :)C)L)g\)c)4Dl1#Ȅl)u)x)tH))<`)))))45`l)))A**D0<&).*;*P*&***TԻl<***H4*<3[**+$+++)<Fq{(6+D++`,,i $  --&-T-b-m-|F3Lx---m-= 44---U.c.n.YZ̑3E...O..,,F 4./ /1!/./Z<9. 3/A/\/J//)<hzV$///mT/)<hI z ///1060,,F{A0E0R0D*`)7pY0b0f05,,m0w005G1U1_1 =Dhj <' 11U*h1)*q̩IaY11W.11<) 'pq122NCL2Q2,#m$ f2w2Y 22,,L'Ĭ222H2*<q\w$22%22)<FqL$23^3.M4[4g4 0j yI 44444\*<F 45/5<I55\*<'9 555;6D67\5й Y6f6666\*<7'7/7!77j8F(789Y;;a;lXh 8}<<<,ut<,,}<<#<0ut<,,|(<,<\G1"|,,04<9<=<cE<,,0|(<J<hG1"|,,O4<9<R<oE<,,poZ<s<x<<r<)<1#l<<<hU=)<g5 ===17=<=,,Gp ==G=17=<=,,GPa=r=v=C==,,$G======,,4G8 =>> 7>>>,,\C>G>.f,,K>T>n>ʥץ>,,zd6>>>~m'?.?4 4k Q[?h?? @@@<T,H{;jQ@[@k@e/@@4 491n<@G1T1,,@@@<UAAFA<)l h91n<qAG1T1,,wAzA;,,~AA%A,,8|AA G1"|,, AAA~V"A,#`(91AAG1T1,,DC2AAutt,,\AAA$B1B6B,,sSB\B_Bl;iB+<<DnB{BBBBB,,4xBBB CC,,d\3C6Cf,,:CGC]CYyC~C)<0mh6ACCCK)<?CC)<^ 6CCS CC+<DGq{0CCC))`,CD.<)'2D"Dutt,,$*D3D6DO.FD)<<KDNDLY,, VD_DbDY%lD+<qx&qDtD`.DD4DTGqPqDDg.DD4DdGqjqDDn.DD4DtGqdqDDu.DD4DGqqDD|.DD4DGqqDD.DD4DGqPqDD.DD4DGqqDD.DD4DGqqDE.DD4DGq<!qDE.DD4DGq<qD E.DD4DGqW0E3E6E>E*<qrAEDE *<qAELE *<qAETE *<q<AE\E *<qdAEdE *<qAElE *<qtE}EEEE Z|OHq /AEE *<q JAEE *<q8 etE}EEEE Z|OHql AEF *<q AE F  *<q AEF *<q GhF F;:.F3F+<$HqX :FAFMF+<4Hq *uTFWF%;u+<q "AE_F, *<q =AEgF3 *<q XoFrFyF9FF+<DHq8 sm5FF?F+<q DFFEO+<q FFFLF*<q@ AEFU *<qh AEF\ *<q AEFc *<q 0E3EFj>E*<q 00E3EFq>E*<q8 KAEFx *<q` f0E3EG>E*<q AE G *<q 4GGB*<q AEG *<qH AE$G *<qp AE,G *<q '4G7G (*<qh #AEcG +<q >kGvGGG+<Pmq, hm5FGF+<q m5FGF+<q m5FGF+<q@ m5FGF+<q m5FGF+<q l)GGHGG+<THq oFGG+H H,, +HH^w"#,< O H,H6HNH)<dHqP dUHHHMI IVVpm uIW%2*<, I(I4I #MIRI: 4mq ]IfIjI9wI~II*<tHq 'IIIBIIP*<t IIIUIIP5 4q IIIdm:I: 4q< MIItqJ:3  JJJh:J: 4q ':AJDJ ;:JJ*<4 1OJAJXJ;:^JD*< BhcJfJ5|w)< RhcJlJ:|w)<X o rJyJ?_J)<m |JJDG1J)< JJJ,Q5KLK`p{ eK-nK-~K|#, KKYK)<t k>KKoKh*<g#8 KKKKK8W4H3X! KKKKK8W4H3x" KLL(O6OSObcP @0 =!9Oy%2\*<0 P!9O~%2\*<1 p O PPh38P=P)<HqH2 7HPKPKq)<q2 OJQPUP(;:_P+)3 fPpP~P>fPPd5 PPQ=QQ;\5|$ l8 QQ[RgSSS$4 >  WTeTTUUUЄL 4D  QV_ViVmVV:D (G )VVWXXXĹN \M = YY+Y3YYY4D qP e ZZ7ZnZZ)<L(qLS u6ZZZ-<S ZZZZP-<7DT ZZZ^Z(;D#T -ZZZ4;DTU 7Z[K [P*<U [[%[P*<7V 7Z![K [P*<|V |)[-[G1J)<V #\5[9[f\*<V 6\5[=[f\*<V JA[E[* )<W YhM[Q[6|t*<qtW jA[Y[; )<W a[r[[>II\x)<P Y I\S\\qi]s]3 4H ] ]]^^^^L; 4I b G_X__>__+< ``qUacama7 4J ph aaWbugcucc  7Hn #cdRdLeZehetWWK 7`s = eee, eeP*<Ht R 7eeK [P*<ht g g ffff"fP*<Ht )f:f>f\fcfd;D:u jfwff^Aff|+<H}v hff|t*<qv -.ffHff4DH#pw ff.ff4DHx fg g~g)<qhx g2gIg gg,,(|y +gg 4g,,mz F ggg h-h6h4 41#| Ch {Lh)<} t{ThWhah)<~ hhhkh|w\*<p~ qhhhii`SS| , NiWiZizii,,I T iiii,, _<iiLY,, iij2jjD <l% ȅ k kkGkLk,,m _kbk}kCkk,,l q ll(lVll<) q؉ lmVmtnnn4t~  D6o@oo-p;pIpdxH fppIp,, tppp ^7qTqT$, Zdqgqhu)<x hD*mq|t)<К ;*D*uq"Q*X*)*( 29q22t.2,,I| qqqeqq*<(G<Ԝ r)rgr IrrD0<LV Lss s,,0 %s1s5sisqs<XX vsss "t*t7t4\ `titrtTZt<)nܤ 9ttt x_t<)0np Sttt.$tt,,Pn ttt u,,$I  uuu,,4I< t)u u,,DId  u5uu,,TI CuFuMuqutu,,T u<u<u,, %uuu̅uu<*dIX 2FuuFv,,pn F #v,v0vz4v+) [\;v?v}f,, o #v,vCv4v+)< uGvKv<u,,h 8Sv[vovvv)<n !vv!vv)<nĬ [ *uGvv8;u", kvvvvww)<tI ww&wzjwxwwlDIL 7wwKq)<q 7wwKqw)<Iq 7wwKq)<ql 7wwKq)<q̴  7wwKqw)<Iq, %wwwx%x,x)<8 ;?xCxF%[)< S?xKxK%[)< t 7SxWxYK [)<h _xcx^H)<ظ _xkxcH)<H _xsxhH)< {xxxmxFx)<I xx()<H $xxx2@-y8y`|qؼ MSy`yzyUyyhN Y(8 nyyzv=\zgzhNY| zzzAz,,d hzz|zz,,I 2zzutt,, zzzq۶|{{<X.ȋ8m p -{{{| |,, ) C|%|9|@U|Z|,,L)H ai|v|~|||,,IP y|||Y|,, |||eu>}C}h*<) d}r}}1?OxX :` L1\: 4n1@  2fir))) <0<=,, ![WɀxYO ; Ҁ߀H`S`PI L 7K [*< \#15SǁՁ|@ v+O65 * ւi@HM,, duxm#,<t kƒ,,n+54 (̓ڃރ05|.<o  P]sC2`)*0o1# 0΄݄*T <)PoD ;$!*-TKTt 4It I[|dlKq)< Xjsvu*h<)<Jd  ,, h5g+<( v{ƅ΅*hׅ܅,,J ߆J݈l,  Ή׉ۉDk+dX3| v9xXb7\5<q x0&7\5q   WWh8 /W8vJp WWO enkx } %03 4U DDX S\\b $ `4z | neތx 1\ 6 =Y| ^cf  $ uu 4 1  O'X\g, <x l'u\g< <H y'\gL < %\ < 5l < EȎ| < U̎؎ <$h f܎ <4< w  <D   <T "1  <d 5DHo <t  t <P ŏȏ̏ < ŏ̏ !<  ŏ̏!<(! ŏ0̏,!<p" 4ŏF̏d1 uuBl1 *uuJt1 Buu'R|1 Wuu/Z1 luu7b1 \\?h 2 \\Im2 \\Sw,(2 \\]|< <2 \\gL(P2  \\q\0d2 , \\{l8x2 GEE 2 bH3  ڒڒޒ@6 ajm7 uu7  8 uu8  .!,8 *u*u6!X8 *u*u*C&X8 DD>Nt&8 *u*uNW&P8 *u*ubbd&H9 v4x!X9 )\\%l9 8oFoF9 Fʕ 9 X\\ڕ4&9 g ,9 v% : DD%0: &H: DD %l: 20E;U&: ]I% Z&; *u*u4; oFoF$&d; )Ֆ; #ޖ5; 4C < H  F=%L}p< UDDB[< dRd&`< tbkn%\}= %l3= DD$= uu= *u*u&$> &<> #0 d> uut>  =@9 <JP*<pov? <SV1P*<$JvH? ]I^a!kFr*<o? {~*<4J? { \*<DJ? A ǘԘ\*<TJ@ \  H\*<dJA y=*"%2*<@B 7@GP]b\*<tJB icru)<xC KA%)<C 7@P]b\*<JD icru)<4E C *"%\*<E _icru)<,,qHO CCGK,,qQ O,,qQ  DDRO,,qR 44UB,,qhR 9 XX[^*<qS P ajTm*<qT m uux,,qT  *<qT rr u*<qpU x{Y~,,q8V !,,qV 44UB*<q8W  r  *<qW * ##^#*<qX H x{Y*<qxY l *<qZ Ěǚ&ʚ*<q\ Ϛٚݚ *< _ Cu*<$` jT *<a L)*<@b .)<`b 1)<{|b )  47)<{b B 0E>AD)<b eKJ)< c OM)<q(c oFSVPZ)<qXc 0E>aSD)<c  eXi)<qc g ps\w)<q0d g p`w)<qd " g pjw)<d < g pmwf)<\e W':p^J)<e qY0rsǛ)<Lf ':̛x^J)<f ':Л|^J)<4g ':ԛ^J)<g ؛)<g ܛ)<qg  oFSZ)<qh 10E>D)<Ph V  i)<qh p g pw)<qh g pw)<qLi g pw)<i g pwf)<j ':^J)<j Y0rǛ)<k ':^J)<xk 4': ^J)<k N':^J)<`l g",pl ",l  )<l 1>A/juD*<C#ln ZŜk4|C#p М%1kk|r >'r (A'r ?D'r Wt"'xr yG!'hr J$'pr M0'r P3'r S<( s V?(s ZKL",s *^N<" E)<(u oF,F)<qXu Ȇ 7)<qu " IKT)<u t* PKTRT)< v QÝ̝ϝYQ*w)<dv ljb՝؝aޝ)<v cBb՝lޝ)<w 2{)< w )<{E)<x %0E7>E)<y oF;F)<q4y :*u?B ;u)<q`y 9*u?H;u)<qy \< N")<qy x@ R;KTRT)<z PZf)<z ]^s)<8z @bz)<qTz h)<qpz Z0En>E)<z .p oFrF)<qz 6 v)<q{ dz\*<0{ d~*<qL{ jm5F*<q{ Ӏ0E>EP*<{ w\o|P*<T| q"Ew"",d| q"Fw"",t| 6ў؞ߞ)<D} A#*)<~ =JOLqx)<L*~ Zş̟)<D ߟd)<tL )25nq?)<Ā /)2Dxq?)<< M N( im#"L oFoFzZ(,ԁ j( m) "T "\ 0 )$ R$)d4 t4)lD (4T oFoF(D oFoFƠ(< ܠ|" %" 9  *<q4 `  *<qh ŏ *<q !*<4 4_X (/7 < i4Nt̅ n^lwD*<*i} @$l,<i} YâB7>d;DJ} hM[n8<1x ̣ӣAe ݣ,,J ?,,J $C;,,0 H Qy0I`R`  wDDdE*qК [ǥOХ=ӥޥ,,qd ~:,,q 7,,q  4,,qH !*-.0A,,q$ FOR*Uf,,q -  k\*<3  Y66$\*<m ԡ  4[^t44\*<J u\*< ̧9DI\*<D4x c/)<  Ĩը9gl\*< +Ԧ  өީ\*<J  1CNS\*<ol  lo9{)<J !=h*<4$ ? !,EI&T)<ܫ ^enyMӥ)<op }enUӥ)<o en]ӥ)<p ͫ֫e )<40 '>mxh*< ɬԬ3D@ )ݬ`hO@t Q  )< w Bˮ׮lhh q  ̯ׯܯ*<L+qd   %0;: 40p FMXd @ :qϴڴjH\`Kg#h Y ).\*<K ;HKY", ^gjx<) ŵ<) εߵ<GN+)`\g# 3iz}+<g# WͶO&/*<}g#X NHWda*<g# fornEDE0 (Ʒ xd " }<+.1<,,qp E <rE{N,,q h SZc)<$K jq; )<4K *uz\*<PpH *u\*<ppt % ƸD*<C# % W˸Ҹ)<pP H W)<p n uux\*< \\_\*< ")<DK8  v)<  *")\*<` ,  . \*< Z S9c)<TK jB; )<dK *uzK\*<pL *uW\*<px cluh*<tKh$  Ĺ˹3 4K = ع߹)<K ` )<K ع)<K$ )<KD % ƸD*<C# %  h*<q  *uz\*<q H *u\*<0q t ع')<K 0)<K$  9BSv{)<+ )<K0  )<LL .̺)< P*uz \*<PqD s*u\*<pqp  v\*< $)< >)< CLOӥ_)<8 /S[pt)<+ T%  h*<q v v\*<L )<Lh  )<$L Sc)<4L j; )<DL * v\*<P O*uzɻ\*<q| u*uջ\*<q i\*<q \*<q KHA%\*<T  r S*<q 7^gr,#`$ s =h*<X ~ ȽF\*<t ̽ٽ,%X+)`Ti} 045P þaL]fPP`i} (ԿtKWlDx} ,, C44TL R)+dL #[)+tL #58y", 75<z", M@Nc{}C#| `,< ,*E P^+ 6,,L ]vXh T ;t@T    #*8 4rC#h 5CX(xXC#  1 @ [D*<C#` D3BG(6 40r4 +P]dTx\D 4Prq A b[h|\& d  Yl{$44+I@ 6,,L Gbs!!" &MZ`q$ )<L% % +H؏pr ( =4ALh{)<r( S()<l) \ d)<) rwr)<- )<. )<q`/ 2*<q/ x -BGc~:hDrq\1 K,,L x1 6I,,L2  c4DC#3   5F(6 4H4 &Ohl0VSqh6 K ̯"\*<LD7 \ )BJhZrI8: q6,,L: 2(1t,,,; P<QXD*<rC#< kxp73s> $9DVX0s?  Sa|HC# B  +EPU7 4LB t`qVO , D >|3"|,,\D J=A&)<MD ` -8ULW)<PsXE ybkrp)<ME )<$MqF 2 *1)<G >Ob)<DI )<ps,J  (+)<HJ =/?)<sJ bkJZ)<sXK 5er-)<tqL KhXt)<TM b']JY`)<TN ys|,,P )<4MDP  LLO*<qP  ? <P*<DMvhQ a "%<(H7*<TMQ V >A9DSX*<dMpR _b6\*<tMR K ? <P*<Mv S  "%<(H7*<MS V >A9DSX*<M(T _b6\*<MHT  DDR*<lT . 0ep*<qTU F wO*<q V f O*<qdV ~ LLO*<qV  DDR*<qW  DDR*<@W  DDR*<dW  8t*<q8X  p*<qX % +*<qX ={))Y K:LEDi}H[ Z$I,K 4H4] i(TadkR<s^ ,f<P_ ,wPhd 6D3e  6D3Tg  "%( @*<h $O`c T<M~j   /)<j $ 5)< k > *<@$k O (+<#ht1# ( S`c;oz3\51# ( ;!xSt ) ;%)< 0);75D  O)Y;;5D  d) u;IDZ *t;*2<)OB *:em;^<)$OG *,-1;9($<IO +0.;?;44N|S +8;PZ<DW .+#Nj; =D$ #p] D+86BF;{Oc Q+4;(OIg ^+,3<@;bnDDIi k+0u;T 44ONs x+;Ock)<Pu#hw +~;Z!)<pu#@| +5?C;)<+= +;+<D5#P , cmq;n)<l -,  ;f r )< x A,x   ;   ,,DOܕ o,   ;  ( - ,,u$< ,h@ C ;12M ,, ,R _ b ;y   p#,TOL ,   ;   p#,dO B)   ;"##,0 ,$   ;(  $ \ZPtOŅd ,$1 C G ;2^ i r \ZPOŅ ,0   ;X   `PuID 1-$   ;( : dtcx J- I R Y ;:p   *<OI ~-   ;D~*< -I -  #;CN4 4 .$U;T<uL# 2. ;~(9*<p B.$>{;PL# q."GK; ,,L- . ;FQ*<q .X]Pc,, .uxxP,, . {P;GM#,O /U^Pth{,, / P|#,O #/P,,d 9/P  %)<O4 R/KPHA%)< j/ vP)<T }/09DPWjo)<O4 / vP\*< /zU <) /U<)2 /U2<)O3 /U,,4 / $(U[`)<R96 0e~U|)<g58 0 Uo )<q9 0   U< G )<q<; 60L a d U D+<Ɂ< A0   U   ,,O= \0   U  !!"!,,Px> l0)!^B!UTl!}!,,<@ 0!!!U! "<)D 0" "Z6.\*<4E 0WZ!"Z<\*<lE 0 $"1"ZB="\*<DF 0B"ZO)<`F 0\_F"ZS)<tF 1J"ZV)<F 1N"*["Z[̯"")<uqlG 41"Zj)<G J1 """Z~"# #)<T qhJ 1@#I#ZY#d#)<qK 1k#t#Z## *<P3%%%6DPv3V g2&&ZT7&<&)<DPqW |2K&X&Zd&&&h*<pv\X 2&&&Zu&''(+<vY 2 '''.'ZB'M'R')<TP|Z 2 4UY'Zg')<Z 2p'{'~'Z''W`b{[ 2'''Z''')<dP{D] (3'(Z(5\5{] C3"#(Z(r *<Eh^ Q3%(6(A(Z8r(}((8D\5tPE$` t3(((Z(())<vg5Pb 3 )Z)b)Z)**8DD h 3$2*K*O*Z**EHl 3***Z&%A+L+,? 4P3n 3[+l+p+Z++3\5g#q 4+++Z&ϴ+:Dg5,r 4+++Z3++,+<Pg5,s 74, ,#,ZZC,N,*<Ixt G4U,b,e,Zm,*<Iu [4 ,,,Z,--)<-hx 4 4-A-D-Z_$--PD 4P0z 4 ---Z...)<-| 4 ;.D.G.Z...)<P~ 5...Z$./h*<g# 54 //!/Z^//<$ (5/0%0Z01 1*<X~E$ @5431@1C1Z?%O1X[<E\ J5V1Y1Z)< ^5 `1c1Z$)<̍ s5f1s1v1Z'116D3@ 5$111Z2111DP~ 5122ZB2.2h*< 5 32@2G2ZMW2\2)<P 5c2t2w2ZW22(+< 5 222ZgF22)<v 6 22 3Zt/343*<vH 6?3L3O3Zs338=DC# 46333Z3*<3 J63 3Z3,,H `63,3ZJ=4I48 4g5 m6 R4c4g4ZB4445DPN 6(555i 15<51<< 6A5O5S5i555qP#, p7J6S6Z6m}6664jSP2L 7666m1L6-<2 7\66mF)< 7666mHN7Z7a7(E3w}L G8s7|77md7*<3 k8667mxL6-<2 8\67m)< 8777mE8W8d8Ĝ0w}P 8s7|7v8m7*<3 8888m'888@j4RQ2P 99 99m:L9X9)< 09_9l9x9mO999(E3Pw}X R9 9 ::mp:::4E\5d +5@ 9\_:m)<T 9\_:m)<h :@:;;m;;;D#  Q:H;;<m<<<d1(5 :===m P=g=*<q :l=u==mB===4 4pwɁ, :&>/>2>mML>_>4DɁd ;h>s>mZ>)<w W; >>>mo>>Ԝ y;>??mi?x??@EDwɁ ;,???m? @@dDw< ;()@2@5@mD@t 4, ; 0mep*<q <M@mtV@ *<3 3< [@\*m̯d@*<q W<A|$ <}<k@n@}y1<#,( <}<k@r@}z1<p#,| <v@@@@@@,,wp =@@ABAAAt5 4Xn $ u=BBGBWBBB5\5 3 =BBu)< =!Cl*C{4C)) >Z;C>CHJC)) >oFQCTC)< 7>u\C", Y>`CjC}CCCCpO|O 3d > DD#D7DJDWDOOQ3 >$^DkDDvEEE)<n >,E EEE)<g# ?(EEE F F)<g# ?'F4FPFPFFF*< 3 G? G!G$G'G2G*<q e?9G,, o? ?GQGUG GGG#,x< ?GGG H)H,0,8x ? >HWHpH|HHHj#~q ?I)I8IIIIp@D .q@I"J;J7KyKKDD8x M@KKK L#L)<?;j@d*L8LLMMN11L q@NNNNNNh*<$Q#|@NNNNNNh*<4Q#@ NOP?TeTTd8 t 6!B`VxVVW!W.W$ | i} 9WBgWWXXY*Y> 4L g#BDYYYcYY4 4CDYYYZ'YY Pԧ0xDDZZ+ZRbZmZtZ45`\4FDZZZJөZZ))`tGD[[2[Ac[t[{[46ID[[[ [4 4I]sx]]]> 4.g#|Z H]]]y ^^,Px[%H!^3^Z^=^^ PjȊD ]>H^^_=_F_ Pj|_WHc_s_____ PjapHX\c\_u\\\`4TQcH ``#`vG`X`a`3XE`.g#dHt```.``D1#fH ````%aLaYaT 2hH\jamaBqa\*<iI Y6xaa6$\*<xo jI,\jaa|1<Gj.I abbb0b5b#,dQkBInQnFynn*<L/q̝AMnnnnnnP|O|nMoaoo}qqqU Mrrr(sQsysi},M ss5s2)<qM sssX#t`tit@61H\-N6ttZ,,Q #N$$ tttxuuv\o\2N @vKvRvkv|vvZ|Ox|GN6tv,,QaN vvvwwwlm(q \qNaxzxxxxx4\5ytNxzxxx#yx4\50yN*yCyJy)jyqy4\5QN xyyy=z3zHzm,m qNsz|zzzz.<Q7Nzz{m{y{{Pyg5|N{{{|;|\|ԃ/ On|w|||||,,Q +O ||||||)<QTO }B}F}}};plO}}} }}W1#O/}~*, Aņx{ @ ̃rg#"P g[t t: 4pyqEP8 щމP]|OQ\P6t. ,,Q4xP}<k@ 1<,,PH  :MV8S/C"Pkx .)<d #P͊7 ׌,b4l C#3P L e#(: 4 0q4Pl;NZ hq q;QR25 ;F#,<<'Q K^f "Mht=D\C;QwϴڴjH\`Rg#EMQ ʐܐ\*<yFiQ)<IV(yhIQ^ÑƑx<)JQԑבŵ<)LQ Y# +<Rg#TMjA{',*<$Rg#MQ 3<?TgpP5\54Rg#NA}'x)<g#lOR/}x)<g#RCRԓݓG9LU>\5L0g#hT-R##zU*<g#TWR~^*<g#TlR$jɔpE\5yEVR$ڔwɔpE\5yEdWR,%"  ȥ wsSG{ȟ(p0 #S$Ԡh@RcH H܅+S}$ #>S us\*<(OS~ӥ*<DRg#aS¤Ӥǥ*< W g#S !,gzP5\56g#XS0E*<TRg#@A̦Ϧ*<dRg#S&++)`g#4SΧ+<g5S$6C^٨jlSET,+Ax+'AR@m Eؤ.T Aͪj@tRȦHTM/|Elg5 fT0E6U*<Rg#LVAH+U`+mr*<Rg#L}T}o$)+< g5T0EX*<Rg#}Aj*<Rg#T|7ɬ*<g#0OsάѬbgmg+<g#T׬(P5\5zg#A9JM`sx*<Rg# B\6*<g#T $<L`*^` g#UۯlS_4 4g#U gqu$*<0zg#A##.c*<Rg#A8ӥ*<Rg#hEUF_S_e*<0 g#_U$ƲKcrkR8P E<vUij#%BQLg#LUr{c)<Pz`UȴuLĝԝ0g5Ur{4)<pz,UTLĝԝ0g5Uy 4 4 1@%V8QZ:ER3Agpsx)<Sg#>V3<Tp<)SdWVɶжB'; 4$S(gV O[b+<L1g5|V\*<g#dV .׷ELS$V>%.P5\54Sg#V ;l+HFn*< WhV>Sĸ Ӹ*<z5Wg *<z5TW$-4tC,RW*<z55Wf'?D*<$ g#KW{;\5zg#^W кٺ5R]O`P7G9$qWvb,E\5{E`W ͻֻ5>ED8h@W]fi ED EW̼ռؼ P5\50{G9W"+2 _|X@\5d7EW½* -8X@\57EX_Ñh5 y *<P{WL.XC FʾѾ*<p{5pEX޾Q  '*<{5ZX0 ,9f ZmxP5\5{g54oXÑs ĿϿP5\5{g5X$޿#  ##4 Xefn *<{5XC& X@\5|g5X <U`X@\50|(X o|  )073؁qh X$HQ\ E387 A|7O x)<DSg#p Y W F,1x)<P|g#,Y@̦Ie fy;\5p|g#BY@̦o fE\5|E$@v Y#*+<g#XY} 0;D+<T8g#oY0EW *<TSg#Ai *<dSg#Yb, *<tSg#Y 'J x)<Hr g#Y# C kOO}Y(14: QdoP5\5|g50Y~A *<|g5YT :S`O\51#d+3B  2+))` ,kZ:GR v)<0}H-xZK p8 4P}h.Z ED1#/Z(/: (#TmHl2Z $ <Sd4Z$(1 t|dxP87ZJ AMV*<g#;Zt Dhm|md ETJ[ Ko p$kxP qS[ aju9\5p}EU'[ ,0k4R}EV9[*9%>\5S7VM[(,5@B15`i#4R}fWa[ t}NjADDh-\ 1<C-<t jB\ bko-<lX\ !(AD}(mo\ 7@C^ipAD8n\ y+ɬADS$o\ 7@^ipAD4p\  TkR44r\ 9EI$4dXt\ SHu\ 6GTԈSv] [hl`k4 y]A7$)1<10z-]<Mr'.<|E }J]&=?cnsx)<9g#}g] 4[=t44\*<S~'J\jaE)<~]G)<}]\jaR)<]\jaT)< I V)<$]>;C`Hk)<~^0 Jh@WW q^8#4(C#<^ Ĩ 69gl\*<1|U^ өީ\*<Sk^[t)<SsJ V  )<0~^<!$2EJ,Z^Tq\^DQd]k~j^T3^D(g^$TC#4^@j^4Tq^  'G"')<P~ _[2t)<DTt!_[@t)<TTH;_NWf h*< 2qęO_(t)<p~f_0)<~p~_+89_dh*<9q0_@̯)<~ _+.UdtL2_u~c3DdTC#ܢ_m`hOtTC#`u #3DTC#d` *|)<|;`.;?b`6AJ=\5TG9Щy`/+Q.o-<2#` =<\`  =<` U^ *<q4` + "\*<~4` v\*<Юa/8?2HMx)<TC#a7ÙETx)<C#@6aYbir)^TXabr)$PTua&/2)<LaE4 4~a',\*<Ta;OD+<3a;OD+<3|aIP")<TbYbi\y~)<b&/28D*<C#l:bYb\y~)<0TbYb\y~)<P̸lb̯)<Tb.<)<U8bYb\y~)<pbMX+)<bv:)<Dbv:)<b% Ƹ)<c?H[ )<3cB'*<C#Lc&/2)<`bc7ÙEP*<3yc7ÙETh*<qc;OD+<3c$\*̯ T<3cB'+<C#Dc7ÙETx)<q d F)<$$d% )<q:d7ÙETh*<qQd (G)<fd &2H)<Ud RM)<td"-2)<dIRYbmr)<$Ud% Ƹ)<$dIy)<0dMX+)<Ppe;OD0<3<-e&/2\*<Fe853p`e7ÙETh*<qxeB'+<C#e% Ƹ)<(e% Ƹ)<e2EJ)<2#Peajy)<  fe )<(f!*;"-a)<$,Ff% Ƹ)<_f7ÙEv)<uf&/2{P*<3@f% Ƹ\*<f% Ƹ\*<f&/2{P*<3<f% )<{f&/2{*<3f% )<q8g7ÙE)<#2g ' )<Lg ' )<Ldg% *<qg% *<qg% )<q8g;O1<}g% *<qg ' *<C#T h ' )<#hv:)<l q 7I`@L O}$r0hG\58rIr g#=8r 3W[+^4@Or/t)<WAr3t)<WAr *7̯)<$WBs0;Uehpo 3Os5CXixo m 38^%uhlp)<dgAu o+<4Wlhnu +<DW1iu$ `6; *<TW~ju  .\*<kuBKV\in*<dW0lvyE*<tW1lEvv@Y*<W~mov  .\*<pnvB\i *<W3 ov):EJ*<W3ovU^m*<W3p w o+<Wq5w +<W1s_w$`6; *<W~tw  .\*<uwBK\in*<WuwyE*<X1|vwv@Y*<X~pw$x  .\*<xHxB8\i *<$X3xlxI:EJ*<4X3xyxU^Z*<DX3zxw  d 3~xP> G J `Z i " yL n qv "*y     |+<}@My(  ( ` l w D=DvJ!hZ`PC# ,EIPļԼ`$Y@ R,dC# QczZZ`P4I?LOuP= 4C#|i 6FQ\=5`4Y<cptPNTC# &ZZ`DY݀ 0I[fZ|OT331#")e,5h=\5pi}@[HmQ;.7D*<i}Voz~)<L31#\Q`gD*<i},&vB R _ t=DЂi};$o      =p6TYJL "!2)*<i}Z!!!G_!v!)<i~!!!~!!x1# |! ",""""$x##L###$dC#I$$$-& &-&0VZdx 1#&&&y'''<Ldx ɂ&&''''<Ld%قp(/>}(A%((8*<dY1#$'((K(`7D1#<(( (X.(=D1#('(*(^̯((D*<tY1#)9)))w+2)D*<<*O9) W))))l4DXi}-)* *C*R*W**<3i}/Ńx****l4 4Yi}0*** +++*<3i} 3@+`I+oc+j+*<Yi}(4q+++x+)<@6/$+++C,,,\ldx<?-%-)-q--ZXi}@Q r S*<q@w-----= 4YC#Ak>----.<)YlBڄ k>B'.*<q0C$ ...(.4.;.)<Yg#DB.O.V.<`s.z.h*<Yg#4F:...Y9000(LY g#Qn91R1V111 *<3xT 1111)<U1(2=22 343H,,ȅ1#p_:[3h3q363385 4Y``V 3#3*<q8ax333?444:3 4@g$444556H Z $o) <6I6]6666؃<sW7!7=778'8DThs }H@@8A`S ED\ BBBsCCC.<Ex4"b C>(r k<wCCCOCC,<} DDDzEpEEDLF8 EEE6FFF,p.LF݋FFF GLG,U5SGGGH*IDZi}L6lUsU,,Zʔ UUUU VV4TZC##V2,V+bg6V+<3   ]RL? <P*<Zv ѕ `R%L<(H7*<Z( V cRAL9DSX*<Z fRbL6\*<[ nu7 ;Vu,,< FVMV(VV[V,,[ u7 ;Vu,,8  % % *<q  DDRL*< 8 r S*<q X [@\*̯"*<q|zbViVqVV,,LVVV5VV)) VV"VWD8 W5WDWExWWW8@6L4WWWLWoW,,PLӘ <WW X:X[XdX794WWsXWoW,,PH8XXXXX4RZpHXX Y3\w\\lD d 4Z00\\\ ]]g#|2Й"]7]N]`z]]RRЃ23]]]^!^*^)){5G^e^i^.^H7 4q`86 ^^^T^_ZPg#;R_,_/_iK_Up#,{ <f$Z___```:8:8HC\aa #a,,Cš*axx4{b5yRyWyp#,\q|KqqX{/rLrUr=p63([{{{{{{(>3\#hlzz|z{!{= 4\3y <|E|X|||||7 4\Լzz|z{!{= 4]3 |||%}B}I}= 4]Xxx\}5yRyWyp#,$]qt}E|}K||}|#,4]äSv`v}Uvvv@[PT-XӤf}~d(~E~J~#,D]xx]~5yRyWyp#,T]q$~~~~~~d 4d]~$~~~~~d 4t]~` 0EjE"w9wVw]w@> 4]#3xxA5yRyWyp#,]qD$enƀ̀t3]1`SpwywIwww 93]#c-t6tTetttL> 4]p-t6t,^etttL> 4]PYlhL> 4]q,zzˁZzwz|z#,]\3PWd>3^j3PWd>3^ɥ(x-ς<9T$^7J4ڥ$"Lip34^7J||%}B}I}= 4D^||%}B}I}= 4T^ ӃH<YbZPTЅ1#-t6tWetttp8 4d^q%Ӄa<YbZPT1#2$w9w ]w0,,t^1@-t6tetttp8 4^qR-t6t3etttp8 4^qeW`c6m:h,,#|x(mvy>4g,,Hg,,#(Wi^f+,,<|ąZO#<̦(p),щ8٦"5slYlX>3^:|`i|}Ć> 4^:0E0E׆$1&"/W$AJ& ",1 *<q@T DRM*<qr v\*<)8_4D^C#t&)<0ć͇ԇ;݇)<^\ѧicr{)< v\*<t")<^#Y\y)<PBć;#)<pTc,")<^5>ESPU)<ć^e;݇)<_$nw~Y#)<ݨ.<)<_\:҈׈)<4$Qj% ,,%%A4F<)@5(N[^%X[<$_L yJ%JV`5\5qp %܊*<Іq %!Jep> 4$,o|%@7ȕ5$ $ɌՌ%~/<{4A%$;d[<24FT%X:x:ܕ x<drv%]B -N?%_D psv%*<L#F٪ %ޖ+<i}xG, %!Fp[t*i}J4M%A$d H Ja%֦)<4_,ī   %Fem)<D_|ҧ%QNũ[ ܛ$0Wj%*CQ|[d_B4w%>Ы٫OHJ\(%5Ut*g#<%GZ\*<4anq%4~,,%qb)<Ȭ +%Ƭ*)֬ͬ֬٬%E)<l@1%+$P<'|7 %-<HSB&%biB+<<Э0=L%ch(+<T_|w%'"|,,̮*%+r(= 401C  %$+*)R4AD%4x)<hf OX[%AYk)<\{ rux%)<P ,Uî%(U<l 6qF,U%(U<lL6qF,?BE%w(U<l6qF­,%1կ(U<l6qFܺI %K>UZ#,d_0w c%b>UZ#,t_ҭrZn%$,<p$$Ȱ̰%#*$,<$X(?IM%},-<$ jñ%˱ $,<$$ڱ%Ǜ$,<$  %r $,<$ 0 %r $,<$>(m1%=PU$,<_$tPNi\_%)w$,<_$b %AIJɲ$,<_$rز%Z$,<$o%_ $,<$!~n*%d0?$,<$ЩDG%jQ$,<_$X%p`$,<$Heqn%x|#, ʮ}%+<\AD%,,HQT%;VX,,<!s]`%bg6V,,<pwdg%'q,,Rv%.y ,,`hv%5y ,,|%=:,,۵ߵ%P,,Ї"%%j1,,|˯08BF%v[<{>Lٯ0Ķ%!^f(Ut*l:qF%ѷط$,t*_$%ѷط$,t*_$ 4&)%Kry[t*`(P%$,<>+('%Ƹ۸@O<$$9(B% $@O<T$I,7d@%^{[<>D%,-<$<V %ι,-<$,e< %SĽD$lLn%ʺݺ$,<$%16$,<$@ENQ%g$,<$%»$,<$Ұ( %@Ot* 7$H׼%/%/>DL 3({%c2@O<$\s]%hbgmg+<32(%plS_$H&-%}G^e>`9_3 c(l|%\5`$ yĿпӿ%߿5`93 o%-LQ$,t*xD$ 4huy%[$Px YJ̱0Sei%)[t*0{>߱0%:AH[t*t{>([gk%I$GM$,<P{>H!anw%[B'\*<p "  R%g;\*<p"%%p!.[W1#l%C,Cgk%PlS)[%(-)<`H+88u%5W4R$`>6%sgH(+<9Q%L8@Բ(DH%Խ$;|L ~%4,,L7jJP@X\%d>(Sn%)ӥ)<S(%N?)<7Vd \%v .| 2tkƳ$#&%obZ:[<i}m$ ?}%-K, -i}z Gh%;Vu,,4`8{/$%[<i}|? +%2xv '8%?{$7Gh%D;Vu,,D`%W<$/<x`Xj%w<)T`˴Z^%t5 47 #'%,,d`%#,0,$O%R@4TL 6l(%[<t`6p%:ci *<`# z%*<qh $`% T<`$`2%8ag+<`M(x%R*jyh4T $ %2*t*$7CS%FaTt*#Lfr)%u-t*7LҶ$ %-t*E\fr)%u-t*7\0%)t*Dfr)%u-t*7D(% )t*`4:%%.AF)t*`Kfr)%u-t*7^MjT%Vx)t*C#r [%.j\*t*dov%*t*`%)t*` [%.j)t*Ʒ% -2 *t*x 8qַK#%Tg)t*`lu|%)t*x4%*t*xL82;B%O&b\*t*`&d!G$G%*t*Ad!G$G%*t*Zd!G$G%*t*siry%)t*a,%.AF)t*a 2;%&)t*x %2*t*Ÿ% )t*$a`ٸ [%.j\*t*@ _k`%5-t*7H %2*t*:CJ%c*t*x8% %)t*xd(7 %8af)t*x8N {%)t*x 9pe %=B)t*xL9{Su\%i)t*Ј%")t*4a%.F)t*Da0%\*t*ɹ,%ZdR "1%ax}\*<p %ax\*<   %!G0)<Ta" ?JQ%^c)<dah9 jsz%\)<taW &%2HM)<au ?J%^c)<al *"%)<&/%2H)<º %.)<a@ۺ %^\*<aP&%ɬ;@)<a<   OX_%\f\*<a )  %Im*<q < _ _ b %*<qD T O%*<q i O%*<q }  %Im*<  7. 1 %q*< r@H(6G z-@POg#(@ )<a!&E4,,HsE<d#t#\ 1 E5n)< "A QG'EGg#,$WmEq,,$lxEq,,%\_|E,,%E,,,% Et\*<&Ƽ E)<&E4\5 ' EFQ*<qD( =+<aLF.(<i$9 4LF3$t~$9 4LF6& f093x;$` +<=( 3L\e4s~\@9(:=:B:+<0 BH&+<D ).]r$93LFFL{ ,<pHE<)<bIE<)<bIIEbmr)<$bJ vE\*<J7E")<4b@KN#@JAВnبL' WJ*<DbXEJ )<P Z`"JY<C)<Tb[zJW^Om<*db\6O,,tb\O3ϴ))`p]O:ϴ))`^OAϴ))``&7DT15cl=\5b3La< yT=\5b-bY$T t31|c}TI#,4d+6TSZ5 4Љg5eewzT,,$gTI"#,qgi%Tbj.09i=D<l)j`KX[i2hyD9k i3<*l i .ׅ,,miS,,,mi#,",u ^oi ^Z9#KNiG)<xzXif7)<l{ iu3N4 4{x} U^ai4 4{h$ Gi)<?Ti)<x^Ghi)<~#<i&e9DqLi@(+<"-iPUrw(+<$؅ il,<7h. il,<7R il,<7w$i._f0F|t;7y<Ghi;Vu,, 8i=@6qGhi;Vu,, ti!AV_kZ :#(?Ghi%;Vu,, ei,AV_kZL:#PGhi0;Vu,, Đ0i8 SZ8@6̖Ghili};Vu,, @piUq73uii;Vu,, $i/JSD$`P:~ $Xri) E V ?3=ui i;Vu,, e    i/ K \ |G1ui i;Vu,, (    i/ K \ G1Xui i;Vu,, ̨<  F i   <ui* i";Vu,, F8. M  i9  ) m7guid i=;Vu,, 48. M h iT  ) m7Դui iX;Vu,, H`  6io T$d$13Eui=is;Vu,, 4j$TAe|it$ZTG~Ghii;Vu,,  ;^i;G1 uii;Vu,,  ;i<G1(uiLi;Vu,, T$Ptimd<GE(pui1i;Vu,, 4<5Y|i m<uii;Vu,, d04"Fii%n=ui i);Vu,, $+04"Fi?nT=pMuigiC;Vu,, z kiY*;=?ui^i];Vu,, 0bsi{kZ:#qGhii;Vu,, Pbs ikZ ;#qWGhi=i;Vu,, p|AR]i`))4diHF@6ЊGhi i;Vu,, $ ': i;V^J )<b'<WiȞL;G3tuii;Vu,, 9iDYfkZ;+qUuii;Vu,, ||ikZ;+qui>i;Vu,, BS`i1*+WiWoW,,P\  0i) 8@6;Gh0:i-;Vu,, aDi4l_Z\3Ghi8;Vu,, , h iI)>ETF@60GhTiM;Vu,, Xehiy= 43$ i3Ak$=EH7udgi;Vu,, Yl)jmit,,Tv i#,0Xi  `F@6+#Gh3i;Vu,, p6GZi}`F@6&J4Gh3i;Vu,, gPilF@6#xGh3"i";Vu,, p%6Ii'r`F@6D#tGh3i+;Vu,, $Pi lF@6t#PdGhi;Vu,, Xi $`F@6#4Gh7i;Vu,, P:Mi lF@6#;Ghpi;Vu,, kP:silF@6#Ghpi;Vu,, ` $Pi"  t$ZbG  u* i';Vu,, < *# G j iW   ؞PYu*!i[;Vu,, ~!0!S!i!!!7\u*"i;Vu,, P#"i2%")),"#9"i2I")<8P"3.]"i̯k"","p"iz"")<"""i#$$/qLuAJi;Vu,,  r  i.\*< R$_ b i(")<!R$_ b i(")<! 44Ui*<q!  *<q##[$e$v$$%/%Tb@(a64;%>%=2I%)l)(P%]%`%2u%%D9 *%3<** {%!))+.%%%(%%)<q,A%%%E%&)<q\-Y%%&a%%)<q8.l&0&;&vY&d&m&99b/ x&&{(ݣ,,bl\038 &&&/(d((0KPK==M6((7,,c=k(( )d)i))<4g5?B)) )))<cg#|@)))I)))<$cg#4A)))M*Y*1#En*q*H}**)<dH***e(*)<0I***pb+)<I, +++6\+\*<hJE `1 +8)<J_#+&+;4\5Kz3+A+P+u+++UxPPi}N y|++r\,,*)4cqO$,1,D,`,o,x,4 4pP,,,,,,4 4lR--8-f-y--4 4S@$---=Y#-U<HTP 7--E-)<Tf 6--\-mg-)<pU--es-h*<U..k*<C#HV s6 ..p .3.)<W s6 .<.u .3.)<ЋW(I.R.|_.)<W\h.s..)<X VD..s..)<Dc|X D...)<TcX$.. /t///Ph <HT]]\//X)<h]t //0l00085\5L\ ` 001)<`111-1h*<a21G1z1$122DhPeP2a2h2V22*<dcC#f/0222i373B3UU#qiWWs3~3rWoW,,0P|jz 33333)<P\k333%,454)*$l T4W4>\*<l Z4f4i4mo4\*Um v4y4q)<m&}444x4446Dp3o\$445K5f5q5bT~q555555,<tcC#(s}<551<#,#|s555E55d85cC#8t6646x666633@v$66667W7b7b~0y55u7555,<cC#z%}<571<#,#z:557E55d85cC#{L 777777*<<}\788+̯8+<C#~s8&8-83A8R8[8܋c1#b8k8z85888#,H888\8)<+5*88b+(+<89 9"9Y9: 4Db9e9isi9h*<q n98w9}99l,<74  n989}99l,<7& n989}99l,<7DB999999(+<8g@9: :\:p::c7{::(ݣ,,cl :::>:::̂cH@ ; ;;ӥ&;+;*<c+5Ԍ" 6;C;F;O;`;)<h8e;h;LA8R8[8܋d1#܎ز~;;N;;#,;;;X<(</<h*<Dq><K<R<in<<<t5 4t+5l<<<<<<(+<dt<<<<<<(+<$d|) <<==)=0=)<4d987=G=R=l===b܂`Dd7HW====8>@>,:ċ7 <<_>=)=0=)<Td  o>|>>>>>l,t*Ќ7( o>|>>>>>l,t*70 o>|>>>>>l,t*78>?7????D>i})?@@P.@)<@%@.@j̯F@M@)<ddC#`PT@^@b@@@V`P[@@@A&A/Ab0+50l:ACANApAAA)l)PpAAA.AABpx BB)BE[BBB(8Ԯ; BBB]BBB8 4KCC-CwkC|CCH||CCCCCC8: 4i}C DD@DQD`DXhЍP kDnD\*<lrDyDD)<td\DD)<*DDDDS\(+<@ \DDx\*<X$DDD E.E7ESd i>EOEtEEEE@R VؼrEF%FnFFF8 41#ؿFFF.F(+<l FFFG G)G`SVd80GAG0ZGaG)<d{hGGGOGHHĸԸPu(H+Ha;Vu,,p3/HDH[H{HHHUU4#qwu(HH;Vu,,pHH IGIdIyIx>?Gh(HI;Vu,,tXIII III3(8dIIII J,,|JJJ>(J,, -J:JBJUJjJoJ95dq-J:JvJUJjJoJ95dq -J:JJ$UJjJoJ95dqxJJJ5KXKiK>A:KK.(ݣ,,dlRKKL:MTMvMP` C#MMMM6 4C#{MM .M*<{MN.M*<4 NN1N NNN5`9dC#O)O,OAOVOP$VPaOnO}OOOOaOnOO*OOO0"OOsUp#,P.OP%P VPbPhP-*eH:oPwP*(ݣ,,elQPPP< PP",$e(_PPQ#IQpQQH(H4?i}X QQQ@QQQ*<P QR<\*<DQR=RR)<p( R$R)<D\'R+R)<X.R.2R*< D=RARDR)<(KRcRjRRRR0V%U*<qt UUa U*<qT UjU*<q` DDR*< [@\*̯d@*<q` U? <P*<Tev U%<(H7*<dexV UA9DSX*<teUb6\*<eVV VVV)<eC# cKH!V)<(6 Fb9)<V&V-V26Vh*<e#<s =VDV.MVh*<eqLOӥ(+<C:`TV4(+< !]VhVsV*V)<e 0VVV-1V)<eL !VVY#VV)<e'VVV\ W4 4eD DWW#W\*<f` D*W1W8W\*<f% ?W *<DWY#MW *<38$(/2RW T<aH$WWI T<~% ɬ)<#HDWY#14)<q:% ɬ)<#YDWY#14)<q< {% ɬ)<# DWY#14)<q! `W' iW*<N:4" Y1\4Y\nW*<" sWzWWWWl,t*$f+#$ WWWWWWl,t*4f7$J sWWWWWl,t*Df+d%q WWWWWWl,t*Tf7<& sWWWWWl,t*df+' WWWWWWl,t*tf7'LOӥW(+<|( TV(+<)) cKH!V)<)E Fb9)< *daXX&X=XBX(+<8+/QX`XtXXX8 4X,LOӥ(+<#,TV4(+<-% ?W *<(. DWY#MW *<3.-$(/2RW T<aH/L$WWI T<~<0nXXX+XX+<f!<1XXXXX\: 4fC#H2% X,<!2DWY#Y,<C#3VV YVV)<fC# 4 cKH!V)<4, Fb9)<,5K&V-V26Vh*<f#5g =VDV.MVh*<fqH6LOӥ(+<C:6TV4(+<t7 !]VhVsV*V)<f8 0VVV-1V)<f8!VVY#VV)<fp9VVV\ W4 4g :1 DWW#W\*<gD:L D*W1W8W\*<$gh:j% ?W *< ;DWY#MW *<3;$(/2RW T<aHh<$WWI T<~ =% ɬ)<#=DWY#14)<ql>% X,<!?>DWY#Y,<C#?`% ɬ)<#\@~DWY#14)<qA% ɬ)<#ADWY#14)<qPB `W' iW*<N:B Y1\4Y\nW*<C! sWzWWWWl,t*4g+DC WWWWWWl,t*Dg7XEh sWWWWWl,t*Tg+,F WWWWWWl,t*dg7G sWWWWWl,t*tg+G WWWWWWl,t*g7HLOӥW(+<DI#TV(+<IA cKH!V)<`J\ Fb9)<JzaXX&X=XBX(+<$L/QX`XtXXX8 4T MLOӥ(+<#MTV4(+<LN% ?W *<NDWY#MW *<3O=$(/2RW T<aHLP[$WWI T<~Q|XXX+XX+<g!RXXXXX\: 4gC#S Y0eY*<qS$Y~-Y"slD#,`T$Yb91Y"{slD#,T5YCYSY"YYZ``2Z) ZR";\*<Z@ ZZ"?)<[X ZZ"H\*< [pDZG"L\*<D["Z/Z2Z"BlZ}Z4 4q(]ZZZ"]ZZZTd3` [['["oG[d[y[TdC#c*Wi["[)<{d  [[["}\\\4 4gti \\\"]] 7DEq5] ^ ^"U 6^7D3(sI =^F^I^"ho^x^*<gC#4ts;I^"n.^5D3t ^^^"t\_n_d+<`8z z___"O__5DC#| ``"5`D`K`)<g} V`_`j`"%``)<~-```" b$bBbEE#7`mwbbb"bbb",ЎTbG b"b c)< c")< c")<Ȋ jTc")<q#v5c"Ac07 4g3܌#vHc"Ac<7 4gC# (Tc]c`c"Ync`Pyccc"\cP|O2ď",cc"C,cX$w. c c"cc29cRc"McP|Og#D$dG  d"d4$EO c &d".cc2Ԕ\cR4d"?McP|Og#i$dG Bd"Jd4$EЖvزPd_d"UM{dd+<Dg5ddd"sde e?3<IeVeze"}+frff,, q 4f" gg)<-g"Y#+g)<\0g:g>g"|gg)<#Pggg"gh)<#dhhh"Lhihph)<$hhh"hhh*<3Ih i#i" j]j|jt@ }Tmjkk"%kkk$1'l:lbl"KmamzmEE@N E m+n/n"mnnF\qn n"S,,|$n n"S,,|n n"S,,|dn n"S,,|;no@o"2ppp@`HШ 3Npq>r"vwx_crz|zz"p{{{))`s g5(?{{"| |)<0$|+|"E|3DL|V|i|"|||4 4<q L|V||"|||4 4<q &}4}Y}"cl F"\hs"с؁PP =3$$+".ENP`P3<&enq"V6D3d'. "y15p2(8Âʂ"(Ԃق(#,h3)G#",7 4*Z 36">)<*jERU"o46`h+ T"bg?)<h, "'GS\+*`-ƃɃ"ۃ<),.")&,,$h/1BI":^afh*<4h0m"J2?PPp4( [ho"q)<Dhp5C "ȅH7 4S77T"S\)<*F8c&3:"))`L= ;†ن"-4`7Dt<Qbu"Їׇ5D=k7D? ".54DC#x@FOR"j})<ThB"{`؈`ƍӍۍ"9Yd+)`<3Pd"*юގhNQ`f"8-@K76`qli  Zi"Jp\*)`O (p3 07"))`HrR  ב",3\*)`tf FZՒ"5̉ 7dx 1:>"!p Q,Q| P".8QDQ|43 u"/;Vu,,X  =|"< *<q  [@\*"̯d@*<q 8E"?*<ЏG $&I"Øޘ*< >Țm  ""buz*< " "(*<d}0  T8Cq8"L988*<} $GPk"5К՚+<LFXb ."`e+<}Ԥ x"(e*<}p Л"*<0 #." CRW*<th}  rr "*<q  Bb"ɬe*<qt$  l^ 43  Ii^%'43]   d֬q^UE)<ȵZ  ^`x)<4A Gh^c;V)<h  ^f՞ޞ)<P g ^n;)<h Gh^q)<hp '47^xalw)<d4  ^C͟؟)<qM  ^9T[)<L>q$f  z^)<qr  ^)<h} ^15ɠΠ)<p ۠^(6 4q  ^-<D*< CTW^i| *<3 (^ 4) *^>p> R^gŢԢ", }<٢^k1<",h h̝ߢ^oz",$^s.7)O_FS^^d.^{ˣ,,А?أ^,,M7^,,\^7 ^,,m^'G-4<)7?^C+<q"#J^(N*<g# U^y^ͤԤ)<>4  ^BU\)<$ qz^)<0ĥͥإ^ *<P" ^+<E;\5hU$LUd^)Op_t ^27)<T  R[^^z)<h   ^)< ^ħ*<q ɧ$֧m #,m2 ,, ?%( *m@F1<X6(rUdmK1<e *mV*<Бt`v _ ˨ڨmw*<t my A*<t< FWZm"~*<t$-m|6 4 mYѩ֩|6 4tXmJ,, #s|mԪ٪,,L?<m0?)<0nJ`|m,@H)<qktmF:)<Pg# mW^ox?qX1 ŭm&/$pq`GHym6JR;DXpuxm,)<m:ih*<HmFʯh*<H ϯدm_#4;L^|OqDTWml\*<[dmmx+<h3  mL^|Oq ,5LmL^|O qX3ñDZmDDG m7TDD[]|jm|DDPomβ߲*<, md}D  m ijճ-< ڳm@@D m$"3l/<#@8ADm-Xkhh܋(rm>&1?jwm](7܋?#. pmsɬI5DqB :mbH*<q$Y 7 m)<h~ 47m)<i˶ζm)<iWm)<mm|)`) @Pm˷ҷ+<$i3((ٷm;D38G!m+<@8D3`AJWm\*<4i Ÿm +<Di3"iRm9)<Ti"DMbm&Mx)<T#Hm0;VJJ1<##m8L@?;(_mf¼Ӽ!!d :/nwmҽ*<Вq1,.mϾپDDv4C$!Tm 4RHR\Z8Yesm? fR ,) :Dsmq-DIDDdi@FPcm"8Kk4lJ mL]xP(P qR˶m.=Fhi܋tiSMZ^mk\U7mp[^ \\]vym71(@3܋^#mRx)<_tmY9Da !6Imj})<q`cm@8D#emCim xn1IMmsrm@v MZ]mop@DqXx mp@DqPymf)<qz. ^m1 1 | H  m'Ev\*<i|E"BKmB\h83 m :D3 m#L> 4 *m8L> ?`#$Y_DAmsi9)<#LGT[mr(\?6`i3m*<i("%m!:Q56`31Xehm1q*+Mm9h\`i3p{mE*<|  mM+<3\`Wm+h*<g# $14mNC,Z_*<t 5T0|m`8@L0=VZmz8@41mC,5*<E,:GKm O A)$mD 4D;Dm0iFSm<DtLim<Dt$m aqDXmwC<Dt0m#@"k |m,8EĚ<(Edw{m\RpRE$ m'AUrkk* E (ma3?8 4њ6NWZms))ihF(mAn{te(mZfsttv,mlLA|0m*mELD0(eswm;At0'15mHG!OP\0mY*3!|Op0Lml*3!|O,mKZel$@@m-QQQ F<m!Th|=tt@>9,W4mL3X=0u <r<m@>9$Xalm3ADAE $mHRR|E0&4mjml B<H+8mlAayH` rH4 m$:/0mp4i" AI %4m'GTY*<LBqB\nmXh#Hn0q}m(l JHmhtB>9XN,m!O[hBthQ(m5'G)<ig5`R$m>,?L =DГxTHanmP)5HP">9pY$mznziT\X_ $mԖa 8m4` "t=  rm)<q x[ mVGgRI` mkD <L_ g#  N  >N A'|, D'|< +$'|L!.4'|\!t"$N4l"!G!D'}|5! vm\*<Q! 1:AmeHM\*<jh! B' mK ,<QK!P\4Ym\g *<3\!' m)h*<!m`i,<#!|r mS~(+<D!pcrm{+<#"N_ b m(S)<@9"$h/m2TPQ<)S" $mIY+<p" ^gnm w)<jP"=*"m2)<#ܚ" ~ m.)<l"=*"m2+<#" ~ m.)< #$}DDD$jEt8#0<)4j[#"b )( #)<#d#"b *0( #)<## ^)`)Djg## "u^ V]*`)Tjg##l~ .)^,\/ U... 9.>.)dX`I0 b.o.z. ɬ..))Ȋh0 .o.. ɬ..))Ȋ|0 --- Y--)*0 //"/ 'GJ/O/)p.<ؑ0 f/o/////)<jqؒ17ÙET\*<,1///Y0 0*<k3T1 ' 0\*<4}10'060E0J0*<k3ؕ1KHA%)<\1 7Y0`0E]b\*<$k1 7Y0g0E]b\*<4kԗ 2n0w00o0*<Dk3ܘ12KHA%)<`S2n0w00o0*<Tk3hy2KHA%)<2&/2{*<32000ɬ 114 4dk2&/2{*<3@300 1ɬ 114 4tk,&3?1H1W111*<3K311111)<km311121262*<k3l3IQ2X2bma2)<k3&/2{*<33% Ƹ)<L3 !G!G$G*<qD&4 A A D *<qJ4 lROuR*<|l4 lROuR*<H4h2u2~2222+)Дl4222,,4222\*<k8/5 233">3E3VOCql5b3n3}3)33)<!p5 WZ303*<q`5ugr36{3\*<$533=3 449Dkq0T6444C4H444ID3T6Gh4d4JJDDȰ6Gh4j4JJDD<6Gh4p4JJDD7 VD~4v42p@DqG7GgK5|5kPJD#y7 *575z5X777V4007~888:; ;5D4q7 ;;;[<g<P*<p 8 <<< =P*<u 78%=2=e=*>>>5D qf8???AAA5D q8BBBjB3< D#H8CC C*<q8wCCC|D*<q9 D*DD KEcEkEp@DH qA9EEE\*<k,9 EF3">3E3VOLDq`9F"F}3)33)<!d+: W1F303*<q9ug4F36{3\*<Z:37F3=3 449Dkq$::FRFaFHFFFIDx3\";Ghc4d4JJDD":Ghc4j4JJDDD#N;Ghc4p4JJDD#}; VDF4v42p@Dq $;Ggc5|5kPJD#$; FF2GXDIPIYIV4<0<J#JfJwAmLvL5Dtq`TW< 3M=MDMMMP*<@ HW{< N NN^NP*<8v 0Y<yNNNOOO5D2 q d<tPPPRRR5Dt qz<BpSsSjB3<D#|%=SSS*<q}M=-T:T>T7T*<qPw= TT\U V)V1Vp@D\ q`=VVV\*<k= VV3">3E3VODq܇a>VV}3)33)<!> WV303*<q0>ugV36{3\*<>W W3=3 449Dlq$? W%W4WH~WWWID3?GhW4d4JJDD\X?GhW4j4JJDDЎ?GhW4p4JJDDD? VDW4v42p@Dq@GgW5|5kPJD#0I@ WW1XX\\]V4 @^^._ccd5Dq @ eeeffP*< 4@ g gg%vg}gP*< HAggglYkeknk5DԖq66All*mDrq~qq5DؽqhlcA s)s-s x}s3<#nAshs *<qpA}ttt{ tu*<quA uuv vwwp@DLh q|B% www\*<l|gB www" xxxVO Eq~B;xGxVx)yxxx)<$"B Wx303*<qTBug36{3\*<*Cxo3=3 449D$lq܀CxxxHy&y1yIDX3CGhQ4d4JJDDlCGhQ4j4JJDDDGhQ4p4JJDDTMD VDNy4v42p@DqDGg"5|5kPJD#@D% !iQyG)< $D [yhylyX}}V4E}~~Kx5Dqx'E ? P*< ĬKE -7C ф݄P*<H oE  LJӇ5Dq E܇Wc5Dq[ Ely}3<v #^ E$(,N*<q` F ҍ*<qHh GF ލR )1p@D qm yFVhin F  %7<\*<Pq F *FU-bq*<T"qq F 8@L 3`x #G5KTqcrw",0x @G yȒߒp@Dqz fG"6ENxYOPqH{ GugrY{3\*<{ GatݓLEq~ G-"6>*<l HEWrƔШ"q 8Hugr{3\*< lHcz$4EqЄ HZet4X  H HU;Cp@D X q H<\PJD"# I ŜJ,GN** II o|V(tll DɁd xI5Kcrw#,p I6ѡܡI\J` 3 I $>MT5Dq I_lѣ5Dj qخ 'JΤߤVhi KJ ' ,1\*<ЕȲ |J *;J/bq*<"qT JUߥ:ɦ@ 3 J5 )scrw", J 8W{Ȓߒp@D\q Kw6ENxYOq *< K(:UƔШ#q8 Kug{3\*< Lècz$4 Fql NLZet48 ( vL H@;Cp@D\Z q L >\PJDD##D L LXuLڭ**p L Xİtll Ɂ &M5 crw#,0| YMϱI\J`p 30 M ڲ>MT5DPqH M O5Dx q MHQZVhip MŴ%\*< *N *U-bq*<t#q RN G8P{@ 3 N5Tqcrw",x N yȒߒp@Dq N*"6ENxYOЖq Nug5Y{3\*<P O8KݓLFql!>O-r6>*<!iOurƔШ#q(!Oug5{3\*<!Ocz$4Fq\!OطZet4 !$P ȸո;Cp@D\ q!OP|<\PJD##4!zP ̹J9@**p!P anVotll Ɂ<&!P5crw#,&!Qj}0KWI\J`  3*!:Q $>MT5Dq+!ZQ#3;5D4 q1!Q!Vhi02!Q*7A%Sdk\*<P7!Q *uU-bq*<$q@8!R8 @  3 ?!-R5aTqcrw",p?!JR jvyȒߒp@Dq@!pRxYOqA!RugY{3\*<tB!RݓFqE!R-&6>*<F!S);rƔШ4$qLH!BSug{3\*<H!vSVicz$4 GqK!SZet4 C,,4lP!tVJSVr^o,,؇!VtJTP Č!V65:\*<Dl!BWA;JWϴZ-<܏!tW_hoe-<Tl|!W Fxp@D@q!Xgu%+ *<|3P!XVbi9Ddlqܝ!+Y E>3E3mOLGq!Y ?{R*<tl!Y ]im)\D 4Bq!Z: 9D![K*9,,!,[ >KSp@D$q!c[g~t i ![0c`,,gJt![  ";D ĺ!R\*25D0 q0!\ @,D\*<@!\[dgK+s85 4@!\zY< D*<0C#!] b)<!&]~ *<lq!E][d+s85 4!e]z*< D*<PC#H!] b)<d!]fo|\*)`p!]<)l!] R;)<0!^W`f*<$E0!'^ }V'#,L!I^#$~$C#!p^ ,:OX6 4l3X!^ _kn68q4!^ C:OX6 4l3!^ M$-D 4X!%_$<IVVz i4L !_$&B'*<q "Mg &1\*< "ng,1K}܋Gi}$"g1mě H+5"g1^u02"g1F.<P+5"g1 1,,"g1]vLTBt"Ih1&]vLB"bh17]vLB4""{h41M]vLDC%"hu1\*<%"h 1$܋Tmq'"h18ԛ܋p<)" i /8K1Nkr: 4q8*"(i1X==dm#L,"Zi1nr(iO:."}i(5z1~*r RP 0@  B"iXLe1sDD@D"i1%Ȳ #lM"i 1DRO"&jY1=Y+<3P"Tj 1G&A(6H4R"yj FCu1O*<q8S"jTXe1 wEDDPT"j1D0W"k0 19"Y"SkL5U115eiODZ"k$py|1`dlt(\"k 1DMX܋CD_"l1eED_"Z)<m"yDRZ)<,"|\_Z\*<@"|ZMY`$I5ȋ ȝ"4}*Z-<"{ .7Zj{YOmq"V} Z0b$nȋ"}$ 0 4 Z }   ȋD"}b Z( t4"}   Z/ ( L^Uȋ$%q"!~E S  Z=  # WXȲ #d"~ Z@*< tT"~]iZ4@5ȋH"6ZOh|$- v , A"X'48ZdtȋȌ#8" qDy~,,H"q[)<4"=qKUt5 4D "qx<7 41 38"#Z;CqHJC))"5Z;CqHJC))@"NZ;CqHJC))"gZ;CqHJC))H"|A q)<"uq","$7qpO|OT%3t"q$9OOm3\" DAN}q+)<w "*LqT+B)<g#"?IWq`*+ 3"q\_|,,"|,,"I|bmr)<m")|")<n,"kO~!29<)n" DNs~)<%L" % ~)<g#"; -?T~t=6` I" T~45ȋq" 5~~h=E8P C#P#. .;R~;PW8]ȋLIq# [~O % * 45ȋ$nq # 5 B F ~^z  45ȋq #Q $ ~u  45ȋКqL #Å   ~!!6!*<4nq#7 =!"R!~!!PWj$q# !!!~!",dq #Ȇ "4"<"~`""",dDnq# "'"~&""45ȋq#J"#~WY###*<Tn<##'#~dD5#*<dn#B<#cI#~\a#f#P*<tn## q#Y~#~\##)*ȋn{`####~$$$| S"#E<%e%%~&+&1&P*<<#&#tX&a&l&~N&&&)<%{(#*&&&~S'$'+')<% +#e@'J'U'~^|''')<&q|-#'''~m' ((x\OD&3/#ڊ.(7(:(~;f*<q@0##.(7(B(~;f*<q0#l J(W(Z(~h(w(P**1#|(((~((<)t2#(((~-)\)o)t&$6#9)))~_***Ih>#u ***~a+++*<nq@#!+2+5+~xi++D*<tB#aY+++(J,,C#+++=9++0V`PD#$+; ,Mϴ,D*<C#F#D,0,i,c- --0Vd I#dQ-f--o .-.4.)< ` 4L# s.}w.)<TL#~....D*<C#,M#2 ...ɬ..VO0qN#K4 / /S8i<`N#k/6/x//00DixP + i}PR#,W000G1k11T+ LW#,111V11dRnEY#DW 2XY#24 4Y#&2*252aS2d2k2D3܋P3Z#}v222i353C3 PP _#(333334xpLb#O!4#*<@c#Ώ )4G445$5;5; 4, }Hg#,{555*55"Pilng#h#555kcrw",i#555xcrw",j#&555crw",Лj#8555crw",,k#J66676N6ti}l#fY6p6$666\iO&n#}(667:+$737 LnLp#,:7S7n7M7770R &Ft#7 8 8yH8S8xt_dv# f888+979\9|}@{#Ր999(:::K:$"4"8i}d~#Ur:::::,,'p# ::;Vhi4'#%Ur:;:::,,d'́#=H>;K;};Vhi'#WUr:;y:::,,'#o;;{Τߤ;Vhi'D#Ur:;l:::,,$(P#<<nM<VhiT(x#Z<m<<\<<<(v#<=d=IX>d>t>` #/>>>? ?+?tiD"nU#L#^(2?o??`m@@t@ ԙ#@@@rxA#A.<(#4A=APAuAAD 4(#ג4AAB'BBCvwa p# 9CJCoCCC DT"d" U##*9DJDeDDDDt""IU#`#WE%E,E5EPJP]P9Dq`#PbPoPPP QQ)<0q#D/Q;QAoQ~QQ)<$o# QQQXS%T.TV44!@ $F TTUzUUP*< $qUV:VoWWW5D7 qX$/X[*<qH7$ -T[[:T*<q:$;5X\a\ rw",P0;$g p\}\\!\]]p@ 4qh?$"5X\=]rw",p?$QM]Z]].^u^^X0Xy #,G$h^^^1^_: 4qPH$ ___>0_?_x\OqI$ؠ __J_L0_?_x\OqK$ `_i__j___*<tEL$~_` ``o*`,,(M$3`?`F` _`r`w`,,HN$n```2}`*<4og#N$%0```C`,,DoO$L`S`!a83g#P$m aa'\1a(+<g#Q$6a9a@aG,,DR$SaVa,]a,,R$lbaaa0Zbbb4@ 734W$ɢJbb6Yc,,ToW$ cccQc&cD\5QKX$-c>cUccccq0S)1#[$"ccd>ddd1#T_$2 8tT*<q(`$NB' *<3`$r/dd- 0e.<Мa$+e`4e- <oGe8 4g#b$/dPe- Ce.<\c$ңpeyee- Nee3 4dog#Xd$<eee- [Iffffh" D1j$$(fff- ffg4k$]g#g6g- fgvgg< 4*En$Τ4ggg- nh~hh,w<$ F v$8hh i- 9oi{ii #Pl|Fz$ r - S*<q{$iii- өijD*<4*C#|$:ii"j- өijD*<d*C#~$] QjZjej- C|jjVPtol$jjj- %jjT|O0$4jT- ji<`$ť3jk? k)k0k<)ox$ե;kEkIk? ikkLd$,kkk? *Slql|l"`PLJL܍$7,lll? ]llli<oL$R,mmGm? mmmDp$, nnFn? nnnj< 3$n oo? BoKo? 4P$00Vo)co? Jso$D~$H(zooo? 31pNp]pxlD<Ɂ$g(ppp? Yq'q0q"OJ&$8Kqdqlq? qqq"o<$0q3rFr? jrs/s*3 $4BsUszs? MsslE&$Χ\t t? )<$4$tBtet? $ttt"OQx$',$uHu]u? Xuuu"O$Lv"v? ;Cv)<pH$<Rv_vbv? @MZED*<C#$Z lvov? |w.)<($zsvvv? vvD*<C#$ .vv? ɬ..VOq$4v w w? w4D`8$Ψ4wUwew? www\`$ ww5x? xxyR$Hyhyy? )U{{{4`d +5$2 "|+|/|? TUa|n|jTow$[$u|||? }}!}lTd3$nB}h}}? F,~~~L܋*<$(~~<? b̀R р$H1V? OsPR#Lb =x$L݂̂? )<* $ک l _ H))`$$7;_ WuTP<E $b_ ɬ5 4o$D ƒɃ_ e҃ك856`o$k<a Y,,($a  a<)\$iva (>RsppRJg#l$a ex\#q%L a Ns|dНNw%a ևa$#Pp%kx|a ͈RPp%ګ܈a ' -t*7l%  ' a 0\*<%0  a -\*4%P2Bba >\*4%whQT{ z,,@%vZ]{ g#v,,o%ɬ C}{ ӥ&;)<oD%HE ,,% &މ855ȋ%   8ct{4 4$+,%)  H054 4F0%C2k@Z 1t,,%Zbl  D(8 K!%w?HO sTU`LKp"%$̌   9 4T+#%3^ ~Ҏ~~R 9 *% %2E ԏDT\J,% 8'T G0Un9xy %91%6 {,,p2%͑ԑ 0P-<pv3%i$ 8 rzU|UdFg5%ʵĒ˒ dߒ="9 4$p6%! \*<4pT7%ö`Sa )<7%Wn%( SCp+<U#`8%Y1,/ G\g8-<U#9%n%3 0S6x)<9%E ; ? <P*<Dpv@:% >% <(H7*<Tp:%V AA 9DSX*<dpH;%Db 6\*<tph;%Z ; ? <P*<pv;% >% <(H7*<p<%V AA 9DSX*<p=%PDb 6\*<p =% G  c-*<>%7 3# g*<>%{ DDR *<?% . . 1 *<`?%0 DDR *<?% G  c-*<h@% . . 1 *<@%8 DDR *<@% 3# g*<A% DDR *<A%LTY ax,,B%[$ } f0,,8C%p$Γғ sF% , Zfy$^hJ%$Ô UP~dO%$"% =LQT<pP%$X  $,<\h%)(  &E@O$P0i%>0PSa w44q~k%V3Ù X$,Dd Xn% ٚ$$,dR Pq%G]a ,$,dR (t%  @=h$,dRKu%{ J?$,D @y%!n eݝ4<$,l ,~%Ze~ C$,D |%z $,$PL+ă%8 xӠ, :,%$$' m$,<P%8x աڡ$,$P+%K   o,-<+X%b( ߢ@Ot*K܏%(% Pg@Ot* Ld%x ֣,-$PFД%3,-!K i4U$Pp@%K, ]ĥͥT4 %|,HU] oæЦ@G%, ۧdb ċTG%7JR Шި@U$xLL\%(! Q@O$PP% ߩ5`93%5$ ǪLUXUG: %c(nO W@O<%)1 o̫TdU3L%,  )T<QG%ux ,$,<QG%$' 3[<bgT<G%(ˬ OA9d %ugr r$,t*$qQG%4" wAlqTS,m%U  ~Ů -$PОQG%o0 Jyd: %,/ T<QG0%ӯ ߩ5l93%, /6T`)QG%?Wb <7txD,3,%K,  T<Gx%a\_ $,<G%w\_ $,<G%Ű $,`)t,G%%, /<C*<0%(N :$xb(h c %0 kT`)4qG%0#8F wT`) ,%B4"SW ޴4pUm%\0" ҵTK (z S\%,/  T<Gl%! ߩ5l93%,5+A gThQ,G0%Ͷն /z<7Gx|3 & $ շ9x9PGp&(  ^mt9 4,& ҹ &~~hS G, & %2E ԏDTJ &A Tyź GȻ~90z %G&{6 {,,Dq&*+2 0M\c8-<hTqW&( 8 rzd|UTDH&j jw~ d9 4hdqX& 8 t{*<q&' %w{' '*<q&I \*<tqx&N`Sa )<&EDW Y#`,<I&Y1,/ G\D-<I<&,DWü 0Y#**<9& ; ? <P*<qvt& >% <(H7*<q&V AA 9DSX*<q|& Db 6\*<q& ; ? <P*<qv,& >% <(H7*<q&V AA 9DSX*<q4&Db 6\*<qT&'Ƽ I{Ǜμ\*<r&ռ -<dbr9d!&DPi 5ƽӽlb|p$&  8*9D$r$&$ 5BM rѾtT(&zn9ܾ bN,|#4r(&WW  #83Dr)&?*O sTU`L*&1>A SX\**+& cgn)<Tr+&3u| )<dr`,&`C ӥ_\*<tr,& +<r-&`Sa )<(.&z8 ҿ׿85 4r.&`Sa )<h/&d$DW Y#\-<v0&B'  ޿`,<I0&$DW Y#*h-<9d1&B'  -1*<92&2(Y1\4Y \U<v2&eh/ 2:D-<It3&fr) +t*3t4&G  ")t*5&'{' 0;)t*6&0 \*t*7&0CN _v{)t*r8&fr) u-t*9&02 &b)t*rX:&F )$PП;&_  !&)t*rX<&uK# Tg)t*0=&-9D i)DH?&K# Tg)t*?&K# Tg)t*@&K# Tg)t*A&,K# Tg)t*tB&JK# Tg)t*LC&f 4dLD&2 &b)t*rE&#* 3NS-$PrF&Zcj s*t*rG&d!G$G *t*H&G  "*t*J& (U" U`)q|K&%G  "*t*L&< [ .j\*t*M&U [ .j\*t*xN&v *dR-P&  2,t*C#PQ& %.; LG_\*t*,R&l  un*`)S&r) +`)3T& r)`)sT&r) u-`)U&, )P MHW&K r)`)sW&g'!G$G *`)X&'!G$G *`)Y&3? Nmr*Pp[& }r) u-`)#p\&  .j\*`)P]&  .j\*`)0^&l  un*`)_&9r) +`)3`&X }r) u-`)~a&v )hQ0a&'!G$G *`)b&'!G$G *`)c& )`)$sd&  .j\*`)le& &/ 2H\*< f&6 aY%  Ƹ*<qf&T G  c-*<g& !G$G 'G*<h&! DDR *<h& . . 1 *<$i& DDR *<Hi& ZK H)<qi& FbH*<qTj& FbH*<qj& aY% Ƹ*<qk&1 G  c-*<dl& !G$G 'G*<\m&d DDR *<m& Y$ :\9+<q0n&'I]c> cYT+<q$o&'l [ ޿c*`)t4so&Rjs w,,tp&~ | @Xk`LM1#q& 7 )^@Xk`M1#r&/< -M+<Ps&uT )<g#`s& X M\)<q t&!a 0)<qt& !Cle {i)<g#xu&TWgn bg^+<u& v} H)<Dsg#tv& v H)<Tsg#v&& *<+5 x&> *<=Hy&Q &'*<+5dz&d7; =*<=@~&v AM*<=&XpSa j*<=& *<+50&  C`e*<P+5&x ܊*<4-+5&3 3FDd-؉&U ;' ?.9*<+5h&l >pSG Oju*<1#&}z z(*<=&1:= *<-=H& +<+5t& +<=ȓ&"% &FD+<+5&Ibf = +<=И&" 0l+<=&ͬL3w +<=&  +<+5X&. 3 `w|+<p+5ȡ&Ax ܊+<-+5ԣ&f1 3C,FD- &~TV ?+<+5& >G Oju+<1#@& zZ+<=& +<$.=Ь&K HA%)<T&"+: OT)<dsP&&/ 28*<C#&cls IY|)<ts&*  ))<s԰&C= ,,`&P ",|&tux\C ,,&ux ,,& #,ı&E ",Ա&ux  #,&ux  p#,#& ",&; ",,&R" 2CLL> 4sP&xs2U Y I,,ȳ&j 2CLL> 4s&Zb z ~S+<l& _`s#&6 ,,s& ;)@0A 41#&GT @s<+`&\_ B,,&2 V_f#Ot3' m W<{'O $>B lPS0{'  < 4"',   V|Oh&'-  R3 qIf$ <''l kR If@ <)'  R If$ <\+'  R If$ <-'! G  *<X.'^ R If\ <0' 4EI h*<Pp2'@  CJ)<p45'@mz #$tv 7' G >,af@ <t=9'$m 3uT G?'7D cTe*<@' 0l  m\_C' ]r{  A 41I'RWy} 9DW|O؏g5O',w Tym0_V'  S@1x['",N j$pd N_]'Z G 2 >M <g5^'Rjn lVtg5a' G   >M <g5,c' G  1 >M <g5hd'>( gmPt]h'  0ix lD/g5m' e4kt' [@\* ̯d@*<qu'J$v /Pt/3x'l# E_/3|'O Vӥ,, |}' \ %0Ĩ/'AV] oy:@6tC#'6 q,,t0'M ajT *<q 'sD`F \'0Y#14\Q<e'J",'J,,7$'JH,,4'" ,,D'%/3'XtD5H' )<g#'3 dE4'(/+\atg#4';B77u'H\_U)<']  WNy)hQ8'sb4t '<J\c#tQuzD'<JR$,$P04'$ar}W7 4'PVA<)!'FS]lH,T,#7$' q}4Q$u'H H,T,#7'dq}4Q4uX'yOqLN7'  77' 1F)<Du`'@Ujm-)<T'W<06Q$PqF'j4Q^bp$a8aF'HELF40}'(\zD'@4s!    PJ '?[C d q)<l'Z  n  )<Tu{'  $ ' 1 < A +dui}h'(H T W a l q Qtu@($x { Y#YQ<(,   '   s Ѝ| I (܈  t D7 ($4 4 A    \9 \С (^  EbN,,(J >Yc,,uL(=&:,,( *-&IQL#P(uuR;Vu,,( (Vv`ppJtF(G$H!`z8u%8%(c\&,,%([C q)<$&(   )<u{X&(,5~}d0I,(,EJuI2(6 EB'+$P i}3(A cB'+$P i}T4(RR!-G` + H=(n 4 4g# ?(  <C)<ug#@( JSb4 40g#4B(?,:XQ4E,G(Q _+0,,uEI(v d=VZlLaHqmL( d d0\0qmT( l "mT4I+}\a( Wb5ud( !mh*<PDf(X!D0)<p,h("\,(-KP}p}q(e#gpwu)`)uLs($ d8yFt}\<'C#w(%{5,,vDx(I%hhht)<x(k%\E f u J0}T}(%   \nW)<~(%   J!m!!~~vC#(%0!!!6!"'~t(%"+"E"N"""Ԏ0L(&8""R#b%&&x ( 0(A&L'''-'YĶQ#(l& <'E'H'R'i'hNQ#|(&pr'{5,,(&x''''''<$v (&L'''''F$)#("'(({5,,4v(X',((*(6A(T(](Զ\5Dv'~t('0j(((<))*8$1'~8(' !*A**3,,,LD ((cP-Z- Hce-,,(6( n------5`4TvT(K( $-#(-)<(^(--(-..3 4q((&./.D.6Y.n.u.QOТ3(($...<...Q3l(( `..A/*/1/QO1(( `.D/G/*/1/QO01((<Z/f/{/M///QPl((8///S/00Op()8//*0Y/00O\(0)&./.D0_Y.n.u.QO3(C)${^0s0e000OУE(X) `.0k/*/1/QO1(r) `.0q/*/1/QO1<()4WL01w141;1O0()0N1Z1o1}111OP()0N1Z11111Opd() 11112l,t*dv7 () 11 212l,t*tv7(* 11212l,t*v7(,* 2)2,2,?246 4(>*,H222733-4 I(S*l4x44u4444$v((n*444h 515<54Rv(*O5X5_5Zg5z5,#v(*5556664D((+*777>7X7m7v733v@(+}7kD|#,\(*+77)<t(>+777777RRv(K+777828?8P(RT10(Y+N8s88999`ata)g+*:G:Y:F:::8\51$)+:::: ;)t*( )+;8;a;4$<<=\`NX)+c:=D=LHce-,,),P=i====>0tNx)',6'>1>,,v)G,?>T>^>>>>8@6v+4 )\,6'>>,,w )|, >>>F>>68$"),>??X?5?5p6$),>?>?e?5?5p6%),P?]?a?qw??4(8l'),????@@@RTw*),@.@3@_@@Ā.)-@@@@6AF-р3)--uKA ;Vu,,T(4)T-OAbAAB*B7B48(8H{ q7)n-hBvBBC7C=C+<{ C#4;)-pCCCC,D?D1L@)-/ODTD:DDD@83$w3C)-DDE{5ELE[ELR|OE)-0fEEEFBFQF4,Ф:~J)-lFFF/GLG_GFF13O)-~GGGbZG8Q).GGGWHuHH G 4w/1#V)).cHHHce-,,`W)I.HHHI2Idt11#8\)_.cHIIHce-,,\).!WIZIy`I{I)<g#]).III~III)<0g#_).IIIl+J0J)<Pg#`).?JLJOJCwJ|J)<pg#Pb). JJ)<g#b).JJJJJ)<g#`d)/JJJKK)<g#f)"/ͬ*K-KKK^K)<g#g)eKhKKh*<Dwg#th)9/KKKKKKh*<Twg#i)E/KKKL=LBLh*<Хg#\k)X/$QL^LyLLLLXRPEm)n/LMM(gMMMh*t* Og#q)/ MMMKMMM3\5dwg#t)/NNNW9NbNmNtw3tv)/tNNNhN OO*<IEtx)/7OAOEOu$P?PGPL8Dc E0})/PPPPP)<wg#x~)/QI Q`*Q1Qh*<wg#)0>QKAQQ(+<))0QQQQQ4D03\)?0 FQ#,x)T0 QR=RRRRLO@)h0/SASNSiSSS)dRP@)t0 SSSTTT@T,|)0 $R%#,)0 1UBUMU'hUoU\*<w)&zUUU2ӥW)<L)0UUUMUUd8 4i})0UUUi VV8 4wԖ)0 "V/V2VqDVaVpRQ3)1$hVyV}V}VVQ3)*14VVVVWQ})B1 WWW/WFWMW|RQw1)o1$TWeWiWWWWQwEt)10WWWWWXQwx)1XXX8XOXXX w1#)1_XpXsXXXp83t)1XXX)<p@)1XYY":Y*<q)1 Y Y$Y-_YYYP`x3 )24YYYKYZR}))2 ZZ!ZW9ZPZ|8D1̯)?20WZlZoZeZZDD)V2 ZZZsZ[[86`x-)n2(;[[ӥR<|)2[<[C[g[x[[86`$x3)2(;[[ӥR<)2 [[[@\"\+<$)2$I\V\q\R\\\RI )2(\] ]sJ]a]<Lg5ȿ)30j]}]]]]0p})%3]]^*<G)23%^0^H^*<G$)?3 W^^^^5_A_8 4h| )i30j___*`v``(D܋4xI)3```` a+<G0)3da'aIaaaat,ď2)3bbB{5,,@)3@b%b)b^1bDz9P)408bEbUbbbb$\5Цg5)'4Tbbb/c\cic|.Gd)=48ccccccD@GQG)Y4Tdd7dtdddOQGl)u4dddUe$eRRi})4$0eHe]edeeeaDxO})4(eeeefT4)4f,f/fSfpfwf58Tx)4(fffR<P)40fffggRI()50,g>gBgjggaaI*5g3g:g*<C#*950ggg0hii h d I*5b&j)jcHc,,,*5b&j-jaHc,,*61j:j=jMCjRj))*'6(Yjojsjjj4I*B6$jjjjkO*^6@ k'k;kkkkHdx *6(kkk*Al^lkl`tx*6(kklRAl^lkl`x *6({llp2lR<x!**7(lll'mDm`d$*E7,QmcmrmmmmdxIx&*Z7@mmnnno`O.*v7(7o\ozooCpUp(D25*7(sppp3qqq`(t2<*7(qqqIrrr<0C*7rr(ssssTP%F*7cssHce-,,ptG*7sst2Sthtot,< Pi}I* 8(ttt7tttR<LPK*\80ttt?u$u+uS<PIL*8(8uAuLuHB']udu S<2IhM*8$ouxuuYuuuS<PN*8(ttustttR< QO*8uuu ,JvX8 4g#lR*9 v#v$ }}}_\}}}6 4Ty3*&>}}}!}}}+)Ч*7>~~~*~C~)`)t*R>H~m~~1~=N4\$J3t*>vz8{5,,dy*>h[t)<H*> t|t5*>cHce-,,*?=v́X *h?>W\P*$(7ǂ [΂)<typ*?Ղ&7xSS*?BO[146 4y*?(ȃ̃C܃S*?K->GR4Ry<*?,VcgSw$S*?T\B'D*<i}h*?g8 4i}*@;)<H* @BOSi)<L#(*, n{4 44*+ *)<g#*@Sl4 4| 1#<*'@NW[%w|D*<3i}t*d@`ˆ!dqSS|\77*@261t,,@*@6!,,y*@J(Cχއ8@6y̵*@6E,,yl* AT",* AU",*4AqcdJQd*RA |#,*hA Ĉ|#,*AȈшՈ8\53*AINʼnԉx33*A "8\53*A)_jƊQ930*A6,,y*A &37Slu8 47*A Ël,<07*B ΋Ël,<P7*3B  <))`p|*EB2'1t,,*]B+<A~4 4*kBˌ.M`L;*|Bc{Hce-,,t*Bز6M,<Шi}4*BčȍߍSSyq*B(,IPSSyqd*BW4,IPSSzq*BnrG~\*<zD*C Y\*<d*(Cap#,q*@Cep#,q*YC Վ5Vg4DtJC#<*fCS+S<l) *yCÏԏ`))$zL*C\,,*C2J"<**CcÐ'Hce-,,$*C@ΐ VlT4z *C(X\&Q|DlLe D*D$M~d d'~\*"D  R!e|tGGG+>DȘ՘ '.`))3#l+UD iAUj{*)0+tD iAj{*)P+D<|K̙3 4pq+D<|Q̙3 4q+D<|W̙3 4{ +D'0B]ez3 4ЩqL +D %-SPC#+D ANb8} 9\51#+DЛ *SDz+ E R"*#,+#E %=Y,$4+zUΜҜ7ӥW)<+9EۜT d8 4i}+LEU%- VV8 4Tz+gE;HMiSOC#+E;HiSOC#D+E Ν(6 4dz+E $0Fcj(6 4tz!+EuyFcX8 4qD#+FuFcX8 4{$+-F՞7 4&+OFuܞFcX8 4{P(+iFh*<(+F0 !;Tt`PM~*+F]jxZ8 40++Fȟc8x?xX8 4z-+Fp(?F7 4z.+G M^n}(6 4PD0+EG )<d0+]G ʠؠl,t*T47X1+|G"2TkrX8 4p3+Gա ,41#H7+G!27HqH73`9+GxX)<,:+G$Ǣ*<q:+H̢ݢ/ө,<C#8<+(H9,<C#=+?H )-@=LQ,<z->+sH$XkpNԣߣS`zB+H(;QӥR<8C+H |"1D*<C#D+H6HL\uh*<E+H |TT`-pG+I(;ӥR<H+CI$Ĥ R\M+eI<|ew̙3 4{|N+tIޥ8 44$P+Iޥ8 44Q+IFSe+~3 4ЪqS+I#*Sz0U+I ֦ڦ-#,LU+I %ݦ/5xX+ zU48:ӥW)< Y+JۜAFW d8 4i}[+$J`liܧ9ķD5QGd]+BV",+OFSWZar*<qd+ P weƴϴDTPT{3p+4P4q09PT{}+LP J_dL+<{1+dP0̵ \T<|<+}P $6>Vgn86`|-+P(;uyӥR<(+P3\5$|+P ŶԶ))`Ы+P ,1,,4|T+ Q\8<)<{h+1QBTXl}hTtT`3+OQ(;u<ӥR<+sQǷη86`D|3+Q(;uշӥR<+Q۷ &-TOT|qd+Q&.4H]ryTOq+Q25,,+ R ø*<d|q8+ R rθ *<q+@R%(]8K,,(+VRbPWQHgn4Dt|q+yRua,,+R y|",#+Ru9p#,+Ru9p#,+Su9p#,+ESu9p#, +kSu9p#,+Su9p#,,+Su9p#,<+Su9p#,L+Tu9p#,\+=Tu9p#,l+oTu9p#,|+T Y)<|+T(Ź y\lȊ<+T,ںߺ"؏4}+U51:crw,,0$+U 8t{*<q++U zK*<q+@U R[R"^*<q(+SU *<q+pU $$'*<q\+U 8t{*<q0+U [@\*̯d@*<q +U enq*<q+U 8t{*<q+U x]cY*<q|+U =G]e+<|LF(+OV(w&$9 4LFt+xV$1;@z$9 4LF(+V #H093`,V$U` +<5,3W(Zch346s~,WҾ۾49+<P,WLUY&~+<,W ۿ$93LF ,W !6,< ,)X 7. 1 q*<q ,FX&/2\*< ,\X7ÙE*<3,lX% Ƹ)<,,X=FQMx`)<|,X% Ƹ)<,X% Ƹ)<4,X% Ƹ)<,X% Ƹ)<|,Y% Ƹ)< ,%Y% Ƹ)<,=YB'k*<,SY;OD+<3T,bY ' 0\*<,sYpy\*<pH,Yϴ\*<p,Y   IN)<,Y gp85 4Ь,Y #,TP|P,Y ;DSzTT|,Y( PQt* ,Z%8*t*", ZbKHk,<",7ZHEFbH\*<#,QZ=*"2,<#,gZ ~ .)<,$,Z  .\*<$,ZD*<|C#%,Z F(9)< &,Z   h*<&,Z W)<|&,ZDWMW *<3|', [ W)<|',#[ Y1\4Yl,<7d(,>[  h*<q(,[[ Y1\4Yl,<7),z[  h*<q4*,[ Y1\4Yl,<7*,[DWMW *<3+,[nr ~+<q,,,[ F(9)<,,[   h*<D-,\ W)<||-,(\DWMW *<3$.,;\ W)<}\.,T\ Y1\4Yl,<7 /,n\  h*<q/,\ Y1\4Yl,<7L0,\  h*<q0,\ Y1\4Yl,<71,\DWMW *<342,\nr ~+<q2,] F(9)<\3,(]   h*<3,<] W)<}$4,U]DWMW *<34,i] W)<$}5,] Y1\4Yl,<75,]  h*<qD6,] Y1\4Yl,<76,]  h*<q7,] Y1\4Yl,<748,^DWMW *<38,-^nr ~+<q|9,I^ F(9)<:,_^   h*<:,t^ W)<4}:,^DWMW *<3t;,^ W)<D};,^ Y1\4Yl,<7\<,^  h*<q<,^ Y1\4Yl,<7=,_  h*<q,>,7_ Y1\4Yl,<7>,X_DWMW *<3?,n_nr ~+<q$@,_  .\*<@,_ *"\*<@A,_ 7)0E]b\*<T}A,_R$_ b (")<|B,`R$_ b (")<B,#`VV9VV)<d}C#C,>` F(9)<D,_` =*"B2)<D,` cKH!V)< E,` Fb9)<E,` cKH!V)<,F,` Fb9)<F,a   h*<DG,?afLOQ2}h*<G,ba W)<t}H,a `gr)<}LH,a*")h*<H,a . h*<hI,bDWMW *<J,"bB' yK *<3J,Eb W)<}J,kb `r)<}0K,b Y1\4Yl,<+K,b h/:l,<7L,b*"2h*<# M, c .h*<{M,8c$l' r-1T<G\N,fc$ +\4YT< O,cLOӥ(+<#O,cTV4(+<8P,c*"2h*<#P,d .h*<qTQ,Cd*"2h*<#Q,id .h*<{pR,d  h*<#S,dfLOQh*<qS,d Y1\4Yl,<+DT,e h/:l,<7T,@e  h*<#U,jefLOQh*<qV,e Y1\4Yl,<+V,e h/:l,<7W,e8 4X,fU"388 4Y,CfDWMW *<T<.{,njT+`)3|,n4T<}},o jT#>-`)~~,%oCLS_v$,hQp`~D,Ao)hQ,`o,ÙT<`~,o0#*`),o,ÙT<`~L,o0#*`)4,o  .\*<ă, p$,`)$~`~0,"p%.5>Q)`)4~,>p X% a -<`~D,Yp 'cp\*`),wpnr  +<3,pnr  +<3T,pu7 ;Vu,,ȇ,pu7 ;Vu,,<,qu7 ;Vu,,,#q,OU<O}|,?q r S*<q,Oq x{:*<q,`q Bbɬe*<qЋ,zq _k`o*<q،,q F )<,q {' '46L@,q !4\5,q (4\5,q Wo)< ,r ]'%)<Э<,1r 048 f,,,Frz `ly$S^dT 1#8,sr ^S1#إ,r   \*< ,r0E> \*<L,r  85 4`,r &- <MR*<D~X,rYw~ T~ī,r; 7 4,s-z ]XL L#,;s"3 K4Dxp,sNl p!-L`|,s  \*<L,s" )<1#,s{ <+<C#X,t AN Cp\*<, t w =k;dA 0,6t s 85K 46p,Nt Y##x)<C#,at` X@ 4 ,tt ) 1H^Ol,t \D O *<C#,tHW ;VJJ*<C#L,t_l| KKC#,t -@q 3T8` ,u 3?Xd i},*u G)<,?u  N5DC#,Tu  \bhxq,tuK HTPd~4,u  .!*46 4,u D 7 x\*<4,u D ? x\*<,uGQp 7 4,uY0r {*<,v) AX553,4v]j "Ŀ<3-Lv{S <+<C#x-cv  FQ*<q-zv %   \*<@-v %   \*<-vkt{ ^Ot~l-v  Y#*<~C#-v v \*<-v% ̯x)<~C# -wj \*<~C#< -*w#* 3JS^P~ -@w Zd ht*<qP-Uw Bb ɬe*<q<-ow lROuR*<-w({ Lj4N@-w ~6 (,,z$@-w U ,,~t-wSy m,,-xSy 8,,T-xYfz &.*< 3<-mx ;I[b . !#,~-xuUi '",-xlu| )|+<0}8!-x 6|+<P}"-x1 IC,/XjWg##- yuU: U",#-3y>HX Wdj4R}h(-Yy- zdj4R},-y  1\*<p--y "{9,,~P.-yFI -)<.-yXe ;t5 4J1-y/@c H5\5 f 34-Gz! eY#!#,~H5-Vzux k",X5-pzux m",h5-z oZmpO|O37-zz OO309-z `sz)<K;-{ @LR*<tW3`K-{ ,,0L-+{s bg*<L-O{ < *1*)hdKN-{ Dk c| i}V-{ W>]r#h4Z-{} t:\51#[- | >IXd6l]-&|n{ h*<$g#p^-9|! "{9,,4 _-L|! 3Vlut5 4 b-p|! A(5\5l 3te-|+_! \)<e-|8q! i2#,D|f-|ux! r",f-}ux! t",f-1}`C! vCCCpO|O63,i-_}! /BKOOT3j-y}R_!  07)<m-}Zf! OO3n-}p}! ( PX(t-} 3%?! [ns)<dg#xu-}z! *<L 3<{-~3=CLJ,,~-~LI)<~-3~LW_`-Q~/?L'Dtq0-~|Lttqt-~  L|#,- Lts3-0 L**Ю$-a L0<*-J58LTmt\*t*L- {L 4q- L2C4- VL#|#,L-5\i|L\))܋6x-ULc,9Od6g5-u LLtm+*<5--"RLyX5D3-_L}Dz C#ԧ-ր L^3 45- L4 K R 5 43-1Ze n LHkx *<-G " L )<g5 -c * L& 2 *<b}L-9 F  L   D́ 5L-   L\-/ 3 45- 7   L<C O g ~$~ 5p-   Lp3 X s _T\g#-D   L   _x$7g#-' 2 G j L   34xK-=<  L @ g#,-W0G \  L __ Sg#-r O L I z T -> K ` L@   55g#-   LO^ . 5 )<Lg#-T i x Ld   66@T7g5d-0   Lb) 0 ĵ6dLSο--,G `  L   _4~@Sg#t-r . M j L   D~T~Sg#4-,  ( LY p } ` `0-ʃD   Li   <P g#. G  ' L y  4  ).P J N Lw  s31.  O L= n  8g  g#PJ.6 G N L+d k *<g#PK.r   L/   t0 g#lR.9 F N Lh 46Ե,pU. $! ! L#" " # P@ g#a.=# # T$ Le|% & S& Q p.}$& & & L ' 2' )* Tq.W+' 6' L!WoW,,PPr.0E' R' U' L%d' {' <*s.܅u L';Vu,,THt. ' ' ' L ;( f( ( _dTTL4y.7( ( ( LV( ( OO({.^( ( ) Lf%) 4) =) L63hLTi}x|.{N) [) b) L.^q) x) *<}.$) ) ) L9-A* N* |3X.†* * * LH* * * 0|7.* '+ b+ LT+ (, O, pЈf 3., , , LE, , *<q~.,, - 1- Ldz- - - ~4`TW6.- - - L- - d6T4p~.. . . L". *<#ؕ.އ'. *. L)<#... x. . L\/ h/ z/ ~~ȝ.1/ / / Li"0 ?0 L0 ~~$.S$\0 m0 t0 L=0 0 O`8.t0 0 0 LM1 `1 s1 OO`} C#p.1 1 1 L1 ~~`i}p.@2 @2 2 L3 3 3 9 DU P. m4 4 5 L3a6 6 7 H` A<.a7 7 7 Lf28 >8 lt3.Ly8 8 8 L9 9 9 IH7JE4.͉: : N: LW: ; ; PT3T.,M; Z; ^; L& ~; +_. ; ; ; LG< < < x} 97C#D.[< < = L_= j= 4p6 UL#D.= = = L= = > ~ Яi}.&> E> m> L ? ? !? Xi}.يV? {? ? LP? @ $@ pLUC#8.CC@ T@ X@ LxTU@ |6 4E`.eL@ @ -A LTB B B 8}- . B C C L*C ?C #6 . FC SC \C L\jC oC #,$.΋4vC C +D LE jE vE g JL/E E F LoF F )<Ug#/F F )G LG G G (+<V g#x /=EH _H H L&I XI _I *<Lh  /[ I I I L(I 66`/I I L5",/ I I I L9EI *<4q/ЌJ J J LH/J @J x)<qT/(fEJ HJ Le-1O<&/(|NJ ]J Lv{J J 6T4C# /X0J J K L~K K L ̌L\/DL PL SL LaL xL L x)PDq/ލI L L",/ DL L L L/M M M 4l>9'/́(N 5N 8N LO15DN 36`(/#4MN N ?O L\R 9V/ߎY0W W L{)*4W/W W W LW W X PPVY/1Y0W "X L{)*0Z/YW W *X LW W X PPV\/Y0W YX L{)*,]/aX kX X LX X X PP W_/ՏY0W X L{)*0`/W W X LW W X PPLWb/'(-Y :Y EY L;Y Y Y $P0PWle/|<Y Y Y LM=Z jZ yZ p`8Eh/0Z Z Z L`Z Z Z P4+Ti/ސ<Z Z [ Lm.[ E[ N[ `Ek/6_[ k[ n[ Lq[ [ ,`<m/c-[ [ L[ ))܋d$n/ۑ[ [ [ L[ \ ,<\p//:\ \ Lub\ ))܋p/^ \ .\ O\ Lv\ \ \ 4 4|s/\ \ ] L<] _] h]   O& 8 ӥ2 7 1<ԁ 20j $> 8 ,IN U F 4qS30-"^ 8 :~ 1<3@40Y1Yj 8 F\~ ~ F 4E40  Oz 8 Tӥ2 7 1< 50 $ 8 `IN U F 4бqS<60 8u 8 n   1<V702 G 8 z   F 4I70I  O 8 ӥ2 7 1< t80y $ 8 IN U F 4qS,90  O 8 ӥ2 7 1<$ 90á $" 8 IN U F 40qSx:0ܡ$ycc2 8 \: ,G6`H;0KA 8 H-<G;0 KI 8 H-<GP<0"Q _ m 8  ƀ \o#XIB06 {' 8  + 4 `4FC0N ? F 8 "T e l nODFD0ds | 8 *q)<E0z Ё ԁ 8 3T O0 Ƃ 8   5D3TQ0\_ 8 )<hQ0O2 8 " ,,Q0̢7 +@ 8 t,,4R0@v "H 8 Qv *<3R0 ugR [ 8 {Ǜi *<Pq v  (+<8q 0`(x v c Ǒ U<49G9T0} ڑ v *<t0 v )<0  v \y *<$D0ק! * 3 v 29? \*<40LOv ӥ2}+<1#0TVv H (+<q$00cKv H!Vx)<0G Fv b9)<00a % v ɬ,<1#Ԣ0wDWv Y#14)<q|0 % v ?W0<2 0DWv Y#MW *<3Ȥ0*"v )+<T0٨ v . h*<0 % v ɬ,<L#0DWv Y#14)<{00/ % v X0/<i}ԧ0IDWv Y#Y,<C#|0f % v M ,< 0DWv Y#]P)<ȩ0LOv ӥW+<\0TVv (+<0ԩ % v ɬ,<L#0DWv Y#14)<{@0 v `i *<L#ܬ0)nr v S~*<{|0HR [ h v  x)<D0d v ْ )<T0*  v  # x)<d0 *. 9 v  L )<tp0 % v ?W0<20ժDWv Y#MW *<30*"v 2+<L#H0  v .h*<{ز0(LOv ӥ2}+<1#l0CTVv H (+<q0av W ,<i}0~nr v S6+<C#@0 % v X0/<i}0DWv Y#Y,<C#0ӫ \ t x ~ J t0 ~ T)<0  ~ “ ӓ *<02ړ ~ W t0R$ ~ ) W S0S 30Ȭ  " ~ 2 ř ֙ 4Dв3L0  ~ 0 7 4DC#0!m5( B ~ Mxr H ,,x0I 8~ tM *<qL0j lROuR*<0R [ `  t <)00 )   ՚ ܚ <)`00   I e q l|Od9C#00 #,40Y 0E  5t \*<t0u ",0 ћ  "  + 4 I P \*<ԃ0dW e  Rɞ 4XLYC#0Ȱ ( L  [ DTY3`1  h $ + \*<1]4 M w  pˠ Y 1  %  ; ,<C# 1$*@ G  ] t { 1<08 10,   á ʡ l<P>` 1`$ա  B'| 4`$ 1,˶ߡ   $ 41 1  E 36`g#1    . @8DC#1 3 6 #,1>9 F I  )CX 5F1b  a d  5; ,<C#(1$y  A 1<p1,c  FѢ l<>1$(  W " )  49`1@,[: A  ^Y j q $ 4911lY0 s h*<g#\1 f  x ʣ @8DC#H1ʴ 3 ϣ #,d1ӣ    5F1&  a  ; ,<C#1W$y !   1<1,c 1  Ѣ l<г>1$( A   " )  4$:`1,[: Y  Y j q $ 4T:11Bq m~  t @8DC#|1k #,1 ':  ;V^Jt \*< 1   2 *<1F S  ''Gh +<C# 1 ¤ ˤ  2(S1<;F8!18 Ҥ ۤ  7 | 1<V"1   I D? 4"1 '   P F 4IH#1ڷY0( +  {4 @8DC##1 (} #,#13 jw 9 B  ̯w w \*<$1bXR U  Z 5\5`%1a n q   *<C#d&1   * 1< '1 (1  /ǥ l< '19 ҥ ۥ  @: F 4:qS|(1d(   G\% , 4 4:mL)19 K U  v C#+1 v4 *#,+1  .Φ T,l-1'  > $ + ]O$C#P/1: G J  Gd u | <7<94301Ⱥ  T ħ ϧ T8l`D4214ڧ  \ % HPRT441]  , /  p; ,<C#L51$*E L  z] t { 1<0l61, b i   á ʡ l<P>71$$O  B'| 4`X81T,ƃ   $ 41$91  ٨  T0nd;1   = f  q>1ټoFSs \*<>1 ( {  . x)<tC#?1@ y K  y D*<C#@1l L   Ω 4 4q`A1oFSթ ')<A1½٩   - 4hB1 L  @ Ω 4 4qC1  \ ' 9DC#\D1p. '>  c^ m z dt`C#F1Ⱦ(   vɪ ժ SpGH1\_ )<I1&   ) : I Dl\` K1WR c f  } Dl\`M1 />  %ǫ ҫ O\`дC#@N1۫  9 c DT1( 0    ֬ D`#V1 R  M 5DC#@W1> b  : I R 4F`,X1c   s )<`1{  6 PPde1 +  ax2 ,<7|g19 R  t SS7l1* ү    Dn$80qo1^3 F J   ư p<Lz1n .(p  ;\*<z1 $G  * 9 B 4F`{1*u~ M )<{1+Q )<q(|1 \_[ )<<|11DR_ &\*<`|1Xc "l  1v x/<ĄI|1~(} />  6 ñ $|O$~1 $j ̱  D.Ա 1<~1ٱ  I[ ʲ $l:qX1 K  qH!V*)`q܆1 R  uM ! 4 4P10 * 3  Q ` i `ԄF1Xَ t   )<`10 dz ׳  K ] x $`ph18 ʹ  ` v   Z1!0   1ٵ TD1Q  @[ 11}  c߶ PlNȊ31K  qH!V+<C#@1   7 H FD11 \_Q )<13\_U )<{С1e[ Od  p *<3d1'   ROC#1 Q1 #,$1  Y \*<1 Ʒ ɷ  cط *<14F ݷ  "'Gh +<C#1a   ,:i 1<31$ &  1 5 1<%41Ή@ G  BM[ b F 4;E1 $ҥ o v  I:  4D;18  ڸ C#\1h kDڦ ,#,x1     0/ D T,l|1O \ _  D} ]OC#16  Mҹ <73$3t1j   Z! 6 A T8l`4 1L ] d  bx HPRD$1   x; ,<C#<1.$* º  ] t { 1<е\1, غ ߺ   á ʡ l<>1$  B'| 4`H1,    $ 411   H @8DC#1I Z1 #,1u w )  c+w 0w \*<T1l0 3  8 5\5D1a ? B   *<C#H1 W ^  ( 1< 1G(1m t  -ǥ l<0 1u ҥ  >: F 4t;qS`1(  E\% , 4 4;m01 ʻ һ    dC#1 n *#,1+   .Φ T,l1^ , /  >D U \ ]OtC#D1k x {  G <7<931  T ħ ϧ T8l`01f ȼ ϼ  \ HPR81   /  p; ,<C#P1$* L  z] t { 1<Pp1,  i   á ʡ l<p>1Q$#   B'| 4`\1,   $ 41(1& 4 Z   Ͻ ޽ `D1    0x\*<1ugW  4{ +<C#,16 I  8\*<H1f   @X { d1  Ut 5Dq1ľ Ѿ Ծ  ^  *)`q@1h  bt)<1¤ {  ( @8DC#1D ! 1 #,41l ':$ +  ;V^Jt \*<1^$2 5  : 5\5D1F A D  'Gh +<C#<1 Y `  (:i 1<31*$o v  - 5 1<ж%|1TΉ  >M[ b F 4;E<1z$ҥ  E:  4<1¤   ( @8DC#1 1 #,1 ':  ;V^J\*<1 ÿ п ӿ  \ *<1AF  "'Gh +<C#1l   ,:i 1<Fx1$ &  1 5 1<>1Ή G  BM[ b F 44<S1$ҥ v  I:  4d<19¤    ( @8DC#$1b 11 #,@1 ':  ;V^J\*<1ÿ ӿ  \ *<1F  "'Gh +<C#|1    ,:i 1<031T$ &  1 5 1<P%1Ή G  BM[ b F 4<E|1$ҥ $ v  I:  4<D1+ = E  j ąC#1 ڦ ,#,1.    0/ D T,l1_  D ]OԅC#P1  M ( / <7331 :   Z! 6 A T8l`H1]= N U  b{ HPRD1   x; ,<C#\1$* º  ] t { 1<p|1 , ߺ   á ʡ l<>1>$  B'| 4`h1k,    $ 4141n9  b @8DC#1 }1 #,1 ':  ;V^J\*<L1 y  \ 5\519a B   *<C#1d  ^  ( 1< 1(1 t  -ǥ l<з P1 ҥ  >: F 4<qS1(  E\% , 4 4$=m11   4 K X C#|2_ $R *#,2 yV  .Φ T,l2` m p  > ]O$C#2%  G <7<943T2W  T ħ ϧ T8l`D2   \܊4 A HPRT 2  H /  p; ,<C# 2$*K L  z] t { 1<8 2m, R i   á ʡ l<>` 2$Y   B'| 4`$2,\   $ 412¤ _   ( @8DC#p2! F1 #,2J ':b  ;V^J\*<2ue r u  t *<2F  "'Gh +<C#2   ,:i 1<0 h2 $ &  1 5 1<P 28Ή G  BM[ b F 4T=S2_$ҥ v  I:  4=?2    dC#2 *#,02     ./ D T,l42, 9 <  6O ` ]OC#t2>g t w  ? <7332n  L 853t 2    T<> K HPR2  R U  h; ,<C# 2$*k r  r] t { 1<pd"2v$  B'| 4`(#2,   $ 41#2 ':  ;V^J\*<h$2    ğC#l&2  " #,&2C% 7 >  M d q 0+2$(  H " )  4=`(,2!,[  OY j q $ 4=1(-2G ' 3   <0C#32r " :#,32  ? * 853D52 3 ? F  KR i r \lNC#62y  S ]QC# 82, F  \ <73392[  i  853Ć:2* C N  q| p>2   ; ,<C#?2 $*  ] t { 1<0@2_,   á ʡ l<P>A2$   B'| 4`B2,   $ 41`C2 % . ?   e l 85 4pD2   ;6`C#F29 " #,F2d  !G c s ВXnЗ>K2  ;ϴ 5 ?`L2 x  D^ ,<C#N2$y  N 1<N2.,c  SѢ l<>O2[$(   d " )  4D>`P2,[ $  kY j q $ 4t>1Q2 m @ C  J 9+`)YDR2Y f i   @85C#LS2 F #,hS2*  # 56`T2K,  , j`)C#0W28Y b i  ;z  tl<qp,X20  L tx9>RdY28   S 0 7 x9>pZ2C@v F I  Qv +<C#0[2m P n #,L[2 P \*<h[2GhAJS  ;VX *<[2a ] `   *<C#\2 u |  $ 1<V]2e(y  ) l<01^2   :  F 4?I_2((% ,  AD " U 44?x`2f o r   7 4C#Lb2f   7 4C#xc2F   +<3d2y    ,9 N \*<e2 V'U 4#,e2 -X [  8Y#b \*<`f2g t w  = 5\5g26   G; ,<C#h2g$*  R] t { 1<Pi2,  W á ʡ l<p>k2$  jB'| 4`k2#,  q $ 41l2R   D [ f W$0Mn2w    Ħ g#\q2(H U X  *u ԟC#Hs2W 6  8#,ds2 -  <Y#b \*< t2f  A 7 4C#8u2  F +<3u2 K\*<u2Rg  O 5\5@w2y   Y; ,<C#Xx2$*   h] t { 1<xy2,  $  m á ʡ l<>z28$:  B'| 4`d{2f,=   $ 410|2@ X h   S` кC#2 1#,2  5" . 7 T(2&D b q  DM `̄2M  [^ =\5C#܅2~   f / 6 1<032$A J Q  kg | 1<P% 2   ~ l`PE2:$   $`P2i  H \ o S` pC#2  1#,2  5 T(Ԇ؏2  D; G Z `2) i  [^ =\5C#2\ l   f / 6 1<32$A s Q  kg | 1<л% 2 z  ~ l`PE 2 $ }   $`P2Q  $ ] <<C#2 c1 <#,2  @ " 7 S4N2Q p  O  S  T2 . 1  f^ =\5C#d2I G N  q / 6 1<3x2$A d k  vg | 1<%2   l`PE2$   $`Pt2C¤   ( @8DC#2k 1 #,2   \*<2   *<L2F  "'Gh +<C#D2    ,:i 1<032W$ &  1 5 1<P%2Ή G  BM[ b F 4d?ED2$ҥ v  I:  4? 2¤   ( @8DC#2 1 #,2&   \*<2Sÿ ӿ  \ *<2uF  "'Gh +<C#2   ,:i 1<pF|2$ &  1 5 1<> 2 Ή G  BM[ b F 4?S2I$ҥ v  I:  4?2s¤    ( @8DC#(2  1 #,D2   \*<2ÿ  ӿ  \ *<2F   "'Gh +<C#|2C !   ,:i 1<32$( &  1 5 1<м%2Ή/ G  BM[ b F 4$@E|2$ҥ 6 v  I:  4T@D2n9=  b @8DC#̽2? @ 1 #,2j ':C  ;V^J\*<\2F S V  &*<42a e h  " *<C#82 }  , 1< 27(1  1ǥ l< 2d ҥ  B: F 4@qSP2(  I\% , 4 4@m 2¤   ( @8DC#2 1 #,2    \*<,26e u  t *<2WF  "'Gh +<C#2   ,:i 1<0 2$ &  1 5 1<P82Ή G  BM[ b F 4@S2&$ҥ v  I:  4A?2O+    j C#D2| "" )#,`2  4 8  -/ D T,ld2 Q T  A ]OC#2> n q  J ( / <733,2o  W! 6 A T8l`2=  _{ HPR$2   r; ,<C#2'$*   |] t { 1<p2,     á ʡ l<> 2$4 7  B'| 4`2,RA   $ 412K )<C#2AK )<C#2 O *<q$2 O *<qh2 O *<q2- O *<q2^ O *<q42 O *<qx2 O *<q2 O *<q2 O *<qD2K O *<q2{ O'c \O *<qX2 O *<q2 O *<q2 O *<q$2C O *<qh2r V _ f  'Gm t 856`4`2 {    \*<D2   \*PPT2<  Y,,H2  N  <)27 N8  M G6`W 2W\ bi  ɬ )<2yv   )<T2Ù  E )<2  Y# 5DdC#2     *<tC#D2    * ; J6Ft2.I S@  R g X8?2Tl  9 [ h 464е 42h  2a! ( )<(2G Y g  C 464 2 = E  X 464N(2  sL a j 464N3>      : x7J` 8 3b   ( \*`) T3Y   A R T t`. 371  q\*<<3 2   \*`)DA3    k BJ`~ qd3  &  )<tA3/ #-  4T e l \*`)A("3K}  J  46F`\&3i$ 2 6  Xd p 4 44*3 #{  ~T e l \*`)A`,3   \*`)B$.3    7 tfJ ,,D/3u[ *,,T/3u^ 0,,d/34\jaa `\*<x/3Y e n w  d'G 853нp03f  jӥ2}4 4q13  p   33  R20  {;)<l33A  6 9  ? P 856`043h wW d   `4Bq<63 \ja \*<P63  ~   (6 473   Y#  85I̯t83  ) >  } @q8<3/ \ja \*<L<3W     )<=3   % .  I? H 85 4=3 Q ]  9 DT qC3 \ja \*<C3    Q ddBH3  R2  ;)<H3   %  I? H 85 4I3    H Q 4DLZq  Y j o 7 43 F #,3\jaJ \*<3 N   ( 1 ; 4оq3 ye   (P3D yo   (P3i  % y  I? H 85 4Ĉ83  $ e z t q 3\ja \*< 3 e   7<9Ԉ`3: 1  . < 46 43[8C N  >c z  -`PV3    e  h*`)3   o   h*`)03& 3 7  ] i h C#x3!z      F3D$      G J73g( +    J J<3  # 8  }m  x  l3       t$Vq3     u   J 4_03O8     ; F Ht`̶07pA43U  {5,,3Y f i  {  46`t3       <4\53" / C  +  - hX$O3<Z g k  G   4P3    ^4 e p \t|03 (    o  " ptp1p3ou#-  u5 ,,3u#< )<3 B     ttL[<3. 7 >  P i n (+t*$3B. 7 u  P i n (+t*4<3n   < X( 3d3L U Y  s 73    P   -WKC#32      ,,DH3      <# : A (6<9T3    H  F# : A (6<9d3    T  Q# : A (6<9t,3! ` r }  c   )$P[`3)!     v= z  C4R!        t4~!(>C&  ) 8 A -Z`$4!H U e    ( t 4! g z   }   |0W 4>" J    {   tp& 4f / 8 ;  0sE )<q44_"J \ e  6   `74"   ! . *<q,!4" x{ :*<q!4"   sv   *<#4" A A D *<q0$4# x{ :*<q$4;#  * &  *<q8'4c#  ^ *<qH(4# ajT m*<q8)4# x{ :*<q*4#K HA%)<*4$ [ .j\*t*d+4($K HA%)<+4M$uux .<RX+4s$\\_ )< ,4$uux .<RX,4$\\_ )<0,4$uux .<RX@,4 %\\_ )<T,42%uux .<RXd,4T%\\_ )<x,4y%uux .< ,4%\\_ )<,4%uux .< ,4%\\_ )<,4&uux .<RX,4E&\\_ )<,4r&uux .<RX,4&\\_ )<-4&uux .<RX-4&\\_ )<,-4'uux .<RX<-4;'\\_ )<P-4c'0uux t<&`-4'\\_ )<t-4'0uux t<&-4'\\_ )<-4'uux 2<m-4!(\\_ )<-4L(uux 2<m-4p(\\_ )<-4(uux +<g#-4(\\_ )<.4(uux +<g#.4 )\\_ )<(.41)uux .<RX8.4X)\\_ )<L.4)uux .<RX\.4)\\_ )<p.4)$uux 2<.4)\\_ )<.4*$uux 2<.4?*\\_ )<.4e*uux +<<.4*\\_ )<.4*uux +<<.4*\\_ )</4*Duux u<0/4#+\\_ )<$/4N+Duux u<04/4r+\\_ )<H/4+ uux 2<QX/4+\\_ )<l/4+ uux 2<Q|/4,\\_ )</47,uux +<g#/4\,\\_ )</4,uux +<g#/4,\\_ )</4,uux +<o;/4,\\_ )</4- uux 2<cX 04@-\\_ )< 04k- uux 2<cX004-\\_ )<D04- uux 2<7T04-\\_ )<h04.     " 1 : 85 4пP14&. uux 2<7`14F.\\_ )<t14i.\\_ \*<14.V _ b  DS*<q24.uux )<o;24.\\_ )<,24/uux )<o;<24&/\\_ )<P24L/uux )<o;`24v/\\_ )<t24/uux )<o;24/\\_ )<24/ uux 2<7240\\_ )<24C0     " 1 : 85 434k0 uux 2<7340\\_ )<340\\_ \*<340V _ b  DS*<q\441 uux 2<7l44)1\\_ )<44R1     " 1 : 85 4h54y1 uux 2<7x541\\_ )<541\\_ \*<541V _ b  DS*<q 64 2 uux 2<J06472\\_ )<D64d2 uux 2<JT642\\_ )<h642uux .< x642\\_ )<643uux .< 6463\\_ )<64a3I S b     ,#`[84t3/ ~  ;sE )<qL943    A   $ F6`F4;43+ 8 ;  QW j s @86`C#=43z   c [ *<g#=44$Y~  ~si9+<H>44 )<`>4>4      7 d<FA44P #Y  {  43C44     " - lxtOF44uH  ;Vu,, \G44L V Z     lNȊ0EL4W5  10  +uR _ ln<ĉlO4{5 "g  ,  ,,ԉ P45t    DK  *<~ g#U45. S   `   nH u1]45A R V  k   kl؞PQEa4(6 "    ,, b4Z6 "  g  ,, b46    D g z 01e46  =! c! r! O1i46! !  ^! F6`}j47,! " )"  " " # $lp fr4V7># Y# #  # $ &$ 9F/ qv47 x _$ f$  ;tr$ w$ )<w478~$ $ $  D$ $ $ l)`$D#y478$ *$  Q$ % % p64D#{47T% '%  _9% L% TD?G}48@S% c _%  hu% % % n`D`#4A8P% % &  u' 4' u' T̬  ^G 4b8T' ' (  ) _) ) p\` |#48$) ) 9*  A + -+ C+ llHh Eȥ48,+ , ,  k, - E- ij C\48 p- y- |-  - - - lm`T49 - $-  - - - lm`d409 . 8 .  4. E. N. mm`t`4S9 . 8 Y.  4. E. N. mm`,4~9 . 8 }.  4. E. N. mm`49 . 2.  e. mm`49$. . /  / / / F`9 E490 ,0 =0  v0 0 0 +<Cg#4:0 0 0  0 +<Dg#4#:0 0 0  #1 41 ?1 (m%DDF4E:P1 b1 1  <2 g2 q2 ;p6 i g#04b:52 2  Hcrw",p4}:2 2 3  WK3 `3 q3 (2 8qL4:3 3 3  p3 3 i}4: 3 3 4  d4 {4 4 )<tD4:p4 4 4  4 5 5 4m`1#04:W5 &5  WoW,,P4;(45 S5 5  6 6 '6 %@m 47;h6 ~6 6  67 B7 I7 86`Pg504N;,7 7 7  X8 d8 }8 T8XE4b;,8 8 9  9 9 9 lTE4v;: : 2:  -h: s: x: +)` \g#4;$}<: :  ;1<#,E44;4: : :  A5; G; p; wtx4;,,|; ; ;  m; < < $%LmDIE,4;(< 1< 4<  n\< s< DF4;z< < <  b< *<g#|4;$}<: <  1<#,E4<$}<: <  1<#,E$4!<\< <  < *<g#43<< < <  = = *<Dg#(4G<$7= c= >  B B B L Ep5<$D D D  Y#D Xm*E5<$D D E  H H H H E(5<$+J 8J ;J  BIJ Xm*E)5<$PJ ]J `J  LIpJ Xm<EL*5<$PJ ]J uJ  VIpJ Xm<E+5<J J J  kJ K \T2-5<K $K 1K  C,JK SK 7 4.5=*< `K  b< h*<g#x/50=fK sK wK  K EL UL \\`2l65a=]L jL sL  L L L 7 4Ċ75G= L L ,,@85~=*< L  b< h*<g#85=(L L  .L L h*<Ԋg#X95=L L L  ;M LM SM X86L\g#X;5=jM xM |M  M *N ;N $EI3?5/>uQ" ;Vu,,Tp@5a> PN cN jN  N N N 4 hqlC5>uQN  ;Vu,,TC5><N N O  O .O 5O W>O IO  WoW,,0PE5?YO rO O  O P P X\C#Q5G?P P P  P P dmxP\S5k?P Q Q  IQ Q Q DD4PD\5?Q Q Q  Q R R +<pg#]5?R (R  b:R MR <)^5?R VR  :R MR <)_5!@ [@\* ̯d@*<q``5B@ -hR -  Y--)*@Ta5@ sR R R   R R ))Ȋ4b5@ sR R R   R R ))Ȋ|c5 A b.R z.  ɬ..))Ȋd5DA ^R R   w\*<d5eA *" )<0e5A R  L R *<qtf5A x{ :*<qX IX \$\1#t50F XX jX rX & xX X Dd1#d5WF X X X & X 0\$\t1#5~F X X X & AY QY nY $`dE1#5F~Y Y Y & jY <\`PC#h5F Y Y Y & FY Y >@6C#5GY Z & (ݣ,,l 5RGlZ Z & \Z > 4k7ܠ5G&Z 2Z 5Z & LOZ |5GZZ kZ zZ & ~Z Z >@6k75HZ Z & (ݣ,,l@5Gs?Z & bgmg-<k75^HZ Z R[ & mK6\ =\ >3Ȋ i}5xH\ \ &] & ] ] ] 043ȊY i}5H':Z^ & ;V^J)<5H`^ m^ t^ & e^ ^ *<0i}5H^ {'^ & '^ 0VH\`1#5H ^ ^ ^ &  _ ,_ ;_ x\O}L5aIP_ [_ __ & _ _ `5{I_ _ & _ :+)5I\"` & ` L.<i}5I ` & )<5I y ` ` & y D*<C#@5J@v #` &` & .` *<3̸5GJ [ ?` B` & P` D*<C#`5sJ y ` a` & y D*<C#5J y ` i` & y D*<C#h5J y ` q` & &y D*<C#5JChAy` & +`*<ql5K y ` ` & 0y *<C#5OKChA` & 6`*<qp5KChA` & ;`*<q5KChA` & @`*<qp5K ` ` ` & E` *<C#<5L v?` ` & N` ` 4DC#о5WL y ` ` & Ty *<C#T5L y ` ` & Yy *<C#ؿ5L` a a & _ a 3a 4 4q5L 6:a =a & jCa mg)<h5)M 6:a Ra & oCa mg)<5WM 6:a Xa & tCa mg)<X5M 6:a ^a & yCa mg)<5Mda ua xa & }B'-a *<C#5Mda ua a & B'-a *<ċC#X5Nda ua a & B'-a *<ԋC#5+Na a a & Sa a \*<5WN T:a a & bga )<45Na a a & Sa a \*<5N Z` b & Hb )<X5N b $b -b & Zb qb zb xST\<5Na a b & Sa a \*<5/Ob b & b )<$5^Ob b & b )<l5Ob b & b )<5O b b b & Ib b \*<$l5O b b b & <Ib b \*<4$5 P b b c & JIb b \*<D5RPc $c +c & VB'=c Dc 4DP1#5xPMc ^c ac & ^D*<1#L5Pqc c c & jd d d $ g55P$e e ie & ?f Kf af |JJ E$5P(f f f & f >h3x5Q f f f & Y&f Њ35KQg g g & 0;g ľԾC#5}QHg ag eg & g g g YOTC#5Q(g g h & i 9i Li 8 35Ri i i & %i j j pC#5ORV A'j & :(;j Bj *<qt5RMj :a Zj & Bbghj mj \*<d5Rm5tj {j & Kxr }j )<tH5R j j k & O@l el l c$ 35Sl ^c l & l Km <)\5SHE>m & m $m +)5 T a )m & 3m Dm *<C#5;T Km Tm Wm & -)<5eT_m bm & jm MW-<C#5T{m m m & )n dn n 6|Sa n & DS+<3h6T n n n & Ln V`\X6 Un n n & S o "o hNP6KU+o 7o ;o & e{o o o 8 6Uo o o & so o E 6Up p &p & W \p wp $dP6Vp p p & p p p Pl\В6TV p p & q )<6Vu$q 'q & )<g#6VF` +q & U)<q6V/q 8q ;q & 'G?q 4 4q|6COHq Kq & Wq fq \*<L6Wkq uq yq & q q :336@WDq q & \*<6iWq q q & cr 436Ur r r & ̯)r 4 4C#6W.r 7r & ?r Pr 5 436WWr ar er & #r r ,3`6X=ip r & Er r r 4DČ36(X)b s & JIs x\\`36RXs s #s & O:+s \\`Fx 6{X=ip 4s & Tr r r 4DԌ3!6X)b @s & YIs x\\`3!6Xs s Hs & ^:+s \\`F"6X Ps 8q ]s & c'Gks ts 85 4#6-Y {s s s & ks s TDP%6Ys s s & }t 4>&6Yt t /t & =4st t ԐX @)6KZt t t & t t t \-6Zu u u & .u :u Iu ,c26Z 7Su Zu & Enu uu 85 426Z|u u & u u 4 4C#36[ Wu u & \*<,462[u u v & Xv ov xv \Q ]C#66i[ v v & Cv 856p76[v v & )<76(SoFv v & )<76Bv v & )<76[v v v & v v 4 4E866\ w w w & 3w 8w 4 496u\?w ^c Lw & f4 4:6[?w ^c Xw & f4 4D;6Bv dw & -)<\;6\\thw & 2\*<p;6\lw uw w & 8w w w 46 4 =6 ]&.w w & Ex x x $P>6F]%x .x 5x & I:Ix Rx PT?6][x ex px & Rx x x xS\`0|A6]x x x & a y y ,L]B6]'y 0y ;y & mky y y xS\PD6^V`y y & }%y y ,d~] F6DhQy & w\*<xF6N^lw uw y & w w w 46 4p(H6^z z 6z & z z z P|OQJ6YQjz z & bgz z )<4DK6ZQjz { & bgz z )<DK6^Qjz { & bgz z )<T4L6^Qjz { & bgz z )<dL6WY*{ 5{ <{ & L{ S{ 4$tM6_*{ 5{ Z{ & L{ S{ 4$\N6O_*{ 5{ j{ & L{ S{ 4$4O6_*{ 5{ z{ & L{ S{ 4$ P6_{ { { & ̯{ { P= 4C#P6_{ { { &  { | hZ|O<C#TR6`| )| >| & s| | | 4`E3T6~R\t| & \*<T6J`'I| | & Y| | 45`U6`--| & uZ4 4V6`--| & uZ4 4V6'a| } } & M} n} y} 43Ȋ$FX6]a(} } & .} } 45`$Y6a--| & uZ4 4Y6a--| & uZ4 4~ L~ P~ & ~ ~ ))`hc6Lc~ ~ ~ & $ A T Tč3f6c\ di & K+s V[3g6c,|  T & 4 ҂ D p3 3|6dP Y ` & s z PT}6Odmw & t)<}6dmw & t)<@~6d & x׃ ]6d  $ &  N a d ^6$ex &   8 TQC#L6Re[] d & +v  dԍC#L6~emw & 2t)<6emw & /t)<6e & # Å Ȋ6f8̅  & 9ֆ  E6Af" ; c & [ }|L6|f  ) & #? J 5 43H69g-;PU & Y#[ 5336zg b m & ? J 5 436'h- & Y#[ 5336hh & 2'ɉ 9DC#6h ҉ & I  N\L#6h$ - & R(ݣ,,lh6h9 < & fB'F 46`,6h} M & lEU 46`6i\ i y &  NJ J0@6 4k76piZZ & Z  >@6k7<6i % & !(ݣ,,l6i1 > J & o JJ`P3 6'j1 > & 0o JJ`p3\6dj ̋ & @  t,6jzR# & & K20 436j7 D K & Y_ d 5 43ж6jm z & c ˌ JJ$6,k Ҍ & z ' < K}@46^k D V ^ &  K~@D6k ō &   Td̖T6k ! 1 & s  LG L^6kzR# & 20 43P6;l ǎ ˎ & } tL6dll  & \Z > 4k76lZZ   & 'Z  >@6dk76l8 ? & ,(ݣ,,tl6%mHK N & 2;V^J+<C#6fHK T & 8;V^J*<C#x6cmsZ ] & =bgmg+<C#6fsZ c & Cbgmg*<C#h6mi r u & ~ \OC#@6ni r & ~ \OC#6An 1 & , ?DF6n & 6Ə ׏ \O6n 1 & = ?DĎFl60o2P & SY#  7DԎC#6o2P & ZY#  7DC#6os  & bgmg+<C#46gs  & bgmg*<C#6oH" % & $;V^J+<C# 6gH" * & *;V^J*<C#69pu/ & 7(#,Ɂ6}pu/ 2 & B(#,Ɂ6pZZ 6 E & FZ  >@6k76p_ f & K(ݣ,,l`6;qlp s & P\Z > 4k706nq&Z  & WLOZ |6q Ր & L d 0L` 36q( ґ &  / D dTFE6rU f ^ & Y&x 0`3l6>rv & .<C#6tr*  &  465`36r ǒ ʒ &  Y\`$6r 8& t{*<q6s 8& t{*<q6+s aY% & Ƹ*<q<6s v& \*<6sK& HA%)<\6s&/& 28)<6t   & . ? D )<46Rt lRO& uR*<6kt lROuR*<6tS \  b ,,86tWy ~   ,,6t$Y~  slD#,D6t  Gؓ mS^T6u `    P2 M V 0b`C#6(u67 R,,Dl6Ku0a o  r+ ږ  ċ0 < 7eu!   )< 7sunO×  ӥ-*7x 7u˗ $Gԗ  'G 0VPg#p7u     ɘ ܘ d%$, Q#47v6  ,,T7017zz  m C b H77z{   ! 2 T `$7;7z> H O  b ,,0>7z$Y`  XslD#,>7z "  a֞ ? 44@78{ i  l \*S A7b{ $ S5  jC \*<|C7{J _    4DȊ C#F7{1 )<F7{"b 5  (; *<F7|n9@  biB*< G7)|F O  k l4DC#H7V| ]c  Y 43I7x| Ơ  ܠ )<J7| ;  $ϴ 43qK7| & *  <L9 )<N7|  e% AD3pP7:}    - < )<Q7c},C \ Ӣ    - $`4 G94Y7z} ޤ J  ~ ̦  3b7}O #  V3 ֫ B  8 3L7~ 0 *  :< M lPPC#L7:~(X ɮ  L M L@ ܭt\7d~ q G z   V|O7~ 0   ٶ Tp7~   *S d s TF 7~  ]   B\5^T7-!G$G3 )<g#L7AQ i v   4DDAx7Wc  Hc,,7x,ø ۸ ޸  ` OO}l7 ^$   y\*<7   H!V\*<7   !  C9 `S7 B )<7:F S Z  x +)Tl7W$  ٹ ޹ /T, _#7|˶  !ۃ<)t7  #  3V [ *<Fg#7€|l o  ASw P*<N\7~  PB' x)<dg# 7 ˺ ׺  W / Td7! ;  eE B 4N7AL λ  {U 8fQL#7 -   [)<NL7  @   ս ` NH7# 5 ^  ޾  `N7%C [ ~    t`Nt7HD V {     `N7owCC j   d\N75 ? b   ;DQN07҂  -    ;DDRN7    `p Ӏ7  X  8  Ȋp NX7*m z   ;D0N<7I   5 < B5`PN\7n(K X h   aaFpN7  5 v  ; q dWd *88  bN,,88c    . ?\587 E b   aOL_N 8 ) O  + (.XRo8"  =bN,,8 & 3 D  Cg ^ B  ad P|O{Td8C  n P|O${pf8c  x P|O4{h8    P|OD{j8 !   P|OT{l8ɉ 3 D  \ P|Od{o8   )<{o8   ))<{p8     - T ] P|Ot{r8! d u x   V)<{s89 f   )<{t8N   - T ] P|O{tv8g  )<{w8}    < E P|O{x8 L   < E P|O{z8 ^   < E P|O{|8 p   < E P|Ođ{~8Ԋ   < E P|Oԑ{8   < E P|O{p8  % < E P|O{X8  . < E P|O{@8.  7 < E P|O{(8D  @ < E P|O${8[ u J",{ 8t   V1. 7 ))8F _ j  1 ;D_C#8#  %  Y ^XtG8]   1 (6 4`8}< ` m   4IC#|8c  Hc,,8Ȍ qD   p+<8\ )<{8  .   ( = *<g#87B O V  j { 5 4D38a  0 )<048   , 3 h*<Th8: A  .7hL (+<d8ōS d o  ' HbOti}8    `f<G:n8 57   `f<:n8?,': "  ;VJJ0 Tb<P[n8e9 j   pg#`8 # < @  ]g )<d8  - t 0 \8j V\4Y \*<q 8 \   9' . |+<N8 9 R V  =0 _ h +tfLF48(  x $9LF8$ ) -   $9LF|8_      098җ$)  ` +<G08(- : >  3~ Hs~88s  z +Ķ8ߞ  &  +Ķ8F ' : >  m $9LF8   , ,tf8 x{ :*<q8F(3 @ D   N 9r  R V  =0 _ h +PLFD9;(* > B   $9LF9$  + v $9LF#9 ~  B 09$+9w$)  ` +<4H4.9F( :  3 I S dHs~829  z +*49p  &  +*79ӧ   ) $9$LF;962 ? F GLG,P?9,C P T   0K9˨  ! *<qL9 ( 1 [ x4 *<qN9 ; H S   3w { ))ȊO9= sR R   R R ))ȊO9 sR R   R R ))Ȋ|P9˩ ; H S   3w { )`)8Q9 sR R   R R ))Ȋ<R917  Ev (+<PS9Q  B' (+<ĒT9o *" \*<T9   )<ԒT9W   \*<T9!  29? \*<U9\\_ )<U9&    3 B I )<qV9H V   )<V9i_ h q  .2 )<qW9    6DH3 Y9  (  R c h*<HZ9ӫx   W`b${T[9DW Y,<C#[9 TV  (+<\9F   5\54{`]9n   )<Dx]9    $ \*<TD^9- 6 C  k z  )<Hq<_9۬ 4   )<d_9 q  e )<|`9+DW MW *<3$a9N   h*<{a9uTV  H (+<qLb9nr  6+<C#b9ŭDW Y,<C#c9    ! 6 ; *<td9=*" 2*<# e90 ~  .\*<e9QW%   P*<NTf9vB'  P*<Ng9W%   P*<Ng9W%   P*<NHh9W%   P*<Nh9 W%   P*<Ni9.F   P*<NTj9T x{ :*<qk9} *'  O *<qk9ǯ x{ :*<ql9T ` m -  D[tn9%c 0 y,,n98 0  O <* s9QW a e 0 h <*9j %- 0 G 4 A hx_9ܰp 0 Y = u <( q94   0 W n v 4 1O$F8: , ! 0 P ! D::-4! ?! C! 0 }! !" <" @@[4FB:rQ" " " 0 # # # t  DC#K:# # # 0 &!$ \*<M:-($ 0 FY#+t*3@N:ȸ0$ A$ D$ 0 Ge`$ ,,(O: e$ A$ r$ 0 Ue|$ *<]P: $ k $ 0 ]$ *<qQ: $ B $ 0 ~$ % 5\5qT:>$%  % 0 6% ADEU:X$%  =% 0 6% ADEV:x$U% ^% 0  % ADELX:% % % 0 * % py`Pg5Z:% % & 0 b& py`Pg5]:Թo& x& 0 & h*<g#d_:& & 0 "F& )<h$`:##& 0 ))<`:! & & 0 -& )<h$a:;& & 0 4' !' 3 4c:S(' 5' 0 ?A' R' )<\d:j V1Y' 0 7b' #,d: m' v' 0 zY#  85I̯TXe:' ' ' 0 ' ' 46I̯4Sg:( ( 0 ':( )<i: $Y?( B( 0 si9)<qli:7 H( y( }( 0 ( ( )<ql:Z( ) ) 0 0) 6) )<`o: m' E) 0 Y#  85I̯d0p:V) d) ) 0 (8* k* * T[\x qv:޻* * + 0 <<. (/ / ${ X q: 01 Y1 i1 0 @x 1 1 *<tqt:h 1 $2 (2 0 $3 A3 Z3 h[|[q:(o3 3 u4 0  8 9 : D $:; ; ; 0 ; ; ; <)(:ռ; ; < 0 ; ; ; <): < (< 1< 0 L< [< d< `S|y: m< ~< < 0 = > > ,h|j :.x  &? 0 tV@4 4:M@? @ I? 0 2S? 85 4:nZ? c? f? 0 ~? ? 4 43:? ? ? 0 9A A A P:Ƚ 80 t{*<q:$MB j^B 0 %Y-L 4ӈ:Y qB |B 0 B ҈B \*<p:x v0 \*< : *"0 \*<:IB 0 ")<$:ѾB B B 0 y B B )<: B B 0 C C )<Ĕ: }!C (C C 9;C XC ]C )<Ԕ:6dC nC rC C PC C 5D#@:OC D D C F F F B 4 ;8G G G C 1JH fH {H 8 a8&d ;H H H C H H ,,p;3H I I C I J J 0bs3;c+J 9J BJ C K 8K IK p;z(RK kK oK C =K )L :L X,";}7FFL C ;C XC ]C )<(#;@\L vL L C N @N WN 4HؖT&x-;$@zN N N C O 4O EO IJST&@2;VjO {O O C )tO O 46I̯I\5;v O *P C KP #P )<q86;(0 *P CP GP C #Q =Q SQ s$,4La5#@; Q C Q ,,A;Q Q Q C zR R 460WE;R R R C %HS ^S qS T\ J;S S S C 4U JV V Xsls 30c;V W W C W W W \*$g;1 W C g\*<g;ID W C sW X \*+h;_\jaX C )<h;x X $X CX C X Y .Y D4,aCm;OY \Y `Y C Y Y ز,r;Y Y Y C Z CZ HZ *<4qs;OZ pZ Z C [ "[ 3[ 4\5Dw; O[ CZ[ C 6r[ }[ VPTx;'[ [ [ C I< [ [ )<0\z;4\ja[ C Q)<pz;OD[ [ C Z\*<z;l[ [ [ C eY4 4C#{;[ \ C 'G$\ )<q|;u)\ C ",|; -\ :\ C .<N\ *<Pq };[\ d\ k\ C Y#w\ |\ *<d};\ \ C o\ )<q~;#\ \ \ C \ )<q;=u\ C ",;a \ \ C ] *<pqp;7 ] C E*<,;] E] C 'C] )<qH;J] [] C ɬq] )<q4;Ev] y] C ",D; Ev] }] C #,qT;u] C #,d;4u] C ",qt;RD[ ] C \*<;q] ] ] C ӥ] ] D*<tC#,;] ] ] C ӥ] ] *<C#;] ] ] C ] ] *<3X; ] ] C <ө] ^ 8-`);$f6 ^ C AB'>+<E\;%^ 6 ^ C JB' 8-* ;N$˗ "^ C K'G \ZPE;}0^ 6 ;^ C TB' x2)ԓ3܉;$C^ L^ O^ C U]^ Et;,h^ u^ y^ C [^ ^ LX@;( _ _ _ C L 1_ 8_ L+hQ};$?_ 7K_ C [_ l_ 6<9Eܔ;)(s_ ~_ C M_ L+)܋};L$˗ _ C 'G \ZPE;u ܈[_ C t_ -t*1h;$_ _ C Y&_ E ;*s_ C ,,t; _ _ _ C e` q` |` I?%;` d` C 2y ` 7D3D;` ` C ?e[+<3,;+` !` C LC,a 3DC#x;G a a !a C Yc1a x)<C#\;h a a 6a C fc1a 8*<C#@;Fa Xa C s|a a 7 43;@a a C ea D;8f6 a C B'>s<@D;Da a a C b b b @AĕH|; b b b C lc c c 5 4;c c c C  c c @8Dԕ3;'c $c C d +d 3 4C#;K4d @d C "< dd kd 9DC#|;t4d zd C +< dd kd `7DC#ܺ; d d d C 5d =Iس1ػ; d d d C :d d hNOg#; [e C Gt_ =31ܾ; e e !e C L/e Le 4 4g#;*{ Se C Yce ;:3p;6 he Xqe C ^e e hNOg#;[e e C k\e ;33h; e e e C p/e Le 4 4g#$; d d e C }d =Iس1 ; e e e C f 2f hNOg#; [;f C t_ =31; ]L^ Kf C Wf tf 4 4g#;C*{ yf C ce ;:3`;j f f C f f hNOg#D;e f C \e ;33; ]L^ f C Wf tf 4 4g#;f g g C jg g 3\; Zg C (; g *<;)-Xg C g g g 553;Hg EC ?*<;$h IC Øޘ*<a(; #h "C buz*<;6h C  "(*<I};: T8Qh q8C L988*<I};$GUh kC 5К՚+<LF;ph .C `e+<}4;xh C (e*<};.h ЛC *<0D;Uh .C CRW*<$}H; k>C B'h *<q ; % % ( C *<qh; C  <)<; ~h h C  h )<4q; FC (H)<q; h h h C Hh h 85I̯P;7i i i a ei i 4k4;Ji i i  i j j +t*D$;(j Xj xj  k k k 4%D%1 1#<k #l 6l  =l l l pm|m b<Hm ;&<Br r r  s -t 7t L>;p0<#Ot t t  7u :v Dv =;:<CBr r \v  s -t 7t L>;4D<cw -w Pw  jr(w w ))Ȋ  E<w w +x  ~; x x $ntZ 4I<y y y  z z z =;ST<{ { '{  ?W{ ~{ { t 0(X<={ { .|  P} } ~ ȩRHg<bB~ f~ ~   + 8 mT%$ l<4s       DJLHo<p    ,,o<n !  ӥn1 p#,TXp<HÙ8  E r#,q<$\aa #a,,(q<A8T a h  9 `V<Pg#s< Ȁ  N   h*<$Tg#t<{% 2 ;  $L S )<pu< \ (+<u<'l o  i(+<Lv< (+<,w<4\4  i(+<w<h (+< x<ʁ dӁ  +I(+< y<%  * (+<|y<  I(+<Pz<&\" f(+<,{<Y @ (+<p{< L O (+<{<] n y  L (+<t}< Ă  E΂ a#)<D~<u K",T~<J  M΂ a#)<$<}u S",4<  U΂ a#)<<u [",<    ]& 9 7 4T<K@ o(+<<| J  ~V (+< <] j m  j (+<< (+<؃<   ރ (+<d<{  P Ά qd<ۆ  c t*)H<8  A  m %%$tTl<4ч   b %%$T<"  ,( #-<C#<(2  l),щ<.\Ɉ ̈ )<q,<=\Ɉ ҈ )<q@<Mn؈  Skn.<C#<Mn  Skn.<C#<(    RL   41Ğ<7<! . 5  }] t  &Pt<\4   ‰ 4<d$<{4ɉ ։ ݉    ' D 4d<$Uq.  etqTD}<n9@ C  bVV#,#<{qK  q /<\<_\ W  +K_Up#,{`<*}s  7||}|#,<e-t  Aettt= 4< sЊ  _stt=p6-t< w# 6  ]#x@xEx|#,Ė<zZ m  rz{!{= 4Ԗ3ح<x  G5yRyWyp#,q< ^lҋ  Q * / #,:8<:-tB U  =etttL> 4\<U-tB y  GetttL> 4<s  flYlX>3$:ij<`Ԍ  pĆ> 44:<z   zZzwz|z#,D,<F Y  3PWd>3T\<(x-}  ς<9Td7JԸ<$ э  Lip3t7J0<0|   %}B}I}= 4h<N| 6  %}B}I}= 4<l$^ q  q9w ]w0,,1< D)"<(y DN< &T)"<  *<q,< DR M*<q<C  j*<q<q  *<qt< \4Y \*<q$<   c *<q< wO  *<q<# Nm / 2 *<q<Q aY%  Ƹ*<q,< g B'.*<q< 8 t{*<q< _k` oȎ *<q< ώ \* ̯܎ *<q<5 aY%  Ƹ*<qL<c  I*<q< // *<q< A A D *<q$< /  *<qD< _k` o *<qL<H O *<q<q _ _ b *<q< r  S*<q< @   ȏ n <0 ! P  ) ΐ h H<)     F [ n xP<Zy   ɑ ґ 85<9ė<ّ  vd h*)`( < Ԓ    *)`LbC#<( > j  Q ti #<R(ߔ i  @ L q d[ #8<(  5 ,Dk #H<( A  i  # =( Ɲ P  ʟ ֟ dD #=4( Ƞ ]  ͢  w5 #$#=l( r  ڥ  (L #.=(Ŧ "  ڧ ܩ@ #p4=8A Y |  Cͨ ٨ n$U; 7=8 )  V ͪ T Ȼ ;8C=8n @   S $ < |o ;,R=, >  Ѱ ݰ `L #Y=(z ȱ  )X d w \tL0 #]=9(Ȳ  6I r ,Lx\m #m=r(f   < } <] #dy=(  n  8 D ] 8 T 7 #=,Ⱥ   3 V  C =&     *< g#Ю=Uw   X+^ԗ<=   & mcdU== hF  89c qq3=-"r  H) *<3=Rpx  L;)<= Rpb M;)<=>|  O  ))T=X+ 5 9   3p=h {  : 47!q8=~ +  1t,,= ;I  . !#,= $    *<g#=VD~"  4 + )<=0 = D  =e |+<}=   1\*<P=' . *<q=B(  P+ ; G t1lS }p= Ft   ,,b#=   Tdb}L=     (E3\ }=;8  ` tDR T=i  "  ^D S X *<03P=i v z  @, pO|O3= [  Y 4Dq=$   jP c *< cq=\0~  |+ ,,P==    x\xPXT 3=9 )p   P*<H =  #  (6 ? 5 4g#=uxF  1",=uxI  5",=h@L X _  9L n s q<D=Hz  G $<=|    *<p3 =  *  Y ^ )<q=+@k x  2 F [ )>H  5H ^ o 3\>WZ \*<>WZ '\*<>S   6 \*<>7\_;v B)<>R*u~ E\*<>o*u~ M\*<>    & x)<$q>ry- 1  ] 8*<LcC# >I     $I 4cC#8 >i S  F i n 0I 43 >w [   `/<3@> S   8 *<4q>? L  n *<DqD> y-    P*<T>3    > o P*<dh>Tz $    5<9(q>x +)  y 53q> =*" *<q@> 8 tM *<q>( s " ө ؁}T>  " .N l x d@\5t3` >/$ L " U d*O}!>V (   Dp   ( ~". 1 )<g#$$>g p8 ( ;< ",$>A J ( b D8d&>< ( 0 *?)>@ ( &   ( @V?G->B( />' ( T%/ A 4}.>q(6 O Z ( Y @4q2>4 * (  P { $ => (   xS|OtJ@>b0 (  Th<}hA> + 2 ( D S Z +<wAxB>Ua p (  #,C>cKH #,(D> DRMZE*<qD>q :  ,,ĘTE>   :   & lcXM>6 G f :  #,JO>^r Q : r ,,O>c  J H  #,0|P>c  J H  #,PQ>yc ( J H  #,pQ>c 1 J 'H  #,R>q,: F M J P_ j )<Jg#R>L: F u J `_ j )<Kg#S> J ) )*w{> 8 J Dy~,, dP}>\t\ J 3)<d}>E\t_ J 6)<x}>sb e J :p )<}>u ~ J J )<~>! J ]  4 4ԘT>X ' / J u pOP3P> J 9 pO|O3> J  ' 0 OO3> f; B J nJ Y ^ )+>@ /J  *<q>oe r y Y \ *<3|> Y  ! Thԓ>[0< T _ Y y *4 Y   |D4K1>$ < D Y % >\5$3>$ Y C u $*4* >$ Y n T<43>?  - Y y D*T*؄ q> Y Y p@Dqh>  Y }, ; D 3B l>Y b Y ܊ <dKB x>3  Y   )<ط> # Y , <UB t> U Y  - 3 )<Ld>@ M X Y  )<G9> # Y 6 E K ,,h >v I Y  ,,x4>  Y %r ,, $> Y =D T Z )<VL>} Y U <TV#|><  Y AP W <<D\ @>d n     <)0>$Y  slD#,> S @  <*>   ^% 6 <)> 71 = p#,`> B O X el {  #,T> 71  mp#,>60   . : @ P`)`d4>Z T a p Q   $4d@>s   bF U t*)` >a e v   ,)`H>  8 @ p ~ @8 >     n. 5 ,<0MP>;  J   ] tL P>b  H <   \``Ptq>  " - ?E X a 5@<Kx> r P h`t`<30>  6 +)T?  N +)?  d ))` ?7  7 J O lA3t?o $Hd^ ;VT<t? $f s v  D? $f s  D?  S (+)`Pg#,?  V 65? Y0 { (+<g#?# u  ",?K R  ;)<|?r u  ",? @b   , D? H3 ? B J Y \MD? u ` ",? R d ;)<0?0 Eh k ",@?\ @o { ~   D?| H     pMD?     S d s pEt?     5   EX!? R  N;)<!? R  O;)< "?    Pxr F)<|"?2 - Q) *<3#?Q - R)+<3#?n PNi  \x1 0- dF%?  @ C h|#, 4%?  v G lQ |#, %?  TV Y sbge |#, &? 0j s v >f`<&?  Q)<&? )<'?GX| Ñ X   ``t\(?   jG   8@6.?W  oWoW,,P.? . [    $P- $3?u2 ;Vu,,T84?]6 A Q d i ,,(4?4t    E j d2 q@?u ;Vu,,TDA?6  Q d i ,,(A?W  WoW,,0PB?@ l+  . P3D?j9 F "ӥ2}\*<E?P  ] @  ZT{G?   o   # V|OPI?8: G J Yh 4DJJ?[m     . = lqN?I     C Mx|3 qY?   \)<,Z?  Q    |`\?D4̝ )<\?~  . B x  pq_?     ,a?, + > f y  DPd?   : h*<e?# - fY#*\*)`e?T  j)<e?    )[<$ #, h? ) > A W6U #, j? Z g j s15v #,k? { ~ x)<Hl? {  x)<l? ;   l,<7Hm?= ;   l,<7m?` ;   l,<7pn? + )<n? {  x\*<n?     7 4o?R  ;)<4 1cZ4 a4 h*<q?p4 4 4 @5 45 I5 dC# ?(x5 5 5 ]6 6 6 e0E ?(7 O7 k7 A8 8 8 Mpx e3`?)6j0 8 ,,?M*u9 9 9 9 ,,$,,?q $#9 _9 9 9 : : ܏eWAh@6j0 E: ,,4@ S: p: x: : : : `P@: '; G; 0< H< i< |t@|gq@]6j0 < @,,D$@h< < = [= = =  #3@6j0 0> f,,TD@ >> S> b> > > > 75`KP@ > > > > > ? )<d@  ? ? -? [? ? ? ^dtK%@6j0 ? ,,t@ 6? ? bgmg? )<(@? ? *<C#@F ? @ ~@ tA A A @! C#@'@6j0 iB ,,'@6j0 wB ,,(@B B B B de)@@ B B B B DA*@jhXB B C L%C @C GC ęi,@6j0 VC N,,Ě,@hdC qC yC TC C C ؙԚ(/@,C C C nD D "D  4pH0@0+D 8D GD ~cD vD }D 8<+1@P6j0 D ,,<2@{D D D  E E 'E A<W+C#4@6j0 FE ,,|5@  TE iE 0E E E 5`46@ E F lF .G H H tlV g#TD@= H H H }H I P`g#F@V I +I .I XI gI 5\5qH@x 4rI I I _J kJ wJ eh P@ J J J &K CK PK PP etR@ J J iK &K CK PK PPLeT@ K K K $L ;L HL ,`$#DX@3! [L xL L mL L 4p64hZ@K! L #,Z@q!L KM M ,YP gQ Q k w@y"uR R S =T T T X 'C#<@"+U .U ӥb $4X3 @% ab zb b b b b Y`L@% b b b c /c (\@4&:c Rc Vc  tc c `3 @d& c c c !c c ,,@|&c d Ad /e f Wf M XX3@&f f f g Gg l|A@&Sg b kg }g g a(q@& g g g \g \*<@!'g g g h h !h (6 4D@:'$(h 5h Hh zh h h OL@' h 5i di -j j j  @' 9k bk k +l Cl Kl (6 4! A6( l m m o p jp  A)Zp A+<Ab) p q Tq q r &r (65` P A)DYr ]r +<t A) cr r r t ?t ft <M <,A* t t ju ,v v v eP L6A* @w w w kx x y LdȚ@A* :y ky y z 0z Gz MX\GA+ mz z z `{ { { uQAQ+ { { { C7| Z| g| 4xUA+w| | | _} } ~ p- q]A+E~ T~ m~ ~~ ~ 541d^AX, ~ ~ ~ ~   (eaA|, O3 6 %? )<bA, F T a ,   *<eqdA,  | f و  {A - Ό Z1 N X P A- lU V $V PP fA-J Ս g 2 ? PPLftA-X b bŎ 4 4fA. 5 ]c PPfAE.( A2Ï ʏ 43Ȋ08At.Տ ޏ JMX 43܋TA. LU V $V PP glA.& / 6 BOJ 4?dhA /Q [ DU $V 4 4LgܫA Ŷ  Zm   ݼ ]- \ d )< DBh> hn **ȋ o3B> Ŷ  m  #v; J Ff m 4:L|    45`ZЖB(?m5@ C xr F)<,Ba?J Ս K  2 ? PPLoB?J Ս z  2 ? PPo B? ÿ   x\] 3B@ Ŷ V m  Dm  S V Xn *<3C Jv3  oQ #,C3Jx s+<3C[J  4axPi}CtJ *  8C#CJ # A+ = E Y@aPCJ,KZ dZ iZ Z Z MMH C K]  , (,LqC#T&CmK U . 4h5CK,. R W # e`8CK$ B A 449CK " K ] p d`,@C#L  <  \ j h,HCwL   ( (DhLCL 3 . ' } :X " taCL   + y 4Np\eCMha  b /b >b $]3hC@M 8 b g / N lCuM:c Vtc c `30nCMH % \ jD tnTyCM  / = /. Y`PT{CN ! \L ) LL ԒCN G &' @ hC:O* C H z Ȑؐ1#ܤCOO c HN\NhCO % F    0\ HCP D j F *< qC)P  O }S T0Nq,CfP ! V G @P CP  A   HMCQ ; M R P LaXadCQ  d \$^JCQ  i i XdtCQ  :  Ydat^C3R\ -(#,AChR$  1> [ d $paACRo v M{~  (#,tCR$   Q / @ p<q$CSW c l kn  3 4g#XCS   u   tDMg#C0S$ 8 < t KCTS      : c ,Lt8 :DS(      DA$ DS  m     pN4hȈ 1DT(T a h h\|v U<#D:T4}   %  , -$!0DeT_ t ,U V $V PP rDT (8 g x  ` DT, H  DC!DT(  * PF Y ` AD} #DUm v  Y  +<ĝ3($DKU( 3 ^ϴ A 43P%DuU$ g   ؁ԝE$'DU   p% 6 |aOE@(DU,= I L rjX |H)DV$e r u Y D3*D+V,  \5g#+DlV$   ( aRtMEl-DV3 @ _  ,< #/DV( =4 f<1DV0* 3 8 0be p 4|O>94DV    fF  *<M$5D1W0   D15 DS>9T6DkW0   D15 DS>97DW8   m8 L [ ȊLr l:DW0   D15 DS>9;DX0   D15 DS>9DX0   D15 DS>9?DX0   D15 DS>9@DHY   L a p PNȊr-|EDhY0   D15 DS>9FDY0   D15 DS>9GDZ<   # / B `TP#  LD!Z0   D15 DS>9PMD]Z0   D15 DS>9NDZk t y   07 43PDZ@   15 a<~QDZL     `PRDZL     `PTD[H  + 0 N ] \5VDK[,h p bz <,,HVDp[     ))`XD[      8ZxPC#4ZD[Gg" * Hc4 ,,0ZD[ ; H M   3]D[    t (6 4]D\      NP^kɁcD8\6  ,,$dDe\% : N /v   ,< skfD\   B   YP4qhD\h   Q   hD\# , 0 YF W 5D3iD]^ o s f_$ H74kD]   w  h*<Dq8lDF]     SdqnDk]  ( F ] t56oD] d      ^tTcrD]    ,,d4\sD]' 4  l   X4W,~ D3^W # 8 Ŗ PPLs0DZ^Տ g n MX 43܋tD^~      45`M8D^J    2 ? PPsD^  ( Z4MD_7 I L f y 4 NܚDK_ r)SȚ$ T$ i$ N}Db $ $ )<D6b$ $ $ B$ $ $ RaDfb,$ % &% z% % & t̛ mZ|Db,8& J& N& b& m& r& TIDbTy& & & & & i}lDb\& 3' ' ( ) S) (ȏ ElDb) ) ) c* 4* ;* )<Ng#D3cRN* Q* 2\* {* ,, dDXc* * * %+ f+ n+ )< l Dc##+ ~,, Dc + + + # , , %, \EDc 44U*<qDc ^4, *<qDd *' O *<qD8dV;, ?, {K, Z, 5DĞ6Dd a, n, s, , , , a4Ԟ6D&e ÙE!*<qlDHe k>B', *<q0Die k>B', *<qDe a, n, s, , , , a46 Df v, , , \*<D(f v\*<DDCf v\*<Dhf v\*<|Df v\*<Df v, , , \*<Df v\*<PDf, )<D g , )<$lD,g6- -8=)<4 DJg - - - !- j0- \*`)DDpg7- 0\*^Dg(;O1a<#Dg IFbm*<:(Dg(;Oa<AD6h C- L- U- E_- d- *<01Dmh=*"2.<:44 h `4 4 4 tEGmK4 h Hh*<`Enmux4 h W#,g#pEm4 4 4 h \F4 4 86`g# Em4 4 4 h g5 (5 /5 )<"Em65 T5 h ~5 5 5 )<H$E!n5 5 5 h 6 ,6 56 h*<4Ng#'EFnB6 N6 h ^6 6 <t%(Een 8j6 h (e6 `S[)Enh6 h 0)<)En 6 6 6 h 7 7 7 qq$<3En r h S*<q3Eo7 8 8 h 8 +8 68 4t5E!o 2=8 D8 h IK8 R8 P5 4DC#,6EAo' h 0x)<C#6EaoY8 b8 i8 h p8 8 8 TL8Eo8 8 8 h 8 8 > 4dC#<9Eo *"h \*<9EoO8 8 | 8 I8 ,,p@:Eo 9 9 9 | 5H9 9 <)LAEo 9 9 | .9 9 ,,AEp9 9 : | ?= V= = xypX  1#0\E9p#? @? ]? | g] ? ? 3\5| x^EXp? ? @ | A 2A qA <@$ jElpA A A | mB B V4Rt mEpm5B B | xr H ,,hmEp&B 7B :B | ^LB (+<xnEpSB xB B | t SC ^C rr̯hrEp C C C | A-9D PD **tvEpkD |D D | ]D D D 56` u {EpxE -E AE | E E E LuiqEq6E E | ',,PE+q;E | LE F ,,E9qF 3F =F | hF F )`)tENq0F F F | BG ^G G y 5i}Edq6E G | ,,\Eqr 7~ G | r ,,ЌEqLG G G | "WH kH xH r,< 4EqH H | '(ݣ,,lErH H H | O:I MI ZI NuKErH uI | T(ݣ,,lP Q Q 4t*,Es Q :$*Q  PQ aQ thEslQ Q Q  Q R %R ~Хd_EsHR UR  -b< *<W6$E,s _R lR oR  L+}R \*<$Et R R R  [̯R R \*<ԠE0tR R  hR R )<E_tR R R  wDS aS pS i}DExtyS S S  S S 6D3,Et$S S S  ET hT {T U_%Et T T  T T T \ZPEu-T  ) *<3E2uT U U  MU vU U lPxPPEQu@U U U  V V V *4l X%|Eu W "W )W  Em H3W )<Eu:W GW JW  cZW mW ,,EvL rW  s.xW h*<E"vn2fW  |ӥW h*< EGv$W W W  9X eX ~X q`dN%EivX X X  X X *<u30EvY Y "Y  ZY qY xY *< v3Ev c1 #\*<EwY Y Y  -Y Z Z +<NC#E&w Z $Z +Z  J^=Z DZ 85 4ESwKZ TZ _Z  TwZ Z Z 5HI$EqwZ Z Z  a/[ K[ l[ ,(NqEw$[ [ [  [ [ [ Udg\LvTEw \ \ !\  5\ P\ c\ *C#Exn\ {\ ~\  Y\ qOECx \ )o\  \ \ \ (66`4Ebx\ \ \  ] ] ] 6DD3Ex k> B'.*<qEx   c&] *<qEx [@\* ̯d@*<qEx *'  -] *<q,Ey C- 2] =]  E]L] )<TE9y$0EW] ^]  g] *<dW6(E`y0En] u]  ~] )<thEy$%  ?WS<΂ EyDW Y#MW *<3Ey,(/ 2RWq<hEz$WW I T<~ E,z(] ]  ] ] Q<lERz ] ]  ] ] *<F{zW ^ ^  ^ D*<W6Fz W ^ '^  0^ )< Fz7Ù ET *<3Fz B'  K ,<QKF{P\4Y \g *<38F5{7^ @^ I^ h^ ^ ^ <)vF{^ ^ ^ gO^ )<4F{^ _ _ `*_ ;_ D_ <)ġTF|O_ X_ __ @_ _ _ +)N F.| _ _ _ u` ` <7 41FY|` ` ` ` ` a ;3$O}F|a )a -a wa a a 5 401|F}ua a =)<g#F2}a a ?a )<q(FP}Ha Ca )<qFn}ua a L)<g#F}a a N:E)<qF}Ha Ua )<qXF};I;a #. |#,F}"Aa *( #)<hF~a b b tb c c *<P3F.~"c /c 3c .mc c )< !FW~c c c Oc d d 6Dԡ3#F~ 'd b 4d c>d Ud )<P$F~ Zd d d oqe e B\5+F~e e Df g Lh _h NlV$ 7F(h h h oui i i Qq Yq #, [FɃtq q q q q q 0LDv|]F{ r r %r 4r ;r )<g#4^F Dr Mr <tr yr #,|_F'r r Kr r L.<Ɂ4aF@Y0rr t Ǜ+<3aFZY0rr ] Ǜ+<3,bFzJ,, B e ׂ 4 4#FR  e 4 4\  F-܃ e  " ,,Fb + s 4 e:< D*<]F + s A e:< D*<]|FˏI ^ b e ,,ԢFȄ Մ ؄ eN )<q@F5Ȅ Մ eU )<qlFq  % 8 e\. )<qܿF  Ѕ e 6 C `SuLwF6\/\ e#,Fe` r } e ʆ ц 46 4PF en u,uwF  f eϊ * O Xh F  ! eU xS8u F# ei : A \*<DP$FՔP j es |tP F@Y f e  ' xS8u FuL X g e \*t*tPFĐ א ې e- # Du3Fە, l? e;f P]C#`F  epߑ   ȃlC# G# 4 7 exbZW )<Gɖ \ n  e Ւ PPuqG6{ eI- )<q<Gj, 3 f e0 % - p+<| j G` Ô et Е 4J GƘ F J e Ж ܖ *<3G F e2 Ж ܖ *<C#G<h Ou e uR",Gy Ɨ e P *<3G V e P *<C#!Gh O e?uR","G/ e$ / )<#Gl4 = B vI ,,$G(l vC2r t:6`%G l y vJ))`4&G  vP> i \m k72G֛ v # +<%%3GO 6 C c v ۝ 0DwC#>G=   + v4CN U \*<L@Gm b k r vO *<C#AG ̞ vr 1 > 7DC#DG͝O y v I Z \O C#`KG Ġ Ƞ v" / D hrlV`% hVGG vi  , <i}d_G l p vq P *<C#xcGʟh vuR",DdG v! / )<eG3$< I M v x  N _ f ))Ĥ<4H;$Y m ;slD#,4HOq z < 60<Ԥ5Hdv Y #,(6Hy$Y ]slD#,6H 7 ,,6H$YF slD#,7H$Y 4slD#,p7H; , <)=H  <)pAH  $ J D5HH   S <)MH[ is l lbO7NH4,  D4PPH $ . I *t*0RH0P % Z ̄ F`H /h S6h*<g#`aH8 l ~ 3 (B{bH[ @   L66`DS1#dHz(* I ] _ ( I XFlHe q  DDltSmH* bN ,|#(nH  ;V <)nH  {- <*oH26 o: Q <)pHRX e t ɬ 5DpC#qHE ,,qH {' ' )<rH} M +<q sHt x S  ̐  a -qHO k TdHkGh U u,,H  ( \ 8Hq H A m d̖\H ( ,<3@H%(  Q 5 B txI ЊXHPI n ` ! K 4 L H  ЊLH  ( y   H! /h S6h*<g#HH % D & )^ H' : v MA Y l ffLn C#H q   )<SH   " )<H` q z C, 3\5DL#Ha ,,`HW ,,H  (T#pH /h S6h*<g#HB  5 h*<dL#@H\ < Z c 1 bOtJHr H%+ 6 bNh yi},Hu/ U |)<g# W _  \5N0*I  ;  9 | a4Iv  p#,5I {5,,5I1 {5,,6IO  *<,7Id   $ ; J p#9I{S \ q  @B 43|:I$    0HМ=I$" `  f :#FI0E3 6 < *<3GI$< H Q C N II- c\e - )<ĥII>  ,, LIXn9  b$m ,<7MI l 4D|QI Q  DTII" [ӥ,,TTI"& 0 E ` dTYIo  2 v TdT-H^II ӥ,,X^I  v ffTcI ltcqgIC6,,ԥThIw#6Cp5iI6R,,jI`dH,<kI j5DqlI; |#,oI\ #,1/ Q4 ?`g#qI}ZmrQ07 43 "tyb<4tI3 N (+<UI0 ^ .D48I  5f  \*<DIDk  )<TIB N[`s dB 47Il    \*<dI  )<tI0% x Hc,,J"$L _ o W  8!F!xg0UqJVZ!g!s! !!!d ħ`Jz!!!  ""!")<U|J,"9"G" c" r")<LzJ""" """<)zJ """^ ("#, J i ~ #l  #*80GJ(##q p#,GJD *# ))` Jc= 4# <#)<XJ|Q#U# J)<J7]#a# 1)2)<JWi#q# }#)<ԧ4J### ###0733\ J $$#$M$j$s$h"J: ~$/\*<"J[\$1)<0"J~u4$3",@"J\$A)<T"J $jS $C$$)<4#J$$$EB')<#J$ $K$ %@g̖q%J\ %%U(%?%5 43&J: DD%U%]%s%%%<@6C#D(JZ6%,,(J %%%%%%4@6$*J6%,,4*J%&&H&i&r&b`D3-J6z&,,T,.Jd&&&&&&|BBds30J!u&&;Vu,,`1JH6&,,t1Jo  ' 'D*<C#,2J  ' 'D*<C#2J'1':'r'''P`0s5Ju&';Vu,,`6J46',,6Jd '''''(8@67J~6 (,,8J(&(.(L(a(h(8@6P8:J6s(!,,:J(((((*t*JuU)b)n))))5Dq?J))))**4AJ*+*0**++qHHJ!/+;+?+Iy+++Bt Ĩ7IJE`++,*<3`JJgh+++-.@.|n 4ؐ 0-YJe8))ZJ..{5,,d`[J...5...dt1#]J./>/$///0bbԨ7\^J]\6/\*<p^J +:/x)<^J g >/B/;)<@_J F/)<\_JJ/_/c////h*<q`J6c/////p+`)HF0bJW /h S6h*<g#bJ /h T  S6h*<g#pcJ //00F0O0BD0#eJZ0l00)0009 4bC#hJ.161;1Ns111 PPjJh11Q,,LkJ1 1o11B`94 OXlJ111z1224mJ3)2-2F2W2^2)<nJak2x22222hNZ$u(pJ62,,4pJ213634N5t5HH \5 J.5{5,,0Ju&5;Vu,,hJ%.5{5,, JRu&5;Vu,,Ju&5;Vu,,lJu&5;Vu,,p|J.5{5,,Ju&5;Vu,,tlJ3 5 5,6/666D*`)DC#J C6b6g69666X`xTUJ.6J{5,,J666>)7<7M7LHpJ  `777b77$NJ=78+8B8I8D0p.dgJoV8`8889BDVgJ#969C9999xx$DVgXJ ::,,xJ:::,,xJS":/:4::::\HTJ:;;^\;n;v;)<tJ;;;;;;))`tVJ$Y ;;A,,TJ1<  <2<C<J<)<q`JT W<`<d<{<<<)<ȧJ{<<<<<<.<pJ<*=/==>>48zJ<>>>?K?]?bblVC#Jw???5???x)<VqdJD? ?H1@C@N@B3WqJte@r@v@h@@@bNqJ@@@{HAfAxAp`<7JAAAA BBB6` {qxJ/B/:HBBBBccȊL{$@JCC*C.CeCvCCX8qJCCCDDDDTl& qJE E$EcZEoExE93Ȋ4WqJEEExEF&F P c{hJh jS GF[FrFyF))`ĩHJFFF}GGG4OlHqJ * HbH*<1#HJC!H-H2HaHHH4ԩqLJn H),,|JHHH,[IIIdNqxJIIIUJJx))qJJJ!J]JJJx #J!7KWKKM|MMb XJe<PNeNNOP8PPo O KPPP PQ Q,cX K)Q,Q1Q"ZQ}QQD0<:KU Q',,|KQQQ6QRR4<9K (RE,,|`KH,RK Z[[ L[[[8cԝ {7xAK GZZZ[ZZZWEKCwQ#[%J)<lEKi E[[)#\6\C\~XGKR\[\w\B\\\0IK.]M{]]<)IK"]+]/]VA]R]85 4dJK Y]rb )<qJKEg]]]zO^|^^  qRKc ^) *<3TSK^ ^b$m +<C#SK(^__?_P_W_ 4$X $VKAD(f_z___4 4VKm__`abJb4; Q 3pgKbbbO.c[chcB:qjK ucccdc?dZdHO@TXpK td,,|pKI xddd d e 1#`sKl 3eDeMeke}eeВ`uKeUee)<vKeeef(f7fthĪyK\Bf\*<yKFf$SfB'-(+<\zK&]f+]jfttf)<0{KK yfUff+<> |KyfffgZgugggPpKggg gg`1#dKGh&g;Vu,,؄KGh&g;Vu,,LK# gggh&h-h<@6ԪC#dKM68h,,K VFhThK, qhxh33pC#؇K hhN,,`K hhhhhhhNDc#K6i,,8K[i)i-i;iRi4 4`K)[i\ui~iD4K,iiiiiPcY,K j,,|S|h|0Oh4K  p||| ||YO`hK% }}/} X}k}r}4<+tK 6} ,,DKH&} ;V+<qK }}} ~~0 @KE 3@E!]cTKq. !6DlKc`!Hc,,hK {#'e!I:C;Dd K JӀr!%Dc 3L.!{5,,\LKƃ׃!hhtYKqL6Ą!,,tL Մ""JclOO C#Lrj" x)`)qLI$g""WfcOLro#"k$$@ qx L6A#,,!L*c`%"Hc,,!Ldc`*"Hc,, "L/`q[#  h |UqP&L63_#,,&LH D\r#U T؏L|p)L0ьD# 0p 1LFjw*$Hbci}D3LW$̎D*<Ĭi}|3Lӎ#^jO$̖4 ,{S)<p,Mi,A\``PqH/M,<@,<dq4M-?Cgw4d``i}8ML-'JĞTĮq`AMf-bl5 4L}w,DM|-KT@dLdd$[qFM-g ^e5\50 MR1z\*<4TMn1~ Ա )<M1[+t 3p6M1 K(G<)M18LOBYlq,,D8M1 x#,TM1|_tjdt 3,4N; 9N)<g#4NJ>LX3`7Np> c$!V0)<D7N>,7D[GQ4xȡ-P\>N><o\8 C#NN? <)ON!@pC`sPOTSN=@,(`TL~PNFY0dhF {,*<3lN&Fp} V4RPlN9F )<p\NPF -1 =P+<q4NmF(U #Fx DfqNF ]iuG (1#NF4W ,Let;p~NFW}Y WoW,,PlN G %*<C#NG  CWf8p fLNG{4,NGW} WoW,,PNH &HX4]3N n:3qN;JT J{,0NwJ6 ,,NJ 4 15V4NJ !Cdn  #,|NJ  9NU)<0NK^ O\}C#O`Kc Hc,,LOK (,,OKd {5,,HOK$O2  |hnI@ OLQbV PܔL+t OL6 X ,,OL  ( 8 i ` }  P^+OM6 k ,,`O@     )<]O0M    !:i#!)<P{LOXM.!:! P!_!d!p+`)HpFOpM /h S6h*<g#4OM /h T  S6h*<g#OMo!x!! !!!d;`9H]FOM /h S6h*<g#<OM /h T  S6h*<g#ON!!! "*"1"lCxC̑+O7Nd:" {5,,OgN>"G"c" ^"";\5] ON""" "")<4ON .##&#5#:#))`OO G#S#}####C|OYO$$h0<O~O$$ $H$q$x$t0$ OO$$$$QO!OO$$$$$$X8 44g#,#OO$%%'%,%5D1#O P7%$L% n%+<1D%O%P$s%%%%%0<Dt&OJP%% & S&n&u&(+<$^ )O`P&&&$'&(+<(*OwP,&;'(**+ L IEOPq++-++dhpGOP+ ++'++DA8HOPX, ," ,,,,HOQ!,6,@,d,u,,W(RTJO*Q ,,,+,,#,dMOEQ ,#,,MOcQ --2-9Z-i-T^OOQ4---WR.p..uu WOQ$.../.>n>{>Yd#\OU>>>=??8{pOU?+?;?a?x??0OUp???>???|B<+3OV6@@@,,ıW6@D,,\OfW ,D9DODmDDD:<$+qOW6@D,,4 OWDDDD *<OWDDEAEUEjEXhgg#POWEEE7EECCؔ,O XEEENBF]FjFPdȊ O%X FFFZFF<4\5ODX A FFl' GdOQKOdXG!G;G9GEHbH؏^$OX{HHIqIII$bt ( pOX /h S6h*<g#OY!CBJFJ{LJh*<O2Y SJ\JtJJJJ<3C#OXYJJJK%K,Kx))`qOY D?KUKU T؏̀0OYKKL/NNNu ԯ

\N\z\\\$t?P`69R\ ,,@P=`q\\]2]?]ܟ7BP]D=RV]B)<BPY`Z]c]g]g]]])<DP`]]]s^"^'^)<(FP`:^C^G^_^^`Pqcddkd,#`iPcc0dKeeWhMii؟  !/P+duOjS;Vu,,\PRduOjR;Vu,,ЌPydjjjk9kLkL0@L/ԐPduOck;Vu,,HPd gkqkkkk`PPdBJk{5,,PezRkka2k6DēP;ekkkjlleOd@ P_e &l0l5lͨ lt5 4P}e lltl85 4Pe$llllhЗ Pelll mm)m(t3TP f0m9mUm mmm43pLP,f }[m[! \8<+XPMf69Rm,,Pyf'Imn:nQnXn43Pf @snnn$nnn<<+C#DPf69Rn&,,Pfdno o.&o;oDo P^ij+`Pg69RKo1,,ԳPVg YoooBp!p2p8HȊPg,NpppyrsWs T e ?Pgsss ttP]O8PgU(t(2t))PhuO9t;Vu,,,P?h=tJtNttttNcPfhUt{(t<)4Ph ttt+ u+u:uXh|^C#Ph /h S6h*<g#B'h *<q-Qxt r S*<.Qt r S*<q /Qt ZKH)<q/Qt O'c\O *<qt0Qu r S*<q1Q1u 8t؉*<q1QXu r S*<q2Qvu C*<q3Qu X[ *<q$5Qu TB'݉NXq5Qu 8t{*<q6Qu TT*<q7Q$v Nm /28*<ql8QGvi ? 0eOD9Qv "&11HĖԖ6:Qv U^b2s4T<ВPQw ? <P*<v>Q/x %<(H7*<Ĵ@?QxV AA9DSX*<Դ?Qxb6\*<?Q$y r S*<q@QEy O'c\*<qPAQly [@\*̯d@*<q,BQy  V =0 _ h +PLFxIQLz(* B  $9LFUQz$  + v $9LFZQ{ ~  B 09$bQm{$` +<_heQ*|( Š 3 I S _s~liQ| NJ z +*$lQ9} ۊ &  +*nQ}   ) $9$LFrQ}2 F GLG,P 4PC# Q~I*<pC#Q~I\0<$3Q .j\**pQ7,cr{/Qnr Sh*<Q4*"Te<;4Q .<8*<C#ĄQ0ό֌ߌ`e<4>/Q2 0E)<D@QW< \7le<T;0QxBKVe|+<dC#$Q4H xe<t>/QW \*<XQ< ōM_ ԍe<;Q TߍB'>x)<C#܉Q4D`W' f<;QW Y1\4Y\,<C#8Q}8LOӥe<;̋QTV4x)<C#dQȁ4*")He<>/Q . h*<Q0cKH!V`e<>/QC Fb9)<Qj8LOӥe<; QTV4(+<Qǂ8 #_fp6;lQLێHCp6C#$Q8LOӥe<;Q:TV4x)<C#PQe44e<;Q% !w)<ĵQ0,5CE@xe<>/Q؃ |IRS ]\*<@Q8LOӥ2 e<;ԖQ$TV(p+<lQN8fox͏؏i;ܙQu9Va0PQ0,xCE@xe<P>/QÄ |IS ]\*<pQ4אސ6Ե;ОQ+2=6C#Q98 ?FS Oe<;QYXV]f*<C#\Q|8Xmt}e<;QY#**<$C#QɅ ͑ґ\*)`4ܣQ ݑ)<D{tQ/29)<(Q* RM\*<QN  %4=85 ?`TQn,*u*u~ 0<sHQTiR2bg)<Q(LOӥe<sTQԆ `W' -1\*<Quux)<Q $*u*u~ -<R<\hoxm$P4WL?R&/2= *<C#@R̮ E_- ,<DC#@R0Ğ+<T3hAR ˞0Ğ+<d3BRH  .\*<BRl&/2= *<C#XCR$Ҟ۞ T<t-8DR&/2= *<C#DR  w+<C#ER Y#D ++<C#8FR9{ 4=II,<FR_&RY2=b *<C#GR&Ei2HU,<XHRrg%ܔ+JRu g';Vu,,T|JRW$ҟg3  o~ LRr(g%ܔ+MRu7~ g';Vu,,T%nsؔ0<\Rc"b n6( #)<\RѢn@\u\``1#D^R B -nPUdhu`PT`R߳oR nqL \u\`1#aR)lPeRC7O^+̖gRʤҤ %>Q%@ĺ;FkR &/2H-<1kRL&/2 *<qllRYԦ||,uR$-1enT<ԺL#|RC '. )<|Ru~   ~R,W'-<6@~RѶ,W,-<6x~R SΨӨ#,XR-oFSڨ`,,RboFSިd,,RoFSh,,RǷ,[m МhhR,LPv2zh,R&ʩ)êߪ RYć7>;݇)<Rć7G;݇)<dRƸć7P;݇)<$R v\*<R.Ybipu*$P4\R^Yb|pu*$PD\R [.j\*t*tR .j\*dXTR .j)dX4R% x{:*<qRU  c*<qRҥ {"\*t*R,ѫ*<qR֫78gxDT3RV¬85<9dRUѬc¬85<9tRG n %\*$PpDR8cEYp\*t*R+{2R\*<hR!+2R\*<RU\*< R {'D*<C#(R\*<xRŭ\*<ȢR˭ԭޭ!\*t*RO Ù 856`\R c\854,R.7`1#(R V\4Y\&*<qجR! 7. 1 q*<q8RU -Y#3 *<qR RM:*<qR?*XC))аRïʯw\ )<R*(ǰ*<LdR߰Set))4`qR3 ۱ٲ))) qxR AJWe))qPqR'`Iu.\y`o0R`   ,#`R˻pyt$R$8<!n 6p 4/PR "  ,#`DRQ,̽н9 -D\$T9@S L:  ,#`dS XWN$th-S X  ,#`tSGIt tt2?@S   ,#`S(FZSM_rL3Sz< b\ ))`tS< ÙE*<q0Sr '. )<HS~    S,W '-<6S,W ,-<6$S1  FΨӨ#,SaoFS  S,,4SoFS  W,,dSoFS [,,S([ `М3S/D`4 g<R6`3 Sbć7Y ;݇)<ļSć7b ;݇)<ԼT Sć7k ;݇)< S v \*<!S;Ybi pu*$P\"SlYb| pu*$P\#S [ .j\*t*d$S(tG  "*dX%S  .j\*p.&S: x{:*<qH'Sk wO*<q(St  @)))Sï m\ )<*S $" x*<0S   m4G`q3S A ))̃qX5SU T2  bg)<q5S   I)<q6S' ])<08S +d Ceq)<t:SI ] #)) #t S LT<b-)<TH)|mt8X C#DT' ,v  ,#`4XT 8s  ,#`DXTDQU0qTM7X<iqx T 9  ,#`TX$!TEY m$lr$E W q;Tk c!  ,#`dXt&/j2 *<qTcT{ tQ<u fTt!.ZPiT$t)H -*<ľ#iT4Et2FenR`ȊbXkTDRt;(+<|kTGt?$7ȩudppTi(MPt 2r 76`#pT(MUt/2r 76`#lqTZfitGw3Xg#xrTtSqPWDbC#pyT2ut^;Vu,,TyTb  tLixdtGC#|TWtWoW,,P8}T tx)<ԾC#@~Ttc+<3$T1+8tfh`TTWtWoW,,PdTt#u n̑#C#Tt({5,,T t.4ENZP T Yjnt@FTMtP3pWg C#TcWvt 0ĠT$  t\ DTd = D t   W0T   t2? \ k u(RtbC#̨T-~   t     PC#dTU    t=+ N ^`C#TwupW t@;Vu,,TT[ ^ t5g 4DF,T n   tK  LauDT& n3 tlO b \G3{lT (i   t׌  2(T*, + / tl x  ApITt   t  S46 48T&/t2=(+<T -\ct ǥ 856`T -\jt ǥ 856`$T>dq0Up HTj92TTdxA*Sl|x, 92T-%>Q%@4;FTCu-Ķ1T)Cu *ĶqTf7T^; C#T( DiqF l 9 f$U$Ibx2c`,8 i}@U3- m3J`U^fuDi}\U!.9]t~U *a +<PU *a +<U +<(U( +<dUP D80 qL!UZ)<!U1)<l"U!69J=6`q~ $U1UbeJt})<$U`t\5DC#%U f}ӥ*<C#$&U py + ('Uug6 ;Vu,,`(UH: C F T s )<(Uvx   h:  \*)ؔH *U+!=!A!!!!\*)ؔHt-U !!"v"""\*)ؔ 0U"":""\*<T1U" ## ###\*)ؔ u 5UD #$ $)T$k$s$)<8U $$$>$% %)<:U\ %[-%oE%DTO1;U{L%H G)<dg5Ux%%%$&_&x&8u&<tKDUk&{5,,dXEU&&&9C&&FFU &&&>&&07lIؔ3GUn7w &&Iӥ'<DhHU'''NB'S'; 4qLJU*b ^'*(S+)`JUe'x''\'' (-W01OUq&(7(hO(^(>\5C#PPUg(;p((((xY\`C#xQU pr(()<QUI((B'(x)<C#RU((2)x)<C#lSU))).)X@ 4xTU5)`B)P)a)3DFUU3h)"u)*<k7 VUj^$))m+*<C#VU))C))h``PC#XU))m+*<>HYUl )) **<C#YUV*#*9**<>ZUv >*^*q*|*``C#<\U)*m+*<>\Ul * ) **<C#]UT**(< **u``ĿC#^U**92*4D3_UO+E++4DC#d`U)$+Rm+*<>aU6l 2+\) **<C#aUr@+Q+dCi+t+u``ԿC#cU{+++u+++3dU+++2, ,C# fUL),m+*<>fUl ",) **<C#TgU@+0,Ci+t+u``C#hUH,U,m+JDXiU4g(;_,(((xY\`C#jUqu,,,E ,5D$C#Q%@t;FU  r 6S*<qUZ  / 6J S*<(U k6J˷)+U ۠6J GD1U 66J̯6 *<qUL 666L 7 72@LE U $'7 07L%0K7zl EU V7|77N#7 88)<pg#ĸUW 8D8K8Nm88)<g#U 888Q88)<cUw @ Q')<ܻU \_PQ,\*<U oF88QR9\*< U oF89Q^9\*<PU@ \_9Qh)<dU$ 9"9=9Qov0 o9x97 ?`0UYW99Q9\*<hU 99Q9)<U 9<:@:Q#::))`|U :FQ\*<U=(:::Q::2OwUu:: ;Qc;;R;W;)<U*$b;s;v;Q;[)`3xUj(;;;Q <<[<L3U((,<9<<<Q'F<[<3Uf(K<d<<Q= =)=223U"(Z=m==Q>>(>22|3xUc(Y>}>>Q+?G?T?22(3(U(??+@Q-IAAAf 3U<#Bg 0BQ15FBt<3U(KBjBBQ-CICRC223(UY(CCCQDDDc3U$E(E7EQltEyED3U<EEEQ5LEt<3LUB<EE FQH(G4GMGyyXc3DV(fGGGQSHwHHH\ 3V <HHHQ0I6Ipp)`$d3 V<NIIIQ qJ}JJyyX3VJJJQkJJ\GT4g5 V9(J3KwKQCLoLL22؍ 3P V'(LLMQMMM$Td3($Vg(MNNQPPPH)d) 30V*FQQb,,1VQQQi,,D1VQQQm,,1VV$QQQQqr(Q[)`5<3V,QQRQ2[<%R4 4g#46V,,R[R_RQGRRR4 4g#$=V,RpSRQj SZ<g#>VA,S*S.SQ}VS4 4g#AVv0^SsSwSQSS,Z<g#EV0SSSQLTXT`T,Z<0g#(LV vQ\*<LV) FQ*<q MVdpTyTT[TTT8qNVTTU[ 'G'U.U56`dqOV AU:VU[mU#,PV+rUUU[aUU)<qRVqUUU[V)<qSV VV V[KV\VgV> ?`qHVVWpVVV[rXXXy<T0* qhbV.qYYY[s[[[@\ |* qmV~p\\\[] ^#^Dp+ qhvV^^^[5x __96`qwV 2_@_]_[I___PXv qzVh Sa`[K `#, {V  ``.`[E`J`\*<,|V!]`j``h`7a=a,2h TV'!|aaah TUa))`g#|VT! a4ah; bb*<dg#V!7bG Dbh@*<g#V0"(\bbbhN c/cJg#V^"@9c]cachccu<g#V"4cddhddd 4g#V"de#eheee))`dg#ؠV#eRehM9e))`g#V?#eReh[9e))`g#XVk#eRehi9e))`g#V#f7f;fh{gfrf))`g#V# yfQ fhgG\5g#4V,$ g=ghgg*<g#Vl$ Z h&#,V$ gghh+Nh^hkh`u|V%  hh<H!V\*<V$ ZhhA\*<VP% ZhhG)<عV%DZhhM\*<V%hhcihZCkkk4XP g5V&mmmh&m/m* 0`$qVJ&86mCmGmhmnn.nP,V&$Vnbnenhjn}nWt*g5V'nnnhon),0g#V2' nnnhnnp.,04g#LVh'nnnh" *5D3V'n^@nh9unpU.pmV'(BnhH oo),m@V (!o 3ohMEo\o5D3VE(8aomopoh`vooTnt*Vz((o oheoooKD4V(41nohj oo0,V(ooohoo p5D3LV()pp&phCpLp=x9lpV{)Ypwpphppp;D̉̆C#V)XpZqrhsttPp 7HLW-*uuhVv*<eg#WS*dv0v4vhcvvvXDe7HW'+vw[wh}.x5x*< g# WT+xxxhxxx:$g#W+0 yy yhU JyUy$.Rte4,W&,(hyuyyyh+zlz4.D.0Wd,L|zzzh zz{4( T5W,${7{?{h"{{{8 H  E"W-X{{|hD|||4t  7H0+W- }!}heM+},,q+W(. }!}heM+},,q,Wt.80}>}i}h)~`~{~0Xhj654W.X~~~h~~X8J7HH6W.(~hm~T.d.eG9W/ G h )<e;WWe/d}h΁x7HFW0d hPlPX7HTJW>08ւ;hr?M4DD 65(PWq08 hd{t.xPL65SW0XɅՅhXD7HDVW0X,?LhņpX.7H[W*1X)6h|Ȧ7H8bWh1`ryh2еdq\dW1`rh>еtqfW2ЈhJ =43tiWI2HQth[\*)` kWu2h/8C4lW2CUYhetDXnW3ۊhamX Dg C#rW3̋ߋh0<<3sW5>Tdhl Ōu\`ɁDwW6,݌hCxq<fXxW6,1jh!ĸh X(W7,w׏hdPb, ! XHW74ߐHhҒ @t {W8,~h c|-xq)XWD8,ɓh9IS.mh XW8$|h/L9*.u3dWN7 Y0Y`hRl}#,W&9 hV#,dWY9 h^;UbuZ`DkɁ@W9–ʖhq!/8H`Ɂ0W:9lҗhԘ 4tu&   ɁW?:hXh ɁW: -hPcjKd Ɂ$ hYxüW>Hlmhʩx2TW>өh3CXh \fHW>gszh *t*qW?hx5L@08WS? ƪѪتhߪ85L@W?h*<W? [h.j\*<xW?%R h1n *t*qW,@LXh*<Wi@ h.j\*<W@(hB'M'Lv<lX@(hB'M'Lv<0X$A apshөj*<qpXSA ÙhE*<q,XAKq Hv*<XAk{˷)+XA۠ GD1X=BM *<qLX{BcԬެD,D p XB 15dlkXBi?ƭ6D3XB#vͭЭyح5 43<XCvG)@)+P<XCWcpP)*p{XC®ÙϮcEݮ)<dXCp 'NdvXD2O[\*)`XsD$ЯگQxtx fVXDϰx!XD .?LȊ$#X"EQ[ñ4&XjEαر UbԈf0*XEyTedT 0XF}^AЗLG5X=F>KTmq\Z`D77XFy˴\Z`T7P:XF{Whqpv|v7|5DqlXuK&*g $glXK 1Jbs5Dq0XL |5Dq$XKL485D2$PXLFJg5D2$xXL7;m5D\X!M(5DXZM6TX*<XM #`5DDXMWD6`R)<XOYVz,)<X PWIC)<X:P^j+)<\XoP0EH{+^)<\XP0Ec+})<\XP };A*<XqY+Qn*<Lр|YZQ!2A}: 4Tg3YQ: 4|3 Y%R Dnr*<qYSR>E)<4DYRLad`)<YR*<DYYSE *<T3Y=S$'oKP*<d3YnS_}f*<pрYS/UI3?G*<рd$YSz5D̊рX*YT15Dр 6YcT8*< 3;YTb;GO*<t3L?YTX*<Ȩ3FYU6@sC5D3JY3U8)+KYU5K )<LYUGh%O-)<LYU4@ETV]4,JȊ{MYVbk~^vVgFOYV+o;h.X\a F]Y"W#bZ!dP_Y^W(,9Dsx 4g}`YWC,.`)4FaYW|T gYW_zv4'3iYnX+FQvP'LFlYY v$)<mY"YD..$ FvYeY2>EmoZa.<FwYYjvwEDFyYY|1ZaEDF{YYE4F0}YY+2ED̋F,YZPKX!0H$ VH0YZ[doM;D3YZN9Lz Dq 7Y[8EHD\85 4LY![eosPPPqYP[ W(,w8K*<qxYu[ P'3*<qhY[ 9QU*uqY"\-؃LrxLpYV\ Qimi*uqY\ <go*u0qܽY$]oDau@ 0 2$Y](,*u4lY] 8\`*uPq$Y]2O4 4qY1^X0y*u<Yh^  & * {   *ugqY^      *uouW*T;Vu,,w[do.TAT~T.UgUU P C#~[o/NRU RR,#Tj[o8SU TT,"p[ouWU;Vu,,[ pVK V!V)V)<[*p y+0V3V?ɬ9V85 ?`[HBVEV)<P[Pp MVVVkVVVV85\5j[sp VVW~WWW`SlV# [p 7^ WWWXX5DC#x[p"X+XBX pXXX,p#Ȋ$m[pXXCY[[ \P ( ([pi\\0]U^e^s^v/ g#([GD ^^^__##`$[q_'_+_UxM_)<g5<[1qR_[_^_z_)<g5[Nq ______\*)`T [}qKHA%)<[q&/28)<D[q ____``)<d *<q0[r 44U*<q[r O'c\O *<qX[rK`Hv*<ܶ[rt`!` *`;`B`)+t[JsI`R`[`f`w`~` GD1ĸ[s`M *<q[s``-`P`D*`)HKX[s /`T  S6h*<g#[+t``1`P`D*`)HK̻[Rt /`T  S6h*<g#l[t``5`P`D*`)HK@[t /`T  S6h*<g#[t``9`P`D*`)HK[u /`T  S6h*<g#T[Vu``=`P`D*`)HK([}u /`T  S6h*<g#[u```Aa'a@P2[u2a5a:a? ?`#[vCaLaSaCaaa\R[^vaaaSab([vb!bHbfbbb`p`8 i}x[vprbF ,,[v(bX2r 76`[*w8bteb\[[_wb c.ccc+)H[zwkcxcc3cd/dPL[ x;dbHd ɬ#x)<C#[Sx)Rd$efd9DC#[zx kdtdd6dddC#[xd ee:eMeXe]RɁ[x _epeteee.<Fh[7y0eeef%f0f4[sy(7fPfYffffDl[yfSfff-<1[y fg g3/gBgKg$E[zRg_gMmg,? 43[Uztgghzhi$iĿԿxv C#<[s{ KÙ[iJEai,]OF[{ jiyiPiii2[9|(iii? j0dEt[| j.j2jiHjx,<7[|MjZjaY# 8?D1#[|jjkk nnnE ( k7\?} Mo^oXD [ f W$0tm\`}ooocp=pTp,K 0\\}mpgzpppxC#\} ppp(qKqdq0\}sqqqqqqd43#\~rrrrrr ` jX+\~rrrQsdsws@Dh.\~sssssЋDdTP0\sss_t|tt@KP4\N ttt=Cu u\*<j\5\|3u@uPTu(+<<6\euwu{uuu8\uuu5vZvv TC#L?\vvv0vvv 9\5di}l@\$(vw w}wXdO} B\s &w/w$ 2w*<qC\ 8t{*<qXD\' p+<FE\ ' p+<FE\5' p+<F\F\^' p+<FG\' p+<FG\ %  \*<XH\ - 9w ǥ 856`tHI\ BwKwRw[wdwTD]|J\Q lROuR*<HK\$Y~kw]slD#,K\0E>qw]\*<K\؂ ywww]bZwwT|Op|M\ww]6wD*<3TO\+  x]%x8xHbPC#P\^ ?xHx] ^xxHbPC#4R\xxx]xxDG 4S\x yy]Syyyg#dY\yzz]2zSzРi}\\ `zgz]rz\*<\\7 lRO]uR*<]\I yzk)zz)<{^\u I zk.zz5 4C#_\ Ùzk3az)<p`\΄ z*zk8z8GDLLa\ Ùzk>az)<b\&zz{kC{6{={4 4{c\RL{S{kI_{p{u{)<td\\_|{kN)<d\\_{kS)<d\ɅDR{kX\*<d\ {k]\*<0e\ux{kc)<@e\?#v{kh07 43df\fy+b{kq{{{h*<{Pg\*;{kz{{{<7 4C#xh\WZ|k)<h\g  ||k;f|)<i\1$|-|4|k(C|T|[|\*<i\Qb|k|z|k|||85 4j\ty |y|(J,,k\||y!||))tl\ԇ||}y} }'}+)lm\! ڦ,)<m\  4}1i)<qm\8 W7}:}6=})<qm\X D};iK})<(n\x R}@iK})<$\n\Z}]}Ge})<4n\0El}o}LD)<n\! s}Q)<qn\ oFy} VZ)<q,o\&l)|}}[}*<Do\N} }`t}}5 4T3p\x * {}j( #}\*<dq\ g }},w)<|q\':7~ }1^J)<q\܉Gg&j}6!V)<tr\ }}; '͝)<tr\ ':7~ }@^J})<Xs\<Y0}}GǛ~)<s\\Y0}~LǛ)<Pt\ g } ~Qwf)<t\':7~ ~V^J)<(u\ʊP+~[#~2~7~*<u\>~K~N~``~o~x~5 43v\ *`R~j~~\*<Dw\? g ~},w)<w\a':}1^J)<x\Gg }6!V)<x\ ~}; '͝)<y\ċ ~~@ '͝)<y\Y0~}GǛ~)<y\Y0~~LǛ)<xz\2 g ~ ~Qwf)<z\U':~V^J)<P{\wP~~[#~2~7~*<|\>~~N~``~o~x~5 43|\ˌ *F~j~~\*<$l}\/~~~~,,~\ K~ ~))\\/~$))(\Rv jQ #,\u$Y%(%slD#,\-6:O`<)\ g*lku##ă\ 71 .|#,$\ Bu)<Ȅ\>hFZ `- \:\(?P. K\ˏ!C{<)4\EɃ̃3,,D\-σ҃4#,@d\RTuՃ؃5<ltt\x`uՃI 6h?,lt\uՃۃ7#,\Ðg ރM;)<\Q>]h4 e3@\:XWфڄ4tP\d ^7FQLt\ jmpx)<X\ $Ysv,s}+<$\  2<<T4D$ \k $Ys<s}+<$t\  ƅB<<T4T$\Ȓօ߅N$5D3̡\)29aX@4x{`\')2iX@4x̍{\V- Æq /t*x {H\$$14uPcD\nnq2 /<{\ؓnny2 /<{\nn2 /<{\25D3\g _0q\Ȕ@шԱ /<{p\h@و.+)܋3\L"f߈( #)<\DWY#-<$(\$Yss[-<$\{@.-<$ \$=D-<d$\?Q[_s+<3D\x$ ĉˉDtܹ\͖$։ىĉDt\+<3\/$Ys*s[*<i}\W0+<3\(14,Wlu+)4\${Q #/<\$W  \$>]f0C,< 0\?*<A\Ìیߌ3Gbt 3\b\ox{ԘOt\XЍU$TLhLt\\%+|L5t\F 0IM.StLTcO}\j1 D@4\(14]\s|? 4Pp\ugVy{ *<C#\Rh=}.*<C#|\~=Ա )< \,܏rPz,0# EF\Lˑ֑<Xt\Ԛ "%_$1x_|?O}\:L_D@\(ĥҒݒ-)<p\Ol%.1UUP~\v(h.(@D@\(m.(@D\כrP?DFl\vbʓ@DF\=Tѓԓ{bgޓ5Dk7l\l5DK\ٜ\5D\D #(-5D>T\w47EL5D>\ޝ4SEL5D3l\E a(-5D>\uUkr)<\ Ȕ :DC#H\ !9JU$\ A \kx\O4C#]L (-@D]} ŕԕ@DF] ە(-5D>]ݟ4͖ږ\l|C#H]K#0@ix$ C# ]'${|]7šϚ|< 3]"]rTc4eLw @$] ^ۜ B' )<]T *Uɝ`m|] 8ƞnC#] >(ɟ֟| C#T"] $c/Ϡ hLT&]*NYl6Ρա-t*x 7(]\ *Bɝ`dn*]@CG*<3 +]@GH*<3+]@KI*< A,]@OJ*<k7p,]M`SVK*<3,]|`SZL*<3H-]`S^M*< A-]ޣ`SbN*<k7 .]`SfO*<3.]  jmPY#q)<C#4/]sѓxQbgq)<#/] %|Rs[)<0]%Ss})<q|0]@7T [)<q0]q7U [)<q<1]7V [)<1]פ7W [)<{1] {xXxr F)<qX2];{xYxr F)<q2]o{xZxr F)<3]{x[xr F)<{l3]֥{x\xr F)<q3]  ^آV_ 5]8 d,KT85 4DP6]hanmZåL t0A] p|Ϧ]LL$ C#$F]J¨ ( x  L]  Wdw̩۩4DkC#O]>UfDk3R]ŧ s##x {h\] 6GJb"l+<]] sqxĭ##``]@ sɭxĭ##`b]lY0W {#,b]=6`3tn]7w ЮӮӥٮ@8DC#o] oF)<8o]>I ,,To]d )"I\T-ĔHr][  o-~P`s]5үݯ_PTt]3<_OFu]PB? _OFv]{!$B(9*<k7w]V>AEEV: 4Tx]{ 8]HarP5 4K0y]-yK}P5 4z]fN}P5 4>z] 8QP5 43{]ԫ 8TP5 43|]W}P5 4>X}]< 8ZP5 43(~]q 8]P5 4 A~] ŰȰ`̰ݰ*<k7]ڬ-c}_O]$f}O d]A 8iP5 434]ul}P5 4> ] 8oP5 43܃] 8rP5 4 A]{!u(9*<k7d]L 8xP5 434] Ű {ݰAD] { 8%=N5 4C#̇]U^aqp`C#t]/ ٱdC#@]i *<C#d] n-4 4{]ޯ'259Px\O3܎]&>WZ^u4 4#]Z "X|4 4C#H] "X4 4|]Ӱ "X4 4]fIJ4 4qܔ]If˲IJ4 4q] "Xϲ4 4<]fӲIJ4 4qh]fײIJ4 4]+f۲߲4 4{] "Xx\OC#]c&>W^ _OD7,]fIJ4 4qX]Ӳ "X4 4] fIJ4 4q]GfIJ4 4] n!-4 4{ ]f%IJ4 4q8]8)4$EV[)<0]>(fA!,y ]omwcJcbt*<q]Pt"kl6,t ],ox{_t"|]ȴѴԴڴ4\5l]; TO3̫]cX'?C}LDPt]ӵf͵@QOp3د] ,GH[b7 4ܰ]8uqtRp#,#]c$Lx{eөTE,]Ҥ t\RTg#] DRMX*<q] ?{.Ƕ*<qP] *<qd]G Ѓ ك &y ζ*<q]n r)+*<q] /*<q]÷vնܶh*<|])@_ *t*l] v\*<]N .<)<{]w{ ")I27*<P] v\*<]̸ .j\**̾] >E.j0- \**]* .j\**]] . D*dXC#l],Nr)u_dXl]' P*<Ɂ] =*"H/<] ~ .<)<{4]10=*"_<7]Y ~ .<)<{P]0=*"2_<;] ~ .)<l]ѺZOfuHe<0M8]dz'c<t] % -<L]PDWY#*-<T]:ip+<]nr S8p+<F]*"*<ʎ] .Ա *<k7]I:ip+<H]~nr S8p+<F]%  *<M]DWY# *<K4]#LOӥ2 *<L]WTV(*<`]LOӥ2 *<׎]TV(*<>]*"*<]) .Ա *<3]^LOӥ2 *<׎<]TV(*<>]žӥ2 *<h]TV(*<3]$÷ӥ2 *<]TTV̷(*< A,]շӥ2 *<]TV޷(*<$3X]LOӥ2 *<׎]TV(*<>]Mӥ2 *<4ʎ]|TV(*<Dk7]% -<LT]DWY#*-<]% -<L]GDWY#*-<H]~LOӥ2 p+<L]TV(p+<t] `W' +<N ] Y1\4Y+<F]D(#.Ա ,*<T`]s3:ӥ2 C*<d3](J.Ա ,*<t]3Sӥ2 C*< A] (\.Ա ,*<];3eӥ2 C*<3<]oLOӥ2 *<׎]TV(*<>h](n.Ա ,*<ʎ]3wӥ2 C*<k7]7(.Ա ,*<]i3ӥ2 C*<3]LOӥ*<@D]TV4*<C#]cr{)<2X]9V _ b (S)<{]n*"*<d] .Ա *<3]:i)<#A]nS8)<#0]T \ɸ)<@] и׸4 4$C#] cKH)<@X] Fb\ )<]4L)<4l]iTV f4 4Dq] L)<T@] %,.Ա 5)<d ]c<CHL)<t]?SZb\ c)<q,]sc<jHL)<9]Ssb\ c)<8]c<|HL)<]Sb\ c)<qD]E cKH)<@]x Fb\ )<P]c<HL)<2]Sb\ c)<{\]LOӥ*<@]ITV4*<C#]LOӥ*<@]TV4*<C#] cKH*<@8]% Fb\ *<C#]\:i-<\]nr 8-<7] `W' r/<a] Y1\4Y/<LX]6Ź(SX)<]hcιչH޹)<q\](SX)<9]cιH޹)<$`](SX)<4]<cιH޹)<Dqd]s cKH)<@] Fb\ )<p] (SX)<T2]cιH޹)<d{t]G(SX)<t]|cι$H޹)<qx] -6APw _)<T^hj v<t8^ ˺Һx\O@x^O &-VSC#^XKHA%T<tD^ R$_ b (")<{^ KHA%)<H^@LOӥ*<3^+dKHA%<t`^T7ÙE]*<C#^x*IPYjsV|O>4^ z__TFx ^Ȼӥ] ѻ*<q ^ ػ)< ^R ߻)<( ^6-8=)< ^ KHA%)<L ^ B' K ,<QK ^P\4Y\g *<3 ^D ' 0)<T^u;OD *<3 ^+5T `ȑ ^Str~#j(t^t&˱ƽ˽<(t$^vҽ Q #,^սٽ ))`^.<^6@? 2 .<^baY.<P^aY#.<^aY/.<^*;?K.<4^ *;PK.<^.aY\.<t^U*;hK.<^|*;tK.<^.<D ^aY.< ^%.t*!^*;K.<l"^AaY̾.<#^i*;ؾ K.<#^*;)K.<H$^*;;K.<$^+{ tk'^C¿п :8 ث3^`?hy)<3^7.~+l)<X4^jP]X$5^r { )<p6^Ou)<6^(\c)<6^gO L)<t7^(9=YpL\]8^|b@Xh]k#Jt;^WFWoW,,P\<^ 6<St]P=^(^jmL*dXC#?^@Z%,Бn 0B^0AScc]dX01#C^4pL8i}^hTgG$\% ^f ]R1# ^):AmөW\h*<4L^cty]]P^J Wo)<k2@^t)<D`^y)<T2|^n v ~ \*<p^)6=Sdk5D3^\t}*<l^C.;,<4l2(^` R \j85 4d@^>3htC# ^7q ;334^] -0B]d; 43^|ȴ kڴ4\5t^qt *<s?^TVz}r ?D|^TVzr 3DF^[ӥ3DF^TVzr 3DF@^8TVzr 3DFؗ^XTVzr 3DFp^yTVzr 3DF^TVz r 3DF^ x)< ^ )<(^  X!m 1d @U s?8^^bN,,D^j,,H^mwcJ%t*<q^ WW2I856`^!u8p#,#^E|'JMdw,8$;3<^r6L,,ܬ^\1B4DoC#h^Yv+)`q^ *)`C#^91@E*)`Է^Y LV~F0]]dlqt^W[pk )<^\~« x)<,^;4~*hQ^{ *Tq^0}0E:H^?". 854^{Fp. >\5C#^'L %.<L3^T5>ArGX]R3^zajmyYs4\5^z~H*<3`^(S*<3^H*<3d^H*<3^;H*<3l^cH*<3^H*<3t^c p+<F^^@ b\ p+<F^c p+<F^'c p+<F^Oc p+<F,^xc p+<F^c p+<FD^c p+<F^^@ b\ p+<FX^c p+<F^>c p+<Fp^fc p+<F^c p+<F^c  p+<F^(+{*<3^3<?bgq*<3^0(G{*<3^X(O{*<3^(W {*<3|^(_{*<3^(g{*<3t^ vovv)<^#(]O04^H ,< *5]Ol;^Peh8%|-<2^O0XTTo3t^$vdk ^:)? 4^0 02\l`Lg#@^$<rLLg#^-?)<)$^\T)<8^ ajT*<q(^  *b*<qX^@=*"2*<#^c ~ .\*<t^ Y\y()<{$^@9BӥM)<P^&/2*<l^% ,*<3^)V_.j)<p{^Q s|0\*<lL^wcl4 4C#0^+l4 4$C#0_8 l4 44C# _8 $l4 4DC#_*8 5l4 4TC#_VFOXeipl4 4dC#_FOweipl4 4tC#_8 l4 4C#_FOeipl4 4C#_FOeipl4 4C#_(cl4 4C#t_Q8 l4 4C#d _l4?C# _FO!eipl4 4C# _8 2l4 4C#p _FOCeipl4 4C#X _(FOTeipl4 4C#@_SFOeeipl4 4$C#(_7ÙE]*<C#_vӥ] ѻ*<4qx_ KHA%)<_=*"2)<#_ ~ .)<_? B' K ,<QK_cP\4Y\g *<3t_MjTV*t*C#d_7ÙE]*<C# _`i(+<_  7. 1 q*<_J8}qeb\[_l)q*<#_q)<#_ ;I q$. !#,DD_?"b q.( #)<#_zq7B'*<#_q?)<#_"b qI( #)<# _4 BwKwq[wdwTD]TT_t qt\*<d(_ *"q)<_  q1\*<_5 7Y0qE]b\*<t<_s q \*<,_ *"q)<_ 7Y0qE]b\*<t _6 8qt{*<qH!_v(1tMfo<)l"_ t#43\!&_ Jjt%43X -_ d֬Ot:E)<-_A ^tEx)<D._ TάbtHfhj )<._g utK;)< /_$Y8 }tNs)</_@GhtQ)</_b3 t[] )<$mD2_s tq)<2_ !tzӥ+)<q3_ 0tӥ+)<q4_f :t)<4_Dt15ɠT)<(6__@1ht%(6 4q`7_> b,tD*<8_d t *<39_(!*tC` 4;_ /ettY)<;_ t` )<Tm<_"+<tg`sz*<m=_($Lto)O_ ?_ Dq t0)<0?_S t616)<̎@_SVtCl>)<B_EtLF*<,C_tT/ @+<03D_4 O'ct\*<qE_XQ]p<PxܕG_uxq)<g#G_h*<g#G_ e 36`g#H_m :$ >?R_E(8tJ_uxlZ,,J_9$pYy_ (#"4K_y ac*3PL_$;n\5M_\_,r)<M_y '80#,N_ WGJ,,N_ Q#,TO_7\_ ,,lO_y be#,O_ p##`TQ_X>Y,,HR_6 N##`S_nB!,,T_ W7}<9,,U_ CFAN,,tU_+KDUJ,,U_k Y v'))`pX_(Ha! ,,X_miK^imIg#|[_6k,,$\_ v\*<\_R@LOӥ\*<L]_KHA%)<]_ 856`4^_>\*+D__)<Tt`_ .j\*<Ta_ &F=B\*<dxb_MnU\Y#c)<t c_ jut&\*<c_")<d_ t&\*<Te_U v\*<e_ v\*<f_)<g_ n Y#c)<@h_X   'Eib)<h_ 07@f)<i_ OXcC)<$k_  s-+dl_o  ) ajL|5\o7tp_ =*t*s_i  M)< s_ D7 E,,s_  ~P)<4t_L8_000\/ |~_` !)<~_(4=Qlq)<$<_ 3 z)<X_9\)<{l_\)<{_0 3 )<_ 3 +)<_  x,xD_eem)+_&) \*<0_-0\*<d_x 8B[DTo_l%  ;-)<_% :=o)<4؇_1& DGN[)<_&dpy )<_ '& )<D{_'\)<{̉_'& )<T{_t(W)<d_(\%)<0_O)4)G  _+ATXU#dTtL(ܖ_;,83<Cc3r)<_- n9< b\ ))`p_-p-t<H_b.D)<Ș_. )<8_%/ 3 {)<T_/ 3 )<p_/ 3 )<_C0 3 Y')<_0\)<_1 3 )<ؙ_h1O*$Pj ԡ_7\m Hl% _8 0BFAp)*7% _9$ ((Y _: y K7y D*<C#_); ΉR$<**t*P_;Y1Y=ACR4D7_;4F%WFi|-< $_/<ÙZ)<m_=u_",_=0d2,bZ_F>i", $_>n",{ _> sbZ4T4_Y?)<Ĺ_?=)<ܹ_< )<t_?", $_ @8$c$040 h(_TB IVe)<h_B 8B'()<,_BH  ! )<n_ D$! $ 6 YT y -`)H_gD~ y- q  -+7_D$ W  C S8x _&EO h     5D!q_E! S* @ O -<7_PFV c u  K d D0YL&  _F   > . 6 )<L_GQ _  f   )<_rG 3JW$vFl_GB^i+<0X_HaTU]T0__H @ lku##4_H Z%49*<Dp_M|fpt"o*?_bP dsx+<p_oU*0*"H_XQ^s|*p_AY "gFYbH\h_Zm6;B(Ȅ\_[|fpt"o*?_k^ Z%49*<4qH__$fpt"oo(`a0jf 5D(`Hdfn~5Dcp`3e7 7,,$`fDB )<4`rgϴ)<D`XhnfS8)<l`?i `.)<T`j \.)<d`l X.")<t@`l ҃+T)<``jnDB )< `Vo,3?BTsx)<͢`Bp,| f )<͢ `/q$Y`p)<!`"r$Y\p)<"`s$X0)<t#`t ҃+T)<#`tp4IN)p.$`uWZZbH\*<x%`%v^gjP̯"z\*<PT&`v E)<Dn'`Rw 3!&*dRp)`w -14"7 -<ڢD*`xFIP)<*`y4WZm)<*`yD| B )<$+`Cz )<tn0,`z )<4P,`{4)<,`.}c)<D,`~ )<T,`i (+|.Ա )<l-`%n/2gSC*< .`݀6\\nWBh*<d.`n/I6SC*<\/`PLX[p{ )t0`WZZbH\*<D1`~^gjP̯"z\*< 2` E)<nh3`x3l5`x14"7 <p6`FIP)<P6`ٌ4WZm)<6`ʍD| B )<h7`)@_ *t*X8`T)CRY<)n9`  LOӥ&;*<8:` j"%s*<q;` \\**<qd<`l Cz*<q=`Œ 15o*<q>`  *<qF`o j"%s*<qG`“ LOӥ&;*<qlH` LOӥ&;*<qI` -'?Q@h DM`hv52{<)M`Z y K;y D*<C#|N` ΉR?**t*JQTg~\xd0ķFTf` / S6h*<g#f``ROC# h`?l)<y+<C#` M&7_&nM+q&&D xX`?ux&nX",h`E&nY",x`˪ &nZ#,`"&n[y+<C# `Nux&na",0`E&nb",@` nc#,\`,"&ndy+<C#`q [)&nl+&`S[`"&npy+<C#t` Ù&n{ 856`0`H"&ny+<C#`E&n",̤`ӭux&n",ܤ`&&nEi&)<`j &&nj'\*<ox` % n \*<` 'G n'*<qX`8 x{n:*<q `{,"'~''v)t** t0/ sZ`7(+*+.+vz. ++0O̐1``1++,v---))`0 q0`m../v~///))|`0v)<`s 020vbg)<` b 0v(")<`?!0.0vCJ0Q0))0`f0 o0vSy0,,`ŲF~0v)<`00v ,,`6(000vb111طoŅx`y112v5222))oq `(222v=u3#O1`  3:3U3v334Pg5T`C(4w&4v(;4#O1`B4K4p4v1444))pq|`45)5v6s555))<`555vI667 4D`O !6.6=6v Z6s6|63\5g5`(:)6v6D1`ҵ666v666))q`(77(7vq777vŅ`R(77v/97#O1|`777v=-8@8E8))L`ضZ8c8x8vO888))q`888v"(999@96D3`(S9r99v6::: C4` 1taٷ ';vt)<a+;4;Q;vy};;))$pqac ;;;v;0<vwC#la,K<Y<t<v<<<Z)`Tp$ a޸, /<<v;Sj<& a ,==#=v@o==0$V&ab4===v^>?3?T & sZar\h?k?v)<{a(s q?t?v :@[<1a\y? v",qaJ0|???v?&@,@,Z<pg5P!a0G@\@`@v)@@ thg#H$aH@@v]@@)<g#%a~0 A#A+AvbAtAAwpg#X(aAAAvAA5 4g#p)aA3BaBvrCCCq32aZ `1Dv)<2akD$D'Dv ?DZDaD8 43,4a g }hDv;\*<4a. nD{DDv܊DD*)`G96ahDD Ev E|GHz\ؼWaھ VHcHrHvHHHOPg5Xa(:)HHv6D1YaU6HHv666))q4[a I!I !6-R=6v Z6s6|63\5Dg5a(:)CLa IpSSvIII3 4g5ЏaISTv$cJ~JJ))q8a(CTFTv(15ID1haV QTiTTvTTU3 4g5ԕa(U!Uv 15ID1aI,UQUv(cJ~JJ))qla/(UUUvVW6W80"Ņla(qWWWvVWWW0R01b& Ήnnw**t*>brY1+n{CR4D7p?b4nnnnnn4D 8@bZnnn)<t@b% nn)<@b;Wd no)<$Ab `1o)<$Aboo$oJoQo)<LPBb0jowoooooD$rbZCboooDpUp^p44# $ Hbc0ppp&qKqTq6' bZLLbQ qqqqqq)<4r0Mb? qq2rGr))dr{Nb^rqrrr))Obrrr*Sr)<{LPb+ rrs2e.s5s4T4rQb oF/nHs#)<RbrWxSs+)<PRb Vsds4sss)<4 $Tb  sZ)<Tb" ssas)<DUbq\/9h)<Ub9\/sm)<,Ubsssstt`S`PTVb8 t#t*t9t,,lWbv >tAt$Pt-+Xb itut. ajL|5\tr7\bttB*t*P_b| QtR)<l_b>)@_ *t*d\`btttuu$u,,`ab 9uBu2eEu*<qbb Ϛٚݚ:jLu*<qebV xx{*<qXfb$Y`RuslD#,fb8Uubuuu uuu' YTjb< Wuu v*t*,kb-"vv-<7kb4} Ù&v-vӭ-< tlbOJ \җ*t*'c Tٗܗ`bgz )<'c k^ NU43 {)c xy; 4qH+c ǘԘQD| ( 7t1cD V יڙ( #h*<1c *OTh**Ts3c clo2))<d4cN BĚۚY|OLX5c #< 4C#h6c *36%Ofo4 4$08cs |.)<49c4̛՛ܛ6 *<ql;c $58@V3 4q\^D S X *<3Pc i v z >@, pO|O3c<  [ >Y 4Dqct   >jP c *<Lqc 0~ >|+ ,,=c  >  x\xP\ 3cf )p > P*< ܪc uxF E1",c uxI E5",cI @L X _ E9L n s q<@c Hz EG $<ԭcA  E  *<03c   * EY ^ )<Pqc @k x E2 F [ )xܴc! H E5H ^ o 3|%c\! hJiS$4%3c! 6S,,cC" P/TS(Ȩ٨DTsC# c" 6S*,,$c # \ DS(#,3cA# \ S(#,3cx# uS|#,c# I S)<c# ! S)<c&$ uS#,7,cg$ uxS#,7I(6 4{ dI1 Rcr)р d1 $ô:9If4G9d1 l)V_SH s\**ȋHd?2 z`ӵHP1d2 {e}pрXd2 ٶ)+d(3 ޶˷̓z d3 %9]Itz (d=4 mz~DɁ+d4  _v¹ֹ)<`,d4 lR #)<,-d~5 *-#5(+<-d5 *>*5(+<-d6 Fv F1T(+<\.dg6 % cf;n(+<.d6 *wB5(+< /d7 Fv IT(+</dK7 Fv TT(+<0d7 _(+t* 2d7 l3?Vn~603d38 ǻuݻPq|<TJd< (=ǿqPg5Kd%= UοѿV#,DMdd=  -,,tNd= 2;Qrw#,48pOd= ,@+GVwwHs>CSd> 2,,D Sda> 6-,,TTd> < 46 4dUd> cztTPрZd?? |S3DtC#Zd? L5BYԽ\CH^d? HFQhȸtC#`d @ nTP$1h`Tt3gdl@ sdtPid@ $!^ 8ܸ3lkd@ $E]a+t41``3)<dE ;Bӥ2 t-<f4dLF ;Fӥ2 t-<fȘdF J)<dF 3#*<qd4G k>B', *<qdxG G!G$G'G*<qxdG 8t{*<qLdH 0\a#`<d^H &/J}\*<ȞdH KHA%)<LdH *"",؟d;I /)<G9tdI LOӥn#,dI /)<G9dEJ K>6,,\dkJ  ,)*dJ ,#N_f 4dupdK y3 /53dK $GkX|d|_dL (vs6OXdf m85 ?dDM $Y8  [*<q\dyM 4 INp|<u,d?N k~0||WD4dhN $1@FZq~$TɁDdN 4GIB <*dN RH~dɁdN  T.?F<)td\O Srw |?1dO =B,,$dO "$1dO =/'B,,|d:P 8JSz\^p^`dkP DMdP  %(@Wd4DdP kw.D^ D[ _p#,Fe`^ NgWg_bg6V",$Ge^ _ p.)`I% Ie^ A A D _*<qxIe^ O_*<qIe^ O_*<qJe_ O_*<qDJeH_ O_*<qJes_ ć% _;(+<,Ke_ /_2H)<Ke_ !*1_\:?(+<$Le` % _ \*<TMe0` ={ _B' (+<Ne]` % _ \*<Ne` !*F_\:?(+<4Oe` % _ \*<0Pe` !*O_\:?(+<DQea % _ \*<QeEh*<Tԍei L]mb6x)<qeRj bC h*<dhej 'bTh*<t{ej ;PXbht|E 47ej ;Pbzt|E 47xek bALxS0;Flek WbALxSP;F`ek bALxSp;FTek bALxS;FHe5l b#>Eh*<debl b:]dx)<qel wb+<3em b:r(+<leHm $,bC:|Ol,<7y pcrbg)<emy 07bӥ@+<4h$\ey TVb4+<Dey `WGNbKW,<TWey Y1b\g,<d1Pez 0^bӥ@+<th$e8z TVb4+<|ebz `WGgbKW,<W(ez Y1b\g,<1ez 07bӥ@+<h$lez TVb4+<e { `WGNbKW,<We4{ Y1b\g,<1`ea{ 0^bӥ@+<h$e{ TVb4+<e{ `WGgbKW,<W8e{ Y1b\g,<$1e | h/b+:d.<;FeL| fLObp2}h*<0e{| h/b+:d.<;Fe| W% b`8-<7e| h/b+:d.<;Fy<}e LObӥ*<qe< *b*<q(ef wOb*<qe /IY`S`Ṗ eĂ ;D##, @f E`s:Dg5f< l 5D3(fd E` :Dg5pf l )5D3f T-H4 4ȯg5Df J^S<du*<3h f- |R:(+<4g50 fR T X*<3` fu cTy,, f ,# f - O  ( xf      ,,< f    ,,8 f< x  0 Q   lT+ x2fb    w ,,<3f   p ,,83f   )<3f <V {)<d4f c% $xr F)<4fP . }-7 -IL )<Dx5f Y 6)<5f 17)<5f \ i l 9̯)<6f }   U ,,7f6 0   Z*8pv8f @C\hD'z90=f ,FT'P@f) L PTC#JfS R dKf L#0?XmxU 4dH?Mfԉ q")|#,C#Mf q"*",MfP Lq"76,H?Mf q"8|#,C#MfÊ q"9",Nf D W X \*+Nf5  76`Qf %*;85ԬTfŋ 4`_(+<0Vf ,&+FWzLp)lZf< a)<,]fy  { q()< ^f -9xId4_f kx}Pd'3pbf4 46]<#,cfx :$9Dq df +IjDoVvqhf <3Got'hf`̕#,lfY >s~4 40\of `W)<pfʓ J;)<Dpf )+qfM )<qf  +:?)<Prf \8J)<rf> `1KJ)<sfp PWYL\*`)tf `1l#,ufݖ 2@  `+ Hf> YrfSp,,fv `u`  {`f !C}/{]<)ܕf VD?( 9sA,,Df \Ɉ =\*<Xf! \Ɉ A\*<lf\ `1E)<f tI[pt)fƛ 6,,O>i>7Dg >>>?EEE`ptp@ dg E FF^iF{FFL`C#igO -FFF,<C# jg -FFF,<C#jg ug}F{F(+<(kg -FFF,<C#kg* ug}F{F(+<0lga -FFF,<C#lg FF G^GyGGRoxog PGGGGG H@p$̖}Gpsgg  Hӥ,H3H =DEtg  >Hӥ,H3H =DEtg { LHIXH)<Pug c_HhHxH)<ugT HHH&I?IJIoNv3tyg sI|I YI+<C#hzgó I x)<zg I x)<@{g* \Ɉ I )<T{g^ IjI IIopj`C#|g I) D*<C#8}gԴ J"J }s}p},},,qТh <1}=}B}Z}f}Dxh @v o}s}.` *<3h {}})< h& }}x\*<h[ }}}7,~D~XHXE`ɁĪh DW~u~y~m~~<хh 4~~~(ph L/GL ܳha 0 $`Fh (-:>Zs(Vlh $|'8(`Lh K7Q)<h? ;L\VʁyI3h h[,,Hh ;h!p41 3h  XdY#sx,,t phY ĄՄބ PjPh f)<tw)<h $tUB)<h8 MX|O`hz  dX|Oh 4EI{]nt5 44h u~))`{h> )<h )<h b)<h ŠƊ|#,C#hW ʊӊ؊3 44C#8h Š9n|#,C#Hh ʊӊ#3 4DC#ph: Š9|#,C#h =FJZqxD*<TC#h 4($<T[8h( 4LWALdPhR HEȌ̌cbڌ)<h ߌk76t h Ƚ{}l)<2D*<C#h MY],Fx5`9ؘ$h Rzv<;)<Ph@ \@\*<dhr D$T%h u  E;Vu,,h c)<h/ $&/3F]tq<|iX OW)<i 4[C,ȞI3i h`,,<i ri3ёx<^: 3i  Y#sx,,t i 6k,,4i Ӓ #\G 40iA 6[hē̓7 4Pxi ؓ'#Ŕє\Z|Oh$4i F%5D{Hp iC ,9=PSd7 4!i kxaՕ5D D$i   ~8ohf`Ll'i .(bɖ;f)<'i" іz)<ز+i[ 0CJ)<p-i \eY*<q-i dav~ʘdH@60i 6ј,,0iR Oߘ)<0i QpH5{72i È% 3D4{C#<3i ERtݙ3D(C#H6i2 0=M,t=Dd{C#9il ƚϚߚB%8?)<{C#;i 3^jP)<C#ih  ٛGp6C#x?i !C4F{Ǜ)<?i vv)<d@i *7Qb@pO+5Ai) yVkt{(+<XBiN lR02<+5$Cip lR02<+5Ci `Ɯv4$Ji< uc;Vu,,x ,Kii uc;Vu,,| Ki 1D,``Mi ucQ ;Vu,, Ni Ubf2͞4(Qi Ԟ9<ݞE'Gp6C#DRi1 I`%,DHЬC#Si #V.Tbg)<,Tia 6CdYßП({k7Ui: Sajx)<dVi Ln&ALUQH?Ӣ $hL H?0hi a {:,, hi Pƣ<Ĥh33|(H?pi 5$(7Hvi< ʥ ;B``̙7xi X[+ߨ\P <(}Gi ccD@`i% 4F{5,,\ih "%b/; 4i 6`d8q`C#i PĩΩ(O9qԐi XΪ`9q̘iL uc;Vu,, @i P/#̫3 9qDi uc$;Vu,, i P C -Ȟ9qiX uc8D;Vu,, di @$<[eL¬$(q$7xi ucN;Vu,, i L *B­ ̭{5H?Яi^ uc֭;Vu,, Di ڭ! ",`i uޭ,,pi uޭx,,iG s.#,iw ug){.<Ei 7 T,1)2)<pi OJ-;V.<Ei; $ XO0 |P4<i ugt{5p#,$i ׮n&/D<wiF ugRg{5p#,$кԺ&B'*<qli"  /^*<q|iX 6+D*<C#|i (8BZs| P^t+i 6D,,Li J434i= 166 4ia TҼD$dai 45>BU'GPLp<$i UY_)<$i ]/RUh j) ]Zc/RUh  jR ľҾ׾#HXp js 0<QhoD4 j 7z~,, j  ]`P1#j WWǿ"Կ2<)j$ *]`P1#jR WW,Կ2<)j (!42A*<g#j J`}B|j Kar <)j '08SL T]7 4R9j; dqub< <4 4tja e,,j (HԖ\j +B <*,j 3HԖxj %6B <*H jL 8Bd>7D(8|#j} Qx}L#-j /;V^~dh,/j Tr 4p2 9jb k<<2$:j  / S6h*<g#0;j k<<24$_$/7 4P G9Gj: LY]m~H\5Gji H\5Hj Zp ;#Lj 6,,DHMj 8PD({tPj? w,0"|,,Pjr 4F[,jh** {hQj wEdB'h *<q,j! *' O *<q؄jT  4 4yvXj $0d4 4Tyv܇j <co pp< ?Ĉj < %) @pp<0 ?j }MQo;Dvj @ydp<Gj "^Nmx:HjS# f45`؏j%$ @B' : 4j% 7B' : 4`jP' &*:Q6D %pj( V{4yHD : Hj, p@48 j-  .)<jp.  I) *< %`j:/ ,9=MR4 4D8j0 Y9fMR4 4Dj1 &vP:Q6D % jz2 Z!P`|p4Hj>3 8uAB'p\`|j 4 -<%lj4 -<%\j5 *<)jv6 2n*<\* jG7 +<Hj8  ` *< %Xj8  ~QmlDh 4jr: " #x\xP̵j&; 0:?"lp|U$vtj; pt(U#Djg< J:Dj< X  H[fp`4#j > u:~ u;Vu,,T(j> ypp\j&? u:~ ;Vu,,T|j? (CR8*j@@ o|\*<j@ @DQuUD}U# jA u:~ KAF;Vu,,TjzB 4ȮD7\jC u:~ J6;Vu,,TjC pt(U#jD J:jD X  H[fp`T#jE u:~ u;Vu,,TjTF ypp\djF u:~ ;Vu,,TjqG (CR8+DjG o|\*<$jH @DQuUt}U#|jI u:~ KAF;Vu,,Tj1J 4Ȯd7jJ u:~ J6;Vu,,T,jJK +/CXp(U#jK cܮj^L H@6jL u%);Vu,,T0j{M -EjeU , jN "@E; HXU#jN +/CXp(U#$jP cܮtjR H@6`jU u%);Vu,,TjYW -EjeU - jY "@E; HXU#tk[ *' O *<q k[ iRiR2*<qk\ 0e*<qkF\ 44U*<qku\ .Ա D*<hk\ nS (+<kI] Y1e\nW)<k] Y1;\nW,<hk^ .Ա D*<k^ nS (+<k^ Y1e\nW)<H kI_ Y1;\nW,< k_ .Ա D*< k` .Ա )< k}` .Ա )< k` nS (+<H kIa Y1\nW)< ka Y1D\nW,< kb n4S~(+<Hkxb .Ա D*<kb .Ա )<hkBc .Ա )<kc nS (+<kd Y1\nW)<Hked Y1D\nW,<kd n4S~(+<k)e *' O *<Dke *' O *<ke Z)<tkf ^D̯"z\*<P kJg %.23M^c\*<p kg nr"b\ *<pkTh uIP)<kh 4yZm)<kVi D} B )<k0j ZX)<kj Dc)< tkk 3)< kl ".Ա )<$kl uIP)<`km 4yZm)<km D} B )<xkln V ^(S)<kn QE!VY# -*<k(p QE4MY# -*<Hkp @D@bH\*<kq @H7bH\*<X kq 9Ll X@8 4#0!kr DW_Y#*<j!kIs TVcgH \*<p"ks ko}\*<$"k5t k}\*<4#kt c)<D#ku 9ce 55ȋTj#ku DWY#*<j$kv nSC*<#8%kv nSC*<#%kw B)<dj&kyw 9l X@8 4t#\'kx DWPY#*<j(k:y YK)< (kz F)<@(kz A.\*<(ko{ 99\*<|)k{ V &~(S)<)kY| P *.y6EL856`*k|  SWqgx\*<l+kC} b\ *<+k} b\ *<|,k$~ P*< v .k sMP*< v/k+ V_c*< \1k *<0 2k+ <%15ATYp<G3k <dptp<G4k 8#`V<?5k 8#`V<?T6k 8*<7k_ oF  _\*<7kLj oF #W\*<7k0 /3Tc)<$7k 97;B\*<48k /K4c\*<D8kx WRV-]d\*<T8k WRk%]d\*<d09kN =*"X+<i}9k =*"X+<i}H:k =*"+<:#:k r{)<t:k4 o)<;kr % M (+<;k DWY#]P(+<`k [4??kю 8=*"2p<),@k ~ .)<@k" {'*=()AkN TBNaBk} Lh/!:<Ck $l,<7dDk `w  cf<HEk 40ekp<$0Fk?  .\*<Fks @LOp)<TGk  .\*<Gkڐ KHA%)<hHk KHA%)<HkD @LOp)<Ikw =*"X+<i} Jk =*"+<:#Jkߑ F(\ )< Kk  Ա )<Kk@ )<Kkm DWMW *<3tLk Y1\4Yl,<7$Mk̒ h/:l,<7Mk B' ~K *<3Nk-   x)<qOki -. (*<qOk   x)<qGP Y qhQ${qvk u7 ;Vu,,wk# `ix,,p wkf cKHc,,\xk LOӥ*p#,xkߟ (ݣ,,4pyk *' O *<zk *' O *<zkǢ I*<{k֣ -Y#3 *<(|k 8t*<q|k rr *<}k~ Bbɬ*<~k 1 % +<DkG r{+<:#k c5!c\*< kէ $.C5)Z4H|+k 5/Ж * PPy|kl ISr5<\p H$k  5150*)Tk 9i5&` kq 0=g5D$ i}lk ?u5\-F$'4'}xk ly57F4$ kD r{5))Tk 5.3)) W4!$ k  U; 4kʳ 0"T1y k +4C'kr)<p ,%  =@G# kG 2-p{DK0(lq |ILKD7l ,7fQd1|[-Pl <_b̛7lɵ j]  4 t # l    O ` m pw@LC#l     ) xx: l"l   ; 0 C )80(&l 'f m QFDw #,&l̶ ~  ] 5D3'l Y05 g{#,(l -r&pX5D3(l' |   t(ydGC#4,l?  u$5DCL-l] u<?,,\-lr CLW1q4Q4~.l z)<.l ]`P3/lJ +D > 4C#1lg %/7D*<31l $B.Ա /<Q<2l $J.Ա /<Q2l RU(p+<Fd3lθ ].Ա x/<#3l nehӥ2 p+<F4l psx/<#5l% R{(p+<F5l= .Ա x/<#<6l\ R(p+<F6lu .Ա x/<#d7l $KpTd~Q9l $0KpT~Ql kax&[xL 38Ql  :.=0x̜3@Yl 0| d g#\l5 *=Dx+`lj b|tDz# Lhl izPG3Ȋ- xjl 0EH{ |)<tll K#,ll W-<@ol $.A )h $LtlԻ ZhḽXxg#~l x,t*l 4 8  >!P!>K4zxl! !!!015!@.<l7 !!!>"B"L"xFT4ؕlL !!k"G"B"L"xFT4lb """P#)#3#xFT4 @lv !!V#]"B"L"xFT4pl !!#k"B"L"xFT4$l $###yI$t$$4l $$$$%d%l%WPо<,llͼ %-%%.<Dl %c? %'%@.<`l $%%%&/'E'ܭlx`,5pl (''()W))[$t. dl H) *****4yDr 7l( '*+++DKlE (+:+V++++D ~qlT 0e*<qlm $+Y ,%,2,L$ӈ@l &/2H)<l1 ' -] )<lH &/2H)<Tlc ;O .<#  l{ &/2H)<l 7,@,S,< p,w,85 4D4l &/2H)<lž ,,,,- -)<TLlܾ C-L-[-p-w-7 4ddl B' (+<(l &/2H\*<l+ - -*t*lB &/2H)<l[ ----\*<tpls -----. L4l ...&.5.<.85DJl KHA%)<xl &/2*<,lؿ { C.J.I27*<l v\*<l S.\*_.r.*q\l( w.....LlA ....9.)l] V [ Uh  D`4l $Y8 UslD#,pl ...U 1/'/PrDr Ig#`l c 6/U#Hc,,l   0 U1 ST\zɁls  Uc 4\r l ڷ ޷ UD P PDDl 8Ut{*<q|l7 crU{ )<qlm <9/>/cY,,@l D/N/R/c{01D5#m 'i2c*)`#<$m l 3 c))`$m n2{22c@222QO 30&m7 222cK)3H3S30`~3L(mg $h333ca333̹P4{M3+m  s4cm4-4< 40-m r 24cj ,,-m* 664=4cg,,D.m + K4X4czYc h ))`$8/md t444c455))Ȋ0 83m *5!H5c555(65`5m 5Mx 5c.6E6P6Z@y`8m. d66c66ZP:m~ 06I6c07A7d\5P=m J7W77c89,9JD,YTEm8 &9c=)<,Emb 99):cB:#;3;4DLYT,Lm ;;;cN<<<5DT8Rm$ ^=cD*<lRmR ,a=z=~=c#==[<5Umv =cj \*)`lVm n==cY#=)<Wm ƒ=ce҃ك856`$Wm 8ct{*<qXm9 ={ F{ n=B'O{ ,,Ymc T{ { { nUx O| U| )<g#^m T{ { p| nx O| U| )<bm } } } q L} S} )<4dmN } q.F ,,dmw 4 = B wI ,,em (l wC2r t:6`4fm  wP> i \{ k7rm   + w4CN U \*<P sm b k r wO *<DC#(um O y w I Z \O\-C#{m  Ġ Ƞ w" / D hrlV 3 ĆmP wi  , -i}m  l p wq P *<C#ԓm h wuR",m  w! / )< m 8wt{*<qmC - w ǥ 856`TЗmm <ץ Y,,m ܥ  - <)m 5 B Q h w 4\5p m  ͧ D . 9 HPSmb ->>` 0<+5m -> >` .<+5m v>>%v)<dm >0>7>'R>c>h>)<tԣm o> >60>QO3m Gh>E;VJJ)<$m $G>o>>>>>)<ȧm ? ? ~ h*<Tm ,??7?K???h(Qm ??v{5,, m ??t{5,, m ?@ @kϴ@&@<0m5 -@1@{Y#7@,<C#dmv <@I@M@Ce@Y$n`̰m p@}@@@@@؃qLm @AA&A=AFAD7mI MAVA_A15qAxAH3$(m gAAAA q\m AABBBChȮqxm 4CFCNCjCsC4)Am3 uzC~C;Vu,,m} &.CCCCH 3m $CCC4D\DwD  ;aEm ?D{5,,Lm? DDD(E/EEEFTfXm lFF+F[EFXFaF P^$+m! 6pFwF],,4|mg ,FFFe6GuGG4X{Um5 GGGvGG= 4:#m| GGpr 7 4g#8m (GHH 0H=H)qDlm HHYHzHHHI$)C#m=  Qi5I9I7 4g#lm 7@III̯YI`I+<TEHm iIvI~IIIIpdqm b IHc,, tm[ I-JtJZKKK|S|{xm KKLLL<0t|m vL"Lx6LdB 4դm; ?L^LyL#LLMdt`tm| \"M@\*<,m \&MD\*<@m Z*MG)<\m{ 8F.M=M\MuM|M<< +C#m 6MM ,,LmD MMM&M%M<<+C#xm 6MN(,,m NN9N-nNNN$q Y 3pm @NNN?NOOP^ +3n6 6M6OA,,hny DO\OOMO PP̝C#n >PHP|P*PP466`n Q)Q-Q$LQ]QT nD jQxQ}Q QQQ*)`Hn RR"R(|#,nt }RRRxSSShx`n hSSW2S@8D3n $SS`IS@8D3<n S4TcTsTU@U`:#$nO `UmUUV/VAV 3t)n iVzVVVVVhS:#*n VVVW(W/W@833,n DWLWE\gГ3$/n% qWuW%x)</nZ TzWWW)Y@YY$ G9@n; YYY{ Z&Z3Z`Ԁg#Cnj DZ{ZZ6[z[[ x.g#Jn [[[\%\4\T$3 Nn <\L\e\\\\ԅ$|Pn \]]Dg]{]]į03$Vn: ]g]x]] *<3Wn Sa~ x)<Wnk ]]]c]] *<43Xn ]^^O^[^b^x)<q[n q^^^__"`d fn Y04Fe`{ +<3hgn 57k`n` t`+<C#gn! y```'``H 4D inf ``a1?aOaXa0q4)H ln ua|a5,,T ln$ uaa45 ,,d lnn 6aa3,,tmn $aabLbbb%^| DvnX ;Х8cӥBc4 4i}vn WIcRc̎D*<i}wn `cmcqczccd4#0U~n d!dWdddd73|.n \9C>I\*<n de*eMeeeQXL} qn f ffw4fKfXf43 n ef~fffff07 43nS fg9g|ggg *<d3`n gghhhhPq qؔn ;Ih.3)<hnD i ii%i,i))|n 3i\r<*n rsA{5,,4,n ks{5,, n sPssPtcuuPU , tn, vvvtvT2*+Hnk "v5vCvqvvvddqHn vvvSvvH3D$n dvvw7wGw\wT)pUpT5dn ulcw;Vu,,TnX gwwwwww4DdC#n Dwwxx?xJxTdpIq0n WSx_xWoW,,Pn oxxx|x)xxtxO}LnC TVxx0x<)n xxx7y(y1ylk^t+C#n 6@yJy9,,4n xxWyGy(y1ylk^+C#nU 6@yI,,n wyyWIyy)<oH ILOӥ2 )<>o 4~ .`q< |?o ILOӥ)<@o 4~ .`q< @o* ILOӥ)<4Aod HY1\t<4Ao h2T+<DC#Bo @nƀ̀S Olq<T8Co! Wր݀f+<d3Co` H$<Do HÙl,<7PEo H$<Fo HÙl,<7FoZ H$<|Go HÙl,<78Ho 4~.L Tq<t Ho I ӥ)<\IoP D% ?W<Jo DWY#MW *<3Jo #)<@Ko DWMW *<3Ko( ,74F)<Loa xB' iWd)<2y,Mo P\4Y\nW,<C#Mo xB' iWd)<2yNo P\4Y\nW,<C#8OoQ DW*+<EOo UBbat,(qPo tyjTj (Qo  QX)<QoA h=*"2t)<qdRow ~ .)<Ro p`i)<qSo |r S~(+<0To! xB' iWd)<2yTo\ P\4Y\nW,<C#Uo p`i)<q(Vo |r S~(+<Vo xB' iWd)<2ytWoO P\4Y\nW,<C#$Xo |h/2T)<2yXo $IY+<C#Yo  \\_\*<YoK h=*"2t)<q0Zo ~ .)<Zo tW% )<2yd[o QEY#*+<3 \o1 h=*")<2y\or ~ .Ա D*<C#(]o \\_\*<<]o F(\ )<]o) %  \*<h^o\ ak@ \*<ao 8=*"2q<(t\bo ~ .)<bo  Lh/!:<~coM $l,<7Xdo Lh/!:<~ eo $l,<7eo Lh/!:<~xfod $l,<70go 8=*"2q<(tgo ~ .)<Lho, \FMV",`hog  ]dӥݙ,,ho mvUςԂ,#`$jo UG&+,LyTlo0 8EUiHtD$6LB Ĵ qo Ea1B,,ro %(a#< =*< to DMVkbw|,,uo nX"<). voS O\߆ڇi,4 ~o{ ~ F ,,Do ':qLV(6t|q|o ,  Ip6q܇o& +[<*Yj5 4o[ qAk\t@o (\%6 4JPo ;HXi8\5To_ p/Td<C#o Rc_\i(+)<o  Onӥx)<o < ))`|oZ t ܎d@6<3Po -") *<3ܠo D x)<Ho   )<doM )<o ;O l,<7o ;O l,<7o ;O l,<7]L<OC#Lol* nzw94^`4,o* nzĖw54^`D o+ rw1{5,,od+ w&<*,o+ r~#w {5,,o ,  w+&1?tTEo, 8JMw0f}?tdHo, pwMȗ|QC#o=- QjIwSbg I,,|Ho- uwR;Vu,,o- wQ{5,,8o9.  w_*P^<7qlo. V 3:wa(ݣ,,to. tDWdwlĘјm̞{xo/ WwoWoW,,P o/ $wz̙l8D1#"p; ɡ;7 $i}%ps< l$N >D1#L'p< l.CJUf{_$_̑Ii}(pA= rZ{5,,L)p= V<))p= <'HYL\?C#P-p> iv)D?G.pp> 6ˣң+,,$/p> 6ˣߣ,,/p*? p2B'+<C#0p?  p:)8*<L1p?  p=B)8*<2p@ M8 V 1#3pG@ u;Vu,,P4p@ uu;Vu,,4p@ ,Τ% Q;7p.A u.&;Vu,,|7pA T1Vi8ХhL/;pA cK#[Hc,,lp}B 6lU@,,$>pB t "/Y@^<C#Ap(C BOVdsz4@64BpvC 6lU,,DCpC <ѧا8@6TDp*D 6lUߧ,,dEpD < bl̒UIp#E 6lU,,txJp}E < Ǩbl̒0UNpE 6lU,,lOp(F !"?ax7?PpsF Rp ;)<HQpF {)<QpG ]c%Y-k *<3RpSG (8ǩ?ЗTpG (Ω<X^<TpG C*<qUpH DRMZE*<q@VphH =*"2-<VpH ~ .)<\WpI =*"2-<WpPI ~ .)<xXpI =*"2-<YpI ~ .)<YpEJ (h/!:d^<HZpJ $l,<7[pJ (h/!:d^<[p?K $l,<7l\pK (h/!:d^< ]pK $l,<7]pFL $B' KPQ<^pL P\4Y\g *<34_pL ҩީ85З`p#M y)p.paphM cKH #,apM =*"$#,bpM O) 4X>3:LcpN ; LkȌ#qdpnN l({5,,hepN Gh"";Vu,,ep'O , "xK(~POqiprO ,8CKL ]fD?`,kpO ,8qGL ]fD?`plpP lBJC{5,,lpjP K8E,,mpP Gh0:-;Vu,,npQ īǫX+٫))opUQ fb,KK|rpQ  mҬ<*spQ [@\*̯d@*<qtp%R WW׬/&I856`8uptR ܬ/*R|OXvpR K$/8AXx))`qxpS 9cf/w,,ypUS /ӭ،pqH|pS ./<)|pS D /*%6+<C#}p*T "=D/+(MR|#,$~pwT  Y\/0.ah*<q~pT n9ho/1bVVz|#,<p U D/6%6+<C#pVU `ڮ/7/BN@6</ WtpV Gh/<;Vu,,pV Inyk+Y #,|pW k ,<)pW 4k ,<)p3W 8JYkҰ۰4xLxܕpW Yk%49)<p*X ZK@kHHLDɁp?X OX]kzL6`ɁXp{X kL6`ɁHpX OXkzL6`ɁpX ֱk L6`$ɁpX k!(L6`ɁМpX 5>CkV]L6`4ɁpX  Ùbk(ExLDDɁdpY *b k.(LDɁpY kAƲ߲-)`$ؠpkY  kPz4ɁpY D" kV07LDɁpY @`Ik]oUz4ɁpY D`kkfLDɁxpY ɳڳk".=z3/ Ɂ pY hkz,,ĩpY k3´˴;DD3pZ ܴk;aOT3p/Z )kM´˴;Dt3pNZ ESjkUɵaO}3دpZ kf´˴;D3԰pZ  knSrzaOd}3pZ k´˴;Dԃ3pZ ˶k aO3pZ #k´˴;D43p[ @M`kaOd3tp8[ k´˴;D3ppQ[ طk^aOd3pj[ $k´˴;DĄ3|p[ ANYk{aOt3p[ k´˴;D3p[ طk^aO3p[ ̸k´˴;D$3p[ k#*aO3p \ 5k´˴;DT3p&\ ANRk {aO3p@\ tk´˴;D3p\\ k#ڹTd3p\ k2´˴;D3p\  +k:MTaO3p\ _kH´˴;D3p\ طzkP^aO3p ] k^´˴;D3p&]  kfMTaO3pB] ٺkt´˴;DD3p^] k|#*aO3pz] k´˴;Dt3p]  1kMTaO3p] #vSVk607 43px\ I ]`k;zz5 4C#$p] \D k?)<8p] DӿkC\*<\p^ gpskG)<p2^ S k`*<qp[^ ̻ٻkk 7B0X̟Hp^ cfk{S8)<p^ t}kY&"¼+<0g5p^ /Ѽkϴ LDɁp _ (1Jk0LDԆɁp4_ ǽk{ 6=LDɁpI_ dmkȾݾLD}Ɂp__ (kqz4Ɂ$P+5q2b HQXkt9 4pɁqb kO^ 93ćɁqb 1<k L _hzcɁqb ykzc~Ɂqb %.9k5g|xSSTqc k?+ȊLɁq.)dX/ ql /$.k 9.>.)$P/qm /<"/k 'GJ/O/)p.\0qjm -G-k Y--)*0qm U.$.k 9.>.)dX1qn  k? <P*<vqn R%k<(H7*<qGo V Ak9DSX*<q|o Vbk6\*<qo U$.k 9.>.)hQ|1qp sR bR k R R ))Ȋ1qq sR bR k R R ))Ȋ<2|qhq sR bR k R R ))Ȋ2\qq sR bR k R R ))Ȋ2t(PqRu  / S6h*<g#qu ZmwA$ ܩC#qu  / S6h*<g#Hq'v M+DKL>t(pLqdv  / S6h*<g#qv n/BX2C#qv  / S6h*<g#,qw Jz_lT$8(qEw  / S6h*<g#q|w X}oqw  / S6h*<g#qw 68=(C#\q0x  / S6h*<g#qvx %DB4 ܩ Pqx  / S6h*<g#qy m8=(C#qBy  / S6h*<g#Dqy JPy_lT$@qy  / S6h*<g#qy /BX2C#q#z  / S6h*<g# q^z EM->D Hg#qz  / S6h*<g#qz ,FY "TT\3Hqz O[xfTPLq){ O[rTPqW{ O[~TP̢q{ `-ݕ8 4C#q{ cK@$Hc,,|r| CWX(Oh=DC#r\| D@Lg C#T r } ,|̽ydP8Y3 rT} n 4^`xr} n.4^`Xr} rP{5,,r@~ TB'<l)r~ r`z{5,,r~ XdGndxU3Lr& D@`rs <+`4r r{5,,r Gh;Vu,,$rd <*r r{5,,Dr   by|7|4U+54jr 1(ݣ,,dljr .M1(+<4nr  1=DJ,*<̣+5pr F1(9)<HqrC =*"1B2)<qrn cK1H!V)<Xrr F1b9)<rrɆ cK1H!V)<dsr F1b9)<sr&  1  h*<|trM fLO1Q2}h*<urw Wb1)<tHur ig1r)<ur҇ *"1)h*<vr  1. h*<vr3 DW1MW *<HwrZ B' 1yK *<3wr % 1X,<@xr DW1Y#Y,<C#@yr݈ Wb1)<xyr i1r)<yr: Y1\4Y1l,<dzrh h/1:l,<7{r *"12h*<2{rȉ  1.h*<{4|r $l' 1r-1T<W|r/ $ +\4Y1T<}rg LO1ӥ(+<@$~r TV14(+<~rԊ *"12h*<Hr  1.h*<qr/ *"12h*<2dr\  1.h*<{r  1 h*<r fLO1Qh*<qr Y1\4Y1l,<Ȃr! h/1:l,<7|rV  1 h*< r fLO1Qh*<qr Y1\4Y1l,<Pr h/1:l,<7r$ p18 4 rR U~1"388 4r DW1MW *<r B' 1yK *<3lr֍ % 1X,<@r DW1Y#Y,<C#r- nr 1~+<Xr` W% 1EX+<qr :$v̑qčr cKi#v Hc,,Hr< rv{5,,Ďr  v$0OKL~[C#̒rݏ ndsv@4^`r* ndv<4^`rw rv8{5,,rɐ ]cv-YD?r rv%{5,,xrh v Ȍ#q0r Gh'v!;Vu,,r L*OSv/;rY vOd(r <v4S,,r A #v^/F8H`;Fpr@ Qcfvq4Hr va<T/`r v:34qr5 [@\*v̯d@*<qr{ r)v+G*<qr ,,Щr NW[W~ԫg#r  rL\g#r< +Y\+\*<dr{ Q )<r  15 p8 4r zR 2)\*<dr, D"\*<rl %69Vg8\5g#Dr n{~'*<rЖ .POg#trz #9xNY2r1 ly}Xh6#,(1s G,mrD1sȧ \ Zqa\*<X1s ~^#,t1s \ jqa\*<1sI n#,1sr \ wqa\*<1s {#,1sϨ \ qa\*<1s \*<2s0 \ qa\*<2s[ #,42s \ qa\*<H2s #,d2sܩ \ qa\*<x2s 4,mr2s0 #&))`3s` #4))`4s #BL))`5s #Pi))`6s #^))`7s+ #l))`8s^ #z))`9s #))`:sī #))`;s \ zqa\*<;s #,;sG \#,s 2#,$>s \ 6qa\*<8>s@ :#,T>sk \ >qa\*<h>s 'BMq\*<P8?s­ \ qa\*<L?s #,h?s \ .qa\*<|?sC 2#,?sn \ eqa\*<?s i#,?sŮ \ vqa\*<?s 'Bzq\*<p@s \ qa\*<@sB 'Bq\*<Asm \ qa\*<As #,As \ qa\*<As x#,As \ qa\*<Bs: #, Bsd   2<856`,Cs \ #qa\*<@Cs '#,\Cs \ +"qa\*<pCs /&#,Cs: \ 32qa\*<Csg 76#,Cs ;*#, ,Ds DWFJLY#]P4DqDs Zgz Y,LC#HGsO ! . X    !lY,<53dKs >!S!W!U1o!DTȊC#TMs z!!!ws"""Y, C#Ts ###E####0Y,5qWs  $%$*$.J$(+)`8Zs@ P$$$*J++'h 3Đs +++_$ ,,L[[i}s5 #,<,Z,0,-*-$+,5ԗsd U-a-A --- 5 42Hs ---M .//0\PD2Сs۴ "/,/1/ g00L.<2 s 00 1 z111Ldg#s7 111 22_2L.<2̴sf f2 o2 22L.<2s 222 22 5 42s 222 22 5 42$s 3&3+30 33vw`2нs 333 464=4 5 42 sE F4P4x4 (5O5W5 5 4 ~ 2s F4P4~5 (5O5W5 5 4~ 2s .6 ;6O 66HP wg#ps 666 B7i7q7 5 4̤2\s 777 .8a8i8 5 4 2Xs? y888 959=9 5 4L2psk M9V9f9D 999L.<2ts 9 9[ 9: 5 42s :::u a::t2s ::: :; 5 424s ;$n0; R;k;r`g# s> v;;; ><R<Z<51 g5,s <>0\P2s ? ?? U?j?q? 5 42s׺ ????(+<s ??? @F@\*< t- N@W@{@4* 4@)<2 g#pt~ @ AAZpAABP't l%+B0ByvBB,B<q5t$ hB)<qtQ BB)<qt BBBCGCvCL0#t dCCCbC$<uH0%t CCCCD*4E&tH D(DAD9DD*<̥q)to DD#,*t DDD@ E#E(E853+t DD3ED E#E(E853-t uOE<L",(-tν QESEWEP_EpE5D3-t uE~EEUEE5 4P$/ti EEEYFF41t X(F,FaD*<C#h2tԾ uOEp ",x2t XFmFrFFFT\`3$5t2 FFFG'G6GDp7tb EEIGFF9t X(FiGD*<C#;t uOEG",;t GGGGGT\`3=t GH HH4H?tO AHNHZHHHHXBt HHHh: ID*<C#Dt uOEI",Dt I!I&III3tItI IIJ9J0KwKăLVt~ KKKtLLBMd tet MMM0MD*<C#htD MMNN*Nw$wjtt 3N@NDNPNh*)`qPkt uOEUN",`kt YNNNNO/O$/3pt 7OJOO $Y~"slD#,u| $Y~#slD#,$u $Y~~A$slD#,u $Y~%slD#,u6 $Y~&slD#,\uu $Y~'slD#,IJu :҉nP6pu ۉc,,u" 7NYdp u b8 lEuhNXxu b8 lEuhNX4uN b8 lEuhNXu (v4 0,, u $ug|/t*u $ug|/t*uA $Š/t*$u{ @Ɋۊ"05Po$Pu $7DG,q/<\u $LX_0po /^ĊTu* (4ҋ׋\ot*40uh $ދ?:AGu $NZgI$Gu $NZT$G0u 8 ߌ_ho<ЫuT (f,GR&&Lu ktm{/$PDu (ˍ=4 \6uD Ɏю6<+DPu (HZ]kTp.u ,ՏڏU$PD#ud 0/4TTi}u O'c\B *<qu  un*p.u" ;GViN\*^puc ѐ)xu #Tg\*p.Pu  )07XF)p.du - MV)^u[ - Ma)^u lu~I)^u đՑ)D̦,u  .\*<uQ .j\*p.u #Tg\*p.tu #Tg\*p.Lu $G "*p.uG 0e*<qpu $'%<MT)<g#du ajm)<g5@u ͒ޒ)<$g#Xu{ APW)<6g#\u |v{* )<g#Tu ѓ" ړ9)<0g5Lue aY 'M t+<t3u 6?Bo? )<g#u ѓݷ a4)<Pg5uf :)v<+`pu Ɣє16$,D$u *uQT,,g#Pu9 WZ_p#,g#u{ Wd_p#,g#0u ipIt*)g5u [/ [-<g5HuH 5SP)<u ƕ͕-] ԕ\*<u ƕە-] ԕ\*<@u :*<quf 8"!?jyl  Ju !@Pu&  !!$;`x1#8uR .H!#<)u OH )<3u 0TmH#7u 0JVYH7^qjp.vM x{H;)<v 0~HzȘqv 0ӘܘߘHCEHw<hv lZH&7\5v; T/2H8)<Xvt T/=H8)<v CFH#,7v CJH#,7v( CNH#,70vh uRH",@v xVH)<hv Z H.ƽ*<qv! [@\*H̯d@*<qvb -gvbv`S|OL vy bz)<h v -bY#+< v b)<( v řҙb~*UfDT2v sb+:d̯v  {qb:yX+)!i}v ~b'5hv ERwbΜלPfȳcq=v MVcb|<)L>v& b#.bM*<jv DXcbr)<Djv }bc*<$kv b; )<4,kv cKbH!V+<kv4 Fbb9\*<8lvP 0Eb*<xlvj 0Eϫܫb)<̧lv  b. +<Hmv v+6bӥ_E)<0mv PYbe+<Pnv nwb)<p,nv zb*<tnv XĬϬbެ)<ov, zb*<ԌdpvG XĬ bެ)<$qve *' bO *<qqv 8bt{*<qrv *' b-] *<qPsv ?CvP]|O\xv `ѭڭ_[Tw,DI3yv  `?W"<)Txzv ),e)<zvL u03i",zv Fu)<zv u07y",zv? ;Ny1BIT`9v <I'Pvdv$bvd I*,,8v~ $3?NI0,#v $I$ 0,,v )r)I+$P3v )r)I+$P3v )r)Iu-$Pv# 5 Iun*$PvB >#ITg)$Pvd JV]Ifu)Dv |!G$GI*$Pv 0r)Iuw$P5v I*$Pv Is\*$Pv I.j\*$Pv3 5 Iun*$PvP >ITg&)$P$vp ' I0\*<Pw ,I')##|w ,9{kdo4 w (-kV<4\5w exk57fm3T5 g# w8 k o8@6$ wb k * ,p#4( w .k7`zpS rxw WW]J kZI))0w ka)<w Ghkf;Vu,,, wI .kj *oThtd"w cNQkHc,,0 "w cNUkHc,,0 l#w YfjkwG 4O}p$wE ~kq`nSO}%ww k4xT́d,w  khx`DC#$/w; *:k!H|L37wk Xitk3\:w k`<8C#Aw #kP<&0Dw k+Yu07Tx; 3Hw  k=x *t* 3Lw $kNDxHl,F }Yw $kkmXX$ }ew  $*VkCZt }0qwB kJaj3GTwA V k$(ݣ,,dw k/Sy`w u)k4;Vu,,TԢw u,k2;Vu,,THw2 /8Kk=nYlnLwc 8kG$SdLd̪Ȩw xk.HgL4&t>ȭw *u{~kQ)<w kX0 **ȋ3Яw< ukmC48ȋ3wk [ky; 83w oFk)<(w2 ,#;Jkj}D&^+f we 6k,,w k'xnUI1`w 3@Qkdo̖čDwB k,,4w 5PkHPlSL#`w qk?\D C#w! ?xkJВ@0wB" \_ [ kQ)<Dw}" kUU0kT&G,w" k\E+)C#4w" [kanG4w # ko?T)pwA# Yykw  x# kتpC# x# !4kTixЗxS$ k)<x$ k,3t:4 C#x$ >ckG^ $8x9% k+ d&Sx% #;YkpmN̨C# x& k !.]n`$ xf& ,Ecwk4ȡء?1#P"x& GhK k9;Vu,,t"x& kEEVcĉء?1#$x' GhkJ;Vu,,td%x<' @vk] )<T7(xc' 40BFkkXg[<)x' $n{kw mO|-x( d& k x kX>  T 4p|3x5(    k9' )<<5xb( <. f k k$  |(=x( % z  k{{   āT Gx)  ( k5H̖\9Ox) $k23Qd ThUx) @kR 45 2x`x!* k 7>5 4axM* 4Mk,Ca0<kx* skIJ)<P5lx+ (k5< FD nx8+ guk6`I 6 xp# nkYӥ2}\*<L] E xx= 6N&ku,,x > ,h &&'kP'(( ?L]( 9@x> 6N7kR,,xW? (M)Z)])kFk)&<_< x? z)))k)*#*44>hvxA N*X*\*k***4@عvhx/B +'+*+kp+++(@<9v`xxB +++k,5,<,(@3̩v@xB z)Q,) )*#*44>HvxE N*U,\* ***4@vxE +Y,*+ p+++(@<9 vxJF +\,+ ,5,<,(@3LvxF _,q,v,kTU,@8?#xF ,,k,,xG $,,,k*- dxXG (&-?-D-k?t -0NxG FCukO*<qxG *"k-)<qtxG wOk-*<q@xH *' k-] *<xbH kI-*<xH ---k:./.nn6xsI 8.E.J.k:_..nS6x/J W.. ']d\*<xqJ W.. ]d\*</ m///4@ 4vyN /// /00@@3vyO (/0 .<*<PyO (30 .<*<yP 70@0C0 e00*<pyP oF00 J\*<0y*Q oF00 B\*<`yjQ  ?c)<xyQ 900 6\*<$yQ 000 111853D ypR 41=1H1 q11\*< yR 41=11 q11\*< yS 11 11-t*$ yT `11 -t*4 yT 122kJ2g2t2$y(W r 2k )<|yX w22k!J 2<xy|X \22k)<y`Y  2k)<y9Z t22kE2&<yZ t2Uk?2&<yZ x252k,2R&<y6[ 2k)",y[ V 22k(S)<dy \ 2k7 -<T y\ 23kb\ *<y\ 23kb\ *<yw] 4333k3+3o<y] +0333k.<ys^ +0373k#-<TTy^ 8;3G3J3kN3e3ot*Tyn_ 0e j3m3ks o<dy_ (Ή%q3kPu3,o<$ys` $3Z)3kFl,<Ty` WSs.k']d\*<Dya WSs.k]d\*<TLy7b 3.k*c\*<ddy%c 3.kb\ *<yc 3.kb\ *<ty|d Z.kP*<vyne s3.kMP*<vybf V3.k*<T!y g 3/k*<0"yh 2/3>/km///4@ 4tv$yh /3/k/00@@3v&yi 3/0k.<*<`'yj 330k.<*<'y>k 703C0ke00*<P)yk oF30kJ\*<t@)yl oF30kB\*<p)y*m 3k?c)<)ym 930k6\*<4*yon 030k111853ԏ+yYo 413H1kq11\*<p-yIp 4131k q11\*<(.y7q 31k 11-t*.yr `31k-t*/ys M@33k3&3)$P/ys 4 44k4+4)$P0yJt M@243 3&3)$P|1yt 4944 4+4)$PL2yt FkbH*<q2yu *"k-)<q`3ymu kI-*<4yu *' k-] *<4yzv FbH*<L5yv lROkuR*<6yv @4'I4 l4}4 PXg#7yv 424 44x\$3X9y3w 424 44x\$3:yww 424 '44x\$3yw 424 744x\$3?yAx 424 ?44x\$3dAyx 425 G44x\$3Cyx 53575 3550,!Hy y 55 [{5,,tIyTy 55 I{5,,Iyy dX56 6 e>6g6`H]`Nyy n~66 4^`@Py=z n~66 4^`$ Ryz H66 {E6D@`Ryz 56 w{5,,XSy8{ ^$66 l:,,Sy{ d677 I7n7D_Wy{ X777 8"818L̪9h[yb| ugN8 ;Vu,,[y| R8e8v8 8884@`t_y} H69 E6D@`0`yu} 5 9 {5,,`y} -99 ,,8ay*~  9#9 #,Hayq~ '9649 D9,<C#ay~ I96V9 f9#,qby! r  S*<q cye cK H!V)<cy F b9)<,dy 6 H !)<Hdy* {'k9H "'46L@deyi n9H $4\5hfy {9H +4\5lgy 99H Zo)<thy/ 99H `'%)<iyv 049H i,,ly z9H `ly$S^dl 1#xyX ~;H !^S1#,}y $<H 85 4@~y҂ &6<H <MR*<48y YwV<H DyB v<<H ]X L#\y "=H G4D((y ,>i>>H lMcSM eM##`y0 jM{M~M M##` yp WM ,,Xy >McM eM##`y >McM eM##`y< WM ,,yy MNN ".u zN##`\y MNN N.u zN##`y N P)<y0 NeN өO)<\yq a O 8O)<4@y% EORO]O 'GRuO)<0 8yc OOO cOO)<P y OO I*<i}y _ OO G*<ETy$ 7OO \P$PP|Og#yf (/Pz UUU V+<3@z V'V+V bMV+<3BzH RV_VbV < zV+<3DDz VVV TUV+<3lFz VVV TUV+<3Hz@ SSV T+<3Iz V)sW x%W+<3Kz SS*W T+<3LMza UUBW *V+<3Ozǟ hWuWxW ɬW4 4g#Pz $W ).<t-<  __ iWԕ)<z~ __` c-`x)<C#z v )<z `+` )F`\*<d4zF W```q` `\*<Hz =*" 2-<ԏzʪ ~  .)<dz =*" 2-<zT ~  .)<z =*" 2)< z ~  .\*<z( =*" 2-<(zk ~  .)<z bK Hk+<c bbb)<T8z RbScbc |cbc)< TzS ccc ccc)< tz &cc 2Hd)<d(zչ  dd d.d)< z &c7d 2Hd\*<ttzX cc@d ccc)< z  .)<0z׺ v \*<̻z _Xd _)<xzX v \*<z %  Ƹ)<zܻ k> B'h *<q|z *'  O *<q(z [@\* ̯d@*<qz *" *<qz' cdxdd 4GddXlVLz #de Be,,$z .e?eJe  ee4 4!g#,z@ eee eee,,dzv e4e / f$fLB3i}z ,fSf}f r1gggH$bb6 C#z ! h h(htPzF /h{ WAkv WoW,,#P(?{ fuu*v uuux$zh$cqA{Q WAkZv WoW,,0$PB{ 8 mmjv @mWm^m4@6P$C{ WAkv WoW,,p$PxD{? fuuv uuux$zh$cq(G{ WAkv #WoW,,$PG{ vvv 0ww&w:@6$C#pI{/ WAk/w 6WoW,,$PJ{ 4?w]wfw =wwwLzh%13dL{ WAkw CWoW,,0%P M{< www Yxx*x3O}LO{ 1x>x btx^NpR{ Y)x!xx,,pS{ x$x! x+<T{ xxx! iyuyy)<@Y{ yyy!}yY$V[{ yzz!)1zTzazȰxp_{ zzzz!7zzz,? 4$3|a{ zzz!5{P{<;i}Xe{o {0 {!3{TVRi}Xg{ ${{{!KY||| {O< m{ $Y||!slD#,Dn{ $Y||!HslD#,n{C |}}!!1}L}3 U+5q{y _}h}k}!6t},,qr{ lly}!2}}dKLYt{ 8}}!*}l,,t{-  }}}!T~ ~30Z +5w{d 3~<~?~!ieI~,,qx{ $= N~Q~!e]~LPz{ 8}t~!]}l,,{{ w~~ ~~~,,P%|{A ~~~ ~<){m r S$)<0{ )6= tVJ)<{ Qdk #xvvp%{o  - -  Y{ $P F :Mj 7 4{ ^{g 8nBD{ ,O ?D0(P{P @5Ù KE w<jB { 0ƀـ U#<K//%0(|{ ,^ lpzzt0(l{Z < "; ~T0({ <2 Յ D0({ D@+  FgTY`T$ 0({ <\s 9 LS` 0(`{/ R_b vtG 4Y{g { 2*<@{ , +D@{ 0p  \w<B{ ,Ø O_x{ , +DpY{4 X[ gxdK3Y(|} <} š՚/4%Bp| 4ޚ w B |g 4Ǜ˛ 0 /B | $6F 8x| Ӝߜ V1>w$Vg50| <Jr (͠$Ȋd& Bt,|  ԇBi}H/| ʡ$ۡ )qN0|  B0BS`'(4|L _lp SȢvvY8| $Тݢ zu//H;| " hZ}7=|U JSj = 4?| ţȣ ѣY`PY(A|  $+w`P̬YB|J S v > "b ,,\C|r ERU 15p+<D| w WO`G| v $ )<YG| ä6Ф m++<Y$H|0 ٤ bZ '+<YI|e :GT 5u x$YK| ( 92HdK 4YL|  Aw4D0O|% + M~2<R|^ Φ ^w`PtHT| $&/6 aLW$4%U| b O\2< \c|I jT שh-)EXd| 4ܩCu Pw)C\e| X t+<C#0f| ,Bb ɬ;w<Eg|H 0 ',w`)4y0h| / 28D*<C#h| x]c Y3*<qi| ,y- 8!A|R#pk|2 L}֪!ܬOL[ C t S7|l 2!pe˭|R#T| ֭!xEiĬԠ 7 %| 7!,˳ 8 }|] ƴҴ!l )@,|+p\| N*Z!y|4|| !ĵӵص#,D| ߵR !L (+<G9|K  4!=jy4<}`T| 4!\Ƕֶ%F| 4!dx$+4 4&q\| 8EL4!}ry8 4dg50|N շ 4!2ٹ"o h|o z4!\i*Ķt8| $Һݺ4!8ET7lV0&|+ _dh4![r)<|s V4!h̻ӻ4 4P&{| ޻ 4!q5DC#|M $ 4!vp&M } ޻ )4!f)< } $3H[4!})< Ņ } ޻ 4!f)<}X ޻ ǽ4!f)<} ѽ4!2{ Qh]؞&G{} \C4!,,}7 8GK!&,uDtH ^`$}u 0;K!y̾ 80} xK!43)<41} K!0L4g#6}5 <FN^!m,,:}g $Ys^!slD#,;} l^![48I=} %/7^!yx\|Oр@}" {}^!l)<@}b ux^!m|#,@} E^!n",@} \_^!o)<@} \_^!r)<@}R ^!sc \*<ԒA} ^!t\*<A} E^!u",A} "^!v2GN)<B} ^!|\*<B} U^!}\*<B} o"Y^!~ex})<|C}< DR^!DR)<C}w DR^!DR)<C} DR^!DR)<C} DR^!DR)< D}3 o"^!ex})<D}x ':"^!;VD*<3 E} ^!|#,C#E} ^!|#,C#,E}6 %w^! 43&HF}x b^!\*<dF} ${1^!EZa)<&,G}6 l{y^!)<&G}r  ^![I)<'H}  ^![I)<0'I} ':u^!;VD*<3I}5 ^!|#,C#I}t ^!)<I} O^!O;`;)<DJ} \_^!)<XJ}5 ':^!;VD*<3J}v "^!|#,C#J} ${&^!EZa)<P'K}; \_^!)<K}~  :^! [I)<p'HL}  J^!![I)<'L}  Z^!"[I)<'hM}B  j^!#[I)<'M}  z^!$[I)<'N}  ^!%[I)<(O} ]c^!&h*<0(q P}g DR^!,DR)<0P} DR^!-DR)<TP} DR^!.DR)<xP}) ^!/|#,C#P}k ':^!0;VD*<3P} \_^!;)<Q} O^!?O;`;)<Q}- \_^!E)<Q}j \_ ^!F)<Q} \_^!G)<Q} \_^!J)<Q}) !Cr^!K %\*<pR} !Cr,^!L %\*<R}- 4U6^!M)<DS}o >^!S)<S} 4UB^!V)<S} EP^!`",S}9 \_T^!a)<T}v Qj2X^!bbgJmj )<T} `^!cd)< U} jOk^!du)<U}, jO|^!ju)<V}k \_^!p)<V} :^!q~iB)<TW} ^!r)<pW}1 ^!s)<W}w ^!te7 4tX} ^!w)<X} L ^!z7 4Y}8 ':^!;VD*<3\Z}u ^!|#,C#lZ} \_^!)<Z} ^!Ƹ)<$[}9 O^!O;`;)<[}w DR^!DR)<[} ':^!;VD*<3P\}  ^!|#,C#`\}1 ${^!EZa)<P((]} \_#^!)<<]} \_'^!)<P]}= \_+^!)<d]}| Nb /^!?MN)<p(]} VYY^!o\*<^} VY^!o\*<4D_}H ^!)<`_}  ^!)<( `} 4U^!)<d`} ux^!",t`}d E^!",`} ^!)<`} E^!",`}& ux ^!|#,`}g ux^!|#,`} Nb ^!?MN)<(Ta} KÙ^!"5<)<(b}1 G^!Wfk)<(b}| uxv^!|#,b} z^!)<b} ~^!Wfk)<)Lc}Q ^!Wfk)<0)c} ':^!;VD*<3Hd} ^!|#,C#Xd} ^!|#,C#hd}` ${^!EZa)<P)0e}  ^![I)<p)e}! ':^!;VD*<34f}` ^!|#,C#Df} ^!|#,C#Tf} O^! O;`;)<f}' ^!)<g}d ^!)< g} \_^!)<4g} \_^!)<Hg}4 ':^!;VD*<3g}r ^!|#,C#g} ^!|#,C#g} ^!/c \*<dh}2 ^!0\*<h}p 4U^!1&)<4i} 1^!7)<Pi} \_5^!8)<di}' 9^!9; )<|i}c Ez^!:",i} C^!;|#,C#i} @v "G^!E.` *<C#(j}- QSj^!Mذm}f n^!fC`73)C#n}  ^!g~4,{4 s}+ @^! `ztzQZt}e D0O^!;Kdy} 5^!A}m C#} 8^!%Xezx)I} |x^!_/| 3@}! =|=^!a ,,$8̜} GT_^!x\m`)3 } $^! |\\LO}p $*;^!@W33;O}  ^!h3} $^!347 O<} ^!l)3} $^!/>$4ēO}o $YsO^!s[)<} -.|}W^!d)<}W kx^!#LW P4} w^!: 9D P$4$} clp^!P43}( ^!_&T d -}s 7^!q&T d -} x {^! Jm48|7 3t} qH$ ^!:)2L<} ^!DL}Z! =^! ,,48$}!  3^!=h1h}! qH$ ^!:)2L0}R" ^!DL}" ^!/8N|ODg#t}# $?L_^!(A\\Oh}K# qH$ ^!:)2L0}# ^!DL~%$ _m^!V4D8 18~k$ qH$ ^!:)2L~$ ^!DL\~A% qH$ ^!:)2L$~% ^!DL~& ^!U܊x\|OT3~`& ^!j/8N|OTg#t ~& IV^^!֦D*g# $~& $=^!nL\| O4~;' qH$ ^!:)2LX5~' ^!DL7~ (   ^!3P;~T( $^!m\\ԅO@~( qH$ ^!:)2L`A~) ^!DLC~j) ^!"@<0n 1`O~) qH$ ^!:)2L(P~* ^!DLR~* ,5^!O.`TD1lY~* qH$ ^!:)2L4Z~<+ ^!DL\~+ $FS^!n`PZX O@h~+ qH$ ^!:)2Li~V, ^!DLdk~, \+R^!)<xk~- CU[^!ӥh*<q l~A- ': ^!;VD*<3l~- v^!|#,C#l~- \y^!#)<l~. |&N^!$(")<q$m~B. (=^!%.4DC#m~|. ': .^!&;VD*<3(n~.  ^!'|#,C#8n~.  ^!( \*)`0*n~^!J)<r~0 8AD^!Kbm)<qr~@0 HU^!Lot)<tqs~0 ': {^!Z;VD*<3,t~0 n^![|#,C#))`*q$~V7 KTW^!sD0<8~7 ': ^!;VD*<3~7 ^!|#,C#~,8 \^!)<Ѝ~l8 |^!("h*<qP~8 U^!ӥ7DC#~8 U^!ӥ7DC#x~69 U^!ӥ7DC# ~}9 ^! h*<q~9 ': \^! ;VD*<3 ~: ^! |#,C#~O:  ^! \*)`*~: ^!NDL~: \V^!1)<ԕ~#; DZcf^!2jyD{<q~g; L~^!9t3p~; H^!<7l7C#ȯ~A<  G^! \*)`*X~< \im^!LiHش~< ^!|#,C#~'= $^!C *<g#P~_= \ ^!)<d~=  ^!HA%h*<q~= $'^!I07DC#~> ':7^!%;VD*<3~M> >2^!(|#,C#$~>  >K^!) \*)`+~> \f^!*D0<8 ~? \ ^!?)<~T? !^!B("h*<q(~? $'^!EI07DC#~? 1~>^!K\Hh*<q~@ ':M^!Q;VD*<3~[@ >U^!T|#,C#~@  >Y^!U \*)`0+~@ jt^!V.7D0< ~2A \ ^!n)<~oA  h^!qHA%h*<q ~A $n^!tI07DC#~A ':x^!z;VD*<3L~,B >^!}|#,C#\~sB  >^!~ \*)`P+~B \f^!D0<9 ~B \ ^!)<~8C  ^!HA%h*<qd~sC $^!I07DC#~C $^!I07DC#~C $^!I07DC#~5D 1~^!\Hh*<q<~uD ':^!;VD*<3~D >!^!|#,C#~D  >%^! \*)`p+P~8E 9E^!Lt` ,~~E \ ^!)<@~E  l^!HA%h*<q~E $r^!I07DC#|~2F ':|^!;VD*<3~pF >^!|#,C#~F  >^! \*)`+~F \f^!D0<9 p~;G \ ^!)<~zG  ^! HA%h*<q~G $^!I07DC#~G ':^!;VD*<34~=H > ^!|#,C#D~H  >^! \*)`+~H \f#^!D0<: ~I \ t^!-)<~QI  x^!0HA%h*<qL~I $~^!3I07DC#~I ':^!9;VD*<3x~J >^!<|#,C#~UJ  >^!= \*)`+~J \f^!>D0<: ~J \ ^!R)< ~K  ^!UHA%h*<q~WK $^!XI07DC#H~K ':^!^;VD*<3~K >u^!a|#,C#~L  >^!b \*)`+\~\L \f%^!cD0<; <~L lw vy^!,,~L ^!NO`~M $15^!*0(`@~XM ^!P+)`,~M   ^!]i  4 4g#T~M   ^!zO NO`g#~'N   ^! ) <)`P~cN 2 ^!!h*<~N u^!"p#,~N E5 8 ^!#",~2O E5 ; ^!$",~vO uK^!%|#,~O u^!&|#, ~O ui^!'",~IP > A ^!(p#,<~P D ^!))<T~P uG ^!*|#,d~Q > ^!+zp#,~ZQ > J ^!,zp#,~Q > M ^!-zp#,~Q > P ^!.zp#,~+R > S ^!/zp#,~qR > V ^!0zp#,$~R .M^!1p#,i}4~S ."^!2p#,i}D~PS uۃ^!7p#,T~S u^!8p#,d~S E5 Y ^!9",t~T E5 \ ^!:",~cT _ h w ^!;ɬ  )<p~T  ^!<)<~T uX^!=",~6U > W4^!>p#,~{U >  ^!?zp#,~U >  ^!@zp#,~ V >  ^!Azp#,VV E5  ^!B",(V .Wx^!Cp#,i}8V .^!Dp#,i}H.W u ^!Ip#,X{W u ^!Jp#,hW E5  ^!K",x X E5  ^!L",UX _ h  ^!Mɬ  )<tX  ^!N)<X u ^!O",7Y >  ^!Pp#,Y E5  ^!Q",Y .b^!Rp#,i}Z .^!Sp#,i}fZ u&^!Xp#,Z u ^!Yp#, Z E5  ^!Z",>[ E5  ^![",,[ _ h  ^!\ɬ  )<D[  ^!])<0\ u ^!^",@a\ > ^!_p#,`\ E5  ^!`",p\ > ^!azp#,;] > ^!bzp#,] > # ^!czp#,] > ' ^!dzp#,^ > ^!ezp#,o^ > ^!fzp#,0^ }<+ . ^!g1<#,1#_ > 4 ^!jzp#,^_ > 8 ^!kzp#,_ > < ^!lzp#,_ .#^!mp#,i}9` .^!np#,i}` ^!I-*<q` /8;^!ϴ@ *<qa Nm /^!2G *<qCa 7. 1 ^!q*<q~a FCu^!ŕ*<qa =*"^!*<q a Ù^!EN *<qD 7b ZK^!H)<q wb TT^!U *<q b <\ ps^!h  ]U b  ^!\*< :c \\_^!)<4 zc \\_^!qa)<H c   ^!o \*< Pd  ^!)<lBd %  ^!  )<d uux^! )<C#d   ^! )<,e  ^!\*<Ne \\_^!)<$e \\_^!qa)<8e   ^!o \*<L@f  ^!)<\Bf %  ^!  )<f uux^! )<C#f   ^! )<0,g  ^!\*<Bg \\_^!)<g \\_^!qa)<(g   ^!o \*<0h  ^!)<$LBh %  ^!  )<4h uux^! )<C#h   ^! )<P, i  ^!\*<DMi \\_^!)<i \\_^!qa)<i   ^!o \*<̮ j  ^!)<T<Uj %  ^!  )<dj   ^! )<p,j  ^!\*<tk \\_^!)<Vk \\_^!qa)<k   ^!o \*< k  ^!)<l %  ^!  )<xSl uux^! )<C#l   ^! )<,l  ^!\*<m \\_^!)<Om \\_^!qa)<m   ^!o \*<Lm  ^!)<  n %  ^!  )<hLn uux^! )<C#xn   ^! )<,n  ^!\*< o \\_^!)<Jo \\_^!qa)<o   ^!o \*<o  ^!)< p %  ^!  )<XKp   ^! )<,tp  ^!\*<p \\_^!)<q \\_^!qa)<Nq   ^!o \*<̯q  ^!)<q %  ^!  )<$8 r   ^! )<,TLr K^!HA%)<r C& - ^!ӥg[)<4lr j\4Y^!\\*< s I6 = ^!bmr)<DJs C& F ^!ӥg[)<T8s j\4Y^!\\*<s @O V ^!] l )<d| t @O s ^!] l )<t!^t K^!HA%\*<!t @O z ^!] l )<("t R$_ b ^!(")<"5u K^!HA%)<,#u @O  ^!] l )<#u K^!HA%\*<D$v @LO^!p)<$Yv K^!HA%\*<\%v K^!HA%)<%v   ^!Y#Y )<&3w *"^!\*<'xw icr^!{)<C#'w icr^!{)<C# (x @O  ^!] l )<(Yx @O  ^!] l )<4)x R$_ b ^!(")<)x *"^!\*<@*9y R$_ b ^!(")<*y R$_ b ^!(")<@+y K^!HA%)<+z   ^!'  \*< ,[z @LO^!p)<t-z K^!HA%)<-z K^!HA%)<|.5{ icr^!{)<C#.{ icr^!{)<C#t/{ @O  ^!] l )<0| @O  ^!] l )<0j| R$_ b ^!(")<1| @O  ^!] l )<1| *"^!\*<<2F} R$_ b ^!(")<2} K^!HA%)<@3}   ^!'  \*<L\4.~ R$_ b ^!(")<4z~ @LO^!p)<p5~ K^!HA%)<5 K^!HA%)<x6c icr^!{)<C#6 icr^!{)<C#p7 R$_ b ^!(")<7Q @O 9 ^!] l )<8 VB I ^!VVh*<q9 @O R ^!] l )<$9F @O [ ^!] l )<48: @O d ^!] l )<D:ށ *"^!\*<X;* R$_ b ^!(")<;s R$_ b ^!(")<X< K^!HA%)<< @O m ^!] l )<Tp=^  v ^!'  \*<> @O  ^!] l )<d ? @LO^!p)<?; K^!HA%)<8@ K^!HA%)<@ӄ icr^!{)<C#8A$ icr^!{)<C#Aq @O  ^!] l )<tHBą @O  ^!] l )<B @O  ^!] l )<pCg R$_ b ^!(")<C (   !\   y<$+$E: @ #*!xf}@|D$+PH‡ 0X!#Vu8tApINQ  !|dyYP *!<),Q D!7ZoTpIUv <v!r E,E8 pI` <1DK! g6SpIc <!T|TpIe? $!Q|@̰5m *!<)n؊ (!1@|`pIy (=\!Z4S0\LtpId CS!|*<q- F!bH*<q@l !,#` N! \@< O}x݌ Yfs!)Xpi} !#)/, ,D ~  !I~<)x : K Z !0 z  ))`ԕ# : K  != z  ))`#    !JeN )<C1 h  !Yt+<#Du 0% !ZH!V *<$#ȿ "n![#,#ؿE   !!!_$!))Ȋ# +!\,@!!nZ!i!))`#Ǐ p!!!!!!))` #J p!!!!!!))`4#0 0%!!H!V*<# !""!"-"2"*<45 9"i""!"#9#44D4 0M h###!A###)dq@ |$!$($!]@$O$V$;@6DL 6]$d$!d,,Tt r$$$!hZ$$h{t{,d0͓ =i$$!x,,t %%%!3%>%^N@ I%V%e%!&%%%DHӔ l%%%!f{&&&Ė% 6 ''!h,,lf '!'!7'.<<  H'K'!U'l'LD3 Ӓ q'~''!:')< $D '!xV<a \''!P3<a&  }!",0d u'X!,,@ ''!#,` L'''!!'m( ļrD4 1((!o\(h*< (((!b ))() \<QM ,K)N)![+\)Ds ?w c)f)!Ta\*<Cd t)))!H2*B*O*t`; hF 8***!8X+h+w+ < 17 +++!y+,`pܙ ,,:,!t,,,\\LQԚ 8,,,!--.-ؼ-17p ,=-O-Z-!v--zsf ---!--C {--!|.=-,p# --!}.<)C (.&.*.!N.u.T4{i} + ~..!:..h*< ǜ 8...!./z17 ,/#/*/!6/=/DsQ VD/K/!tW/^/4DC e/p/!://4D$Cϝ ,///!L//DTslO 8/0-0!f000d4O17Ǟ 00! 0x)<  00!00+<Ć 40 11!lG1P1Ḏv: 8a111! 111t440-N7  v`(1!4\1*<\7 <12 2!92Ds TY22!>&2]D) QE-202!DY#b +<K v`(82!Q\1*<\0$ <12@2!V2D ^ TH2S2V2![`2]D)@! (g2t2x2!i22zi}D$֢ + ~.2!:..h*< % 8222!73B3z17'\ ,/#/W3!|6/=/D$s( VD/c3!xtW/^/4D4C) o3v3!(Z34DDC* ,333!33z؁Ts0+R 8333!344{< 17, |)444!S L4+<x- 4 [4b4!z444Rv. <444!4 5544P-D 1* (.&.5!N.u.T4{i}3n B5!h*<X4 8s_ H5K5!M\{<175 ,1Q5T5!E{<s5L Y0Z5]5!{Ǜ*<CP6 wc5r5!554 4Ch7 ,555!6 6{hp-s9R 8/6N6i6!666{X`D17p< (66!B' 73 4d4=O 7767!n77HbTX]> 8777!',8=8 <AŨ <Z8y88!<88 9pZLZXE  0 $939!RQ9X9tZT-@xF> g9p99!_099P5\5\TH} <99:!j7[:n:4K T:::!: ;;l77-)N ';4;7;!y G;=\5K,PA )N;];!.;;P5\5t\Q~ <;;;!,J << DT T-<K<W<!<<<l77-)W (g2t2<!<2zi}Z? =!h*<Z 8"=.=1=!:< {<17[ϫ ,1Q57=!E{<s\ Y0Z5==!{Ǜ*<C\_ C=L=a=!`==HbTd]l^ 8===!  #>0>`Ѭ @G>f>y>!>>>0Z̲Ysd P ??!2Ǣ>?4 4tCdH ,I?V?a?!;"??4Pshf 8???!I@@"@$5`Ԙ17hŭ =@J@U@!W< o@x@M\5g#,j % @@!I*<Cj* ,O@!G{<sTk^ 8@@@! @@@4D17l  AA!@A*<C@mˮ ,A+A!J=A{<sDn . BAIA!]UA*<Cn: ,ycc\A!d\{<stoq 8hAyAA!lAAA4D17lq FAA!B*<Cq , B!/BD 4sr 84B_BB!^CCC 17x 0CC!D*<4Cyϰ ,DD$D!0TD[D4Ps{ bDkDxD! DDD*<-\|E <DDD!DDDTD,~~ TD EE!OEnEsE<.) EEE!7EEEP5\50.\ȁ <EFF!A4FCFRF $2 T_FFF!L1GdGsG )q GGG!GH HP5\5L\ <%H7H\H!HHHdd cII! I/I4I*<P.\Џ. <^AIJI!]IlIsITD4g T|III!III<D) III! J/J8JP5\5p.\pݳ <IJUJ^J!JJJ T TJJJ!HKsKK.)Z KKK!*KKLP5\5\ <L)LFL!9LLLd *LL!UL*<dC ,yccL![\M{<s䡀H 8M&M!c6MMM4D17@~ cRMYM!iM*<tC ,pM`}M!oM{<sĤ A MM!M*<C0( ,޻M!tҿ{<s` 8Msv M!MN4D17ԧ LNN!4N*<ChѶ ,[);N!+QND 4sh 8VNNN!7OlO|O 17$ OO!*O*<ęCķ ,OOO!7h: PP4Ps !P*P7P!PJP]PbP*<.\8< <oPxPP!UPPPTDv T|IIP!\III<)$ PPP!zQ/Q8QP5\5.\ <IQUQ^Q!QQQ 0- TJJQ!HKsKK.)m R)R Tmn#n! nnnL)T nno!E @oSo\oP5\5\xV <uooo!T pp-pdtZ *LPp!p L*<CZ= ,\p!v  v{<s[s 8{b"hp!~ bb4D17,] _ bp! b*<C] ,bp! {<s^ A Mp! M*<C,_W ,y *p! ̯c{<s` 8$c p! ac~c4D17a LNp! 4N*<Cb ,c`q! ocD 4sc> 8qGqVq! rww4P sǁm \_v!T#,\ ȁ <z!Yǂڂ4O3Ɂ T !`8SX<4)dˁ 7w Og!tӥ+*<\ˁW <q~!{܃404΁ T=`!Ƅ̶)ҁ zz#! z*<P4\Ӂ <=Ol!ԅdp4ց^ !+<Cց , !`NS{< s$؁ 88^i!{< 17Lف !*<CفA ,!{< s4ہ  !+<CLہ ,#! Y^{< s܁ 8iz!Ƈˇ4D 17ށ/ DRև!7*<Cށj ,އ!>r(=BD 4 s 8Q{!H'\i({17 dw!tw*<4C& ,lj!~^  4P si \_7!#,\ <;DY!TD4 TˊΊ݊! <4)  7w O!ӥ+*<\_ <%2K!Ƌ 4 Tߋ! ) zzӌ! z*<5\* <!vd05r !+<C, , !`NS{< s 8!{< 17 (!3*<CQ ,2!={<$ s n!P+<C ,r!V Y^{<4 s< 8iz!^Ƈˇ4DD 17(; DR̎!w*<CLu ,އԎ!~r(=BD 4T s 8B_!%2({L17 dwQ!w*<P5C . ,i!^  4Pd s< p \_!#,\P <;D!TDp5H TˊΊ! <5) # 7w O!ӥ+*<\4b <%2(!Ƌ 5 Tߋ!)d zz!, z*<5\`* <!7vd5q ]!O+<C , a!U`NS{<t s 88^!]{< 17D ǒ!sْ4D CL , !}M\cD6s r!+<C ,v! Y^{< sT 8ȓ! 4D 17D"2 DR!*<Ch"k ,އ!!r(=BD 4 s$$ 8Be!%2({̷17)$ dw!w*<06C<*c , %!^ {4P sX, \_!#,\l, <;D!TDP6d. TCݕ! <p6)/T 7w O*!4ӥ+*<\L0 <%24!;Ƌ 6(3 Tߋ!F )|7 zz!l z*<6\x8W < !wvd6; A ip!*<6C< ,!C—4|O s= 8͗ޗ!4D17>> ,$/!v0 KT<{h s@ 8_t!5O17HB _ !Ϙ*<7CB ,ژ! 4|O s`D9 ,/:!{ Xa<{h s\F  ls! *<07CF ,! ř4|O$ s8H 8ЙR!5O17I+ ,'7B!2^g<{h4 sKp 8rg!=ƚ5O17M Ϛ֚!Y*<P7CtN , !b>E4OD sP* 8T e!ly5O17Rf ,!{ {̱T sT 8E !%H({17\V TSZ!B'lq*<p7\ W. <|!td Xi TΜל! <7) Z <-8!^ P] t (\ Th}!ɝP\57)]4 ҝ۝!`P5\57\h_r <'6!* `qt(] a T!ڞ(xP7)c A i!*<8Cd& ,!C—4|O sle[ 8'!"?\({17Lg ,ew!70<{h s(i 8ǟ!Bߟ({17`k _ ![Ϙ*<08CkM ,ژ!e 4|O sxm 85t F!q^{({17Lo ,!܊ ˠ<{h sXq 8֠#! ({17sS Ϛ)!*<P8Ct , E!>E4O su 8k!({178x ,ġ֡!܊{̱ sDzF 848!Ps({17} |!Ƣ͢*<L\~ < !:JWP{$X Tt!ȣѣdlSp8)$: ڣ!?NYV4R\w <x!& t<]T䈂 T.CL!1u8) ,ȥ!GZ8i}D2 Ȧ!P:Цצ3 4  t 8ަ !;TJ]d{̸ܱ17h ,Iv}!8e 4 sP !5:צ4 4 C: ާ!\Mq{@K M]P D!s2)$  *8 D[!(*8 * D+W!MjȽ"E 8ҭ!".?x{DԷx 8_rv!(<P܋L ծ!*)4k q8‚ '!E{Z< qĂ1 ̲!^5[( QȂc  _!m/F{ Q͂ !|ֶ`]pdL QӂL%2!2¹ (P9 rD@R T]`!vDMqp !Y#,,q "!i\|#,Q?"!f\p#,x8"!c\0,17(,!%AD*,xi}#!`6O- !5,<i}7!YE 4 i}PG !{@R3ID 5>S!|,)`-KZ!(ZL.<-K!̯;DD 3dL*u!)<LN*u!)<L -!,M343O !  '8M6`- QZ>!(ZL.<-Q\F!̯;DT 3hR*uX!)<R*u\!)<R  `i!,M3Ԋ3Ue 8AV!w8M6`$-(WZ!(ZL.<-W!̯;Dd 3X4*u!)<Xs*u!)<X !et},M3t3[ !  '8M6`ċ-D]? Z!(ZL.<-] !̯;Dt 3^ *u!)<^ *u!)<^L  /!,M33b  8A!w8M6`d-c Z!(ZL.<-d !̯;D 3dd *u!)<e *u!)<4e  'J!,M33g,  ! %8M6`-tis Z<!(ZL.<-i D!̯;D 3j *uV!)<jB *uZ!)<(k  ^g!&,M3T3m  8A!,w8M6`-0oZ&!/(ZL.<-oY.!3̯;D 3p*u@!6)<p*uD!7)<p# HQx!>,M3=3Psi !D>K{Z` -$uZ\!M(ZL.<-ud!Q̯;D 3v;*uv!T)<v{*uz!U)<v ~!\8C{@R 3z z!e8M6`|=-|FZ!h(ZL.<-| !l̯;D 3`}*u!o)<}*u"!p)<}O&/6!wH]f{Q i}x m!,M33P !8M6`D-Z0!(ZL.<-4U8!̯;D 3*uJ!)<<*uN!)<h Re!"2E\ 3Љ# !*Ba$5H -jF!Ȋ -N!̯;D 3`|bm!y)<89X!)<ܘ{! ,i}<  !:S`<LL3@5 }!&8MD8-dy !.*1;D-<G!6̯;D$3|fXa!:n(6DM9?!>(6DM$~ 2!G\u~,M`9̹3 !Nl-<-l !RF;D4-S<!Z̯;DD3lHN !^E)<(X!b)<̬$1N!kr()< YG!qh*<qh#!tPM3!w\l-!ze73Tಃ%(!043q䳃Vug 9!{F)<`?H]!)<09 Y0!{ )<d0^! $i}七 )F!q,M`9L3 !%l-<-XX!)F;Dt-|!1̯;D3X!5Y# )<X!9)<Y"1!CbHI)<P9,X_!FB'mt;D-${~!K8MD-$ƒ $* !SF{QHÃE!XB';D- ă$!\ \M3p9-|Ń /N!g؃q ȃug!q{F)<ȃ> ?!t)<9Ƀ}  Y0!(!w{ )<Xʃr 47!F,<yʃ MD !(+<yʃ aYPS!,XƸ+<yX˃!4gp{!;w<Cx̃F!8!X4P0[P[ 7ڃ!<9!D,`*߃7 W  !,,9߃w ##!,,߃ #&!,,<"!)0!!"A2"D*<3y"FWj!.*<̺M"!;at}: 4$ MXM#0!dw<yl#, $U!q{H #&=!q|*P9$!$,!TLq]j$%!KV36`4qh$ R!)<$or!\)<(!%o!_)<`%i!b*)`C#%!e̯,<9-%(+!h;BP*<$-l/&M\!k+D*)`ԏC#lz& p!n{)<&!|'0 P454 ' @!,,@,\'6DK!~,,D' Y\!)<' `!)<F(dv!bdh8~(!- 5 (FSZ!FrdTqD( B"!N)<`?) !Xx)<) ![)<)\!^)<* !a)<[* D!dY73d * !uuD5T5`t *!=]]+Tax!DT0$t_+ &!=hx @+!p[P +Qf!Kp, *,,u[!!#,:*u,u[< !(AHhM@6i}H76OV!,,8I8b}!6B|{  i}aK8!C 8?Dti}c8*!HYd{|qd8$o}!'kk@ r9!:9VaPfQP:tW9s ps!v:yt*)`3Bu9,!`x90!;L]{`8{:d!]]]D:!)*#: !Skn)*#:6 !)<# ;%!$!͝)<#0S; .;^! |YĐ5;v!!q+<5;!I +<p:5<%x !!:Y1+)`5Z<<Id!b+*5<v!! q+<5 <M!p#,0=E!#,-V@V=!\+<-V=$!-<-VX=$!\ *<(>$!"\ *<-VP>$!%\ *<-VȎ>!!(\ *<-V>\3C'!+p#,5?M+!.p#,b}^?iR/>!1]*<54?\3C5!7np#,5H?ssz!:bgmg? +<5 !s[X+<'(*@!'BG`,<= 9A )!$:   `b ~A0C F !X|<A0JJ a !\$ 4LA0   !`  5P)B0   !i  0 Ƚ4fB02Q ` !t<  5LX:B0   !  5xP$B   !h z  dtd QC   !2 H ] ]]=Q`QC   !  p@ 4QC n  !  YPQC   ! YOQC ! *<Q+D P !*<Q԰dD d !/b p@ 4Q|D #vlB!IZp@ 4QD _!$*<QE P d!(*<Qز@E dm!//b p@ 4QwE |!7 p@ 4QE !=*<QĴE P !A*<Q䴄 F d!H/b p@ 4QXF |!P p@ 4QF P !V*<QضF *u!Z*<QG V!a1p@ 4Q7G |!i p@ 4QคpG P !o*<QG *u!s*<Q,G V!z1p@ 4QܹH |! p@ 4QRH !*<Q H ':C!!;Vp@DQH d-!/b p@ 4Q<H |=! p@ 4Qh8I P E!*<QnI 57KN!Fp@DQI VZ!1p@ 4QľI |j! p@ 4QJ 8ru!$8*<QlSJ y ޾}!*<QJ w!p@ 4QJ  !p@ 4QÄK  !7C3<^N4 ń8K0G`p!LDTȄyK6!N,,TȄKLG!Kn\Ķ h C#`ل L ! B\5dۄHL @?  !2,3)<tۄL  x!)<ۄL` :=!Q`gh*<q܄Mr!q߄EMu!#,߄Mu! #,߄M! ,<߄M%!̯@+<P6N% !̯@+<PxtNL$+!)H}ܽ:rD O!46 4OD!6}>0 DD(APL!t#+ ^D:rDpP7@K!g~4 4PA !\*<7Q!~H*<Q !x\*<QD'!tD&R%8O![:qeR!0CT~{;C# R  g! (U3DC# Ro! Z5C# S!/AD[SI[f!-f5,C#S!;T̻C#S,?^!ͨ = $T !)<qT Gg!H)<@T !O[,lC#!U,!dD$=U!7&-))%U"47!4\#,h&U"4<!1\|#,'V"4A!.\|#,'IV6FI!+bgN|#,@(V"4S!(\",(VlXfv!@ D|xۅ2 W6F* !bgN#,`3KW{0 3 !.9 #,3W> K  !|>!J!]!5`́ :W!!!!th"t""8?X"""!i%m#z#ttDOX###!`( <$G$0в<>HXt$$$!V$%/%0вKXd\%i%q%!%%%[$ۅQ Y6F%!bgN#,dRIY%%&!O`&i&V(|TY&&&!; ''` WY+'<'O'!v0 ''VjLYZ'''!y ''4p6Ԟ[EZ( ( (!ɬJ()<[Zd_(l(|(!((([ۅ,bZ6F )!bgN#,bZ))))!YF)M)7 40;c>[`)l))!O))`̼f~[**'*!v0 S*\*Vj th[''q*!y ''4p64i[( (*!ɬJ()<Lj>\d***!+E+U+[4ۅpz\6F^+!ObgN#,0q\d+q++!>+ ,,xt\;,L,a,!/ ,,7 48w@]'',!+y ''4p6dx],-v-!1.B.V.,pl }]d...!./+/*Dۅ ^6F3/!bgN#,D^{0 9/!.9 #,^?/K/n/!D//V(|̽^/00!; a0r0` D _000!15007 4P;tP_''0!y ''4p6Ќ_001!] Z1c1NnL_P|111!111$8p;|D `1282!֦2245`ܖJ`223!xS3Z34 4`q334!45 5*< g#` Y'o5x5!.5)<;0` Y'o55!.5)<;9a 55!r$5)<;\va 555!Y57\5Pa 555!I66)<;a6$676!EU6\685 4ğģDbe!s6|6!(HA%6\*<<Hb666!, 7717 qbG7T7c7!B< 77Ї$C# c 777!K`77̾C#`Ic8"818!TT8a8xTC#cv888!]j88xc8"88!fT8a8xC#d899!o =9D9l4 4C#tFd[9f9}9!x99>C#Hd: ::!c=:D:46 4,d: :[:!c|:D:: 4D3e::!c)<T(e D::!.)<dL%f D::!.)<tplf g ::!;:)<Եf :::!:(6 4超f z< ::!b;;7 40<pLgHE;";!Wx=;85 4P<gN;U;!c\*<g_;q;;! <!<4< hq86h_<l<<!<<<Ї C#l|h <<<!*=9=H=dC#ha=n==!===xLC# i===!&>5>B>pPia=n=W>!===x̿C#i>>>!>>>l4 4p<C# Åi>>?!A?Q?f?C#|Ņ2j>u??!???46 4t0ƅj>u??!?Ï ?: 43ƅj@@! %@)<<Dž .@1@!z,, DžSe4@!>)<8Dž <7@:@!D{)<Džڗ sD@G@!MbgZ*<@,ȅkM@T@!S`@e@*<<@ȅQkui&!X\*<ȅkui !Y\*<ȅkuin@!Z\*<ȅkuil![\*<Ʌ2luir@!\\*<Ʌlluiv@!]\*<$Ʌlui !^\*<4Ʌluiz@!_\*<DɅmui~@!`\*<TɅUmui&!a\*<dɅmui@!b\*<tɅmui@!c\*<Ʌnui@!d\*<Ʌ=nui#!e\*<Ʌxnui@!f\*<Ʌnui@!g\*<Ʌnui@!h\*<Ʌ*oui@!i\*<Ʌhoui3!j\*<Ʌoui!k\*<ʅoui@!l\*<ʅpui!m\*<$ʅSpui@!n\*<4ʅpui@!o\*<Dʅpui@!p\*<Tʅqui@!q\*<dʅHEF!bH)<bK!HkL.<: ҐHEF!bH)<bK!HkL.<:,nHEF!bH)<bK!HkL.<:8HEF!bH)<S=*"!2/<:L ~ !.\*<bK!HkL.<:`0HEF!bH)<y=*"!2.<:t ~ !.)< =*"!2.<:V ~ !.)< =*"!2.<: ~ !.)<< 8=*"!2/<: ~ ~ !.\*<X!ǕbK!HkL.<:!HEF!bH)<d"Z=*"!2.<:" ~ !.)<#=*"!2.<: $7 ~ !.)<$=*"!2.<:(%Η ~ !.)<%=*"!|r !S +<C#>Hn EE!EE36`q?fLO!ӥ-<3Bp@֥-.!4h*<qA bK!Hk+<#A_HEF!bH)<B=*"!X+<B ~ !.Ա D*<C#0CB jEF!\ F)<=C *"!)<lDԧ % ! )<E FF%F!̯ .F)*E] ' !D*<C#F ' !0)<DG;O!5F*<C#H&IF!bm\*<HmR$_ b !(")<C#I ={ :FAF!B'JF)*$I% !Ƹ)<J7;O!5F*<C#LK{ ' !0)<K;O!5F*<C#LIF!QFm\*<LMI ={ :F`F!B'JF)*4Nicr!{\*<qNԫv!:)<(O;O!.<OVicr!{\*<3pP ' !0)<Qެ7Ù!E]*<C#Q% { iFrF!I~F)<0=Rm *"!)<S7Ù!E]h*<qS7Ù!E]h*<qT0 K!HA%)<Um K!HA%)<U,!FM'm<`VLO!ӥ+<=V.0F/!۹ RW4|<8WsLO!ӥ)<sM3P"\*<@;PDP"XPqP4 4(+ \D xP"x\*<t*#"",ù ~PP"PP~hWP"Pt*)\_0E>P"\*<P")<ė;PP"XPqP4 4< \D P"x\*<P"",(ֻ ~PP"PP~h<&QEQ"Y#Qt*)䚆t  Q"\*<Ƽ0E>%Q"\*<X-Q")<d0E>5Q"\*<  =Q"\*<;PEQ"%XPqP4 4ܜO \D YQ".x\*<H_Q"2",X ~PcQ"4PP~hlEQEyQ"AY#Qt*)0E>Q"E\*<T;PQ"XXPqP4 4<2 \D Q"ax\*<~Q"e", ~PQ"gPP~h̡"QEQ"tY#Qt*)tr  Q"x\*<0E>Q"\*<袆0E>Q"\*<(j  Q"\*<\;PQ"XPqP4 4D \D Q"x\*<VQ"", ~PQ"PP~hԥQER"Y#Qt*)|V0E>R"\*<;P#R"XPqP4 4 \D 7R"x\*<Q=R"",  ~PAR"PP~h4n WR"SOt*)ԩ`  ]R"\*<  eR")<<4UmR"{R)<l pR"R)< RR"VRYR",P=<FR"wY,,䫆^RRR"x:SSS,o\S"WSS,,  SSS"SGS)<_ TT"Y#D T\*<(!T(T"̯1T:T8\5K"HA%)<U v"\*<$ ATJTUT"dT|DwT)<س~TT"F ,,h,(T" 15T&[p 8A$ T"]e6 `S[TTT"WUcUoUNlSp=л UUV"V%WVW T: i}ƆHWWW"'WWWRtoȆ(W"Wd+<Ɇ({X" Id+<Dʆ( X(XCX")tXXXdt4 ͆XgX":X<3EΆ(u"M(#,ΆXXY".aYjYVnd3`ц^(}YY"0YGDd҆YYY">zZZZ'x܋؆ ˭ZZ"VZZ,,qن6 ˭ZZ"SZZ,,qچ<[=[X["yS[[$p$>p<ކ([["[\G?`߆\0\D\"8]a]]40T\?3 8j]"e6 `S[h] ]"$^3^1#;B^U^a^"2^^^H=~ r "S*<qx r "S*<q ^^^"^^_T'` _U""_*<q  r "S*<q__"#_,, 6_@_L_"sC__*)Lq,G _"^_,,s #`R1,`"|```t5 4q`]c`"DaYa|`P}=da#,,4 ia#I,,qT: ma#J,,qlV WZqa#Kua,,qr 0E>|a#La,,q a#M,,q0 . 1 a#Na,,q pa#Oa,,q *~a#Pa,,q\ aa##͝#,$ Fa#-aa,,qA\_a#B)<`\_a#G)<~Y' a#K.\*<<a&a#R bb: 43 &b /b#Zgbxb)<t(b#t2r 76`(b[b#xb36`\r b#b)<41#PbQGb#G ccD*<D+5 l(c#2r 76`l ';&#c#y /c36` *"8c#Hc)<T1#TSc\c#ecc4Dd+5(c#2r 76`Luxc#p#,\7 c#c)<t1#;/c#ccD*<+5Z cd d#.̯dd#,x%da>d#j ^d`))8edSnd#{jdd)<q ddd#peee@ef f#fff ^ 3p Lfff#ggg@R@|`T'gg#_NhTh.<8+\hjhnh#iij4^H^?`6j}~(j#cjvj}jH7<9=q83jjj#Tjk)<qp;K k k+k# % # )<`? % #*<@ - k# ǥ 856`@. kkk#Ik)<>qAM % # )<Bm % #*<8C - l# ǥ 856`(D lll#cn5l)<0>q E K#HA%)<E % #*<4F - Fl# ǥ 856`$G4Olelvl#lllHP]`P>1#lJEllm#'mmymm3Ommm#=nnnL 3 [<k&o#sbcp&p)p#;:pMp,)`d LRpcpzp#%ppp^^>+xe6pE #',,fppp#2+ q; 4qg4q$q(q#CFqYq `Xi3fqqq#Tq rhm$nrTrxr#mrs,s4@/s6p}e#,,$tt Ps ]s#gszs\*<`usss#.x)<qusss#es36`qv?sss#) t1t aG!Cr5#I{5,,Erb#B{5,, uv v#bEvbvkv^SDuvrv#Evbvkv^STL4\vvv#Hw%w>wKp~d=}FwJw#U{5,,<NwQw#({)< Wwdwmw#%ww^Nto~w#si9h*<\~w#usi9h*<Č FCu#w*<qȍY DDR*<썇,ww#Gw)<g#wc w#ex;xBx=334MxZxqx#uxxx3DĢɁyyy#MyaynyI\5ėvyyy#Qzazkz>\5> 3uxG#",$D\_z#)<8z#z)< ozzz#W{f{u{pO|O>3P%R {#L {OO3{{{#{||4D>qL 0|9|D|#< p|w|5 45|||}#E|+<L PK y#2ʁ= 43зnс+ځ#T\ *<3 f #[J Y )+|#`>M)<t\o{#q':O>3俇[r#*<qPB˃ԃ# 27,,$‡eT]d# ;V.Fo#,ÇT]v#;V.Fo#,ÇT]#;V.Fo#,ÇI S#j*<qŇrs #,#`HƇ$ф#=#>K\4T3ȇ$fo#NÅ΅d?Eʇ- D #Yx)<ʇp D #]x)<Xˇ ;O#a l,<7ˇ ;O#e l,<7̇M ;O#i l,<7͇#oh*<q͇#sh*<q͇8'#w9[J8 40?·Wiv# dܕHg#҇ 2E#*čԍ}$Շ[ ч#9)} ׇ~4;#.Dx)<ׇ IKR#ӥ)<$D؇3~4[#.Dx)<4؇z IKd#ӥ)<Dhه((/#2T0_<2ڇ $WW#IY T<3ڇS$mt#}<_t*T ۇ w #l,t*d7܇$mƈ#}<_t*t x݇5 w ψ#l,t*7\އ$m؈#}<_t* <߇ w #l,t*7 $((/#2RWH_<i$WW#IT_<E/$׌tLH$@34g#, a {$D:,,qHr {'$Y'03 4g#d*~5$d)<R9 CJ$\[)</&/$2\*<Prbkv$C85 4( $2r 76`#\  $#,xL Ċ $< ׊853  $.axDT< Nj $1Ld eP?wuc $U;Vu,,Pcc $THc,, njˌ $Y@L8pC#q!$ $r@ P^<7V IP $t(ݣ,,x"Zos $*dtp?cc] $Hc,,Yuc $;Vu,,T$ay| $ȓ3|$Žӎ܎ $ @6?E@ZW $WoW,,?P (9< $ZoI ucz $;Vu,,T e g~ $8@6? W $WoW,,?P  tُ̏ $@@6@7H qW# $WoW,,0@P  tُ̏3 $@@6P@7|.WLk $WoW,,p@P$ tُ̏I $@@6@7W_ $WoW,,@PXWTo| $ʐِ@Iquc $;Vu,,T8To| $ʐِ@Iqnuc< $;Vu,,T@Q^ $ `_U+D*W $ WoW,,AP+c $8Hs p#,p Ñ $O. #,. - ɑ $ ǥ 856`БڑI$ERD0CȊ0A5cI$6l}5Dql I$NB8 &ctI$TU͓ԓ*<i}8( /I$Ksqd,2I$ ̔x\xPq.VI$6OX0iPAq0sH gI$2EqC6`Ep1xI$@ϴC5`-2 XI$Ly$ϙL? Q 09 3OW\I$ {5,,O`q|I$@$qHQ6˚ҚI$,,4QI$w{5,,dR4܈I$ct D78Sf I$1&~~ 9)<DT@IbI$A PP? VڛI$T *<TqW$&9I$eϜ\dEaE\f2fߜI$zӥ,,]PuI$n;Vu,,| ]0I$Z`#aI$P!_!d!p+`)HpAFc / I$S6h*<g#c /T I$ S6h*<g#TdPɝٝI$.7b^t+3f|6˚GI$,,g$UfuI$ P^+h6˚ĞI$,,pi$,ҞߞI$294<A+jO6˚NI$,,Tk \irI$ϴ46 4A|l ͟I$Ӡ  B-y2fRI$ӥ,, ,z 2fVI$ӥ,, z[ ZI$ {5,,<{ u^I$;Vu,,{ bnuI$D7| I$$ɡԡfQ`P`~V ߡI$)ɡԡfQ`P  I$.4GL)<A4 WcjI$/a xY u7 I$;Vu,,% cKI$H #,M I$:i$gLkpjSoxp r$upjSol ͣУ$֣pjSo䎈 $Nm!fv ~$֤ߤ!T@ L$J<z H $S8OLQ`< Z~$iץĈ`vl  $2S!`Pv)\$+B v<Tlq$!]vP٧ާ$$ op<d?]b$6!"vXvŨ٨$=(Qn D$`|$}$HȋvL"Ωҩ$X( #$<C'L"Ωة$b( #$<C`Lީ$p $<Cй $$x8Mh`PvĻHV$Gc$TmLQDC#$[ɪfDQ4IC#̾76wF$],,Dlr.8$kfHTC#pĈ6$v,,dň̫$<,)`tC#Lj 4I$uP^+C#$ɈE6$,,Ɉz @ɬެ$ 8<+ˈ6/$,,ˈ@;f$+ & oӈ <;$o H ̱ c<7c&jQ$Hc,,`p̰'$ʱDjL f} $ {5,,t $'$@Y3\*)hD:} L$N$C#m ̲$c85\5A<$t>MXWhf`8c|$80d <dz$\6TiHd Es$$K($88Wei$Qt`E\4͵е$4x9C,'+$]x`t L$ʶݶ*<< $  ,<X %=E$ie`Pv$$v·۷`PvS "L$ʸ>\v,dc$xf< @ǹ̹$L,"π!H$a&`QDԢ<#Xx/3$x'?tQDgX$JHTX$dCQ8% 8$t{*<q &(Տ R$sg<& $.j\*U'.]c$*UC#(fP% $aD<D) 'c$p\*U*ʺ]c$*C#+ ֺ $-\*d+= $!- j0- \*d,y $!- j0- \*d- $$5שD\*d$.O[d$ql4Q4C#/5 r$n*<qt1a i$ *<q|3 !%*<q6 8$t{*<q6 %w{'$'*<q8f r $Si*<q8 r $S*<qD9 ɳY#*<9! ɳY#*<:Kƻͻ"&2,)L<i`,rϼ"&K׽sľX h_, vR !W"&DD v\] <EH"&0nD`4q8_y"& ;v8eRf"&'W|RD `o;O"&vH`(3wt8Y"&mp 3섉 E_{"&C%B ? q6"&,,DLX&@"&c`d ( vآ u#"&)<g#袉 }"& ")<q '# 0"&FM)<BqХN!`q"&rrIMx~!"&{5,,@ !##"&)<# !P"&# `|@C":ռC"&Ut,,qI" Nm /"&28*<qtz"y"&tdT\" "&\*ddH"K"&HA%)<̴##"&xNU4 4䶉<# x"&)<t4j#=*""&2*<## ~ "&.\*<P# *""&)<ܹ# ɳY#*<$ ɳY#*<,C$<&Y,,ta$ &4r$ ,MT&.r(w|#,$ ;I &H.#,<$&A XXLD$ĉ>%&/6&\Bx)<qĉv%I&)<ĉ% M(&0Vl(  qHԉ& &uIm*׉[& v&\*<؉& &G\*<\ى& *"&\*<ى&&,,ډ5'&)Jq~DxIt݉'&q80BZ@|' Z)&g+"4\5|($)5&r\qzl9(8.%n( &%#,(##&& ,,(##A& ,,q) u# & ,,6)##& ,,(i)&/5,,@ 8)x&dPBl* !&y|+<}7* a&   ; 43*;I &). |#,*,&1k<}*(&C,Hn<}P+ !&16\*<@+(&t p .*,  &ӥ,,x/J,$Yb9& slD#,/j,$Y|& slD#,H0,$Ys&slD#,0,$Y &slD#,1,$Y_D&slD#,1,$Y&slD#,1 -$Y&slD#,P2*-$Y&slD#,2J-$Y &slD#, 3k-$Y|&slD#,3-$Y#&slD#,3-$Y&&slD#,X4-$Y)&slD#,4-$Y,&slD#,(5.$Y%&slD#,51.$Y/&slD#,5R.$Y2&slD#,`6s.$Y&slD#,6.$Y&slD#,07.$YRu&slD#,7.$Y *& slD#,8.$Y&!slD#,h8/$Y&"slD#,89/$Y&#slD#,89Z/$Y~A&$slD#,9{/$Y&%slD#,:/$Y&&slD#,p:/$Y&'slD#,:/$Y5&(slD#,@;/$Y8&)slD#,; 0$Y;&*slD#,<A0$Y>&+slD#,x<b0$YA&,slD#,<0$Y!9&-slD#,H=0$YD&.slD#,=0$Y &/slD#,>0$YG&0slD#,>1$YJ&1slD#,>(1$YM&2slD#,P?I1$YP&3slD#,?j1$YS&4slD#, @1$YV&5slD#,@1$YY&6slD#,@1$Y\&7slD#,XA1$Y &8slD#,A2$Y_&9slD#,(B02$Yb&:slD#,BQ2$Ye&;slD#,Br2$Yh&<slD#,`C2$YH&=slD#,C2$Yk&>slD#,0D2$Y &?slD#,D2$Yn&@slD#,E3$Yr&AslD#,hE83$Yv&BslD#,EY3$Yz&CslD#,8Fz3$Y~&DslD#,F3$YO&EslD#,G3$Y&FslD#,pG3$Y&GslD#,G3$Y|&HslD#,@H4$Y&IslD#,H@4$Y&JslD#,Ia4$Y&KslD#,xI4$Y&LslD#,I4$Y&MslD#,HJ4$Y&NslD#,J4$Y&OslD#,K5$Y&PslD#,K'5$Y&QslD#,KH5$Y&RslD#,PLi5$YI&SslD#,L5$Y&TslD#, M5$Y&UslD#,M5$Y&VslD#,M5$Y&WslD#,XN6$Y&XslD#,N/6$Y&YslD#,(OP6&0n<)Up6v&G<)X6& <)b6&u<)4j6}&<)m6~&<)8r7]fi&]m<*s07 &<4\5xuR7h&m. +<C#vv7 &rp؟ z8$l&*&<KRDxC̑pB+7,|X8]a&{5,,|(8 ei&S0<H}8(o& d}x@0-<=9&L9 7&Xhq9&91@rN$39LYc&Q9DBq8 :&a܊6 443DC:,\ xx!&/>TxC̑+Er:]E&{5,,4: Y IY&Frw`2*DX:&(ݣ,,Tlؔ ;&!!Vpz;Fw& ++> xЧ; AJM&fw*<q;%w~&!+< A ;/&,x)<C#H<&6 #x)<d9< 03&=*<qi<@C&HUx)<C#୊<$pz~&SU`).̰<&bx)<C#ొ<$'+&lGhd?< o~&y(6 4Bti=&\*<= &"1\*<Է=8V+E&av463P=&3Di}캊= &)<t車(>&.bZ43g#tE>%&L)<L>";O&Z xĊ> (&w8G#, Ŋ> N[d&v)) @Ɗ> (&\R\*<Ɗ ?u'&L\*<NJ3? u' &O|#,NJZ? &Q `S`PɊ?Z&`(`D*<Ɋ?,&f<,,Ɋ? }<&k1<#,1ʊ?#&ta~8ZdBC#̊Y@& )*Ί@ 7X&,r@r {ӊ@58&H\*+Ԋ@5]&H\*+ՊA m&Hv@ԤF4ۊRA0&A.?аtފlAJ&g+ dLɁAERi&PV4x 7A&9KXBh&)7bq@ =B&BP\*<mBua &O)<g#B&Pv)<qB&Q9%hNPqXB$,?c&Xdf%TrBg5| B{& *< 3(~Ce&-=D *<3C&ph qD,9C&PWly@@D&[mQ;DqD&ux6I܋DL%)&ө3ܗ!D>K[&r&aT]+<3䘋O d[q&oӥ\*<xIO\3{&)<tO &_$TTdTO & #Z|O$МO/2&^HP|O4OJ&5 4D3 PuX&",OP4\e&:'y*<T䟋P&Y=6`d3ؠP |&%85 ?`P c&H)<Qu&",DQ/&^HP|OtoQ&5 43ऋQ &M856`Q  &1BIV|OQuX&#", R \&$)<DR `_k&&dmRx*&.5 4̪R&5+05D3ЫRu7&E",ોR ;&F\*<S ?&G)<6SZCF&H(; *<]SܘJ&IRy5D3S"c&(Z *<8Sgo&)<XSuvq&",hTz&)<)TBw&OPOT&{ #,䰋vT ! & & _ z \T   &1!"!< 4Ci}иT 9!F!J!&X(z!)<LU!!!&km!!)<p7U!" "&T",",,OU01"t""&b$$$|r: ɋV$ %A%Y%&zA&k&&rЦCg5|ыW(&'4&&&& 4tҋW$&&'&Y'p'v'[<4HՋW$'''&'( ([<HX؋W("(.(1(&Y(j(D+ng5$ڋWq(@1~(&-%(VNq\ۋX,((&9'G(T+OT܋X4(((&C/)L)U)44ߋ9X$`)Ñr)&]~))Tt*g5WX8)))&h *.*?*4H$;X,G*S*&**d+r1HX ***& ++-+46 4495+ >+&Hv*<X$D+ÑQ+&y e+l+ T<D3lY0s+++&N,n,~,\pTSY(,,,&8,;-H-rxd tvYP-b-e-&qu--+<3Y ---&|../VA Y%/2/&D/K/)<tlY R/^/m/&] //^s$q/Z// 0&>0G0<DC RZ X0a0d0&өi0)<  vZ000&1*131: 43 ZN1&/R1\*<h Z Y1f1r1&21262t++q[,B2W22&O922+4L[(393d3&_33 4g5[,344&y555D̄ \(O6q66&777U< g5'4\n8&)<V'W\(888&{o 88DCt*v\<89O9&F:%:-:3 g5<1\<{:::&fD z;;+4B &5] ;;;&<<#<3 4Dg#7s] z0<9<&Y<l<u<3 40Dg#8]$<<<&x<<T<g5H:]$<<<&< ==s<;]$(=G==&>>>   g5lF](c?p?s?&1???U<qG=^$???&9?DHLIc^(c?p??&F???U<qJ^$? @&QbZ-@DHL^(8@E@Z@&^=@@ 4q,N^$@@@&j@DHO^(@@&~U<g5pP_(A$AFA&AAArhPDg5\TA_(AAB&( nB{BpDtWb_(BBB&CCD+Pg5`_(CCC&!KpD{DDtd_(DDE&ICFZFhFrhԔg5m`(FFG&gGGG܋$tsa GG&icG<)qta,G H H&9HNH+Pqvb4WHdHgH&+$ 4Vw/b(HGH&cHX[<txPb HHH&J'J9J B 1Dwb(JJJ&J KD+Աg5Ăb8KNKsK&BLRLbL+stg50b4LLL&"(M7Mr8I Qc@bMlMpM&4MM4D&䑌cMMN&NNN,tDq\c NNN&cϴOG 47cO2OTO& OOOx@VHcO(P-P&/xPPC#"dPPP&OaPXC#䠌Fd* P&P7N,,dbd QQ'Q&KWQiQzQD D xd 6 }7&W)<d QQQ&QQ)<Hd QQ&  )<eQRR&  RKR46訌$eRRRR&!VWHWLLƌHe WYW\W&\*<ƌoe dWuWxW&:W)<Lnje dWuWW&:W)<Ȍe$WWX&XYY+jjj4sO$HX*p(jjj&OjjtD1l+pjkk&Wk&k GD1\,)q -k:kak&pkkk@Kl/Mq4klIl&lm!m@AYO5{q(Rm^mmm&mmm@s$PTEp7q0mmm&n'nr h9q00nPnbn&n"o?o?q$Yooo&E'pQp]p+SEg#Ermpypp&ppp|#)xAF,rp#qq&sss *<0 3Nnrsss&tt%t *<E3Or:tKtvt&tttCD3R ZZu&(`D*<Rr uu& 'u`S`PSr g 24u&w\*<\Tr -!8u& >uMu\*<U!s  Tu&/lXu85 4UFs |au&8үgu853hVks  pu&BlXu85 4\Ws  tu&JlXu85 4Xs xu{Mu&Suu`SS$Ys  u&]lXu85 4Ys  u&glXu85 4Zt  u&qlXu85 4X[:t uuu&|uuu`SPl\\t uuv&uuu`SP]t ;Cv&v\*<^t |%v&үgu853h^t uu+v&uuu`SP$_t  =v&lXu85 4` u  Cv&lXu85 4pa/u xu{MIv&uu`SS|bQu Ov\v`v&vvV$(etu (Lv&vv85 4euvvaw&xxxHdu louDyQy{y&# yy(X̯xsu*z7zmz&,zzz^Lsdg#wu2{<{`{&B{{| PP {D}"v?|X|c|&{v0 ||)<d1#@v (L|&vv85 4cv (L|&vv85 4xv |||&}}&}d Xv =}I}X}&~}}}xS($E<v }}}&}~~T\ |v  $~&lXu85 48w *~7~&eA~85 4 8w J~[~j~&x~~85\5E8\w ~~~&~~~r84ċ~w \ &'\*P0Ȍw .;>&.bq##`xw v&B$$@Lw 'H&@K 8Șx .̀π&h)x&jW^3DFJx ||m&}}&}d Dlx uu&uuu`SPDx ||&}}&}d ttx xu{MӁ&uu`SSx ߁& /<s0Fx MYn& Tt ̤!y ̂&#2D8LԧIy EQ`&9  PFHqy MY&YTt y  ΃&flXu85 4y ҃߃&u`p,Ltz! &3DpFȯ%z <&d  ̱Oz Ʌօ&+;NLsz gs&46?T്zÆ҆&C| (Lr&ivv85 4ʍc| (Lv&qvv85 4<ˍ| z&|xS,̍| +̉&#~Љ85 4P͍| +ى&#~Љ85 4΍| ҥ ݉&855<΍}  &lXu85 4ύ9}  &lXu85 4@Ѝ_} ;C&v\*<Ѝ} 3&1@Opҍ}V_n&ө3DFӍ} MY&Tt dhՍ} ؊&sVTX\ٍ~ ϋ݋m&WWxL \?~]fr&%P)<Ge~ ʎ&.OU#2$ ~|N&Nˏ)~֏&&3@~͡15&Pw3~1&א533͡1&,PwЊ3<<͡1&8PwЊ3e#&CGh533͡1q&QPwЊ34֏&\&3&fڑ533,&Mpj<P,,E&Lt}D;,’& Xs<0G^,=^&#Xs<PG,&3<,,0,&7Mpj<ƀ,&?̯+D ,6Kp&GĔӔܔD p,Z&Wҕj< ,&&kҕj< ,&m}j<P؁,ŗ җ&\:Xs< ,,&|j<L,͘И&Iޘj<A,&ҕj<b,ERU&1Xs<h,c&ҕj<|,ř&ҕj< "ɂ,͘*&Iޘj<H#,8EZ&0D$% ,͘&Iޘj<%0,Úޚ& DpG$'Q,"7R&0DĨ)s,Λ&'CDGX*,0k&3Xs<LP.,EZu&OȝDG0ڃ,ݝ9&_ǞD3,&wCDG@5",.&ҕj<T8C,& Xs<G:c,ڟ&9HOj<H;,du&1àʠj<0Ht=,ߠ&D xCƄ,N& Xs<PH8E,ŗ &\:Xs<F,ŗ &\:Xs<F&,ŗ &\:Xs<GF,ŗ &\:Xs<xHf,ʣͣ&Xs<I,ŗ &\:Xs<J, $&WfmXs<pH\LɅ,&'Xs<P,du&C1àʠj<HDR ,͘+&OIޘj<R1,9&W̯+DST,ŗ S&_\:Xs<Tt,ERa&g1Xs<tU,o&oDV,ʦ+&{j<\B$\ކ,&j<`,&?HD TaK,oY&Dbl,͘o&Iޘj<Hc,}&Mpj<d,ŗ &\:Xs<dև,ɪ&Xs<Hg,͘0&Iޘj<g,>&ҕj<j=,ȫ˫&Xs<(l],&!DL s,&I Xs<H|u,ܮ&UD }, #T&}Ѱذj<$,7±&Ų+4$ ,:&̯+D ',Tn&DT[Xs<BH,ִ&#29j<Hk,EZ^&ȝDI܎,&ҕj< ,ȫ&Xs<8щ,(V& Ḋ , #&5Ѱذj<TX,<׹&I\/ D`; 07,}&q̯+D$  X,Ú&y D0ITy,»ϻڻ&tD4 (,X&Ƽּ߼DT઎,»ϻ&tDD ފ,4N&j<LԮ \i&ɾҾ$F 4PI1# &IZepR|OpI1G &$FDI1l /L&$FDI1P &#,1h &$FD1Lڋ & $FD10 &;&w,<I1G &1$FD1tn &Q$FD1HÎ Ou&q7IR$FD1\ǎ &%$FD18Ȏڌ &Zlu$FD 1lˎ &$FD1X̎$ &$FDL1,ЎG M&%$FD1юl Y&$FD1Ԏ & $FD1؎ W&+$FD1َ׍ cp&6a,<T 1ێ ͘&AIb $FD1H܎C &LC&,<I1ݎf ;X\&W|$FD1ߎ &p$FD1t L&$FD 1|Ҏ -Jc&$FDJ10 /&$FD1 &$FD1,C &$FDL1f &$FD0J1  &1fx$F 41 &C$FDPJ1Ώ 1o&U,< 1 f&$FDpJ1 &%$FD15 &%$FD1W &%$FD1y &%$FD1h &$FD1 &%$FD1 &$FDJ1  "X&",$FD1) T&%$FDJ1L &7$FD1r &B$FD1 &M%$FD1| &X%$FD1X &c$FD1 C&uHfp$FDC1) '&$FD14"S $5&} Xa$FDd 1# r&$FD1L% &$FD18& &$FD1'  & %$FD1'/ & !8A$FDJ1*Q V&) $FD1+x b&4 $FD 1d/ &T $FD10 E&f $FD 1l: & $FDJ1d< E& $FDL 1E( G& $FD1dIN @& z,<d 1Qq &S $FD1Q %j&^ $FD|C1V <Yv&~ $FDK1Xܔ -J& $FD0K1p[ A& $FDL1D_" & $FD1`H  & $FD 1il /&" $FD1xm f&B m$FD< 1w & $FD1wו  & C&,<PK1Ty 3& %$FD10z ?Y&  ,<D1D}B :& %$FD1 ~e Fl& 09$FD1 \@j&qa\*< \@'&qa\*<4Ж\@n&qa\*<H\@r&qa\*<\\@v&qa\*<p@\@z&qa\*<c\@~&qa\*<\@&qa\*<\@&qa\*<З\@&qa\*<Ԃ\@&qa\*<肏\@&qa\*<<\@&qa\*<a\@&qa\*<$\@&qa\*<8\@&qa\*<LΘ\@&qa\*<`\@&qa\*<t\@&qa\*<9\@&qa\*<^\@&qa\*<\@z&qa\*<ă\@&qa\*<؃ʙ\@&qa\*<샏\@&qa\*<\@&qa\*<7\@&qa\*<(_\@&qa\*<<\@&qa\*<P\@&qa\*<dȚ\@&qa\*<x\@&qa\*<\@&qa\*<1\@&qa\*<S\@&qa\*<Ȅu\@&qa\*<܄\@&qa\*<\@&qa\*<ۛ\@&qa\*<\@&qa\*<,"\@&qa\*<@D\@&qa\*<Ti\@&qa\*<h\@&qa\*<|\@ &qa\*<ל\@&qa\*<\@&qa\*< \@&qa\*<̅D\@&qa\*<i\@&qa\*<\@&qa\*<\@&qa\*<ڝ\@"&qa\*<0\@ &qa\*<D'\@&&qa\*<XJ\@*&qa\*<ll\@F&qa\*<\@.&qa\*<\@J&qa\*<ٞ\@|&qa\*<\@&qa\*<І \@2&qa\*<䆏C\@6&qa\*<i\@:&qa\*< \@>&qa\*< \@B&qa\*<4ҟ\@F&qa\*<H\@J&qa\*<\\@N&qa\*<p=\@R&qa\*<c\@V&qa\*<\@Z&qa\*<\@&qa\*<Ϡ\@&qa\*<ԇ\@^&qa\*<臏\@b&qa\*<:\@f&qa\*<]\@j&qa\*<$\@n&qa\*<87w ry&ӥW3Dt ̈ġ7w r&ӥW3D `%x &:D*< (&3D ,Z&-(`%D*< Ld ,;&2et{rds` |l@? &:2k3D 07w &BӥW3D č&J9+w H3D͢P ]h&S|D*< t&Y9+w H3DDX%x &_:D*<! 3&e9+w H3DtV{&n.ƽ3D!u{ &w.ƽ3D$!$Z&&}(`RD*<4!Z4&(`RD*<D!$٣ZB&(`RD*<T!P[&ʌw3Dd!@7w &ӥW3Dt!ԕ<& 4 44\} 7&kz3DԪl7w &ӥW3D!%x &:D*<!ș7w &ӥW3D!\Z&(`RD*<!ܚZ&(`RD*<!\!%x &:D*<!$@P ]&|D*<!_P ]&&|D*<!~P ]:&|D*<"P ]N&|D*<"T bm&D*<$"lޥP ]& |D*<4"8P ]&|D*<D"H&D*<T"䢏>Z&$(`RD*<d"d^{ &+.ƽ3Dt"@? &12k3D"P ]@&9|D*<"t¦%x T&?:D*<"<{h&E.ƽ3D"̦ \|&O)3D"X.&U9+w H3D<UP ]&[|D*<"u&a^ D*<"{&i.ƽ3D"*&o9+w H3D4٧J&x^ D*<#`i&3Ddȭ%x &:D*<#9{&.ƽ3D$# \ b&D*<4#8|@? &2k3DD#찏%x 5&:D*<T#{I&.ƽ3Dd#Dި"X]h&rOt#x{&.ƽ3D#&^ D*<#A&c3D#b{&.ƽ3D#&&c3D#p@? >&2k3D#$ĩZ`& (`RD*<#\|n&)3D#0\|&)3D$&\|&)3D$HF{&#.ƽ3D$$غi &-Zps4$ &1ZpsD$X U-0&56:)+dͪ J6Q`&9ZpsT$ w&C=  )+P &Ga(HtƏy &O Zpsd$ȏ a #&S7 )+ɏ { X&\r7t$(ˏ { &`r7$h̏E %w&d)+͏g F&n)+Ώ .&rRipZps$xЏ F&{)+|я { &r7$ҏ4 F&)+ӏ %w&)+ԏ% %w&)+ՏW F&)+֏x  A&)+׏  A&)+؏ 3&)+ُ߭ U #&7A)+ۏ U^a&ge)+8܏$ &Zps$ޏE &57 ?ߏh >HW&Zps$ U^&ge)+P { &r7$Ѯ U-&6:)+ &+2Zps$ AD&J_)+h3 dg&)+pT U-&6:)+|t F&)+ F&)+ F&)+ԯ F&)+ U^& ge)+ F& )+7 U-&6:)+W &)+z A&!J_)+l F"&%)+p (&) Zps$@ F@&-)+D FF&1)+H' L[&5sZps%DI &9 Zps%l "%&G=)+ FX&R)+ ^jy&V(0spKױ F&Z)+ &^Z$\  F&&f)+A a ,&j7 )+a F@&s)+ %wF&w)+  U^\&ge)+L Ȳ bkn&)+  U-&6:)+  k&67$%8, %w &)+TP =)O#&?`)+q e& Zps4% %w}&)+ &)+ֳ &!Z$\ %w,&)+ U^B&ge)+8< 9uHK&k)+^ %w&)+ &)+ &  ZpsD%dô 3&)+<  F&)+@!  &)+T"( F4&")+X#I %w:&&)+t$mPS&M,,$[&&,,$ [@\*&̯"*<q% I&,J_*<q( x]c&Y*<q)' R &L f*<qL*P k>&B'm*<q+t 7. 1 &q*<qp+ Uj&U*<q|, 7. 1 &q*<q,޶ Bb&ɬt*<q- Bb&ɬt*<q.$ 7. 1 &q*<q/F Bb&ɬt*<q0i V\4Y&\&*<q0 V\4Y&\&*<q`1 7. 1 &q*<q1ӷ V\4Y&\&*<qp2 V\4Y&\&*<q 3 {% &*<q3= {% &*<qh4a LO&ӥ*<q4 aps&ө*<q<6 G!G$G&'G*<q47ʸ G!G$G&'G*<q,8 7. 1 &q*<q8 k>&B'm*<qP90 &I-*<q:R j&*<q;t k>&B'm*<q; V\4Y&\&*<q< V\4Y&\&*<q8=׹ V\4Y&\&*<q= V\4Y&\&*<q> G!G$G&'G*<q?= V\4Y&\&*<q@@^ k>&B'm*<qA r&n*<qB &I-*<qlCź V\4Y&\&*<qD V\4Y&\&*<qD  V\4Y&\&*<q|E1 r)&+*<q|FZ V\4Y&\&*<q,G} V\4Y&\&*<qG V\4Y&\&*<qHȻ Uj&U*<qI Bb&ɬt*<qJ  G!G$G&'G*<q|K- R[R&"^*<qMQ k>&B'm*<qMr 7. 1 &q*<q$N &*<q V\4Y&\&*<q[b 3#&*<qh\ V\4Y&\&*<q] Bb&ɬt*<q^˾ V\4Y&\&*<q^ r &S*<qT_ r &S*<q_A 44U&*<qL`l 44U&*<q` r &S*<qDa r &S*<qa v&\*<b F&(9\*<c1'&\*+T%DdS & <D*<dsnr &~*<qteV _ b &Dr )<eDW&Y *<C#fTV& 48*<C#4g"$WW&"S<gQ F&(9\*<thx'1&\*+d%i F&(H)<{8j & <D*<j F&(9\*<Pk'&\*+t%l0 & <D*<mP & <D*<mrnr &~*<qLnV _ b &Dr )<nDW&Y *<C#toTV& 48*<C# p$WW&"S<p< F&(9\*<Lq_'1&\*+%r F&(H)<{s & <D*<s F&(9\*<(t & <D*<t  F&(9\*<@u,DW&B-<7uW & <D*<xvw(=*"&2|s<8w ~ &.)<w(=*"&2|s<8 x ~ &.)<x(=*"&2|s<8<(`N!%(3I8`<ae!%1OtLI\P!%J7Xa4`īC#ܩ\pN}!%ZP,FN\!%e& @ O Ld0LFЯ\b   !%y  @`F`X  !%' 6 E LTȜPLOTN ]  !% g x $xC k7@>   !%K z  X(Cd   !%   4DpLC#  < !%    V( C#ŐWW !%IZ))hŐ;* !%b< x)<C#XƐ}R !%#MҬx))hC#ǐ/ !%'^  f,fh(Ȑ,  !%8@hPɐH&/!%G'GN)<%C#ʐ Utx!%UxT А }~!%r3DPqҐD<EN!%'Gbi 4%nӐJpw!%",)LԐr!%23Q\u!% ]x/M>h>l @>>!%q>?XvLn~3?@?O?!%???o l??@!%G@e@Hĝ\~@@@!%a@@pP&CC#x#@AA!%@AaAjA4 |& yAAA!%aAIp($AAA!%aAt6`I8,QDABB!%8-BTB$4J<d.]B{BB!%-BB=1BBC!%KpCCCX`g#6 CCC!%pDDg#`97_,DD2Lm {LLL!%LLL PP4'g#o(LLL!%KM\MtPr?(oMMM!%MMMXp0D'PLvv(N#N.N!%`NrNNi̗`T'2yNNN!%<NN3\5g#zcNN!%INNN*)hPN|{O(NO O!%OL "O+OdTh#|(6O?O!%Y\IOX[)hpN}WWRO[O!%^IYeO+)hNH~,ŻnOwO!%cC,OOtNYO8 OOO!%gOPPO}؃sD/PAPJP!%tPPPСN腒PPP!%S Px))hd'C#PPQ!%QQQ|C  / R !%S6h*<g#X / R !%S6h*<g#a*uR!%b< +< RR!%H!V\*<'R-R!%?RJRܗiTԭC#LD,WRaR!%RRR(U$P蓒uRRR!%RRh*<RR!%{5,, \RSS!%8SGSRShNxt'A  / R !%S6h*<g#PYSSS!%)T"T5T4-HTRT!%1(ݣ,,'l$^TTT!%TTTTĉ N)L#HTT!%[(ݣ,,'l|DU UU!%j5U>U+tfdMUnUU!%-&VVV(( L q䭒xVWW!%b^WWW  'q첒WWX!%XQYvY 0@ 7ÒIYYY!% ZIZ 3,ǒRZZ)[!%^\]],T 0  p}^^^!%X^_(_ LK8_Q_a_!%n:j__ff'C#<M0___!%v``` ,f`D K3S aa!%?aVa_aD8O(naaa!%gbccU 4p , d>dd!%Xe/fof ,q .fff!%f=,,Hy ffg!%Zpgggp D N1#P)S ah!%J?aVa_aD80O*t5hAhEh!%Kh^hff+ chhh!% ijiiPx -P5Piii!%ijj+\`H'q8$j1j5j!%\+*<q8 ?jRj^j!%zjjjPOq ;Wwjj!%%ww^N'X<5jj!%({)<<e@jj!%jj*<C#= jik!% B' kC 41#X>k(kBk!%4kkrk,*<3?nkkk!%Ekll3C\2lEll!%Xl m$mT0hE FoJPVmim~m!%)mm n,c PԙQqpO)"n/n7n!%-Rnmn~nTt0'XRnnn!%Xpqqp.  C#\l^rkrr!%r sst\(r=sVsss!%st8tĊfE xyB ^tktt!%vw-x` Z, C#~xxx!%Vyy zp= Szrzz!%Rzz{,0{:{Q{!%*{|;|$d,Į0ȲL / R !%S6h*<g#h,Q|||!%}}$~LlD 9T~!%{5,,p 9X~!%{5,,9\~i~n~!%|~~iÓd~~~!%/DƓu@0:!%-;Vu,, ƓpC\{!%E1@ʓ p5@!%4pO͓6ŀ̀!%,,'͓X|ր!%7-\k0O<ѓ@vz!%K,, ѓ6~Jy!%9,,(hғ!%Qف $3Փ  / R !%S6h*<g#8֓MP!%\p#,P֓ jik!% B' kC 41#דu! !%Y;Vu,,ד&X$5@!%fn0OXړ]6~'!%h,,(ړXׂ!%ƒ?`li T 4!%̄4$(Xc!%Hc,, a / R !%S6h*<g#|u!!%;Vu,,6~!%,,4(:  +;!%i+paC#`w / R !%S6h*<g# / R !%S6h*<g# ?!%{5,,SX!% 0O6~̀!%,,D(X)HS!%%چT( X (!%M͇ HT@?X!%;]rHd(W,wz~!%ӥ,, D!%ԈiO(\4K!%pt(ZPC6~!%,,(ɉ!%(F[P ($ 6~k!%,,( +ly!%ъ58fl܊!%!Ԣ\5l04!%*H_)`h(frv!%=i jh(hЋ!%` / j $ / R !%S6h*<g#(5BF!%ET3\5 X[g}!%njPP8 L֌!%15$<Cf \ !%4_jQ$Q0P@ \u!%4< \ɍ!% 4<PP(! $&*!%Ra_P$#1 WWjn!%IZ))h##i t}!%̯ZfP'$ !%ffh'% !%ffh'& !%ffh'(J Îώӎ!%y OTh t) !%%:EV(pP#, $˗ P"^ !%K'G \ZPE-  T]m!%DTPO}.8  Ǐ׏!%  PO}@0e  ,4!%HWd4L(1  / R !%S6h*<g#p2  ,k!%HWd4L(46  / R !%S6h*<g#4  ,!%RHWd4L(06  / R !%S6h*<g#6 !%HWd4L(`89 / R !%S6h*<g#9{ !%7HWd4L): / R !%S6h*<g#0; ʐӐ!%FHWd4L)<A / R !%S6h*<g#`= TT!%*<q\> Ù!%E*<q? /!%*<q8@1 Nm /!%28*<q@f 8!%t*<qA r !%S*<q`B!%r)$) C \*!%_.")CA'0!%ET[44)C#Ex b !%*qE&/!%2=(+<FXn\*!%z܎ t<G4Xn\*!%z܎ t<`HnXn\*!%z܎ t<(XJا,EK+Y e(kW ssAWxHs+(sxPAWLK+в;ܲ(nHbs3L+|(\*<M+s$(T 6?+)D*N,FOV(%hq7 4T* P-, O'c(\O *<qPX, *' (O *<qQ, r (S*<q(R,% (D*<3R,&/(2*<S, v(\*<T!-&/(2{D*<3TL-x(8*<d*:Uy-(Գ۳85 4t*V-=*"(2/<:lW- ~ (.\*<W-x(/<*:Y#.(Գ۳85 4* ZQ.(}i;DC#[.('K( ܴ!L<b.6$(",,*b.|1\(PصX Efi5/67(R,,*hjv/|xIt(u/VF `fr/6(w,,*s/L (=.*<(t0(Bط0Qqtvw04 -(M Yh*x0<w(bʸӸ4 4*ol{04ڸ(oϴ86`|.1D#({NW\5o}k1,r(ֹD lVD1((B'(R<14(+P #\!24Wj(/ #,U24(>+P #2 8(t{*<qĉ2 ;к׺(޺\*<*2  N (*<qx+3 wuˊL (C*<qЍZ3 SJ(15*<q35)I:*t*d3?Tg5)R_$TxP+3,3˻5)}464PQ04Z5)*9@:@6+C#$o46GN5),,$+ĕ4T[ho5):@64+3046G5),,D+З<5,ȼ5)?x  58Խ5)AS`0T+z95l5)D`> 1#Ȱ6 5)TDhW|WDM6 i5) *<q}6 $5)*<q\6P y)*Gt}TWx9Tк6y):*4oD,\307$GQXy)R|4d+F=7'y)`&Wd4$  +5ʕd7( y)$z` hdtՕ7V =Fy)(ݣ,,t+Օ7 R_~y)8$4AFF$ܕ7(Taiy)~pl+IP08,y),Adh+#W8H=Qy)yI 4+3|8j%y)I 43T8 y)Ehy+8y)6 t^pQ+#96"y)8,,+\9)6Ay)cDti},9 y)?\*<9 y)T"9FTdQqd9AOy)[c_8*+C#L:xy)e,J t4R+C#6:y)bk4t̛9HEzy)b$m )<([:y)II++5: #y)DhW|WD:9Yby) sh԰oq@;y)#O,,q;V y)@(m #,Qq;D &y)A2oA,#H+0; /H y)S6h*<g#< L[ y)U*<q6< G!G$Gy)'GZ*<qd< [@\*y)̯d@*<qh <  y)c&] *<qL < SJy)15*<q| < _~y)r(h*<q8 =oTy){j*dR4C= k>y)B'.*<q= _~y)r(h*<q= _~y)r(h*<qp$>),<, |FP>4)~b,0h~> )@ xC ̿P; E/?T,)P, lw Y9P?)7 P5\5( g#>?vRu)50<\@?),,|B?)}Lmvy|O,C#D%@Chb )`*<qDi@)5;̴,F@$)9tOC#G@@Qp))0Ȋ$,,JA )=P[y n̑4,IC#@LUArj){5,,LAn)x,)LQ8WA )) 3DI))D,X'BP\w) hȊT,ZqB ))+[B)*;B))Q\C Q)3DI))d,]OC[)h)1xX8 4^C,L )Cx_C)k$LD`C)GP5`4t,b[D .Wh)&#5#:#))`RbD})<+`0dD c)\1<#eE?)<xp C#lpE !)'?D0<,;$(nEK. u)BN1g#pE`M)Lė fqlFu);Vu,,RFy|)!18D0<,F GZj)=[[̑0R7C#葖Fr)>{5,,d GX b)Rɬ 5D,C#PoGX b!)`ɬ 5D,C#<G(9KT)nttI<GY )w xbO,3XH )85 4<QH#)%Xgt$`4q(H)p#,PH)p#,x(I K)*<qdIcr){-<g5xIV _ b )(S*<qI )ʌ0<g#Jnr )Sh*<4JJ*") 3<~J ).<8*<C#PJ0E)hP-<,g#J 0E))<,О$K ) \X1<,YKBV)e|+<-C#K)H -<-g#LK)W \*<$-衖L )M_ l/<4-;LT))B'>x)<D-C#lyL(`W' )fa<L Y1\4Y)\,<C#ȤLLO)ӥl/<\"MTV)4x)<C#]M*"))0<g#M ). h*<McK)H!VP-<g#N F)b9)<ONLO)ӥ,<5NTV)4(+<HN4=J)nHL\5PR O)LێHCp6pRC#GOLO)ӥl/<DOTV)4x)<C#ܭO% )P*<T-q8O% !)w)<d-;P)CE-<Rg#0qP |R)S ]\*<RЯPLO)ӥ2 ,3<dPTV)(p+<#Q )EbmyRRh^Q)9VaRܵQ)CE-<Sg#xQ |)S ]\*<0SR )S l2<t-CRX])f*<-C#\zRX)l2<-R)Y#**<-C#RW% ) =*Xit,G Xax=*$tba4=*%Ga,#;@=*=Zk,I<;b0z=*NWb$=*^6s8I!b(,8=*nlPSGL'2c(=* sC#)}c-2=*L]HC#+c,h=*T,\`3.d,=*7T,P3T0Ad "&=*N431~d$tBF=*^1u3d(d|=*p{ |xG5dU=*x$tb<72e$tB=*1u,9qe0=*PL;e(d|=*{ |xGH=e,8PU=*TUsIp?0f0=* ,Aqf$=*Ls8I\Cf0=* ,Ef0=*PG4g(d|;=*{ |xGIsg,8PY=*,TUsIKg$w=*>Ls8IMg,E=*K<O;h(=*]dQh0$=*o^ BxGSh$tBO=*1uUi(d|m=*{ |xGWXiU=*x$tb$Yi(d|=*{ |xG [iU=*x$tb\0j$H=*h: ^{j(d|=*{ |xG`j(d|0=*{ |xGbj4Nfk=*bxdHk(d|=*{ |xGfk,8P=*,TUsIhk0=*> , k&l$=*PLs8Ilql0=*]Pnl4 8==*o [xGqm,Eh=*< sSm,=*܊xG,um(=*7{ |xG(wm,=*GTUsIPyn("48=*WJ{`n$W[=*bLs8I|n4mr=*l"(Gn =*H43 o$==*X1uUo$=*i I|oU)-=*ux$tbo,@?D=*T,P3@p$=j=*1u0?p =*bZFG}p,a=*<̎p =*443Hp$=*F`=*V9E@sAD=*N_<)躗+tdg=*{@8DC#Ys n=*S)<D\t y =*y *<C#ȼtCh=*`*<qH%s=*)<q`t =*#du   =*E43—=u$=8 < =*U1uėwu(X \ =*g{ |xGƗuUx | =*yx$tbLȗu,@  =*T,P3ʗ,vUx  =*x$tb̗hvUx  =*x$tb͗vUx  =*x$tbϗv(X  =*{ |xG ї w   =* `Fӗ`w  . =* `F,՗w  D =* `F<חw$Z l p =* sGؗx$   =*h: ڗax$   =*h: ܗx4  =*("(Gpߗx$  =*Apd,I9y$ $ =*Ppd,Iy4 : =*^"(Gy$ b =*vpd,Iz$ x =*pd,IDFz4  =*"(Gz   =*bZFGz$  =*pd,I {$=8  =*1uK{(   =*+ < d,I{ M  _ =*bZq 0tb{$=8 z =*1u|$Z l  =* sG,[|(   =*   WG|4  =*"(G|$. 2 =*5Ls8I8}4 F =*A"(G[}  n =*XbZFG},a  =*c<}$.  =*tLs8IP 1~   =*bZFG y~$  =*pd,I ~$=8  =*1u$=8  =*1uF =*A43|~$26=*S`L>R=*d< $ttr`,@f+=*qT,P3!,@f=*T,P34] k|=*3$=*H؀,t =*sH3! /6=*bZFGl#UUHL=*x$tb$UH^=*x$tbl&(pt=*{ |xGh( 4=*G+_,=*,I-0(-=*/ ,00܂$GK=*?Ls8I1,]os=*Jl$З3d,]o=*Zl$З5$=*jVg7=*zHHC#9),27=*Qb$<f /o=*bZFG= k=*3p?ل$==*1u`A =*bZFGBJU=*x$tblD,t=*sH3G(=*{ |xGI,:?=*TUsI(KI4[`=*G@N$=**Ls8IO؆,:=*6TUsI R4[=*GG8U`,=*#<HW  =*B43X$=$(=*S1uZ$DI=*epd,I\[U_c=*sx$tbx^,@Dw=*T,P3`ш(=*KWEpc$=*^`@eR$!38=*pN_p,`Idgpt=*~< $ttr`h։,@=*T,P3k,=*,P3l]$=*4`xn,@=*%T,P3p܊4,KS=*@<-G$t,=*]T,P3hvS,t=*-sH3y, &.=*FVsW`-IH|͋ =*I43} (=*Y{ |GK$==*j1uU=*{x$tb0ƌ,@=*T,P3t ,DH=*9dX`34C$o=*pd,IxU=*x$tb =*<43t C=*N43B$a=*`4`|=*r< $ttr` ,@=*T,|O3d =*243/$=*D4`g }:>=*V (`GRV=*c< $ttr`|ݏ,@jo=*oT,|O3 =*943<X$==*I1u, =*[bZFGِU=*hx$tb8,@=*uT,|O3|[ -1=*;43$=JN=*K1u觘ʑ jn=*]bZFGtU=*ix$tb<,t=*vsH3s =*843$==*H1u$=*Ypd,I<U!=*gx$tbP,@5=*rT,|O3 [_=*P43|$=y}=*`1ul$=*qpd,I.U=*x$tb0g,@=*T,|O3t4=*"(G8Øڔ G=*bZFGĘ G3=*bZFGPƘL i=* *<qXȘ} i=* *<q`ʘ 8=*t{*<q4˘ٕ _U"=*_*<q̘ r =*S*<qL͘8 SJ=*15*<q|Θ` z=**<q(И SJ=*15*<qXј %w{'=*'*<qtҘ %w{'=*'*<qӘ R =*L G*<qԘ< NK-=*bZW*<q`֘i ^g=*^ k*<q|ؘ r =*S*<q٘җ SJ=*15*<qLژ  Zd=*hr*<qݘ< r =*S*<qݘt X[=* *<qޘ z=*C*<q r =*S*<q# 'G =**<qf =**<qX ~.#=**<q0 i=* *<q8 >=*{o *<qd r =*S*<q( =*Y#*<q ʑ t =**<q, 7. 1 =*q*<qh A=*m *<q( Nm /=*28*<q 8=*t{*<q >QR=*9*<qpW _U"=*_*<q _U"=*_*<q`؜ %w{'=*'*<q| SJ=*15*<qE " =*a+*<qz 2K-=*bZ?*<q, 8=*t{*<q F=*C,O*<qL ʑ t =**<q S VCS=*c*<qt jÙ=*Ew*<q0 jÙ=*Ew*<q %w{'=*'*<q) ~=*5i*<qf 0=*e*<q  i=* *<q П &w/w$=* 2w*<q  ʑ t =**<qM SJ=*15*<q %w{'=*'*<q %w{'=*'*<q4 8=*t{*<q R =*L R *<qLK NK-=*bZ*<q} $=**<qx i=* *<q h=*9*<q, 8=*t{*<qF =*F*<q$z 8=*t{*<q %w{'=*'*<q ע 8=*t{*<q  x{=*:*<q!> i=* *<q#g &w/w$=* 2w*<q% &w/w$=* 2w*<q& UU/>=*%*<q' R =*L R *<q(% %w{'=*'*<q*N SJ=*15*<qH+ wuˊL =*C*<q, 0=*e*<q- SJ=*15*<q. >QR=*9*<qx0L =**<q2 %w{'=*'*<q3 SJ=*15*<q4 8=*t{*<q5 i=* *<q7O z=**<q9 8=*t{*<qX: z~}~=**<q < 8=*t{*<q< 8=*t{*<q=D &w/w$=* 2w*<q?p %w{'=*'*<q4@ " =*a+*<q(B٧ SJ=*15*<qXC >QR=*9*<qE. _U"=*_*<qF[ >QR=*9*<qPH >QR=*9*<qJ`W' =*K,<3J *CP(-L(<Wp*$P-HLQN6-*!,,.Q||4Mj*CtT  5fV6-*E,,. W|%4*ZXs~0!ܔ$.+f,Y,6-*\,,4.Yk|x*h" J ] tT L5f\^6-z *j,,D.^ު @   *}!3!B!8T.C#Tb6-\p *,,d.bI(R!_!m!* !!R<Xd4!!!*$1"Z"e"HjL!#4hի4!!"*41"Z"e"Hjh! #l4""#*ES#|##Hjh!L#o6 ##*V2+<C#pd x{*:*<qtq ##$0+*U$w$))hyȬp}$$0+\nW$+<t.C#Hz $$G$0+$$*)C#@{L$$T$0+$\530|$$T$0+ %TDE }׭ ]c%0+#,~ ,%5%S%0+%%%P56dC#%%%0+ % &Xh|@,&&"&0+#-&D&jH`xO&[&_&0+,el&4  w&&&0+-&&&djStO&[&&0+%el&4 ư w&&&0+&&&&djS8' ''0+9'0'hH`i}쌙<n;'J'0+?4g`.̎xn;'l'0+;4g`.'''0+'("(8H.n)(n0+N o;odt7 .(2(0+?F([((6 4vcb(f(0+EHc,,  j(r(0+IS(()<S@ (((0+O(( ) .C#4{\).)E)0+v)))jj.%3**!*0+S***L.̥GGh*0+;Vu,, @6*d0+y,,.ঙ0***0+** Ol3cb(+0+Hc,,   +3+d+0+L,,,=HiC##=?-0+,,x-!-0+?--4-<).ȶ6;-C-0+,MMS-,*</3к Z-k-o-0+>--X8 4hT-k--0+V--:D1--.0+g .-<1շ-?.0+oF *<C#|`W..0+y&.D*<7(V`W.-.0+&.*<77.C.M.0+0|...<ܕS-™ ...0+D"/=/J/<3C#lęge/}//0+\///jܕ/q\ƙ//00+tx000  q ʙu000+;Vu,, ʙ@0010+L1i1|1ģ\$/`͙ 1110+11 Hϙɺ 1110+ 22^gљ Qj)2U0+bg I,, љ\u0 0+;Vu,,lҙe-20+{5,, ҙ12520+*P^<7qԙGV O2W20+(ݣ,,4/ԙc2p220+373L3QF{8ٙq3{330+334  qܙ/(4"40+-̯04dݙz,;4H4L40+ `4q4أ2(ߙŽ5 |440+E4@6T4 W440+GWoW,,0TP\444+444Dv445+5#5LO4U#0,595=5+N5a5T4P4 en0+q*<qlο 0+j5*<q /0+*<qU F0+C,q5*<q _k_k`0+*<q0x5554555TdD/rEL,5y:+5dOt*^#`55'55644xT/^#(`66636 J6**`PT>5W64^6m644<d/}net6+S x)<@9 *w6{6'665Dt/ 6666\*)`pT)664666)</v 7+.<)<L&*w6{6'77)</7#7+7H7&W7))`Tk d7{70+өi0\*</D F0+(9)< =*"0+B2)<X/ 0+  h*<nfLO0+Q2}h*<| W70+)</ 7g0+r)</;DW0+MW *<zB' 0+yK *<3D s 770+:77,</  770+t77D 4/3K470+7i(g`)4X[0+ 8(g`)3D40+tr$ 4g<=/4W#0+A4g<}wH 8ˊL 0+,8?8`)=HHD8ك &0+P8c8`)} W70+)</Y 70+r)<0 Y1\4Y0+l,< h/0+:l,<7|0 0+ h*< xfLO0+Qh*<q Y1\4Y0+l,<P  h/0+:l,<7Z 0+ h*<fLO0+Qh*<q(  Y1\4Y0+l,< : h/0+:l,<7 h8z80+8 4T U880+"388 4T DW0+MW *<H WB' 0+yK *<3 0O0+}\T<S0'c0+\8\T<)D8Bb0+88<@|wD8jT0+88<tl `W' 0+KL+<W  Y1\4Y0+\gL+<1U4/O0+89@g<04e 'c0+ 9e @g<dnr 0+~+<=W% 0+EX+<q,O0+9Lg<Qt(9'909+A9J9!,T0aE+Q9Z9]9+99^SL#k999+6):E:X:hx$0q4F.+?{5,,(`:m:+O::!OaE4M(:::+ITP<aE(:::+:jaE>w,k>>>'B >>w,6>> ?4T03D?"?)?w,KI?d?s?8H`d03TGz???w,w???; 4t03tH'???w,@@!@; 4ı3I^0@:@Q@w,@@@(sST3L@@@w,4AOA\AD03PcApAAw, !BMB`BX@l JU$B7FBw,BDV4,BBBw,!7CRC4$,C#Yl,BB]Cw,=7CRC4$,C#D],CCCw,YD1D4$,C#8`,CCw,%*<q| x{w,:*<q}Q ` w,BC*<q~ Nm /w,28*<q`GHH,uHH4\=58HB H,#HIdk5H[V II,%(ݣ,,0ȇu*, ;Vu,,<INIRI,HII$kH"A\HB I,YHIdk5V II,[(ݣ,,0 uJ,V;Vu,,_%x JJ,:1J8J-<01#БCJ\JoJ,%{o JJhPU JJJ,:JK= 40ԕM%x JK,R:1J8J-<01#CJ\J3K,_{o JJhP0U옚JJcK,tJK= 405KKK,CK+<KK,^KK= 4PUCG L,L%L64!C,{5,, tf.LRLaL,LLLhh<0GT,{5,,СLLL,*$M/MH7 41 ?M]MmM,KMMM|,1詚, Na!N,$SKSWS,>ClSsS)<t1XɚT~SS,F SS)<1ʚ SSS,ojTvTT< C#Κd TTT,]UoU~U<LC#,ӚPUU,PP4!0Qdq֚UUU,U<0 ךNUUU,U<0  ٚ V V,)R+<qٚ VV,)R+<qXښ0V-V1V,PVgVȃXqܚzrVvV,!)R+<qܚrV}V,&)R+<qTݚ VV,/< ׊V853UޚGVfV,EVWh1qAQh^hah,hh0i}dCuu,;Vu,, CLhhh,hhh;p61,E hii,r(0i@3F ;iNipi,iiHdU1@L% zi,()<Ll ij0j,jjjpG P jj*k,kkk|gO Tkkl,'G l+<q U:+ll,"H$+<qU$Ul1l,`l)<Vg#Vslll,llm,hY Nm /,28*<qPZ; SJ,15*<q[ [@\*,̯d@*<q\\ =|,< m*<q] ajT,*<q^Z *' ,-] *<qX_ [@\*,̯d@*<q4` 0mmDm,qmmm: 4\H,ammm,KnhnsnP`(c nn,nnnP~ d ( oIo,oooggHfR (oop,&pEp4x iRp^pcp,pppD2v lppp, q#qdpU#mF<.qAqQq,qqq24q(qqq,{r4r?rp$2sD(FrOrsr,qrrrU#uCrs,h s7s@sg`PDU#v(Wscsgs,_sssU#wl(sss,Nsspy"sss,;0tSt`tD42| zktwt,ttt:4D2vd~ftt,b\ u*<T2~-uu,=uLuQu*<0VvZucuwu,uuup@D(uuu,nuv8 4d2쁛tvv#v,eM/v4DU#5(6vCvOv,JtvvvDDPVU#Є~(vvv,2$wswwЙ<www,'wwwPȤt2X <wxx,:x{xxDTLPQ#(xxx,zxy ydTԏ$D7yPyTy,Evyyy0У2>=x%(Wscsgs,_sssU#8'(sss,Nssp( zktwt,ttt:42v`c+tt,b\ u*<2虛2.(6vCvOv,JtvvvDDpVU# d2(vvv,2$wswwЙ؟,5(xxx,zxy ydT7<4yy,1yT0<>=g=@yyy,EyR g< 1l=0 zzz,1u3d+< 1,>zz,bH)<C?TV"z&z,H \*<L@TV"z*z,H \*<䦛@$g.z2z,6zMz*$P0~A$g.zRz,6zMz*$P|BB VzZz,.<)< CTV"z^z,*<C8bzfz,jzzg$PD$qHz5,{zzt-<䬛DE$g.zz,qz/+$P0FTV"z,h*<ȮF$g.zz,_z/+$P{G$Տ zz,Nzt-<԰6HV zz,;(S)<TH zz,.<)<䱛Izz,%@)<V|Jz{{,H{Y{`{\*)DԳBKTVu{y{,H \*<lL$ }{{,w{{*$PVL$g{{,n6zMz*$PMTVu{{,e*<aN${{{,[{||=t2%O&|*|,T/2|*<2O$g{9|,Jz/+$P躛P$Տ v=|,2zt-<sQV @| ,'(S)<(8RD|H|,*<VĽS8Id|h|,l|co g<FS$Տ ||,zzg<lTģ||,`||+t*2pUoF||,A\*<2 7V|[,>c)<2$W9||,2\*<3WW}},#]d\*<3›X0 }8}R},k}}~vDXVɛ[$~.~B~,!~~~QRv̛|`~~,(8?gg$3!Rhϛ:c JSh,Y0w\*<43\Лc  ,.\*<Лc , \*<D3ћd *",)<hқad ,  +<g#қdfLO,Q2}h*<ӛdW,+<T3g#ӛJe g,r)<d3ԛe$DW,MWQ<EԛeB' ,yK *<3T՛6f(s 7,:77h<t3E֛f 7,t77D 433֛f<7,7i h`)E ؛7g4X[, 8(g`)3Tٛg<,tr$ h<(ڛg4W#,A4g<}ۛ9hP 8ˊL ,,8?8`)XܛhHD8ك &,P8c8`)}ݛhW,+<3g#ݛ?i ,r)<3(ޛi(Y1\4Y,$h<-Pޛi h/,:l,<7ߛ:j , +<g5jfLO,Qh*<qj(Y1\4Y,$h<-P`;k h/,:l,<7k , +<g5kfLO,Qh*<q8Al(Y1\4Y,$h<-Pl h/,:l,<7lz8,8 4Wg#DmU8,"388 40Wm ,`i0/<g5Lmnr ,S~+<q0n ,`i0/<g5znnr ,S~+<q(n$DW,MWQ<EoB' ,yK *<3|bo8O,}0h<<Ho0'c,\8\T< pL8Bb,88<cpD8jT,88<tp(`W' ,Kϕ֕-B'..<3Z< -; JW|pWD1H]o(fbm-ffg4W(_-֖<DWE`aC4-ܗtFht,s-(h|d`j,),-8:h|tlـ8G`l-B͘P\ԳFpBBS-TU, 5DSst7D[-A)<WG9u̙ڙ-&x)<9 gt|-$d Þ˞<D4EFӞܞ-L4))<H}@I`-Z )<4ŅPɟ-mnzx\OI3 ͠-ey66&l΃.-&#ѡء4 4|I3Ni -?V] P}H p~-&\:D3ʢ.-6ѣ٣5 4H 3` )z-Z#`̥ |YTS\-lkr*<Wqc{-qgg*<Xqx̅ -w66l q 2-+:*<3PN%AJ-^gu)+d8'-ק̍ q { +-KZa4 4qh (v-V }I< :I -#,X%ua q-",hfua -",xua x-",ua -",%ua q-",fEҨ-","ը-b#,@ڨ-l9MH(- 2MVyP4赜W,]fm-/y<$4D ]-@CΩ~h443 թ-G= 43J թ-P= 43 Nm /-28*<q`׋i 9-өihD*<C#-B'M'*<D4dY Qj-C|jjVPT4 @LO-p)<PՌ֪ͪ-TPd4\4jT-ji<`XM&-+9>D*<0XC#XœM-B'M'*<t4Ü͍ @LO-p)<Ü @`D A.p 2,8Ĝ<Vcn.!)< g5Ŝ.+Ϋݫ)<ĴŜ.?nkv(j4t xǜ(Ƭ.Tc*<H q\ȜSۭ.^\hr5DqqΜ +.*< D ؜ ʳG.+Զ*<  .dP*< L" ,Z.HTP*< <T˼ ׼.^m5Dq .|;D\H  .P*<La , KW^. e\*<40l.:.EЦ't#.ק qe#.Ony85\5\K\ituF #.2#,liSBW#.3biB+<#iq#.4B' X+<'j(#.5#,$kf$YNyY#.6slD#,$l #.7.5; 44Pmߠ K#.HA%)<m$ <HY#.r)<oe' #.D*<o#.`,<5p ^#.X)<5dq  #.MD*<$5C#$r\ I. )<{\6I.:)<̗Ϣ\6I.=)<I.Ap )<L@̦I.R)<Yb-I.g<KR4 445{ _ iI.TpO|OD53|,.(I.v0 ;FpO|OT53Hd[gI.{d53Ԥ##I.)< fI.1J Y ^ )+t5TL\tI.u)<{hI.*<53ģ%I.Zi*<53Ф UU/>I.%*<q#k>t{S.UB'..<5̦ZS.^[.<0Y+e?S.doGe8 4g#˦S.mB'3 4g#dS.s#,g#;US.u#,g#s *S.wb•*<g#, *S.}b•*<g#<S.M;P|TD1(fcnS.ffg4PY|S.<DpYE\4 *S.xd6F8!.S.&DF0{ JS. L.<S  I S.#,VuxqS.",ȿuxS.",ؿժuxxS.",违uxS.",NuxqS.",uxXS.",ΫըS.b#,ڨ`S.l9M@( S. %8C5TÝv,JV]S.0r 45ĝܬ ]S.@CΩ~h53Ɲ թ`S.G= 43 ǝa թ`S.P= 43(ȝ Nm /S.28*<qȝS.+9>D*<YC#ɝ$S.B'M'*<5ʝf @LOS.p)<4˝iS.өihD*<C#t̝ܮ)S.B'M'*<58͝ Qj2=S.C|jjVP6Ν[ @LOS.p)<$ϝͪXcS.TP60Нѯ4jTS.ji<`,ѝ ||k. J)<|ѝR|k.J)<ѝ k.P*<Yhҝ . k."P*<$6ҝ A k.*P*<464ӝ k.05D*<D634ԝJ% MXk.5kv)<Yԝ3 k.:)<  ՝XA k.@ )<Y՝ *k.H+2)<T6q՝9@k.OLS*<d6qD֝OZcnk.o)<t6םk.1HM)<Zٝ`imk.*<3<ܝ:k.-=*<3CMQk.8$*<3`и*37k.X[j*<3ox|k.p*<3e\k.*<3T #k.M;-P*<6H Js. ,,6D  Zs.  & lLH6 G f s. #,t r Q s.r ,,'.s+)<0Zۻ).}+?)<6VFRR.v)<G9tFR.v)<G9мux.,,.,,6$C.N'.*<63P9Na.W*<3 .m ZxPqо=.}"5*<qp<Fe.67KqD B.p\I   JVq.}xPX* g.JzXy4ܘ },.71F }&0C&<.XmTXX'  vz.*<q)Y$48.BMq, .4 P*<Ԟ.%.2. *<30/.1*<33 .M<K*<3,5zPei.qTU*<3T7.,Y*<3:_im.*<3>_ .2A*<3? FRU.bP*<PZAv.M 4pZG +.\5<5D6I EQ.qP5M0XK2.,,LO fO.ؙ*<M L .5DN)4.J5D6q\QG.)<$RL .1D)<DRv S^.mtP*<Z8SV .&M)<6S8 ./)<ZqPT .; P*<ZU9 B#,.DM`P*<ZUmvy.Kk *<3Vmv.Tk *<3W!mv.]k *<3Xpmv.fk *<3Y.o)<tZL .w1D)<t [ S.~mtP*<[[, #.)<0[qH\  >. P*<P[][ B#].M`P*<p[]B{.P*<[^|.V-<_mv.k *<3x`mv.k *<3paZmv.k *<3hbmv..k *<3`cmvB.k *<3Xd;mvV.k *<3PelV j.M)<7emv|.k *<3f .P*<[dgkc.*<[qgJV .M)<7`h.0;)<hhUJ.Gt*<q U .{   *<Lq  ! .   DT qT - S . 1p\I X _k.}xP8H !.Xy4 }챞vq.50 } Þ*C&6.XmTXpĞ vzR.*<qƞC. ,BMqɞ 7.2 P*<ğ,˞' f.K<K*<3̞Pe.oTU*<3Ξ. (*<3Оj-69.u*<3Ҟ /.`P*<P]LԞ .M 4p]<ڞ +.Z5<5D7Tܞs & .+25D7ޞ fO;.ؙ*<Dߞq GL S.5D)k.H5D7q.)<aL .1D)<ķd` S.mtP*<]V .$M)<7t  .-)<]q  $.9 P*<] \?H.Bi|P*<].I*<83 .R*<83Smv .[k *<3|mv4.dk *<3tH.m)<d,L l.u1D)<@ S.|mtP*<^P .)<0^q? . P*<P^ \?.i|P*<p^|B{.P*<^h.V-<mv&.k *<3Amv:.k *<3mvN.k *<3mvb.k *<3Cv.*<$83\y.*<483V .M)<D8TG.#(*<$3 7.P*<^PcJ.*<^qV ]. M)<T8LYo.0;)<T hUJ.Gt*<q(ehUR.Lt*<q0Z.Qs*<d8q,hU.Vt*<q23.[`S`P^\vZK.bHJC85 4t8.i%. #o .I  =\53& # .T  =\53' $$$/"$,,0)%'RW$/f$$<|З*?$$$/$%#%<yH8h.s6+%:%/IX%i%n%)<P` /}%%%/R%%%L@1&&*&/p 'B'Z'$4p`38,g'*t'/̯E+<39`''3(/*8*C*RPp 3G**J+/![,s,~,RP3 P ,,,/T---tN`3T?7^ -/9--.53`g#V./;"{9,,8W#.6.U././!/I\5[4h/y///0(020>\5J 3<_uxk0/",L_\_o0/)<`_s0/0)<`000/11.1pO|O`3806?6/`u66)<Dsg666/q7770L3Pz7p7/<;< #,z S/j*<q<| 8*8;8&/.~888|#H|TV8&/F))`#TV&/J))`#1TV8&/N))`#D` 8`8&/R887@L 889&/t9))`9  B' &/K ,<QK̄P\4Y&/\g *<3|!pcr&/{+<#QN_ b &/(S)<x B' &/K ,<QK$P\4Y&/\g *<3ԇ 889&/t9))`$9  B' &/K ,<QKTG P\4Y&/\g *<3x pcr&/{+<# N_ b &/(S)<  B' &/K ,<QK P\4Y&/\g *<3\:  889&/t9))`490l  B' &/K ,<QK܍ P\4Y&/\g *<3 pcr&/{+<# N_ b &/(S)<,  B' &/K ,<QK4[ P\4Y&/\g *<3䐟  (949;9&/D9Y9b9V D90 % &/?W *<Ԓ DW&/Y#MW *<3| i9r99&/9 9)<tXE  99&/9}n :4 4<u % &/?W *< DW&/Y#MW *<3 :%:0/,,T9  . -:0/P*<d9  . 8:0/ P*<t9d#|C:0/J)<e|J:0/$J)< 7Q:T:0/1 [P*<d0/6",t4 0/<",{% M[:0/Dm:v)<a^7 t::0/K::)<ԹT1:::0/<:w:)<9К;; ;0/n;;;)<0*;;0/0;;)<0a ;;;0/?]<m<s<P*<D  <<<0/j<<*<3<S<0/{==*<3]=#=&=0/>=E *<3M=a V=0/p==*<3===0/[>w>*<1pF~>>>0/m??*<1P??0/e*<&8???0/@/@7@5D9р$F@R@a@0/C@@@5D9рo@@A0/eAAAM 4Pa@+ğ AB B0/]BtB5D2$Ɵ{BBB9/JBB5D3ǟBBB9/* CC#C ZxP34ɟ6CDCC9/2,DDDRDdtpE g#ΟDDD9/aKE[EfEdj4@ }TҟU(EEF9/yFGGԴdt( tٟ: GGG9/ "H=H:4>xݟFH!RH9/MrH)+ޟBH9/HH*<&Xߟ HHH9/HHHP*<4II9/*+I;)<dS2IAI9/3ZIaI)<V rIyI9/:M)<9 2V rII9/AM)<9v II9/HmtP*<pa0III9/O J J%J*<93V8JAJLJ9/VdJsJxJ*<93JJJ9/_JJJ*<91d4JJJ9/iJJJ*<:1(KKH/Ja2<+K*4KH/\̯DK|+<}IKRK]KH/i4uK|K5 4:3KKKH/sKKK*<$:3d*KKH/}U*<3nKKH/U*<3 LKKH/ LL*<4:q(DL)LQK/AQ*Q7 4D<$O1QK/HӥP5 4$;QK/N  (#,p$ AQJQK/Rj.<34%,TQL aQK/YsQQD6PC# _%8Q}~QK/eQQT6PF@ %,QQK/vQR 4F % R*"RK/0RAR= 43h O& R*HRK/0RAR= 43D&{BBVR_/JBB5D3D9'BBuR_/( CC#C ZxP3'RRR_/0SSSdF g#p(SD T_/_KE[EfEdj4 }((vTET_/wFGGԴd*  ) GGnU_/ "H=H:4>%R(UUU_/K V)+&*B'V_/HH*<&&^* HH2V_/HHHP*<ĺ':)IKV_/(+I;)<h(&2I`V_/1ZIaI)<))V rIyV_/8M)<:)'V rIV_/?M)<:*( IV_/FmtP*<a**IIV_/M J J%J*<:3|,*8JAJV_/TdJsJxJ*<:3<.++JJV_/]JJJ*<:1/+JJ$W_/gJJJ*<:1T1 ,(KKn/Ja2<t2P,+K*4Kn/\̯DK|+<}P3,IKRKNWn/i4uK|K5 4:3(4"-KKfWn/sKKK*<:34-KKn/}U*<3`5-KKn/U*<356. LKzWn/ LL*<;q6.W)LWq/<qLLLT d$g#d9A/LLLq/ULLM= 4;p:/(MM&Mq/jvMMM$;l>/WMMq/ NN%N|xP}8B08NANWq/NNN؃ 3 DW0NNNq/ O'O2OPPa3@F0=OFOXq/kOzOOP53b3 G0OOOq/OOOV`P4;3H1 Oq/#,H]1uxOq/",H1uxOq/",H1uxOq/",H.2uxOq/",Hu2uxOq/",H2uxOq/", I 3 Oq/|#,,IP3 Pq/|#,LI3OPq/ӥP5 4I3P.P6Xq/!PPPD*<DC#K!4PPPq/3+PPD*<D;C#Lc4 k>Qq/AQ*Q7 4M4O1Qq/HӥP5 4l8\\\/M\)+mv:BH/HH*<&n: HHH/HHHP*<To9II/*+I;)<,pS72IAI/3ZIaI)<Lp9V rIyI/:M)<T;Hq/8V rII/AM)<d;qr8 II/HmtP*<0bXr;III/O J J%J*<t;3@tH;8JAJLJ/VdJsJxJ*<;3v;JJJ/_JJJ*<;1w#<JJJ/iJJJ*<;1ym<(KK/Ja2<8z<+K*4K/\̯DK|+<}{<IKRK]K/i4uK|K5 4;3{=KKK/sKKK*<;3|>KK/}U*<3$}U>KK/U*<3}> LKK/ LL*<;qP~(?\)LQ/AQ*Q7 4l EO1Q/HӥP5 4TE;Q/N  (#,E AQJQ/Rj.<3\E,TQL aQ/YsQQD6PC#)F8Q}~Q/eQQT6PFhF,QQ/vQR 4FF R*"R/0RAR= 43G R*HR/0RAR= 43liG ]].]/ }]]])<G]]]/)]^^5Dqԡ]H )^2^/;7@^I^4DbpHR^^^^/ x^^4DL q I _;_/ __( qUI__>`/#``` qhIKaXaa/:bb$b5D > qȭI[bgbb/bbb)+ I-.6ab/!br c5D$<q\J cc/)'cBcKcx44<JVcccvc/ ccc)<LtKdd!d/4Ndqdxd5DqHsK )^d/F7@^I^4Db䵠Kddd/ e%e4Du qt.LeVee/ee$ qaL2f?ff/#GgWgdgk)<d<ˠNhUEk/-w)<P̠NhUJk/1wQk)<t<̠OV b Xk/5(_kdk)<<(͠ZOHEkk/9btk)<b͠Om5( }k/=xr gk)<c ΠO  /A)<,Π P k/B)<LΠ\PlROk/Dk5 4ϠP#kk/JkD*<0cC#ϠP )k/Ul'l(63РQ.l$G?l/^'GMlD*<C#ѠTQ;I Tl/i.7h*<xҠQZlgl/m~ll\G 4PcӠQ l l/wlllpc3l֠R,lm/C,)m2m 4tC#נWR=mFm_m/mmm@dPq<ڠR8nAn/^` x$x(xG0=Ix\x|#, t@`axkxxG0xyy<)|LG`$r G0by83<2G`$uXG0#,2G a$ryG0by83<20HZa$ryG0by83<2Ha$ryG0by83<2@Ia$ryG0by83<2I b(y&G0y<2I=bP}<yyG0 1<XK,F{4JxbP}<yyG0'1<XK,F{Jb\}<yyG0-1<`L,F{JbH}<yyG011<6,r0K6cHyyzG07*z:zxdF{MmcTIzbzfzG0GzzY1F{Qc G0`)<QczzzG0dLzdS4d/zzG0p {3 4C#`Tod ڸ{{G0w6{G{ZPUd ϣ G0)<Ud,P{h{k{G0n{x^TW%e/z{G0 {3 4C#PX_e<{{{G0{|1h{4\e8*|<|?|G0Q|`|t 42X]e<i|z|~|G0||xxh{p_f<i|z||G0||xxh{a\f |G0!-<YafU|}G0"hw\ }+<$=YHbf4+}7}H}G0*f}y}}D4=A6cf@}}}G04}}}XTPdCgdgD}~~G0?[~k~~ LCkgH~~~G0T~~~[ 4D=rmg@~G0`)>G 4T=Mo hTR<~^G0l0d<{oYhLiuxG0r~ <{phLG0xl|O{rhTG0/?`6 {\viXRquG0B.[yu ajG0Ê֊ۊ)<>áuFG0i"+<$>Yxġv+4=G0Ix\)<4>8šHvuuxG0+<YHšzv\\_G0)<\šv *"G0\*<švcKG0H!V,<Ylơ w FG0b9)<ơ=wen}G0-)<peǡwwŋG0ۋ +<D>Yȡw G0-")<T>tɡwcKG0H!V-<Yɡx FG0b9\*<ʡ9x4+G07Ji`)`ˡwx4+G07OR`)̡x@T`gG0pz`)d>#(ΡyFG0iH2<t>Ρ9y+4=G0Ix\)<>ϡqy,G0q`)FСy4h/G02 z<6xѡy $G0I,<30ҡ z,G0Ìp[`)C#PӡZz8ȌԌیG0z`)>FԡzuuxG0H2<ԡz\\_G0)<ԡ{ G0D3<ԡ@{ G0\*<ԡs{ cKG0H!V/<dա{ FG0b9)<ա{bKG0HkH2<p֡|HEFG0bH)<֡?| G0-!H2<eסx|S.;G0QM d)<eء|qzG0ۋ H2<>h١| G0-")<>8ڡ} cKG0H!VD3<ڡI} FG0b9\*<Dۡ~}4h/G02 z<6ۡ} $G0I,<3ܡ ~4h/G02 z<6dݡO~ $G0I,<3ޡ~<F G0B'$z<ޡ~(qHx{G0:z0z<Cߡ~bKG0HkH2<,/HEFG0bH)<d8B' G0-18D@G0(-z`)>#|J$FG0i83<>}68~+4=G0Ix\)<>L4;G0FK)SeH G0V|-<8',e G0qq`)F` _k`G0,p.30G0CEHz<ŝ|r G0S P-<<H G0V~~ $<) 6,e G0qp[`)C#0oTŽɎG0Ҏ1S<?8,8G0 z`)?FT'3:G0C)bV)SeXC_r)G0)p.X$uuxG083<}6h\\_G0)<|,fLOG0ӥTz<s-.G0P*<T(G0y<}6 G0\*<(cKG0H!V`z<}6` FG0b9)<$bKG0Hky<}6lEHEFG0bH\*<y'3kG0C)bV)SfL4tG0FK)S0f4W% G0lz<)QEG0Y#*+<3Pe<h/G02:xz<{ $G0IX1<҇'3G0C)bV)SPf$ G0-!83<pf}6@S.;G0QM d)<fd{$qzG0ۋ 83<$?}60 G0-")<4?܈(cKG0H!Vy<}6  FG0b9\*< A _k`G0,p.3 _k`G0,p.3Ή(G00zp.C4'3G0C)bV)Sf86Lao]cG0-4<,l4G0/Ii`)`L Lao]cG0/D<\@ ۊ4G0R`)` XmʍэG0ڍT<D?l [@G0(-z`)T?#  FG0iH2<d?i`Ջ+4=G0Ix\)<t? ŏG0)*?@D G0V|-d<\r,e G0qq`)F ̏_k`G0,*3ތD G0V~~ t<H,e G0qp[`)C#EPŽɎG0Ҏ1S<?\8G0 z`)?F΍؏G0)*? ߏr)G0)*F uuxG0H2<iu\\_G0)<$G0/<iҎ G0\*<$cKG0H!V,`<i`* FG0b9)<WG0)*?G0)*?8ƏG0)*?  G0-!H2<fi,S.;G0QM d)<fc qzG0ۋ H2<?iP G0-")<@ $cKG0H!V/<i FG0b9\*<,   G0<ep@Hy3"\ G0Đ@Hy3%(G00z*C0&ΑG0)*@&4V$+G0VV]<$@`d'<4V$2G0VV]<4@'z@V$9G0VVu<D@#|(ɒ$FG0i83<T@28)+4=G0Ix\)<d@)6#G0Tg)p.*s,@G0qp.F+ _k`G0,p.3,,V$LG0VVZ<t@C#-#8SU/>G0zp.F.n#G0Tg)p./_r)G0)p.0$uuxG083<20$\\_G0)<0[ _fG0y\*p.@h1(cKG0H!V`z<21 FG0b9)<t2#G0Tg)p.L3,#G0Tg)p.$4hKG0HA%)<4#G0Tg)p.5ۖ$qzG0ۋ 83<@2L6  G0-")<@7>(cKG0H!Vy<27p FG0b9\*<(8 _k`G0,p.309 _k`G0,p.38:4'!G$GG0*`)0;vS mr0x,,;0L ,,g<HEƑˑ1,,=ёڑ 1,,>   1,,>Dc 61H  #,0gT?c !61H  #,Pg?c *61!H  #,pg\@yc 361(H  #,g@<U61,Dy~,, B y 61) )*}Pj%\t\ 613)<djQ\t_ 616)<xjxb e 61:p )<ju  61J )<gk   61]  4 4@Tm: / 61u pOP@3Ppb 619 pO|O3r 61 ' 0 OO@3sל f; B 61nJ Y ^ )+@t /61 *<qu' D1V% 6 <)wXߕOD1uh   %D1n. 5 ,<gM` J ZD12] tLب `_ H D1<   \``P@q " - D1?E X a 5@<r D1P h`t`<3@M U?D17 J O lA3At {D1c<)$H(HD1;VT<$f  D1 DI$f D1 Dy;"%D1ӥ1(+)`Ag#8 n 8D1c 65)Y0>AD1{ (+<g#YuG D1",$RGJD1;)<ޡuG ND1",(@bRUD1 , DfH3 ]`D1J Y \MDȚuG hD1",ؚRGlD1;)<<#EpsD1",Lj@o wzD1  DH D1  pMD + ̚D1 , , %, \$AEd + D1* , , %, \4AE$G  <MD1B   gERGD1[;)<lRGD1\;)<ФD1]xr F)<,3-D1^) *<3m-D1_)+<3D D1u|#, dѥ vD1yQ |#, Ԧ TD1bge |#, L50j s D1Ff`< D1)<Ħ ߘD1)<0 X| ÑśD1o   ``tDAۛD1i 8@6hW"-D1WoW,,0hP, =jD1   $P-J $8uĝD1;Vu,,TߨȝӝD1Q d i ,,Ph(\<4t D1 E j d? qD¢wuD1;Vu,,T¢ȝD1Q d i ,,ph(hâW"D1WoW,,hPĢI l+ D1  . P3dƢU *D1`Ne(6 4{ȢЪ: G lD1Yh 4DJȢߟ9D15gx qxӢ  D1l)<ԢjD1I\eP]`TAX֢4̝pD1)<֢  ~D1  hq٢f  D1  ,ۢ  D1: h*<ܢ    D1)[<$ #, ߢ$ %(D1U8#, LY Z g =D1o15v #,|IXD1m~ ~~ ~ 54h1`B ~ qD1~   (L O;D1$? )< F ΣD1+   *<qoD1hު( DBOD1'  P,K <J_D17U V $V PPWJ D12 2 ? PP  X įD1-Ŏ 4 4LJ %D1* 2 ? PP$2(OZD12Ï ʏ 43ȊhylsD1B'.46ddA ²J D1 2 ? PP # SD1cOѰ P`ttA#VJ ذD1 2 ? PP `&J D1 2 ? PPL(s,3D1bgqy ))`AH)/J ?D1 2 ? PP+xs,iD1bgqy ))`A0,uD1" Plt$,/J SD1 2 ? PP1Ss,~D1bgqy ))`A2J D1 2 ? PP 4s,D1bgqy ))`A4*X įŲD1Ŏ 4 4L7ss, D1bgqy ))`A8D1E-4 JеA8W 4ID1Ŗ PPD;Ks,xD1bgqy ))`A;J D1 2 ? PP,>ٷs,D1bgqy ))`A>X įD1Ŏ 4 4 8Ags,D1bgqy ))`BAX į D1Ŏ 4 4LDDJ SD1 2 ? PPF;s,D1bgqy ))`B,GJ D1 2 ? PPIɹs,D1bgqy ))`$BJX įôD1Ŏ 4 4 LWs,D1qbgqy ))`4B MJ 5D1r2 O V 45`tOW 4uD1tŖ PPLR/b D1u'  F L' <3rlWD1ȿۿܓ RZ )~D1u Pa, ̖J7D1U V $V PP@<J dD1 2 ? PPs,D1bgqy ))`DB(˾J D1 2 ? PP  D1; X _ )<LܠYs, D1bgqy ))`TBTJ D1 2 ? PPģ DD1; X _ )<-aX nD1D a h 45`ĤsJ D1 2 ? PP  D1; X _ )<LDs,0D1bgqy ))`dBGl<D1B'.46dtBJ ND1 2 ? PPs,}D1bgqy ))`Bhs,D1bgqy ))`BౣgW 4D1Ŗ PP`s,D1bgqy ))`BشJ D1 2 ? PP H?sD1 eO c 3<ƣ [ D1c ,-V  q̣=dqtD1t5 4lΣD1 *<3hϣdqD1It5 4Hѣ,/D1YC*<3ңY jZmD1F|+<i}pӣ' D1k   X4W AW WlD1Ŗ PPLDD1B'.46dBD14,J\<,D1[x PPD14$D14 Nܚ. !$D1r)SȚp(,/D12RW4?$\;>D1)<? Z FD1 4 NȚ`YRD1s[)<\;ZD1)<4JbD1xB'.46dBJ rD1z 2 ? PPhJ rD1u 2 ? PP  cD1Q ! xdP |S g# J~" D16+"  4RA 0" )@D1?,# J# c# <$fL}z# D1_^# s<X((D1l8J_,-0i}B4}xD1)<$|D1<4xtLD14D! k>D1B', *<q>] k>D1B', *<q? vD1\*<$@ vD1\*<@ vD1\*<\AS8D1 `VBB8D1 `VBLD +D1*<qD !0H2IZa8 4pig#ESpH2"|0V$VL8MH2[2K-<B2$NZgvH2c'GL> 4iO+n9>H2b$m >k)<Cg5O4H2.^ 9E6`wpV]fmH2] h*<CW  H2fl< ݦP`$>JgH2PPtg#Xbutr H2{̯0VPg#4c40H28h!fGH2U V $V PP\i !RH28 g K n 6[H2 l34=iv2f,,̏-v2$C1 h*7v2cx3bv2ɬl 85 4x \7f25lhZ+오u27;Vu,,T`c2K#:@6k7uT2M;Vu,,T|(S.2Y:Qxh`3u!2[;Vu,,T Zcg2`s<@6C#НCu2b;Vu,,TD2g*? D5i3ģSf2=_| 3H[2!! 73W)2WoW,,iP7D2>? 3$mX72+$Jx !.<2^ `j520  3<Ǥ HU^24C3ɤ^2SZpQ3d/pˤ V 2=0 _ h +DCLF<Ӥ( 2x $9QLFޤ$- 2 $9QLFp  2  09Q$2` +<8(> 23~ Կs~@k'2+40j2& '+44 /B> 2m $9QLFGT 2  , ,  Yc 2g*<qJ Yc 2g*<qn{4t<  N<_< *fi3r,")'8(J,,TC` PN\NdCqDHp Jk(}8Lq(Bb#,Tc`)l) >QPjq! \n33E\!l  9_$"33q$# +8qZ;^L |*-bx l2$69r(]3EO (4dwpY  & 3I`ilt<)$`J u$p ;Vu,,JI{#)KZf(M#,Lh.v#,LZf(M#,$M%H #,M\H #,,N##N#(#O{5,,(P=47R\+S|=ad?,,DT ;Ij?.} 331#T,tQ8pjy+X<\e)4 4i}Yv00IWjLjPm,^ue)4 4i}_Z|$dbHc,,e^ohNtN`4f\$kfӥ,,ldhNtN`:#m^?Xex}_jp p}_j)Es?Xex}_jv8S{8HMzsL6 Fn)<tCs ^ PB'.5)< ~DSVeNg)<krbCC#@a   n@ c j 4Lq}   w   Nt0k   {! R a MI x     $4CC#W      }}  )    NtPk  = ! R a \NID}  f    NtpkD^  z ! R a NI x     $4CC#\      }ȩ x     $4CC#O      }    $ = H }kS ` v    $OI    $ = H }kMS `     $|OI  7 $ = H }kԾS ` K    $OIåt      04j = e   !NNPqlF"!+!5! q!!!_0_CqtIF!!,,J!!.""#7#D_8 HqVX#\#aӥ,,`WA  `#m#{#C###4Ipl1#Y  ##+$$4 4DZ "$54$gb$n$3 ] u$$$&%%%Ċ 3|fJ %%&&;&H&O؊i}i U&b&l&&&&+`lk &&&&' '4DDm '','@'Y'd'4Dlo  o''' '}}1#q t ''   4n-~-+---,,$e -- .2w.. /@p 3 ;/?/OU/h/D4puOq/L;Vu,,䦦BJu/E{5,,`Qy///a/0:0X_ThPdO0\0t0o000T`貦BJ1k{5,,dy// 1/0:0X_h\Qh<O0\0A1000T`T쾦wBJq1{5,,hu111111}$D|æ6119 I,"æ112s222D( 3˦#3,3636Q3n3u3<4O(4D̦|333<333}l_(DDϦX(:348biB@O<O}Ϧ4 424Az444 צ6559 I,"xצ 5(535H5O5))`TD3(ئKV5b5l53555XOd0m#٦(555]666XDԇN 277(7=7 5D+5D7{5,,lE [@\*̯d@*<qH *' O *<q H7Q7Z7Fa7h785D5dD *")<@ *"2)<0 *"2)< ˗ o7x777)<tDZ *"2)<@ *"2)< *"2)<X? 77)<Dx 77)<Ds 777)<D  *"2)<LV 7777 8)<D *"2)<3 *"2)< }LOӥ2}h*< *"2)<,$ *"2)<n 788_E"8)<D` *"2)<9 ˗ )80877)<D *"2)<p I8P8)<DLOӥxp#,$ *"|#,5 NK-bZY8*<q< &w/w$ 2w*<q %w{''*<q  aY% Ƹ*<q`^  8t{*<q4  G!G$G'G2G*<q,  V\4Y\*<q*! 8t{*<qk! X[ *<q! CCS*<q8! 8t{*<q 2" X[ *<q@o" &w/w$ 2w*<q" V\4Y\*<qT" C`8*<q$# 8t{*<q# 8t{*<qd# %w{''*<q$ _k_k`*<qC$ 8t{*<q\$ aY% Ƹ*<q$ It Lg8*<q % V\4Y\*<qh [% V\4Y\*<q % ^ *<q( % ^ *<q8 5& /8;ϴ@ *<q`w& 8t{*<q4& aY% Ƹ*<q ' R L n8*<q' r S*<q0( x]cYu8*<qw( [@\*̯d@*<q(<F|83Y,, Go buildinf:go1.23.210w tApath github.com/apernet/hysteria/app/v2 mod github.com/apernet/hysteria/app/v2 (devel) dep github.com/andybalholm/brotli v1.1.0 h1:eLKJA0d02Lf0mVpIDgYnqXcUn0GqVmEFny3VuID1U3M= dep github.com/apernet/go-tproxy v0.0.0-20230809025308-8f4723fd742f h1:uVh0qpEslrWjgzx9vOcyCqsOY3c9kofDZ1n+qaw35ZY= dep github.com/apernet/hysteria/core/v2 (devel) dep github.com/apernet/hysteria/extras/v2 (devel) dep github.com/apernet/quic-go v0.48.2-0.20241104191913-cb103fcecfe7 h1:zO38yBOvQ1dLHbSuaU5BFZ8zalnSDQslj+i/9AGOk9s= dep github.com/apernet/sing-tun v0.2.6-0.20240323130332-b9f6511036ad h1:QzQ2sKpc9o42HNRR8ukM5uMC/RzR2HgZd/Nvaqol2C0= dep github.com/babolivier/go-doh-client v0.0.0-20201028162107-a76cff4cb8b6 h1:4NNbNM2Iq/k57qEu7WfL67UrbPq1uFWxW4qODCohi+0= dep github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE= dep github.com/cloudflare/circl v1.3.9 h1:QFrlgFYf2Qpi8bSpVPK1HBvWpx16v/1TZivyo7pGuBE= dep github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= dep github.com/fsnotify/fsnotify v1.7.0 h1:8JEhPFa5W2WU7YfeZzPNqzMP6Lwt7L2715Ggo0nosvA= dep github.com/google/go-querystring v1.1.0 h1:AnCroh3fv4ZBgVIf1Iwtovgjaw/GiKJo8M8yD/fhyJ8= dep github.com/hashicorp/go-cleanhttp v0.5.2 h1:035FKYIWjmULyFRBKPs8TBQoi0x6d9G4xc9neXJWAZQ= dep github.com/hashicorp/go-retryablehttp v0.7.6 h1:TwRYfx2z2C4cLbXmT8I5PgP/xmuqASDyiVuGYfs9GZM= dep github.com/hashicorp/golang-lru/v2 v2.0.5 h1:wW7h1TG88eUIJ2i69gaE3uNVtEPIagzhGvHgwfx2Vm4= dep github.com/hashicorp/hcl v1.0.0 h1:0Anlzjpi4vEasTeNFn2mLJgTSwt0+6sfsiTG8qcWGx4= dep github.com/klauspost/compress v1.17.9 h1:6KIumPrER1LHsvBVuDa0r5xaG0Es51mhhB9BQB2qeMA= dep github.com/klauspost/cpuid/v2 v2.1.1 h1:t0wUqjowdm8ezddV5k0tLWVklVuvLJpoHeb4WBdydm0= dep github.com/libdns/cloudflare v0.1.1 h1:FVPfWwP8zZCqj268LZjmkDleXlHPlFU9KC4OJ3yn054= dep github.com/libdns/duckdns v0.2.0 h1:vd3pE09G2qTx1Zh1o3LmrivWSByD3Z5FbL7csX5vDgE= dep github.com/libdns/gandi v1.0.3 h1:FIvipWOg/O4zi75fPRmtcolRKqI6MgrbpFy2p5KYdUk= dep github.com/libdns/godaddy v1.0.3 h1:PX1FOYDQ1HGQzz8mVOmtwm3aa6Sv5MwCkNzivUUTA44= dep github.com/libdns/libdns v0.2.2 h1:O6ws7bAfRPaBsgAYt8MDe2HcNBGC29hkZ9MX2eUSX3s= dep github.com/libdns/namedotcom v0.3.3 h1:R10C7+IqQGVeC4opHHMiFNBxdNBg1bi65ZwqLESl+jE= dep github.com/libdns/vultr v1.0.0 h1:W8B4+k2bm9ro3bZLSZV9hMOQI+uO6Svu+GmD+Olz7ZI= dep github.com/magiconair/properties v1.8.7 h1:IeQXZAiQcpL9mgcAe1Nu6cX9LLw6ExEHKjN0VQdvPDY= dep github.com/mdp/qrterminal/v3 v3.1.1 h1:cIPwg3QU0OIm9+ce/lRfWXhPwEjOSKwk3HBwL3HBTyc= dep github.com/mholt/acmez v1.0.4 h1:N3cE4Pek+dSolbsofIkAYz6H1d3pE+2G0os7QHslf80= dep github.com/miekg/dns v1.1.59 h1:C9EXc/UToRwKLhK5wKU/I4QVsBUc8kE6MkHBkeypWZs= dep github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= dep github.com/patrickmn/go-cache v2.1.0+incompatible h1:HRMgzkcYKYpi3C8ajMPV8OFXaaRUnok+kx1WdO15EQc= dep github.com/pelletier/go-toml/v2 v2.0.6 h1:nrzqCb7j9cDFj2coyLNLaZuJTLjWjlaz6nvTvIwycIU= dep github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= dep github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= dep github.com/quic-go/qpack v0.5.1 h1:giqksBPnT/HDtZ6VhtFKgoLOWmlyo9Ei6u9PqzIMbhI= dep github.com/refraction-networking/utls v1.6.6 h1:igFsYBUJPYM8Rno9xUuDoM5GQrVEqY4llzEXOkL43Ig= dep github.com/sagernet/netlink v0.0.0-20220905062125-8043b4a9aa97 h1:iL5gZI3uFp0X6EslacyapiRz7LLSJyr4RajF/BhMVyE= dep github.com/sagernet/sing v0.3.2 h1:CwWcxUBPkMvwgfe2/zUgY5oHG9qOL8Aob/evIFYK9jo= dep github.com/spf13/afero v1.9.3 h1:41FoI0fD7OR7mGcKE/aOiLkGreyf8ifIOQmJANWogMk= dep github.com/spf13/cast v1.5.0 h1:rj3WzYc11XZaIZMPKmwP96zkFEnnAmV8s6XbB2aY32w= dep github.com/spf13/cobra v1.7.0 h1:hyqWnYt1ZQShIddO5kBpj3vu05/++x6tJ6dg8EC572I= dep github.com/spf13/jwalterweatherman v1.1.0 h1:ue6voC5bR5F8YxI5S67j9i582FU4Qvo2bmqnqMYADFk= dep github.com/spf13/pflag v1.0.5 h1:iy+VFUOCP1a+8yFto/drg2CJ5u0yRoB7fZw3DKv/JXA= dep github.com/spf13/viper v1.15.0 h1:js3yy885G8xwJa6iOISGFwd+qlUo5AvyXb7CiihdtiU= dep github.com/stretchr/objx v0.5.2 h1:xuMeJ0Sdp5ZMRXx/aWO6RZxdr3beISkG5/G/aIRr3pY= dep github.com/stretchr/testify v1.9.0 h1:HtqpIVDClZ4nwg75+f6Lvsy/wHu+3BoSGCbBAcpTsTg= dep github.com/subosito/gotenv v1.4.2 h1:X1TuBLAMDFbaTAChgCBLu3DU3UPyELpnF2jjJ2cz/S8= dep github.com/txthinking/runnergroup v0.0.0-20210608031112-152c7c4432bf h1:7PflaKRtU4np/epFxRXlFhlzLXZzKFrH5/I4so5Ove0= dep github.com/txthinking/socks5 v0.0.0-20230325130024-4230056ae301 h1:d/Wr/Vl/wiJHc3AHYbYs5I3PucJvRuw3SvbmlIRf+oM= dep github.com/vishvananda/netns v0.0.0-20211101163701-50045581ed74 h1:gga7acRE695APm9hlsSMoOoE65U4/TcqNj90mc69Rlg= dep github.com/vultr/govultr/v3 v3.6.4 h1:unvY9eXlBw667ECQZDbBDOIaWB8wkk6Bx+yB0IMKXJ4= dep go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE= dep go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= dep go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60= dep go4.org/netipx v0.0.0-20231129151722-fdeea329fbba h1:0b9z3AuHCjxk0x/opv64kcgZLBseWJUpBw5I82+2U4M= dep golang.org/x/crypto v0.26.0 h1:RrRspgV4mU+YwB4FYnuBoKsUapNIL5cohGAmSH3azsw= dep golang.org/x/exp v0.0.0-20240506185415-9bf2ced13842 h1:vr/HnozRka3pE4EsMEg1lgkXJkTFJCVUX+S/ZT6wYzM= dep golang.org/x/net v0.28.0 h1:a9JDOJc5GMUJ0+UDqmLT86WiEy7iWyIhz8gz8E4e5hE= dep golang.org/x/oauth2 v0.20.0 h1:4mQdhULixXKP1rwYBW0vAijoXnkTG0BLCDRzfe1idMo= dep golang.org/x/sys v0.23.0 h1:YfKFowiIMvtgl1UERQoTPPToxltDeZfbj4H7dVUCwmM= dep golang.org/x/text v0.17.0 h1:XtiM5bkSOt+ewxlOE/aE/AKEHibwj/6gvWMl9Rsh0Qc= dep google.golang.org/protobuf v1.34.1 h1:9ddQBjfCyZPOHPUiPxpYESBLc+T8P3E+Vo4IbKZgFWg= dep gopkg.in/ini.v1 v1.67.0 h1:Dgnx+6+nfE+IfzjUEISNeydPJh9AXNNsWbGP9KzCsOA= dep gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= dep rsc.io/qr v0.2.0 h1:6vBLea5/NRMVTz8V66gipeLycZMl/+UlFmk8DvqQ6WY= build -buildmode=exe build -compiler=gc build -trimpath=true build DefaultGODEBUG=asynctimerchan=1,gotypesalias=0,httpservecontentkeepheaders=1,tls3des=1,tlskyber=0,x509keypairleaf=0,x509negativeserial=1 build CGO_ENABLED=0 build GOARCH=mipsle build GOOS=linux build GOMIPS=softfloat build vcs=git build vcs.revision=15e31d48a09af0835773bd5c62cedbb3fc0e351d build vcs.time=2024-11-09T01:31:35Z build vcs.modified=false 2C1 rBA: : ;!! = |0/ : ŨΨ٨P0YPPmptª۪ߪ:@[ƤG   8#}(wD(&1F5d=Sz];svvvÇpPш1??F,rG{HH3HIJ,ˊtn <74E$3=l:S;S^SPTTsU[vspvzU`Y6@U`gp      oJoOoooo@j^j`jijnjoj            He 7 77=  ( ) / / _ _ 000J'` ^LH2`!!!!0!0"0)080:0/+xM--@./000011223W3foq    D F H J O T c f  GIlq  e ( ) / _ 000 ߦ` D|ӧ? ABzD@FPG$tIK L(knNP+/,0̨  /5 #'<̨+/,0  /5 #'<+/,0̨  /5 #'<cM7-X Hzj)s*'- 735)2#.!%,40(1$+6    @tAJ $n$ 68EPl #$n$p$t$$C%-%-'---2PQR,0=@INOop p XX & X&0X /sys/kernel/mm/transparent_hugepage/hpage_pmd_size;Zx0Nm;Zx0Nm 040  `He0 *H 0  `He 040  `He0 *H 0  `He0040  `He0 *H 0  `He@68<>@ACDFGO'/7?&.6> %-5=  !)19 "*2: #+3;$,4<VgDXx#Uōrl!6֮IN#|?=֪0Hcq0[kҶq2Ug  578<?jp|!#$&*....//00!0)080;04MNmp%*kEkPkYk[kakckwk}kk ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[????????Q/kH ;ɸGo8d -]B   ..:.;.@.].000012X&c   SQ   * . ` d f o 04?4sz !5Oo`eghj                 $~ |  ?F  8Ui                 ( * 9 < D F H J M U V X Z ] ` a c f o w                              .0/011122`2~2`|  !"Udeg  &(:<=?MP]  6:<=?@GPY      ( * 0 2 3 5 9 < D G H K M U W \ ] _ c f w SQ   * . ` d f o                 ">* (0> ">* (0> " (0>*> (XG dEpɲeeP\P\0F) S$04?4sz !   578;FPY      ( * 0 2 3 5 6 8 9 < > ? B G H K M Q Y Z \ ^ f g v          5 8 : ? H P X pz|#%*-/24:>EGNUZ\chmrwz|oKUpQ R T   *0-000 -;Ż-0Fgi{ooooߦ9@ JP#'pz|  @n_n!(O  `nn"C     ?AJVoqPpP=@!ptv 0@P`p @`@  %&(*058@HJPU`jp)]4};=_F ~ 8 #{ #*#i'u'''!'')))))#.&%.).V.\. 000000>6DHZ\^ =4]c^`u00 ![jkGP>@@kCkooooo @0m7=K`([3{:<_  E } 8 #{ #)#h't'''!'')))))".&$.(.B.U.W.[.00000?"57CGY[];3[_bb d'@Bʚ; TvHrN @zZƤ~o#]xEcd #NJz|;AVj 2b_I_P$бU[D\X"NПW                                   r w  x ~ X ^ p x *3i|p t y  P!_!!`$a$$$$v'',111 2)2H2O2Q2_2222205 (*02359<DGHKMPW]cflptpsuwz}&*]afjA EHMPWY_`}&!e??$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDAZaz%,\bekwyq   *!+!2!N!`!!`,,"ʧЧѧӧէ֧٧0Z\dfi!:AZHJMPVXZ[]`Z]|------------------  &(.                                              ,  of the  of s . and  in " to "> . ] for  a  that ' with  from  by (. The  on  as  is ing  :ed =" at ly ,='.com/. This  not er al ful ive less est ize  ous  the e 09`if o  f o  f o  f o  f o  PY )@IFOPY@IPY )Ш٨ Щ٩PY ';>{ 6V   5)14:\6 7 ;>fio$_jjZkbkUԝԭԺԼ:?EQՠ"% #(38:HJLPSXZ\^`cksx}tzY@ $(q FCdx},jx#q   |,},o-/.010,2050;00b00^00 spϩpݪm\_ipT !"#$%%&&''((()))*++,,,,,------....//////0001123333333333444444444455666677777888888888889999999999::::::;;;;;;;;;;;;;;;;<<<<<<<<<<<<<<<<=====>>>>>>>>>>>??????????@@@@@@@@@@@@@@@@@@@@@@AAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq#4Dc|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-TR j068@|9/4CDT{2#=L BN.f($v[Im%rdhԤ\]elpHP^FWث XE,?k:AOgst"57unGq)ʼnobV>Ky xZݨ31Y'_`QJ -zɜ;M*?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJ*!LMNOPQRTUVWXYZ{|}~ 8G Y e. Lf  0  l : Zs 7I L V   |T $ !    0  mw *m'? , 31 _"  Dn wf *v GER>w u j R viP& 9( ; 85.B Y ? 5!K   x1 !({ '4 b W 9  &  GY eLf l s 7  T ! 0 w *m'? 31 " Dwf vR>w uj                  #4D V n)O?=  X `4    g w~ >kt J s , +KgiK 5 &u n  _ ]Ie 1I[b*HBy  ^`  M\+<=>|~ D R z |  !@!(A!D!K!!E!!!!!!!! !!!! !" #!#|######%% %%o&'Q'''''')))))))*0+D+G+L+)b9df \^uӺ?c?yڌX?9?-^? h?:D?Kx? !? ?8G?2Sg?hz?:?Е1?z?G?g!?Kx?4&?̈Gj?TNK?sp (??P??2Ut?Uᢜ>?&m??l??sjbƈ?UϋE??0?_  ) 1 4 7 = ]  ) 1 4 ^  ) E I W  E I HIWYmq_XZ\^ +&---------.@00112ҧԧΩ'/7=?BESgu  VUU433$Ir]tVUU;J$9.ى%IqgffF]VUU$I@8433.*J$ qaVUzDy 0  C{ ?gfVUJ9o43]g%I@((@pp**@88 '' *U*US##(--=.=.P /` /L/L/L/L/$72A#Dd$`(01PQpq !"#@A`abcBCDEFG0 9 fo6?PYPY09PYPYPYPY`jijjjPkYk@IPY`~!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ (*/:IV^chjnv}  $+469;FJX[agrvxz|~  !')+-368:<BFJRY\_adlpwz (*/:IV^chjnv}  $+469;FJX[agrvxz|~  !')+-368:<BFJRY\_adlpwz ")07:>HT\dlt{ )18<BFJNRV]adjmpz~!&/6>AGTY[biotz "-36;DHMRX_dgmpz %)+/27<AEIMSVY\bKkSsk*!s+!0011SE&!24>!A"B*J24>ABJbcc!"*bJ`aa`E&!*!K+!JKK&68=HWdlqvx|  !$'),/39@IKNP[ft "')06<DJPVZ\^`bhkmoqw{#(,15ESaoqsuy{~&68=HWdlqvx|  !$'),/39@IKNP[ft "')06<DJPVZ\^`bhkmoqw{#(,15ESaoqsuy{~1111 11 1/111 111 1111 11 0111 1 111 1111111 11 11111111111/11111 111111111 111111111 1111 /111 1 1 1 1 1#1/1 1$1!1 1 1%1& 1' 11"1 1 1( 1)1*1 1+ 1 "1 !1,1 -1!1 1 1.1 1 " !  1 !1 1 1 "  " "09`if o   f o  f o r w  f o x ~  X ^ f x  PY 3@Ii|FOPY@IPYp t u y  P!!!!`$$$$v'',0 !0)080:011 2)2H2O2Q2_22222 )05Ш٨ Щ٩PY'pz|  @n_n4Mh  89;>@DFJKPl!<Up4Vn6!(O  `nn3NTVg7Rk";Vo6NPUp5  %*"C@[`{ t~  @d e ?56   d f p t ~   !%!'!)!,!1!3!M!O!_!!!!&$@$J$`$')s+v++++.].//0000 0 00070<0?00000[011111 2_2222X3YY33MM!09.ϩ[jk>Q?0RTfhk ;@[ep.A                                                                                                                           "vS`GlF[r`u!Iw%xEy]KzbzV{ƨ{" |P|[|,|| ~};}l[}dx}(}W}0}}1}}~>~#~=0~;~wF~]Q~Z~c~,"l~t~{~~c\~K~~$I~~ ~z~~*R~e~YB~~ b~ĩ~A~e~x~q~b~~ ~\~~~n~G~^~~s~v~~ ~\~~Gp~Y~~G1~h5~~q~~ ~m~j~i~~g~.~W~/~~~~$~_~\X~_ ~l~{~.~}~5\~u~ ~'ߥ~v~L~D~3@~(x~3k~]~M~zs;~/&~?~]}r}}r}0}|`| {v!rzdw40m /I9/dZ/rt/I/s/k̗/՟/`J/E/۴/ /C/5/O/i////Z//f~/H/GB/,//t0?000 0 0: 00x0S0)00]00b0)00 !0q#00%0&0((0e*0,0-0U/0=H1020;40n60/&80 90[;0HO=0?0@0JB09p?4?6?? X>>>}>>(>> >`>>>>O>B>>5>Ԕ>>l>>g>>>>̼>e>D>AΚ>>2T>!>>Ҋ>T>ޞ>'>: }>[w>q>$k>Fe>u_>߰Y>S>"MN>׭H>C>=>^8>ʪ2>>H->'> ">Uh>5>>d >>>&==;=V==ߋ=k,=_=붱=L=Ĥ==;=H=hy={uh=ƹW=6G=O6=&==*=|~#~=0~;~wF~]Q~Z~c~,"l~t~{~~c\~K~~$I~~ ~z~~*R~e~YB~~ b~ĩ~A~e~x~q~b~~ ~\~~~n~G~^~~s~v~~ ~\~~Gp~Y~~G1~h5~~q~~ ~m~j~i~~g~.~W~/~~~~$~_~\X~_ ~l~{~.~}~5\~u~ ~'ߥ~v~L~D~3@~(x~3k~]~M~zs;~/&~?~]}r}}r}0}|`| {v!rzdw40m /I9/dZ/rt/I/s/k̗/՟/`J/E/۴/ /C/5/O/i////Z//f~/H/GB/,//t0?000 0 0: 00x0S0)00]00b0)00 !0q#00%0&0((0e*0,0-0U/0=H1020;40n60/&80 90[;0HO=0?0@0JB09p?4?6?? X>>>}>>(>> >`>>>>O>B>>5>Ԕ>>l>>g>>>>̼>e>D>AΚ>>2T>!>>Ҋ>T>ޞ>'>: }>[w>q>$k>Fe>u_>߰Y>S>"MN>׭H>C>=>^8>ʪ2>>H->'> ">Uh>5>>d >>>&==;=V==ߋ=k,=_=붱=L=Ĥ==;=H=hy={uh=ƹW=6G=O6=&==*=| @ I L N O       ,> @  ;    6 > ;@ G H K L W      *  A D          > ;? @ F H J L W + L   >?+,18;<VWb cdgm 4#&)+0138UWacdm nr51;=>ACD=$1%+45.0/0#$'Y3èRS1/034M{.}n  p v   O y *48m@ajt|!!!!! !!!!!!#!%!)!.!:! ;!J!L!M!O!!;!! !!!!!!!!!!!!!!!!!!## ##"#(#+#{#}#####&$@$J$$$%%%%%%&n&p&g'''((+/+E+F+M+s+v++++,,P.Q.....////000 0 6070>0?011111122*2G2P2`2a222223MMƤ(+679w>xy@O.%',3>JN]blx~-79>ADFR]ekqv{~ #/;GOTar}!*.38>NTXglt~  */28?DHNS\agnu| #/5BNV_jq %*7BKVY\fo{ #&.3<?DNRVY\`o{ '+18?ENR`cfjnqux}%',3>JN]blx~-79>ADFR]ekqv{~ #/;GOTar}!*.38>NTXglt~  */28?DHNS\agnu| #/5BNV_jq %*7BKVY\fo{ #&.3<?DNRVY\`o{ '+18?ENR`cfjnqux}1oW ?  P X   q  9 ?   UYGM@Ctu8=KLOZ[]iAC`l<=>;D EF?]@F AEpqCOp$qq$t$//njojj7kB8k;kDknSnnoL^_((=(($(@1(h&(8 (H(((X (((0((@,($($(h (+(X( ( ((x$( (%()(x%(*(x'()()('('(&()(()(@-(8((@.(%(9((P-(-(0,((&(.(H*(h*(((`-('(8*(8)(-(.()(X)(H)(-(((h)(H&(-(0-('(-( ((( (('(8'(((X*((*(.(((((((-(*(x((x (&(X((8&(.(&('(&(&( 9(x)(.(x&($(&($(H(H ( (%($((((%(((X%()(&(&((%('(8%(H%($((p-(&(.('('('(%(%(0.(%((H'(.(`1(-((((((%(%(%(1(.((X&(((<($((((&(`,()('(h%(( N(1oW ?  P X   q  9 ?   UVYGM@Ctu8=KLOZ[]iAC`l<=>;D EF?]@F AEpqCOp$qq$t$//njojj7kB8k;kDknSnnoL^_"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlAZ.269GJxy}2:;=>ACDFHNEp+rv /`.1V(/8?HMY_ho&!*!+!2!!,} ,/,`,b,c,d,g,m,n,p,r,u,~,,,,,,,@NyBl".2ny}~ħŧǧɧЧ֧ا!,W":AZ69GJxy}2:;=>ACDFHNprv /`.1V(/8?HMY_ho!! ! !!!!!!!$!*!+!-!0!3!>!?!E!!>,/,`,b,c,d,g,m,n,p,r,u,~,,,,,,,@NyBl".2ny}~ħŧǧɧЧ֧ا!,W":az*/37:HKwz~#3<?@BGOPTVWY[\`aefhiloqru} Eqsw{|}0_a/ay}s '07@EQW`gp}N!!60,_,a,e,f,l,s,v,,,,,,- -%-'---Am#/3oz|çȧʧѧק٧SpqAZ!#%'*./: ;?@\~Z[_7    jm, 0>^d e p v y w  pOZ [qJO`eahn}56 DEZ`}~;?~ C ! ' 0 8 ; > A C G Q S U V ^ ,,,,p-..... .........*. +...0.9.<.?.A.C.D.O.R.T.00=00 s~ twΨϨ.2/_0ͩީߩ\_ުߪ%R0EFILPRTW_ahjk   <adee!#%*,/:;?@[]_{}$~ Z_    jm, 0>^d e p v y w  pOZ [:&;=KJO`eahnn56 DEZ`}~;?~ = ' 0 C E Q S ^ } ~  # #)#*#h'u''''')))))),,,,p-....0.O.R.].00000000=0 00[ s~ twΨϨ.2/_0ͩީߩ\_ުߪ>SQ?0RTachjk   ;=?[]_`e.,EF<,^-.235>?ADGHKMWb c567@AEk0r12;<>n j!&,.801578=@B9UWX/>k_ 45>?AQoPRooooefmraz*78HIwz~349<?@BGOPqsw{|}041_a/`+kwy '07@EPW`gp} !!!!/!9!@9@9 h4g/DhzɫĪ#&YC}Ze h{o|ſ "Rb1qZr\ܤlQ F3s.=х3bN{18ShwUF2|,bTu?3IPNnUUތNw8;C^`|~ uq   j  p  O y ?48mn@ajt|D R z |   !!!!! !!!!!!#!%!)!.!:! ;!@!A!D!J!M!O!!;!!!# #(#+#&$@$J$$$%g''''''))))))s+v++++,,P.Q.....////000 0 6070>0?00011111122*2G2P2`2a222223MMƤ !(+69wy[jk)O@O-bdefi >@\^7?y0wx ?w @DFJKPRq=+0;@HPQ`ev{ GPY`S`mp| !ccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IsFMT[EbhnGu z ^ѕ 67(AqFFp+-T zYEyMR ޷4PH7dЍzvlS! 0 Hvi(|E*k>p֏h B& +!E!xV"_"O#J#I$i$<$$%t4%G%pN%ZH%j5%%$d$f$$4#>#,"k3"8!X 5 m! n2dӎeG 6 s @Ld&);J=3'&vQ[,¶c*@vz!x"pf2G]S+CH<60#4![ ۪^NebWI/*xT4v2;&-0#w e0<]ne' 1Ă-- .7).B.Y.fo.߁.ن..H.(.o.z.oN..l.F./...4.f.&.[/B//g /7!/>/T/d/n/r/Fq!/j$/_'/1P*/r<-/$0/k 3/5/8/q;/|{>/PA/#D/CF/I/L/dYO/"R/+T/®W/rZ/5]/_/b/xe/7h/j/m/pp/-s/u/7x/1b{/~/l/ʁ/(//h/C///`/M/7 //?/nB//L/ i/a̗/T0/픚/5/2`/ƞ/p.///i/ԥ/@/t/>///j/ܯ/'P/IJ/)://&)//c//$/+///K/v/B(//://rT//Gu///4//Ei// /G///:///B/\/j/b////\/}"/Y/H/[/X/6./ /q0a0]S0F0N<030,0+(0{%0$ 0o& 0,* 0'0 0m8 0 C0P0_0q070{0w0>00s0<0d000$0 (0a 0!0l"0$$0l%0&0x (0_)0*0,0{-0 .0EP0010{:3040);60n70S90:0<0<*>0?0A0AC0.E0F0עH0J0fL0RWN0RP0*YR0FkT0V0δX0Z04]0_0a0gd0f0ki0 ?A?Į?"?ʝ?G??i>l>7>>*J>>>^>>F>>7P>>K{>>>u>;->>>|>eO>4(>8>L>N>ȿ>>>>·>ε>߳>>>0>U>~>|>ަ>Y>IP>w>ҟ>B>e>)>~>_>>C>{>>J>﷍>X(>'>N>Í>x >b>x>>!>^}>;z>Хw>@t>wr>byl>i>g>Sd>3a>^>]\>&Y>z)W>T>P R>O>L>5~J>3H>E>nC>@>VK>>;>9>07>4>2>>0>p->+>s)>7'>%>"> >s>L>*>= >T>T>4>>y >ϣ > >>L>>l>=+==0 =C==8==hp==0== =o==|===;=ں=Z=o,=ް=ߗ=.W===%==r=W= C=4=M,=4*=D.=y8=H=~=x=sFMT[EbhnGu z ^ѕ 67(AqFFp+-T zYEyMR ޷4PH7dЍzvlS! 0 Hvi(|E*k>p֏h B& +!E!xV"_"O#J#I$i$<$$%t4%G%pN%ZH%j5%%$d$f$$4#>#,"k3"8!X 5 m! n2dӎeG 6 s @Ld&);J=3'&vQ[,¶c*@vz!x"pf2G]S+CH<60#4![ ۪^NebWI/*xT4v2;&-0#w e0<]ne' 1Ă-- .7).B.Y.fo.߁.ن..H.(.o.z.oN..l.F./...4.f.&.[/B//g /7!/>/T/d/n/r/Fq!/j$/_'/1P*/r<-/$0/k 3/5/8/q;/|{>/PA/#D/CF/I/L/dYO/"R/+T/®W/rZ/5]/_/b/xe/7h/j/m/pp/-s/u/7x/1b{/~/l/ʁ/(//h/C///`/M/7 //?/nB//L/ i/a̗/T0/픚/5/2`/ƞ/p.///i/ԥ/@/t/>///j/ܯ/'P/IJ/)://&)//c//$/+///K/v/B(//://rT//Gu///4//Ei// /G///:///B/\/j/b////\/}"/Y/H/[/X/6./ /q0a0]S0F0N<030,0+(0{%0$ 0o& 0,* 0'0 0m8 0 C0P0_0q070{0w0>00s0<0d000$0 (0a 0!0l"0$$0l%0&0x (0_)0*0,0{-0 .0EP0010{:3040);60n70S90:0<0<*>0?0A0AC0.E0F0עH0J0fL0RWN0RP0*YR0FkT0V0δX0Z04]0_0a0gd0f0ki0 ?A?Į?"?ʝ?G??i>l>7>>*J>>>^>>F>>7P>>K{>>>u>;->>>|>eO>4(>8>L>N>ȿ>>>>·>ε>߳>>>0>U>~>|>ަ>Y>IP>w>ҟ>B>e>)>~>_>>C>{>>J>﷍>X(>'>N>Í>x >b>x>>!>^}>;z>Хw>@t>wr>byl>i>g>Sd>3a>^>]\>&Y>z)W>T>P R>O>L>5~J>3H>E>nC>@>VK>>;>9>07>4>2>>0>p->+>s)>7'>%>"> >s>L>*>= >T>T>4>>y >ϣ > >>L>>l>=+==0 =C==8==hp==0== =o==|===;=ں=Z=o,=ް=ߗ=.W===%==r=W= C=4=M,=4*=D.=y8=H=~=x=ef~5ZE?56_]tgs8c vS8;4;1XT./UChGxQ^i 55!gvlrsAp2OOpH4p8 n)RLGny Zu!m<k zԕcEc jL E/oD Zg< GH9INlu$| kl I60c[*}w%gEysiQDXHٗ:Z3X#A:sL="Z#I%%m]5(JFWm%O^ ^ Z Bg7w"u:P0~Iw%tI9 aBZ>r4M0 jxr2oaTYl@yYj "35w T_fXcqX G >FY&a%s%\}h3smLO|q-\ 7hG>ld=Q95;!p54F]yL\dh&nf4o{_EeS]sy \p*IQjw,;O#k<h^r)3aJ j7C!DuW6Cgn}"#lQ",%:&hqbR1exe  ^A{DJ^.s^8gf\sQ5gc}B0YlF }iwLibqJlZvZ9)v8n'.5+F2K]thS&hb~mM:k¡2lBWZ bZcw-p$6pWClz9gY}lAlƅ'hVT|:ce2mK/A2%~{z>6n *F6{N}` / v~Px`sqc!r"0D]9`5DJzZ {[6aT%]3 E-\Kn_(HE_7d8;^.f /Alohkk m$ @?O76|`Gt!8j[@1f!68xCrB3yPx{3c-Jk# Y~= %E[8]H-bqV_{K7} o7R-00 CO>Hb0E0:^J)g.18S;Ӱ*B`'ZDDPqgwY|sulGk [JP:aJ*:e \I+kUIq.{:R!D,&6Z<J4Pi~V<{BKeh2 [:*R , W`pby(I\z?pIVVeP,EPS{[dx^ A|' {?oK_pf01J#%')-Y[ : < > O Q W b c         < > ? B G H K M Q p q u          < > ? D G H K M U W b c  <    )  < > ? D F H J M U V b c           ; < > D F H J M W b c       145:GN59>?q+e,>VY^`bdgmqt ]_24RSrs .  v# +0;U^`|14Dks$7 ,,--a--*0/000ort} #$',T3Ũ&''-GS)D*6CL M{.|}* /oK_pf01J#%')-Y[ : < A H M Q R W b c  ;     < A B G H K L M Q p q u         < ;? A B D M U V b c   < > ? @ F H J M U V b c  ;     ; < A D M b c    1[4:GN59q~-g.0279:=>XY^`qt]^_23RSrs .  v# "'(29:;V;X^`bels|1467:<Bks,367   ,,--a--*0-000otu} %&,ĨŨ&''-GQ)D*.1256CL |4+ 1O /eJߴy`ȡp: H?D'E+$ՓtLPpC&$x0ԆBdJߴy`ȡp: H?D'E-$ՓtLPpC&$x0ԆB3dE4(agy>|r_BӶh-`>[ͯ YU}'A~>ҵNPwRsA WȨ&*ECN5bF$-P6<cH^ˬKĕ3 U^_L7Jıa`1A@ֈa%/?I@ԃtjNXe؟p\\~y6yR"qnc>C08)Pu!xmz8&vp0g9": Y A8 <kKcSӫr h%鏑0Vd ThN3o{-R.BdwT߰]ίcPЈDËDAui[W*fh]"Kau(e6 05XoiXn?I <,7'Mz(/h0_L 0?Ʒq{ dԏ@nb0J*LT]Rʂ8zxvIOqt/[.^nC#aIdrv,}W0^zt9ٯ C툜ܛ Ƽ0Q-SӍh\tJfsdΘ knqzd JaP㺁 PYiYUwMf=<%ܲ`g|fվ;YO΀aj<2gpoi֨5%ӊm+Ԭfr~UX~|U% |&%|!_<+}.}ԅf2c;If y6AVC([9MQV Ze*I+L؂ [bVs5S 5 :?LZD@Z{CERs *Gvz      8 : ?   $ >% ' FP8Fpst >'4EFs ,7>A;<>DGHKMWb cfglpt5F^R0@+,:0578;>@BC 39;>GQ R[/68?16:<=?@EGC415:>B@4G4H4U4jj0k6kOoQoRoooooo oLb-0Feimr{BD6;lu!#$&*016>DJ./012 34 56 789: ;<= >?@ABCDE@FGHDIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$uu%&'()*+,- vz      8 : ?   $ >% ' FP879Fpst >'+-4s 5/`01467>A;<@f&glpt8?BDF^3:=?@kf"%'+/79:;<>C! 38;>GQ RVY[068=?S16:<=?@EGI\ 657:@B@4G4H4U4jj0k6kOoo@oooLb-0Fgi{BD6;lu!#$&*016>DJ< ?AJnoq /M@X`jp 9 = P X a r                 ( * 0 2 3 5 6 8 9 Y \ ^ r s t               ( * 0 2 3 5 9 = \ ] _ ` a q            5    ( * 9 = X Y Z ] ` a              : = N T V _ a z       023@E@@AGIl*?PQUZ]aefnopurHJMPVXZ[]`Zlo1@Q`lnp D!BDxPmpt T3EL#MOZw5!;6!8!0-g-------------------0<06A000000011/111111114MNФ *+n2h  "@s %0F`|(@BDK`oqvz~ª۪ܪ  &(.mp (*68<>@ACDFG=Pptvfoqdd  d, dFddd d|$ZӤ b   G  E  (  x  /] * 25 =IVh "Tw Ď  4 # "% $ "( #*?&-u(0 P+3  !-63 #09  (%3<< 7&5? K(8B| .T+;F" dj->J Au/AMzi1DQMP]37#-JPz'0co6@U`g8<<?  9 ? ?        5 8 : ? H P X `       5 9 U X r x       H      ' 0 9 `'0YpMRuGPvA DGHKMPPWW]cflptaDPY`l+0F;   8;FPYGP EPlp6:GPY`:>Y#$t$$C%//0/4@4U4DFFh8j@jijnjjjjjjkEkPkwk}kk@nnoJoOoooooooopՌ"22PRUUdgpjp|-0FP&)r{EV`x  FJ%**0m,0=@INOKPY^_q=$';BBGTWdg+0;@HPQ`ev{ GPY`S`mp|ߦ9@ JP#  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~AZaz ptvwz}/1VY`a Jnoq /M$ (@AX`jp 9 = P X a q                 ( * 0 2 3 5 6 8 9 Y \ ^ r s t               ( * 0 2 3 5 9 = \ ] _ ` a q            5    ( * 9 = X Y Z ] ` a              : = N T V _ a z       023@F@@AGIl*?PQUZ]aefnopuHJMPVXZ[]`Zlo1@Q`lnp xPmpt T^3EL#MOZ} EHMPWY_`}q   !! !!!!!!$!*!+!-!/!9!@ACDFG=Pptv!:AZf  &(:<=?MP]-@BIPuP'0c6@U`g  578<?@U`v   9            5 ` |        5 @ U ` r    H  # '0 1Ep7qru&DGPrv +?@ (*02359=P]a4GJ_a/D<H@F+   /?A  2:P\ .@r2s  0F`aeghjH3 P #$C%//0/4A4F4DFFh8j@j^jpjjjjk/kckwk}kkoJoPoppՌ"2PQRUdegpjp| ,NB!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ߦ9@ JP#_`ab cd ef ghij klmnopqrstupvwxtyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP  QRST  U VWXYZ[\]^ #HUH II8 8I>8888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.#$%&...,t'{''''m''(K)KFF( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33* 33333.3.3C<W<===b $=+=2=9=@====F33-24/0KKKK33333.33.333倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ DCE1E5F=FDDDDDDDDEE=EDDDE3.3KKKKKKKK..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3333333334.3.3#HUH II8 8I>8888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.#$%&...,t'{''''m''(K)KFF( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33* 33333.3.3C<W<===b $=+=2=9=@====F33-24/0KKKK33333.33.333倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ DCE1E5F=FDDDDDDDDEE=EDDDE3.3KKKKKKKK..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3333333334.3.3;Ɠ/-B=dH 'e3:>@9@9 h4g/DhzɫĪ#&YC}Ze h{o0L%K0Z2gPNzeaV}S;K!1b[U* ?b5"#XLEpƴ&(Z3D^HPDZ FE)GÂ)'KՇdG_wXARjz/cg.FQoP3Y݊34d~!nA D^˖QZIE/ԓ)rs*/'.04pq>mTuBHCI[_1wi>jUu)Y`,+ؤ2"1DH="U=m"p޼zSAFO#2;oPkowhY2$`-gx.s`Sqԍ߱7$3姑7cx {I$m$H-+-)a όF *ӒQ0u^B͵CЛ/v]?7N8pB֓}Z.B !aQvƒO FHod6U$Y2m DH풵%-)'N9(HoqTȥql*_y3 wYrUFG+m<{wo'޵:eE4Q\GtdF4Iݮ5}2rv}Ic!gy[QXw" #`nP/I 8G {QuO9o]%y"[Z+khܜyצxvGKpXHtUBձ+]J\rgB4 Rs{#|'Ly+fc^lALIq]XU%FLSP&JXr2횼!1 2*o{5p?w8'g ̸)-jQ~4JX+ycdGbSHc1(i6*}Ww\5P@uqh$j*m)<{/0S#w IәzA%.M@}q{qGp, 製6$RWAȨw/&cebg(%[< 6xNk?Ӓ :j2.+U|cGgl三;Jzv֣vj|Ym+" sܑ?(VѮ썗 smMCCHG",M]S("gS\ۻpa קlW, :s{f!+)? >R!xT$ s$؇SF-CYcoÁ 6 u`^J 8/;; Zc]gPTLvi72#.oc%.[/@P?kTyf)Jr}}:`W=oS+=Ư}ydWKvۅxk7-3pC]u"J2BPhpG_Ef|`5LNى\4 |Up $#~ 8R5ĸ9VN@3xKYgj6D=_RA\wǮ*vT X;oÏ^<6C";}JbF+C5tl}W+2L y8]QߜJˮR9+f2mS21yu }P%gzK09k9+Tt0u^y~c<}v@nHY |Oahg%eQR [J%4nA]1J MwDŝlïe!aո** ~bvCB^Ra~,  Wq8@ uW =Yl{n1d0Μ, qtkU嚁eF@2zm WnT̪ 1TYJELAqbpet)6'f;<"]츶<>[CcpCgo{Q5/DYxJ dWn}1eHլ:14;&h1G܌.[4=ٱ :5 C&"&h'ӏx3 +s,^@ :ŇV)H.%)%~֞W (;. 'S7:iW‰v\[a!DcN?A(o~1خ0&?z%틠~[ZLn6caO5:uex\Bj̨pP]a +{}ꐶV)Γb ި}{=p j}8PQ rU\cƙ3lH'm mZʇ\-&⦉,!\?gx<`Pn)o<#(~R.A3==* LwpiG9޸R*aA$}zok|9RSz0y:t|&1b 距?d V%O,bS  &(:<=?MP]-@BIPu'0cpz|6@U`g  578<?@U`v   9            5 ` |        5 @ U ` r    H      # '0 1Ep7qru&DGPrv +?@ (*02359=P]a4GJ_a/D<H@F+   /?A  2:P\ .@r2s  0F`aeghjH3 P #$C%//0/4A4F4DFFh8j@j^jpjjjjk/k@kCkckwk}kk@nnoJoPooCoooooppՌ"2PQRUdegpjp|TV  9;>@DFJKPR46NPnp%*0m,7=NBCK!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ߦ9@ JP#  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVUUUWXYUZ[\]UUUUUU^UU_U`UUabUUUUUcdUefghijkUUUlmnopqrstuvUwxyz{|}~U!(&UUUUUUUUUUUUUUUUUUUUUUUUUUU   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVUUUWXYUZ[\]UUUUUU^UU_U`UUabUUUUUcdUefghijkUUUlmnopqrstuvUwxyz{|}~U!(&UUUUUUUUUUUUUUUUUUUUUUUUUUU  !$'*+.1456789<?BEHKLMQTUZ^bfjntz "(.7=FLRX^djprtvxz|~  %*/49>CHMRW\afkpuz~   "$&(*,.05:@EJOTY^chmrw|  #(-27<AFKPUZ_dinsx} #(-27<AFKPUZ_dinsxz|~ !*6?HWclu~,8AJS_nz"1:IOXajs|   ' 0 9 B N T ] i o ~       * , . 0 2 4 6 8 < > @ B D F H J L N P R T V X Z _ e l t v x z | ~      # ( - 2 7 < A F K P R T V X Z \ ^ b f j n r v z | ~       $ ( , 0 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~       $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |  "',16:>BFJNRVZ^bfjnrvz~  $(,048>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx  !#%')+-/13579;=?ACEGIKMOQSUWY[]_cgkopqrstuwy{}*2:FR^jlnprtvxz|~  "%(+.147:=@GIKMPRTVXZ`filorux{~#,5>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0 CC%C`C#L#@###HUH @y CCCCC7888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.Q'#$f'%&X'_'...,t'{''''m''(K)KF5GF@G( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33 CEIO_ae 2C'5)'?)C `]*!)^;!^; 33333.3.3"<===z$=+=2=9=@=''S)===W!*fZFm3z3*  &. -24/00   |KKK3333>Gc3.33.333 :OJ倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3CC[C sCGOU]gCCIUgCIS_gCkCCCCKC<V?RKTZ~ol *V? KRKTZ~ol *V? ]RKTZ~ol *V? oRKTZ~ol *V?3334.3.3 c~l( )])g){))q))j ! CC%C`C#L#@###HUH @y CCCCC7888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.Q'#$f'%&X'_'...,t'{''''m''(K)KF5GF@G( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33 CEIO_ae 2C'5)'?)C `]*!)^;!^; 33333.3.3"<===z$=+=2=9=@=''S)===W!*fZFm3z3*  &. -24/00   |KKK3333>Gc3.33.333 :OJ倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3CC[C sCGOU]gCCIUgCIS_gCkCCCCKC<V?RKTZ~ol *V? KRKTZ~ol *V? ]RKTZ~ol *V? oRKTZ~ol *V?3334.3.3 c~l( )])g){))q))j !3J[_AJ{^C\Jw7]}Cw!cajUB@&n4QIUP"Iwq\-_Ɵ\hCJ9? 4iY3pjNѼ.+ʔב,$42j?+BhO" 9'½[%)<*jRz3jɊ;n!|[Qũi !1䵦S)4S2j.IYbQy8v8LgcUawĖ jbOFڐ!z2(3w Ǿrpi%OLsԴxn'1W/x $/[YI9-La]4ﰽ+VP9` 5Tpv ^7}-y|{"by8q"yD@PXr̔)AQF纱VIoh gRSr$L^ZE+;\xnWS^)NOjcDjP:滜3 5Z $"xE8N>NT/Sﳇ iC{ PLÞQG [~?"ҥa|E^PnhD6 )D.1=(iHfN`oQA'Ga}Bv<xI@wlFDq p[Gem`xqWn3bnGNR q8V$W|TSgTQY"R=:+8HL+P/hǟ ?\&Xk@ rRq65Jn\@0ǯxיXI qN/݅gpb#a "$#&&P{=!鮼 |Fbz?:7yEyRS@{(ڽ ]QGP27~ ?39>dd[מגX!h!1F{:=j+6g<^9*vvos1PY3$m4@qƤsfnKSA Erj0, XkE)j b\^9鸩NtHᮄ\4q:2J(R'o;.NF`g#'s$Aׯ*} }9,TtB%@f4YE" ڷ9BAVU'(d=koǡRlf*dcJ~Xac6 9s;ًiax=Wɝh:35RP-Dm[1ffe7QhTFp7)]((DiuN#CA)Oy}h UA?t'0FEh#9IZV6a=zlpJp@:ޕG5_Vٸb4IAS(S:oF%b(KcfqjQl2@z$Zf;ZdҀL+":XM=c/ˉ a 9] Ĕ&`ӛWfBX2b/8yY'V:ِK/\];5kvʃ&_BSv@+<]4rdtAxN>/wxRB@b+)N*8S|i{$WcI6k2\d|{g ?ƸG9ptyܠ#wnɷB3' 9[h'MlT: yg~ "I~EMe(]XlC]y2E߇yzVǣ(k 'j΍Bi-U’]7OC̳|<٫^b, ^h[8Cpj\˰'cA?ɨRT XT1a~uL DMk/`6%&Ն3rpͩQ$TZe( 夯$#%3|_B^2+@a d_+<~A>k ;YhIVuL6b* :g(`y!W+~$Q)uJ+%2H5'Mv:Dgw}5l<y5[k'[(c%{1%}B#%h~<_3Yq6*,29CҲ~ Gb_BG[Pc?IlAk"|Or$Z= G 5)=eX( U4+\Bx6,n rypr!li6[ylRb7ygݓx koQu4g$L&Ղu<Fu{⴪\?^%C=D(HM 9"l6#)\_*Tz8d 6G_ Z-ȸhǬ#C %dyZ%Z~=sꤏ<"yuх!=afNgy?*mURmG*mhP#] [w6^e}tr+*k%Csbk$<-0K#1 ] aNO3l6e%9m8+u~`q`l|=/iky* +۶+[$[?`~Ey1\3q4U^yuװw'C,f!*EInȱf=B G.aow]>:?qnGxį@xq$!j߶lN@gve RQ^q+zkA6y/+3C{]n^D ;,7)=O2O)ӄ 7V NܧV|$ZxeGD ]];be(jq0/v׭4xpەuCt92o@LmSЗŚSRYu$axmc*K"?7{F=~kvbk]vr!x:g嫂~4l@vs/ޚLЧ~wMmG=K12L =C&ss:y2nacfO4IDܾT^R A}ø@'YlDNGXn{,T\0{*] 0Gy}9Ӷ+p|F 6ڴkBvSy`CܘόdO2I#(7HPm vOsE}SBbYh+@`~ daUH1uyC;wonfh(4rU֑TTew>oGIUy\cb?9>g""m~cf~f78诤Gג߫jO2)RYtu ё|ؕ:S|۱sfFfhp$qKM C,Ue1X#HX 〽w'rPᰜ]HAq dx9dk/ ^BPg\9L(BI6!w_fQĩCQãQ(y$( [8 ưYJ)Xeި.8Ǎz̖ZSt;^sW~%1: 9  !!#$ !"#$%&'())*)+,-./0123456)789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ     [\] !"#$^%&_'()*+,-./0123456789:;<=>`a?@ABCDEFGHIJKLMbNOPQRSTUVWXYZ[\]^_`abcdefgJThijklmnopqrstuvwxyz{|}~cdefghijklmnopqrst'''uvwxyz{|}~     "   !!#$ !"#$%&'())*)+,-./0123456)789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ     [\] !"#$^%&_'()*+,-./0123456789:;<=>`a?@ABCDEFGHIJKLMbNOPQRSTUVWXYZ[\]^_`abcdefgJThijklmnopqrstuvwxyz{|}~cdefghijklmnopqrst'''uvwxyz{|}~     " eJߴy`ȡp: H?D'E+$ՓtLPpC&$x0ԆBdJߴy`ȡp: H?D'E-$ՓtLPpC&$x0ԆB3dE4(agy>|r_BӶh-`>[ͯ YU3 vE*g*$t!0Yj6JsP9=Qs +G<]9k]A0>%,Eg@2Iʋy+3­b-;B ^ӘYr YLchA8gOƲk=K.҈d_v=eu}@K M=-%Y\E~,87d(r2E6o ~X_*2@,?]$/PNPo20H(C8S9`u4WZ^"Х$(X96#A+Z%?L*Ro/㈁w|:~(9#y\V˵Hjm7`l5IKF`ySgACq"d}Ղ@!}?)&'9B7 hz?E7s025Ϯ\hn+ރDt.J" k)[2 ! C7=y%l"1*U^ێ.9oqq7bt3[%G::]L)<\/ +gPz )UA1]7_ mY<{u,< 6xȊ,/W,bW8F;Bgrٖd,U}l,n'fsy)v˛ [*oloK8f1cÌD%{9*a%_f8>ќqI.{kz8q{.S%ɰ3FOw [*c{W C!-j8*Fƞ+F tgJµXI }s.1t5jCsCԳ?YeNT^~)ms4TT 廀"m'eo~5\. Hz(q֭:t^|·ȦɉG$윑 C4 dNHҕѤNA; xTWO Ϝ;3 T>W&ե+6#iGPdP5χ0 P%h¯/6_G䈬Rascݙ [^*%. @U}1%:igc։.,Y_]nb6Yܤмf#9k*TC2@c^5Ÿ$ sգ+U(|O ƒxq`7LӘ:5`-.edr ecAd0:{ yY#;.P0.qP6J6R%ٮg وFU#h uk f.&dvŤ5ҙpZ=;$"r+ ^1"MxHrҞ,$b(9 :X!.ilnaZ+H8:ʼ-:q2&f;S簑LCr D, ZQCc#1Ff̞M"o楂e@eBxe ݖhEUnw>?m/&`(:Gh($%T`ۏ8b+}s )*S,ZױEs2tD s<±.z=-Y6Qkڰy!ey*0-U%]ԭ*tY$~=iq1fB9~ְ%㙎[a.mWqAo V>. M̅,Gq6j/Iij'^ "`^]Q')h!PMp?ۍne}_lY&pK߆]7 ҥ׷Β<dž*QyI".Z\-U46 eFI2ӂLaԞZw.~ybJi(r%Fbj܁3ܺ J5J+иJmf{2;c=\`[rI r5^ڀkd[4T9<)2Ʊ4wq O[).&qxFevQ}ԅ1C|k,ʫK礊SƸN܉+`RoUkogB&Le#){͟KB uÊUG]: ;~Ɔ'Cҍ"1Jx Ԁ R`-V=V'+b|k, |P<0g<91{Xv]] 72`3 3!ÔԆI|N qUѕCkt0obedfamԮr7(R9F UGpXރBP`K߿}~1]fc-2O3˯ GB"H}=YO}@M$! \V^+x8.Oҳ-qѝ[5hgǶe51@0Ye]ixxyd$Ӡ T y Mޟ@$}hi4gL;M>'u7'½=9)9/K$!prɄř.̕d'L' )lM3?Ld'zPm]H`vs8Eb5{f-jaPBY =S]j&-njPmQLRn tV'"V-ۚQxvI,~mnǟ yr2rI  0rGI̱LMm( .ǯ)sh47:=smύqKgqVr/>PѴ `G;v,NZB W94h~lv+HDD$2Do31ǵu$.Z_.Ӏ4gj&^ȝ,^l 𳿣Xx0WY| tiAؿf=(Ge4jAjĈu# Ri"= Xj†E҇dDOCHJ ʔ/#[lDfSZ r(Xs"^ V^jnh/7$[**@L EH78ls@lViz3iX+/XA٘ϹAJr(khtyERn5:oNvg#ݯ 8Oe*~ƹ=uG~w$'NRU.g25Raj LBF"P x @Ժi KmIW; 5k;#,rHHs!n i`$c uQ}yïHO11HB+<"nzd:2*r,x^zunrFHb(XY*D6$Admqtγۺz6E<a&PPŃm^3p;1՜Ģ"i /YD.keapذ#=F) ѡƶ޾`c$W8"]'!OczVjPlcl* 1@%#-tt|Yc.<[V<A` me'hCDl "5m mdLAM8%b9j7_)x%8eU@}H,|~` mbS֜+G%pbebYfxUˣqtbZWyr/{D_H2m:t;46mi|N;j%a5F랕Z&rrYYI~@ZMȠ4{4󙿩y tN˼Qm3Ţl$qhEs~u|uZdb3MOb-ץwjZ2NG՚O΃[4>G|giWAV /T\h,Ss8Jɷj>3M+*mr>4h' 1 eLa%ԉSC7XUd!L5J&`F KJb Cw% ^GPit׹Qdn&kaJm|C#Spos .F3Y|ouYu6Mw}JŻ{P_bfqŀj[o+-s.U6$  v.HM~|*C(XȿOF HU9*"MqUh%nRL3?|'53 uiba58gy<5ܲ>-F27#u*=00G0GGG#1(1G<1111HE2h2m2 HHH222PHv333ZH3iHnHxH/444}HH4444HV5y5~5HHH 666H6603G_H030304041 4 14GH21>471C4U1a4F1R4n1z4x14}14141414141414115 252$52.52)5@2Q5Y2j5O2`5HHr25|252525257HH2525:;1414(HHw25a:;Z:;o:;h:;:Y<:=<:6<:K<:D<:R<&3<636%;<;<3;<,;<:; ???HH)>9>1>A>oIuIJJJJJJI IIJJJJ'JIIY?q?a?y?i??IIY>q>a>y>i>>II????I!I>>>>II??????'I>>>IIJJJJJJ-I3I/JGJ7JOJ?JWJ9I_D7eDcIkD7qD8wD8}DID>>BBBBBB>!>B/BB9B%BCB)?1?CC C)CC3CI>Q>MBkBWBuBaBB@ @=C[CGCeCQCoC>>BBBBBB77>7>QI>6707$7/D<7W6?7!?{I9?B75DN7;DZ7<<<77A?%F7Q?r7l7`7AD<<<,8&8?-F8828?777MD76)D?88?I@~7GD7YD7CG=N=U=\=0j=c=00q=x===============I@Q@Y@a@i@q@y@@@@@@@@@@@@@@@@@A AA@A!A)A1A9AAAIAQAYAaAiAqAyAAAAAAAAAAAAAAAAAAB Br R && Z>  Zn>ZBn   r~  "JN zr&f>vF 6 . r&Z6J "Vb" nR^ *n 6Zr   ^62 R &NBVV  * v:v2  ~ fb*fz 6  6 J 6z ^ :Vf^*NzJ rb nr . *6 BF"6 b *b >* ZBRR~ F f2"^.&   & N  " V B^bvjN.JNR&RvF R F b j R2bJ*FNJRVZnr*2:Nvb "VZ2 KFB ^ F 2 B ^ & 6  & V v  Z f n " VNb~Zv2*Fv*R":N>VRJZfFf &2&*.6"tBRV^fjvny2^   & * B F R ^ b f n        " & . 6 : : B J N Z ~ b f n      "  * 2 : : V Z ^ f n r J z         2 B B R Z n ~     * > : . F N b j ^ V r z v     ^ & :.JRVB^bfjv~ #(- 26:NJ7.j<An~z~FPUZ_"26NRZ^jdinsx"&}. 26&2:Vv>BFJN&.>RVVbnvZb. f: 26":Nb.BFJ jjnvznrvz~"',2Jfv1;@E*2J6bnrj~OT Ychm&&.rFVbjrw|AZ az yy/00911279HJwxxy~Oaa88  ~"3::+*;<==]>>(*?@?*?*ABCC=DDEEEGFOPP**QQ**RR**SS..TT22VW33YY66[[55\\OO``33aaKKcc11ee((ffDDhh//ii--jjDDkk))llAAoo--qq))rr++uu**}}))&&CC&&**&&''%%EETTpsvw{}t&%@?  ~P/ 0OP_`/1V0a```  З‰‰@@yy}}88A '(/078?@EHMQQSSUUWWYY[[]]__`ghopqJJruVVvwddxyz{pp|}~~   &!&!*!*!A+!+!2!2!N!N!`!o!p!!!!$$$$,/,00,_,`,a,b,b, c,c,d,d,e,e,f,f,g,l,m,m,n,n,o,o,p,p,r,s,u,v,~,,,,,,,,-%-'-'-----@m"/2oy|}}u~Z00ZZZZZZZZçħħŧŧZƧƧuǧʧЧѧ֧٧SS``p0h0h!: AZ'((O(pz'|'''  @   @n_n `nn!""C_ k4jVO+u$KϲBQ hiujA xωV;X*`ZK]t)422/d4gEJ*i0Tqe/ε*/Q"h%N p, 7Cn贘7.HQY ѵܟv# rt!8)Iz8"Tk@ i|bi3G/z}ĸ)K^ yz)ȧ~ʉ-4Q ̦ݾgt/+1Iȴ= MDƨfDdhGn|=e>+X(UHG,qO̕]gq)ux<-h3b;|Jl-IuO/Ez)ʨ)Ij n" q_ܢehĽ΢y/7< B"cI 0) K7)|>}V"W.KZ-s1 RbǃAPSà\Qn6)<6ɪ%"2ELjrL0 2h?ŁMZ ]gӃuD%+l.|F5II@fQag<\~3ArYR3ՒbjUu8J ?*S(bw{D\C4a$#Blz%lW09u#z@Z)٨]m$C]R Eu=s*G+} p'W9|H7~˳Tu)saӖ1A[HȕҌGBLNVfKZ ʟrN.G_QCzeUz\ *'V,}/Z#|(Y-Њݘtd/ĴtEݺ:eg8@ /E 5'e bd#? O[L` zc>cjzLY wo XyS^$MN2@h:{BO#)Ŵ9GOcPJ/CW\@C(c=a~w)6tsF>4Q(zy, v0ȍ#N`Ho,7# =̑|hzC#؛sQԉ1A)ŻyOY)Ȼ󎼮iZHA,4 $JX@v FyzsxǺ&_=$U؋`*cDD&CK|󤘎v{!&|Bo`o)-z;0U$8O9(iXz<jxoY0 grl="Hr AU;! Ze{Aƴb13>Ӗ Y3S^p ^] @2 qKmJTޣ b@6(EuΔc'ORr56~g&*uE3LypG4%]B΀7;QZFZWy>PK__"4v2'ngoPLք=6u!;m-?8@g:uO 3Go>ɺD&}8\GbnjӰ#>怒#ZC!a2|6 [Ž\Q^jC;—GJ"ej4f4Png9o_ix0JFEwmMD\N+uy?pG&/ FfKdiץ}w|R/ιn֛(?>KҮ&s7~SJM׽ @-iT|KOF^R)tՅP,q2Iaѽ s_H-M} 2-2s)#%pu]D<|4۟u!o4S]gJ q:P@m wBf39?0 UWA>A}nm:~<OgГ2%Vn9.m loLnN̿0YipiL ЗMNP͵݋6"h/ceS ?fB=ba*n,15 sI]'A][')OϧIk ġ ǻs/c n/ /*g%`5"w?o̐ 8Wu,Y#ZMi=t{"hpU~عy,?΢G!!m$fpoVoZiQ]vnE)#hHb{l+:(V{)ݸLsR7gnNfĠrN?foN:;iEÞ!< 7Uǝ=ʓdSQ$hL@c`T*@u W6YWHֹ0CK D3Q kX]h"8L/`՝ OE7hT ^*,lK[] CuٹZ07SƬrm 4,JՈGG7 񜱢lqfTC m2_ `OHȦJ&Ef}9n_'&`1 2H 1Vg (g?. 0GOmVr@]:~zTYq&`0g!i?"+Kt3Xф5e#j4U/swbyM@VΙ[/P“:%G ?gN[L 2AB ۅ|_Ε6"B"ǖ%F<^3~Z4Raވ\T!wSGxB cFU+ :5NV ᳨ir?p2hx9.ٶ9.S,R͒ͅsh1f'-VE 6&\CvEUnp}Y47rz٩\<84r7nhYFȨktqr٢~cQo&&ap\TRT.J[o5[SPQxEk>,پ(aw (4ä[HKpsBpYAI$rҌl9BNO mY{cz=VE E0ҸQwH5KC]!@9(wJa^A)Rt}xÞLn!> 49ʔ q(u\$i L:'4q $j0Ȱ0I|WO˪}e.tb}0HlTﶶ.n\q .OeX&n1-.?r}I@/`Mh04x![onw S(*lU!(t"|1 X2T:Bht/dNFJ:Mw7)!ne؈|$9_W@`' WGxK^FΘ+ \QmGt# GN D:_-8TgO<ч7(2/M* [sAN aO/H4!p ]|VIUoГ~}y/toKEq,sZX >\HW(tQ.H/ۏ3Gb׍.`Ԍɴf:u}6;$;'Թ1jIߔ(=orH:K~Kn%\\EK<Ƭtebt )E@o.:& {d^Pjuʝ:(ܢC6vSS ȷB~9*O:ַ,^c;c6gʷ*ml7Őc`i V(>苌*Cqq[=ô_`C* jg䯍X{Š<& J*Cߩw{j¬rΑmoj|Rlw&!} Ff7B wW/Nt)dԢsW)TH0(e6-_ײ>A֌/ AJXJRLx+2x13hŸhieFR2-x5%׌)TtMj`B:7 f F RHR$X+q^_*p%wJ7xi bIlhU٢8!>k\xTJ `x0VtMUB15CF"ǘE`YDJIV}F6T">;ItRF͐SN,uf 8#PtKӅĒaOa[Rvg5}i:f< f-^\&~~g|RN]/I6÷R |M{ZQ Dڙ%j&UHġoB~0e{'J2ߥ6bM\n aBR`~PIa,Z(؅v"|}+p炥LP©@d1X.?p]XI [ H b-Ϝe|SϘ:b7֤ѨVuQ q_r3М(iDg,e:lMt_XfωRcH;jR5F\>ET 2Ehg\K,-@]T@JFd$30k5'ō,Գ0$PARi=sYBZ GSAʊlMa/_Af'QM Yܳq~*ZDY\2/^B̿U] /uq -^^41L횚͐~`f .V-ʸ Bn#fi͞ O ȝ5 LQ2*|HL߳[~X\U=)}TÀͦ" sTmM;Fo[S(nH`F":8ynE3،8!*y\S"C^?O L& -fr_b^+FM'P|kCq_C9g5Mq1)U^a 3UNݥGyWӁ=Y?IaN'ʬi!3{~?B`J1'(- Ɯ%lT]K頔ɭy;J:BEv2JYYYM.JShI `IB,U/eqSЭCM N]jLSOEao,YPKn%TyYDC4kGձ]aa4sd)Q 5X!C; L|/wھҗjFB_q_[NCAq .s| hAN5|HW*VHh:Dv1P&6 SydIVA/)I32ψ}Cߕd3] jrFY2X!9bB钵K'H)ŝ`IBW_u]͎,8m?x]OBã݌D۞{76ȴddP~ p% >14{ D0HzFDSm^p1pLP܅OȊiH#@݄Rw*lݖ53(hWx;ޑz忸aX=oB[dW'"H&MW5i:KPhÞcWrAd 3Phӑ#A0  ٷ`4,ߏ"I+r͑ό6zhJYl401eI"'d~Rl!{y4ho'#~uy^:U`Zn,";tMmFpUJr fNW%+0:! >>u9 {3Fhw9_4Qe` HfU'HEXC,5r(`R;!j4ۘ~M[pϵ4_l.u p:s}ŵďß$%V+=(T`֝OiǏu9Fⴷj GSrZG]:/hiwv`F/@Ntʹ-:%ZKJw=8\,9jY.$ݢ"d_G1PLb?y4M@aPKɱm׊CU k/Xqp-hm/ga7)^neE`ØKqDutĘ}"nmiuk@ -E* qy4W*Q{܆OƏ{5kDCSfIYr־N0ߺဖᘞ5Me      }Mᶶ3ᐟဏE@ 1@@33 333@@@   3@            3@  3@3 3333@@ 3@330303030@0@0;@@0@@303@@@@33 30@@;0 @30@@@@@@;@03@3@0@@0@ @33;@3@ @@3@@ @=333303@@ 03030;03033003 30303003@ @]@]@Ἴ@    @@@@@ @@@@@@@@@@@3@@@E฽@@@@ 3;8@38@ 3@@@3@@30300303;33@@@ @3@3@@33@@ @3030@0303@@@@@@(@303@0303@;030303@3 @@@3333@ 30303030 0308@3@ 3003038;3 30303038@0303@@ }@@@33033303@ E@E@EਯE฿@3@@Q@Yaiq @) ~2 9 @@ဏ@@@@u௯@; @@@@@ @@@@3@@@ 5 5 @ @3j r y  @@5*U*u**u****+5++@ @  E@e@@@@@@3@3;3030;@@@000;3@@333308@@ 30303030 8@@3@30303@330@@03033333@0300;@ @@@@@@ DDA m@DD E-E E 030300;@@@@@@ ME MM KO -U -]V] kMmmp@@ q  smexoyQAi@@1q  @@@@@@@@@@@@@3@@@3@@@3@@@@EဇሏEᐗ %@@% EဇሏEᐓ@@@@@@ @@@@@@@@@@@@@@@3@3@3@@@3@;@@@@@@@@@    3@@@@@3@@@3@    3  @    3@              @@0303 3;@;3@; 30030;3@3@@@3303;@ 0@3@300308303@@ @03038333@ @@@@@303;@@030;303@3@030303 30;3@@03@030;33@03030;3@@@ 3030383@@ @30303;@@030;3@@@003@@@@ 03@30;0@ 33;303;@303 303;@@@ @03@30;@@ @3@030303@ @@3@3@3@3 3;3@@@@ 0@3@030;@@@30@ 30@03@038;@@@@@@@@@@@33@@@@@@3@3 @@@@@ဟ@@300@3@@3@0@@@@@@@@@@@@@@@@@ @@3@3@33@@@@y#######030@3 333######@3@@@@@33333@3@3@@@@3@@3@@@@3@3@@3@ @@@@@@3@ 3 @@@@@@@@@@@@@@@ '@@(((((((((@((@@@@@@@@@@@@@@@@@@@@@@@@@ @I)1 @@@@@@@@@@@@@33@ဖᘞ5Me      }Mᶶ3ᐟဏE@ 1@@33 333@@@   3@            3@  3@3 3333@@ 3@330303030@0@0;@@0@@303@@@@33 30@@;0 @30@@@@@@;@03@3@0@@0@ @33;@3@ @@3@@ @=333303@@ 03030;03033003 30303003@ @]@]@Ἴ@    @@@@@ @@@@@@@@@@@3@@@E฽@@@@ 3;8@38@ 3@@@3@@30300303;33@@@ @3@3@@33@@ @3030@0303@@@@@@(@303@0303@;030303@3 @@@3333@ 30303030 0308@3@ 3003038;3 30303038@0303@@ }@@@33033303@ E@E@EਯE฿@3@@Q@Yaiq @) ~2 9 @@ဏ@@@@u௯@; @@@@@ @@@@3@@@ 5 5 @ @3j r y  @@5*U*u**u****+5++@ @  E@e@@@@@@3@3;3030;@@@000;3@@333308@@ 30303030 8@@3@30303@330@@03033333@0300;@ @@@@@@ DDA m@DD E-E E 030300;@@@@@@ ME MM KO -U -]V] kMmmp@@ q  smexoyQAi@@1q  @@@@@@@@@@@@@3@@@3@@@3@@@@EဇሏEᐗ %@@% EဇሏEᐓ@@@@@@ @@@@@@@@@@@@@@@3@3@3@@@3@;@@@@@@@@@    3@@@@@3@@@3@    3  @    3@              @@0303 3;@;3@; 30030;3@3@@@3303;@ 0@3@300308303@@ @03038333@ @@@@@303;@@030;303@3@030303 30;3@@03@030;33@03030;3@@@ 3030383@@ @30303;@@030;3@@@003@@@@ 03@30;0@ 33;303;@303 303;@@@ @03@30;@@ @3@030303@ @@3@3@3@3 3;3@@@@ 0@3@030;@@@30@ 30@03@038;@@@@@@@@@@@33@@@@@@3@3 @@@@@ဟ@@300@3@@3@0@@@@@@@@@@@@@@@@@ @@3@3@33@@@@y#######030@3 333######@3@@@@@33333@3@3@@@@3@@3@@@@3@3@@3@ @@@@@@3@ 3 @@@@@@@@@@@@@@@ '@@(((((((((@((@@@@@@@@@@@@@@@@@@@@@@@@@ @I)1 @@@@@@@@@@@@@33@S`i2Տ\ B噜asRU^RxZGv\cҾ("J382t/)?;)?Z;S$YJeefXI- y]v>ᮺsy,,SoΊߙZiKy+ؑlHFq6N%#MDz 0rxjm5Q^3-O\5x,#Gf+1̯!P;LvU0 =*$Jߓk<ܭ 4mx݅KbSh@drk3o=qԇQhˌɩf%H;WK`0Kmtv-^85A>~;ΥuLR5]JBϓ CszΕ IBNww&Ԧ`fʴ"U 8G5U]_nUc^s 4!b/6#u{+ջCn6%!3G-;eUk niԜ %Cpv,n% DH(W^j8dW*͖7Ƽ>'u.h3DJkq!jz~X1[Dd)غ`YLhr3)$oE=VyԶӥk0bЏlwHijޔ3<)). %I qM^o(TPa,J2q\":1n1'H cmƚp̻, }x=M֥`%NFN *!&8#Xl᮴ fo(,nGMȟPEyۤ̂(}eC2f;^j@>Ծ@J6VcؑDwZhN"uO>6qZS >D[Z U1(\Q† yX葀r9Mnbf-!= -@s]Ι 4f|hNr#j9 bf'NDGCɨbK"=`?woɦq!M8U"|Hj`FS*~+TmBDt.OSU9zc%C1'~U5yX=X4/UKc5u|&o<%y^Fˋ#w" _uv{fg6]I@'᷂YyX7 1 ?gjgν$m\,B`A֋nsXmSx@I̮jPu9Hh[BRm-^zy;Ӧ{xd J2_`U\&;\HH/oJ&$ڔ;W`X=vWζ]y+zCB,Z[lS*xP1r'0(d$5VN1J<왾6w6^F?nY{U(ω/3&t~W!v]?OH8oꖐSkuzcZ (YImM\ٻ-qd`3ϪMy4,9UgAwGDrĆ`I,"u(19b7]k62c}:%˅tח1]dqӨMS{$crf-bgmYGB`=ހtRx Sal'.gVfQp[yͶSۣ2Fqk(󗿗φͲ"a}ȁ_ Wkyl]=;t60c1ÜD۾`wD-HU;մJM-u-]cxZbҶxF\4|q* 4M=5]z Y`tWFK?p8+׬XҘ'Fc{#TwBձL;,)UdJ_ wsj=r{~T>*bC#Oa鍲5*g8Ԕd1Ӎ@~8<vJ)?@'D|Y+(0TX0tx>ݔ<6Rj20:'Dܡ?^:)巧`Htޥ!d4[IV֑f4 ʕ%ΟkB@OQ]=;i‡FQ* k)XrGVieg!Ysۓ,S>ih0PҸ:BAsUrsONdP#9JFE߃b}$lۃ2kr]ΖKde2?/nO|{S ȢUra6__,tuE7#8H,RA,ZQ;"sMH=`>_ Xf&1ѷ?RpIFwϻ3ӛa՟k.dȂS|nǰsƣz={ch iN\ ->!Qab OInHiãۉZ&ޓuZF)v:k\m#X񗳻e 3R,.X}jtYg+WN¨@8H۔labMPF wfנ.t `2$^V$ il`#c?ʏū|0ks]|d|Fk:Bzk ,SҘl.J{qDw`zdrIdGJ|l_bϛ= -]:NJy4yxӺ9QX*r`K6(eNC2)b"=s>'=z_R?Z}5)f&ϰʨ&4*cݓR04`Cx g|A8?, LKK6)e^y 1cJFM}e5CENKP.?q/^9ϛdLZN'sv]pÂz}oj:U&N6U (&.tE+۲Ꝓɋ ;oOFkȒD7@n ˻zj B̽ܝY-#JFTW"GdeT-V+~xY~)p$wZU|Hihaέ["RDù?BrAggɟܥ k`ŗ T`鸶h;#)8>G#g$!e r v6i>[ΛpD0 ’sHo^+Ʊ;Hw 68(J촰c%2R l (8Z~HW_S#YQZ-7yHelE1D"'Xd˞k?/"=~Fr6-j[wŸG꺔R̆$bGט#?9': dҬ$0hS>-_Uj[n*uRDZZE dug.k`MFU=Ķ{s휆&|VsJyݭ'vcR] X`UY~S|n𸪯qޝhp b!q&" ŗ{`=Ui jP|};+*\B`w[zY78U@gf/Flk7._=;K##⼺;1a ^wl}9!J5U"ST.wAP~uu\T Ғsi$$dDKN^wÿ-> ;ZJbڗ<섎ꊭaнK'Jg9EpCK,΁My%1^_B0CXn >;5Snʋ }4Ud^wH~t*J6ڝXv%"݃:QӮB5yrjR;uD<u'm8c$S,^{tPd2l1+a}JϟCb.2:]‡ I62wyh.L[Mľ K7٬:|S\ 5$oe(KB.E.D?ˈPo ̼H9i$ MZDs00 h16A_p=|6+ aw̫Liv2=BzՔI?il7Sr3܀#GGŧN@a+eX&1Zd;Onp= ףp= ףp= ף@P$ (k@C*焑 1_.@v:k #NJbxz&n2xW ?h@aQYȥo: '@ x9?P 6NgM"E@|o p+ŝ(lL672V߄@<\l: K{ΗԆ H½D PvU1P?]%OʡZ7и@=J'ƫ͜mCư#o\{2~,݋] 7 n0b/54"&EE=!A+p֕C)@_v $_E^D+S69uq`D]ȩdL1FUJ:Ack݈-~<MXdQpl԰k2#FۄEk0ScgedF|~`?~On_O83^Iwm,ӿ\U /ssc*Og(~MTၲQ5F&B|Z"e B‹Xixu3_FiYW皮dR7/-#]gk}{x F6@2cPME;P fδzBΨ?]76l3oߌGA]DG #٨tY l*/h7ȇCØE)wyTzm)^Tj fX_4'R⌏.]^EsCupv]dB!ܨSyJIj~IrhcۇiEB<]ҩE֒PֲE# ś[[hwl26h& C2d#DѸIDvja5 bl _ӨŹzÇ67h͉,TIIdZk"!"lk*Ǭ唔o=]S59#wˌ:BnSv*xriJh %i]_fX~ь[eaz?w/8y/UJX8σS*g].a{tZݲ\*q߈=9tau]V7zGѹ: Ub" `M1k{W+ ~Z픝_vIsX}Aȏ%زnYzdұَ_o_FTX H{%;#jVJ ,ڔQ+(B]D"ySJt:5(+EWA\Bu-/ں5ai .|]|i~C%94›^g.²xº}DKa2si*bd2u{}(>DRs\x5˲dj:aEz®kE='WT[rKxT6c? <ݧjW<Ϗ(QDme %JdCYxķ ]=apeFU Yy "WB$ ˇu/Sm ξTSܷmh.$*(弇Di}nVyu܁7UD`ג{S⻅jU'9pxtmbCF'z8TfAX1{jiQ.DA"&v'ZҪ/ iyhx{RMh, XǂVpEa75 . @v`|BǼ5Гj]CMĸR5VJpz3zrS!{Z\L.YOt֨Ysyob dp+EV݊>ԅ6+>m.7J7̶șŇ" @Ա K ж%YJ^MdD.:0ܵ\$~sީqG_,>%t]V w(N/ukPopk/t#[DzT%k$M,4xߎT¶@)s$ Уrt-ČV<ڒez|/~qeݍ~e>"t*U1Vx_':5k\(37h*VFs-Ciu+-,Ws)b);gj{IB_s!6p$wqBv/?ӌ# S@J286c]ɞ>CH|Y{ ځo&|(1ca/r}c%2t.5_(o?0:ͳ[cрyϧz^KDb2üfQ6^U+Gٍ@4õjQOP4c3Vnع^G/ O 5X'a'bbLBx8}Vc G,ݬ@!tlXxP]C 7 RzRT%`ϖi *.G|$ PATW3L~tґR?GQ.G#wX嘡cHv WD^/gQe,s?5;X^~OK ނ'aB.cy9'zխ"xR7t8DZJٵ "Ho·"MPu8벚ƣJy©Qa_A33Ӽ(ׁl"M"sǥ 4k"hk9@fu)/ ZI`So:K[8h#`^ʵמrFB,8,Fj¢l㴒$s ǓbwRŧmO˸8ۢ:g(3tsɥDm@e?S.R_PD;ϕ&wd C4>04x^M Ɩr =A}_Lb%xW[wߺnYb47>'6r  ;~"6汧 O:!UWʏbO∩*r;듧EuϬ3f0rIl|j; hۘs*hیC?C:ԑy!YkO jHI6.iyF㌄ 9NDN @iꅕ!o!]eqKguDid>00G0GGG#1(1G<1111HE2h2m2 HHH222PHv333ZH3iHnHxH/444}HH4444HV5y5~5HHH 666H6603G_H030304041 4 14GH21>471C4U1a4F1R4n1z4x14}14141414141414115 252$52.52)5d@2Q5Y2j5O2`5HHr25|252525257HH2525:;1414(HHw25a:;Z:;o:;h:;:Y<:=<:6<:K<:D<:R<&3<636%;<;<3;<,;<:; ???HH)>9>1>A>oIuIJJJJJJI IIJJJJ'JIIY?q?a?y?i??IIY>q>a>y>i>>II????I!I>>>>II??????'I>>>IIJJJJJJ-I3I/JGJ7JOJ?JWJ9I_D7eDcIkD7qD8wD8}DID>>BBBBBB>!>B/BB9B%BCB)?1?CC C)CC3CI>Q>MBkBWBuBaBB@ @=C[CGCeCQCoC>>BBBBBB77>7>QI>6707$7/D<7CWCCE?7!?{I9?B75DN7;DZ7EEE77A?%F7Q?r7l7`7ADEEE,8&8?-F8828?777MD7EE?88?I@~7GD7YD7CC GQQQSSY]aceeeu<uWDEGKM[ lE$ZI^#j#$F##R####X##d##$$SmxqYGI[H| G=N=U=\=0j=c=00q=x===============#%')+-/13<EKQW$(,048<@DHLPTX\`dhlptx|CEGIKMOQSU*~2 Z j r v r  > J j v z ~  . 2 : > F N ^ z   &.nrz~>~BJ^jrz~&.jnvz~:NRZ:>BZ^fz~I@Q@Y@a@i@q@y@@@@@@@@@@@@@@@@@A AA@D#DA'!A)A1A9AAAIAQAYAaAiAqAyAAAAAAAAAAAAAAAAAAB B'Z"&n*.26:>BFJNJK KKKK"K(K.K4K:K@KFKLKRKXK^KdKjKpKvKRV^bfjrvz~v  *!!!!!!!!!!!!!!](f(o(x((((((((((((,$,!!!8"!"!"! "P"n"h"\"">"J"b"V"","t""""!2"D"z"""&"""""* "*26>BFJNY/a/i/q/y//////////0//v  Z FF Z>  z "> z R F :  !$'*-036?#2AP_n"""4 "&*.26:>BFJNRVZ^bjrz~*(C,*S,)%0))i0*)))+ +*+/-+:+,'--c,G+.-A-T+))/a+s,60**n+*%*((/*9*T-{+,g-+M*C*}0+z-W*,a*+k*+G0+,+(X0u**+***,+(-/,+0**+( ,,#(-* (7FUds""""" ##"#.#:#v#####Dcw,08(F(1(?(,zbJ#u }eV,LY/q\2l$DTp(GX$,$PxM((t_hM&kP)\}f%$x{5;>`ASht$ $-<KZi"""""###(#4#p#|###########@r R && Z>  Zn>ZBn   r~  "JN zr&f>vF 6 . r&Z6J "Vb" nR^ *n 6Zr   ^62 R &NBVV  * v:v2  ~ fb*fz 6  6 J 6z ^ :Vf^*NzJ rb nr . *6 BF"6 b *b >* ZBRR~ F f2"^.&   & N  " V B^bvjN.JNR&RvF R F b j R2bJ*FNJRVZnr*2:Nvb "VZ2 KFB ^ F 2 B ^ & 6  & V v  Z f n " VNb~Zv2*Fv*R":N>VRJZfFf &2&*.6" 8<DCE #&1E7E5F=FDDDDDDDDDDDDDDDDEE EEE%E+E=EDDDEEEEE!&&J'J'''5'5'.'.'<'<'C'C'C' ' ' '&&' ''',;@EJY^mrw   + 0 5 D I X ] b g l q v { !!!%!*!/!4!9!>!H!M!R!a!p!u!aEgEEEEF FFF&&' ' ''' "',1;@l q !!!!%!*!EW!\!a!f!p!u!&&&'',EJY^mw  + 0 5 D I X ] b g v { !!! !/!4!EH!M!R!a!k!'',6 ! !a!k!EFMFUF! & : ? N S chOT|   ! & : ? N S chOT|     + IEIEA$V$V$]$d$y$$$$$$$$$$$$$%%/%/%K%%% %!%!%(%(%R%`%`%g%g%n%u%|%%%%%%%%%%%%&&%%&&&&@&G&N&$&2&U&\&+&&&&&x&x&&&&&&:$O$H$r$k$$$$$$$6%%Y%%&&&&j&%&%%%%q&c&%%%q&$$9&%3$%|%K%$&D%%((#))(),)=%-3,)~57?3333333.......33:6w{CCCC~75?: 9=;y ACmECCCsECyEDE DEDE)OEOEUEUEEE[E[EEEEE,,////2255558888;;;;>>>>AAAADDGGJJMMPPPPSSSSVVVVYYYY\\\\____bbbbeeeehhhhkkkknnnnqqqqttttwwwwzzzz}}A/A/I/I/Q/Q/ nr~fnv "&*.26:>BFJNRVZ^bjrz~KK |KKKKKKKKKZ"&n*.26:>BFJNJK KKKK"K(K.K4K:K@KFKLKRKXK^KdKjKpKvKC>bBFJNfj N&(:4.CRVBX[`ps|eRvjocegikmoqsu  !$' *-0369RKTZ~ol!#%')+-/13!#%')+-/13!#%')+-/13!#%')+-/13!#%')+-/133333333333333333333333333333333333333362,/;D}M>\nqtwPbhVkJS58AGY_e/;z>nqtwPbhVkS58AYe;>qwPbVkSAYe/;z>\ntwPbhVkS58AY_e,/;Dz}M>\qtwPbhVkJS58AGY_e/;D}M>\qtwPbhVkJS58AGY_e9BHNT  U(GeiCEGIKMOQSUWY[]_a'' B G * "  " f   ~  ^ B   6  j >& R >tBRV^fjvny2^   & * B F R ^ b f n        " & . 6 : : B J N Z ~ b f n      "  * 2 : : V Z ^ f n r J z         2 B B R Z n ~     * > : . F N b j ^ V r z v     ^ & :.JRVB^bfjv~ #(- 26:NJ7.j<An~z~FPUZ_"26NRZ^jdinsx"&}. 26&2:Vv>BFJN&.>RVVbnvZb. f: 26":Nb.BFJ jjnvznrvz~"',2Jfv1;@E*2J6bnrj~OT Ychm&&.rFVbjrw|     :*  Z J Z J                                 :*:* zj           :*:*  :*:*:*:*:*:*:* :*:*:*:*:* zjzj*:ʚzj :*:* :* :*:*:*:* zj :*:*:*:*:* :*:*:*:*       zj    :*  Z J Z J :*                               :*  Z J Z J                                 :*:* zj           :*:*  :*:*:*:*:*:*:* :*:*:*:*:* zjzj*:ʚzj :*:* :* :*:*:*:* zj :*:*:*:*:* :*:*:*:*       zj    :*  Z J Z J :*                           @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ ")1:BIQYai                        q5M  =yy=}                       e=}  }}= %==  Um   } =  -E]u=}=                                       = 3 333333333333333333333333333333333333333333  % @@"=@@@@:*UU-=-@@m@            } --                 3333333                           @=}=                                                @@@@@@@33333333333@                                          333333333333333333333  3   9AIQ                            3333333@333333333333      @@  3                              3333333333333333                         333@@@         @@@@@                          @@@@@@@@@33333333                               0333333330000;003333333Yaiqy33300@@@@@@@@@@@@30003333@@00@@00;@@@@@@@@0@@@@@33@@3@@330@@@@@@@@@@@@@3@00033@@@@33@@33;@@@3@@@@@@@@@@@@@@@333@@@@@@@@@@330@@@@@@@@300033333@330@00;@@@@@@@@@@@@@@@@@33@@@@@@@@@333333@300@@@@@@@@@@30303333@@00@@00;@@@@@@@330@@@@@33@@@@@@@@@@@@3@@@@@@@@@@@@@@@@@@@@@@@0030000@333@333;@@@@@@@33@@@@@33@@@@@@@@@300@@@@@@30300000@300@003;@@@@@@@00@@@@@@@33@@@0@@@@@@@@@@@@03333@000@000;@@@@033@@@@@@@@3333333;33@@@!)19@@@@33A3IQYai3333303q33;33333333y3333@3333333333333333333333333333333@ !)Q19AIQYaiq !yQ9AIIq !)1}9AIQYaiqy                                           -M                @@EEEEEE@@@E@E@E@EEEEEEEEE @@!)19AIQ!)19AIQYaiqyYaiqy@EEe~ @!*2:A@@EE @JRZaEE% Mj*r@@y@=Vv@ @@  @@@@@@@@@@  @@@@@@@@@@@@@@@@ "*2)I)1 "*2@Q a!)9A@@@9&Efi A)I9QYaiq@!Qy  ! )1= 9A I] !!} )1 9A I !@@@@@@@@@@@@@@@@@@@@@I)1 y > ^ ~     " @@@@@@@@@@@@@@@@@@@@> ^ ~  > ^ ~  > ^ ~ >^ !)Q9QAI  !)Q9QAI  A I }=YAQ Q Y                  =333 @@@@@'5'U'u'''''(5(U(u((((()5)U)u)))@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ a 333300%))*U+u+++++++,,,,5,5,5,U,u,u,**u,u,,,u,u,**u,u,U,U,,,,,@,-5-5-U-u-----.5.U.U.u.....u../.u.5/U/u///-,//050U0u000001@51U1u11111252U2u1u222 22353U3   u333333454U4u44444555U5u55555656U6u666 ! 66757U7u77777858U8u88888959U9u99999:5:U:u:::::;5;U;u;;;;;<5>5>M>e>}>>>>>>>>> ?%?=?U?U?m?m?m?????????@-@-@-@ @ !)@19A@@IQYA%AEAeAAaiqyAAAB%BEBeBBBBBC%C EC!eCC@)19A@IQYaiqyC!CC@D !)19AIQYaiqy%D                       33333333333333              33                                      =ED     =             q!)eD        y}D}@@@@@ @@  @@@@@@@@@@@@@@@@@@@@@@@@QA e-eMemeeeee f-fMfmfffff g-gMgmggggg h-hMhmhhhhh i-iMimiiiii j-jMjmjjjjj k-kMkmkzz {-{M{m{{{{{ |-|M|m|| |||!)1 }-}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9AIM}m}QQ@@@@@@@@@@@@Yaiqy@@@@@3y !)@19AIQ@Y@ai@qy@    !!!!))))111199AAIIQQYYaaiiiiqqqqyyyy@@@@@@@@@@@@@@@@I  !!))11999AAAIIIIIQYaiqy !)1:BJRZbiqayAi!)19Yai1 QYa qy !)19AI!QYaiqy !)AIQY)qy19 Aa IAQYa!)Y1 Aiqy !)1Y9AIQ !)1Y9AIQ!)1YQa)19!)1YYaiiqy  !!)19AAIQYaiiqy)199AI@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@QYaiqy3333333333333333}@"}}@@@@@@@3333333333333333@} ~*2-~M~m~-~~~~~~ ~-Nn@@"*2~-   " * "@2 : B J @@@@Q .N@nY a i ΀q y !! ! !!!!!!!!!!!!!!!!!)!)!)!)!1!1!1!1!9!9!9!9!A!A!A!A!I!I!I!I!Q!Q!Q!Q!Y!Y!Y!Y!a!a!a!a!i!i!i!i!q!q!q!q!y!y!y!y!!!!!!!!!!!!!!!!!!!@@@! : B !*2  a !I)1 "" "* J  !)Q9QAI 2 !r !)Q9QAI !! -a MMḿ -Mm͂ -Mm̓ -MmM̈́ -Mm ͅͅ M-M-mM͆͆MM @-Mmm͇ -- Mm͈ @@@M---M-@@MMm-mM@@m-m@@͉͉@@@!!!" "-@Mmm͊@@@@@@@@@@@@@@@@@@@@@@@@@@@@=UmUUmU=@͋=M]M}M]M=@=M]@}M@@@@@@@""!")"@1"9"A"I"Q"Y"a"i"q"y"""""A""""""""%"""Q"EI # ###!#)#1#9#@A#I#Q#Y#a#i#q#e@@@@@                               33@@@@     @@@@@@@@@                  @@@@@@@@@@@@@@@@@@@      @@@@@@@@@@@@@@@@3300@@@@@@@@@330030000@@00@@008@@@@@@@@0@@@@@00@@3333333@@@33333@@@@@@@@@@@@@@@@@000000@00@@338; !)Q9QAI  !)Q9QAI  !)Q9QAI  @!)Q9QAI  !)Q9QAI  !)Q9QAI @@@ @@@@)Q9Q@AI @@!)@9QAI  !)Q9QAI  !)Q9QAI @ @@!)Q9Q@AI @ !)Q9QAI @ @!@Q@@@AI @ !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI ##@@##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$q$q$@@I)1 I)1 I)1 I)1 I)1 3333333@33333333333333333@@3333333@33@33333@@@@@y$$$$$$$$$$$$$$$$$% %%%!%)%1%9%A%I%Q%y$$$$$$$$$$$$$$$% %Y%1%a%i%q%y%%@@@@@@@@@@@@@@@@@@55uu5555uu55᥌                              @! ! 1!!a!i!q!y!!A!Q!!!Y!!! )!9!I!%%%@ @!@@ @!a!i!q!y!!A!Q!!!Y!@! @)!@I!@@@@@@ @@@@ @!@i!@y!!A!@!!Y!@!@@ @)!@I!@@%@ @!@@ 1!!a!@q!y!!A!Q!!!Y!@! @)!9!I!%@%@ !! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@ @! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@%%%%%%%%%%%%& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&9& !)Q9QAI &&&&&&'''!'@@@@@@@@@@@@@)'1'9'A'I'Q'Y'a'i'q'y'''''''''''''''''( (((!()(1(9(A(I(Q(Y(a(i(q(y((@@@@(((() )))!)))1)9)݌A)I)Q)Y)a)i)'q)y))))=)))))q())))))))* ***!*)*1*1*1*]9*A*I*}Q*Y*a*i*q*y******************+ +++!+)+1+9+A+I+Q+Y+Q'a+i+ݍq+y+++++@ +++++++++@ ++++, ,=,],!,),1,9,A,I,Q,Y,a,i,}q,y,,,,,ݎ,,,,,,,,,,,,,- -=--!-)-!-1-9-A-I-Q-Y-a-i-q-y-----]-----}-------. ...!.).1.9.A.I.Q.Y.a.i.q.y............ݏ...../ // /!/)/1/9/A/I/Q/Y/=]a/}i/q/y////////////////ݐ/0 000!0)01090A0=I0@ Q0Y0a0]i0q0}y00000000000000ݑ00=]001}ݒ 1111!1)11191A1I1Q1Y1a1=]i1q1y1111}@ 1ݓ1111111111112 2=]2}2!2)212ݔ92A2I2Q2Y2a2i2q2=]},y222222222222222223 333!3)3ݕ1393A3I3=Q3]Y3a3}i3q3y33333333333@ 3333334 444ݖ!4)41494A4I4Q4Y4a4i4=]q4y44}44Mh4444444444ݗ4445 555m{!5)515=95]A5A5I5}Q5Y5a5i5q5y555555555ݘ55555555=@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ ")1:BIQYai                        q5M  =yy=}                       e=}  }}= %==  Um   } =  -E]u=}=                                       = 3 333333333333333333333333333333333333333333  % @@"=@@@@:*UU-=-@@m@            } --                 3333333                           @=}=                                                @@@@@@@33333333333@                                          333333333333333333333  3   9AIQ                            3333333@333333333333      @@  3                              3333333333333333                         333@@@         @@@@@                          @@@@@@@@@33333333                               0333333330000;003333333Yaiqy33300@@@@@@@@@@@@30003333@@00@@00;@@@@@@@@0@@@@@33@@3@@330@@@@@@@@@@@@@3@00033@@@@33@@33;@@@3@@@@@@@@@@@@@@@333@@@@@@@@@@330@@@@@@@@300033333@330@00;@@@@@@@@@@@@@@@@@33@@@@@@@@@333333@300@@@@@@@@@@30303333@@00@@00;@@@@@@@330@@@@@33@@@@@@@@@@@@3@@@@@@@@@@@@@@@@@@@@@@@0030000@333@333;@@@@@@@33@@@@@33@@@@@@@@@300@@@@@@30300000@300@003;@@@@@@@00@@@@@@@33@@@0@@@@@@@@@@@@03333@000@000;@@@@033@@@@@@@@3333333;33@@@!)19@@@@33A3IQYai3333303q33;33333333y3333@3333333333333333333333333333333@ !)Q19AIQYaiq !yQ9AIIq !)1}9AIQYaiqy                                           -M                @@EEEEEE@@@E@E@E@EEEEEEEEE @@!)19AIQ!)19AIQYaiqyYaiqy@EEe~ @!*2:A@@EE @JRZaEE% Mj*r@@y@=Vv@ @@  @@@@@@@@@@  @@@@@@@@@@@@@@@@ "*2)I)1 "*2@Q a!)9A@@@9&Efi A)I9QYaiq@!Qy  ! )1= 9A I] !!} )1 9A I !@@@@@@@@@@@@@@@@@@@@@I)1 y > ^ ~     " @@@@@@@@@@@@@@@@@@@@> ^ ~  > ^ ~  > ^ ~ >^ !)Q9QAI  !)Q9QAI  A I }=YAQ Q Y                  =333 @@@@@'5'U'u'''''(5(U(u((((()5)U)u)))@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ a 333300%))*U+u+++++++,,,,5,5,5,U,u,u,**u,u,,,u,u,**u,u,U,U,,,,,@,-5-5-U-u-----.5.U.U.u.....u../.u.5/U/u///-,//050U0u000001@51U1u11111252U2u1u222 22353U3   u333333454U4u44444555U5u55555656U6u666 ! 66757U7u77777858U8u88888959U9u99999:5:U:u:::::;5;U;u;;;;;<5>5>M>e>}>>>>>>>>> ?%?=?U?U?m?m?m?????????@-@-@-@ @ !)@19A@@IQYA%AEAeAAaiqyAAAB%BEBeBBBBBC%C EC!eCC@)19A@IQYaiqyC!CC@D !)19AIQYaiqy%D                       33333333333333              33                                      =ED     =             q!)eD        y}D}@@@@@ @@  @@@@@@@@@@@@@@@@@@@@@@@@QA e-eMemeeeee f-fMfmfffff g-gMgmggggg h-hMhmhhhhh i-iMimiiiii j-jMjmjjjjj k-kMkmkzz {-{M{m{{{{{ |-|M|m|| |||!)1 }-}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9AIM}m}QQ@@@@@@@@@@@@Yaiqy@@@@@3y !)@19AIQ@Y@ai@qy@    !!!!))))111199AAIIQQYYaaiiiiqqqqyyyy@@@@@@@@@@@@@@@@I  !!))11999AAAIIIIIQYaiqy !)1:BJRZbiqayAi!)19Yai1 QYa qy !)19AI!QYaiqy !)AIQY)qy19 Aa IAQYa!)Y1 Aiqy !)1Y9AIQ !)1Y9AIQ!)1YQa)19!)1YYaiiqy  !!)19AAIQYaiiqy)199AI@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@QYaiqy3333333333333333}@"}}@@@@@@@3333333333333333@} ~*2-~M~m~-~~~~~~ ~-Nn@@"*2~-   " * "@2 : B J @@@@Q .N@nY a i ΀q y !! ! !!!!!!!!!!!!!!!!!)!)!)!)!1!1!1!1!9!9!9!9!A!A!A!A!I!I!I!I!Q!Q!Q!Q!Y!Y!Y!Y!a!a!a!a!i!i!i!i!q!q!q!q!y!y!y!y!!!!!!!!!!!!!!!!!!!@@@! : B !*2  a !I)1 "" "* J  !)Q9QAI 2 !r !)Q9QAI !! -a MMḿ -Mm͂ -Mm̓ -MmM̈́ -Mm ͅͅ M-M-mM͆͆MM @-Mmm͇ -- Mm͈ @@@M---M-@@MMm-mM@@m-m@@͉͉@@@!!!" "-@Mmm͊@@@@@@@@@@@@@@@@@@@@@@@@@@@@=UmUUmU=@͋=M]M}M]M=@=M]@}M@@@@@@@""!")"@1"9"A"I"Q"Y"a"i"q"y"""""A""""""""%"""Q"EI # ###!#)#1#9#@A#I#Q#Y#a#i#q#e@@@@@                               33@@@@     @@@@@@@@@                  @@@@@@@@@@@@@@@@@@@      @@@@@@@@@@@@@@@@3300@@@@@@@@@330030000@@00@@008@@@@@@@@0@@@@@00@@3333333@@@33333@@@@@@@@@@@@@@@@@000000@00@@338; !)Q9QAI  !)Q9QAI  !)Q9QAI  @!)Q9QAI  !)Q9QAI  !)Q9QAI @@@ @@@@)Q9Q@AI @@!)@9QAI  !)Q9QAI  !)Q9QAI @ @@!)Q9Q@AI @ !)Q9QAI @ @!@Q@@@AI @ !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI ##@@##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$q$q$@@I)1 I)1 I)1 I)1 I)1 3333333@33333333333333333@@3333333@33@33333@@@@@y$$$$$$$$$$$$$$$$$% %%%!%)%1%9%A%I%Q%y$$$$$$$$$$$$$$$% %Y%1%a%i%q%y%%@@@@@@@@@@@@@@@@@@55uu5555uu55᥌                              @! ! 1!!a!i!q!y!!A!Q!!!Y!!! )!9!I!%%%@ @!@@ @!a!i!q!y!!A!Q!!!Y!@! @)!@I!@@@@@@ @@@@ @!@i!@y!!A!@!!Y!@!@@ @)!@I!@@%@ @!@@ 1!!a!@q!y!!A!Q!!!Y!@! @)!9!I!%@%@ !! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@ @! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@%%%%%%%%%%%%& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&9& !)Q9QAI &&&&&&'''!'@@@@@@@@@@@@@)'1'9'A'I'Q'Y'a'i'q'y'''''''''''''''''( (((!()(1(9(A(I(Q(Y(a(i(q(y((@@@@(((() )))!)))1)9)݌A)I)Q)Y)a)i)'q)y))))=)))))q())))))))* ***!*)*1*1*1*]9*A*I*}Q*Y*a*i*q*y******************+ +++!+)+1+9+A+I+Q+Y+Q'a+i+ݍq+y+++++@ +++++++++@ ++++, ,=,],!,),1,9,A,I,Q,Y,a,i,}q,y,,,,,ݎ,,,,,,,,,,,,,- -=--!-)-!-1-9-A-I-Q-Y-a-i-q-y-----]-----}-------. ...!.).1.9.A.I.Q.Y.a.i.q.y............ݏ...../ // /!/)/1/9/A/I/Q/Y/=]a/}i/q/y////////////////ݐ/0 000!0)01090A0=I0@ Q0Y0a0]i0q0}y00000000000000ݑ00=]001}ݒ 1111!1)11191A1I1Q1Y1a1=]i1q1y1111}@ 1ݓ1111111111112 2=]2}2!2)212ݔ92A2I2Q2Y2a2i2q2=]},y222222222222222223 333!3)3ݕ1393A3I3=Q3]Y3a3}i3q3y33333333333@ 3333334 444ݖ!4)41494A4I4Q4Y4a4i4=]q4y44}44Mh4444444444ݗ4445 555m{!5)515=95]A5A5I5}Q5Y5a5i5q5y555555555ݘ55555555=@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@A A!A"A#A$A%A&A'A(A)A*A+A,A-A.A/A0A1A2A3A4A5A6A7A8A9A:A;AA?A@AAABACADAEAFAGAHAIAJAKALAMANAOAPAQARASATAUAVAWAXAYAZA[A\A]A^A_A`AaAbAcAdAeAfAgAhAiAjAkAlAmAnAoApAqArAsAtAuAvAwAxAyAzA{A|A}A~B¢B£B¥B¦B¬B·BÆBæBðBøBĦBħBıBŋBœBƎBƐBƫBǀBǁBǂBȢBȷBɐBɑBɒBɓBɔBɕBɖBɗBɘBəBɛBɜBɞBɟBɠBɡBɢBɣBɤBɥBɦBɧBɨBɩBɪBɫBɬBɭBɮBɯBɰBɱBɲBɳBɴBɵBɶBɷBɸBɹBɺBɻBɽBɾBʀBʁBʂBʃBʄBʈBʉBʊBʋBʌBʍBʎBʏBʐBʑBʒBʕBʘBʙBʛBʜBʝBʟBʡBʢBʣBʤBʥBʦBʧBʨBʩBʪBʫBʹBːBˑBΑBΒBΓBΔBΕBΖBΗBΘBΙBΚBΛBΜBΝBΞBΟBΠBΡBΣBΤBΥBΦBΧBΨBΩBαBβBγBδBεBζBηBθBιBκBλBμBνBξBοBπBρBςBσBτBυBφBχBψBωBϜBϝBаBбBвBгBдBеBжBзBиBкBлBмBнBоBпBрBсBтBуBфBхBцBчBшBъBыBьBэBюBѕBіBјBџBґBҫBүBұBӏBәBөBאBבBגBדBהBכBלBםBעBרBתBءBاBبBةBتBثBجBحBخBدBذBرBزBسBشBصBضBطBظBعBغBفBقBكBلBمBنBهBوBىBيBٮBٯBٱBٹBٺBٻBپBٿBڀBڃBڄBچBڇBڈBڌBڍBڎBڑBژBڡBڤBڦBکBڭBگBڱBڳBںBڻBھBہBۅBۆBۇBۈBۉBۋBیBېBےC་CნCᄀCᄁCᄂCᄃCᄄCᄅCᄆCᄇCᄈCᄉCᄊCᄋCᄌCᄍCᄎCᄏCᄐCᄑCᄒCᄔCᄕCᄚCᄜCᄝCᄞCᄠCᄡCᄢCᄣCᄧCᄩCᄫCᄬCᄭCᄮCᄯCᄲCᄶCᅀCᅇCᅌCᅗCᅘCᅙCᅠCᆄCᆅCᆈCᆑCᆒCᆔCᆞCᆡCᇇCᇈCᇌCᇎCᇓCᇗCᇙCᇝCᇟCᇱCᇲCᴂCᴖCᴗCᴜCᴝCᴥCᵻCᶅCᶑC C C‐C–C—C₩C←C↑C→C↓C∂C∇C∑C−C│C■C○C⦅C⦆CⱱCⵡC、C。C〈C〉C《C》C「C」C『C』C【C】C〒C〔C〕C〖C〗CァCアCィCイCゥCウCェCエCォCオCカCキCクCケCコCサCシCスCセCソCタCチCッCツCテCトCナCニCヌCネCノCハCヒCフCヘCホCマCミCムCメCモCャCヤCュCユCョCヨCラCリCルCレCロCワCヰCヱCヲCンC・CーC㒞C㒹C㒻C㓟C㔕C㛮C㛼C㞁C㠯C㡢C㡼C㣇C㣣C㤜C㤺C㨮C㩬C㫤C㬈C㬙C㭉C㮝C㰘C㱎C㴳C㶖C㺬C㺸C㼛C㿼C䀈C䀘C䀹C䁆C䂖C䃣C䄯C䈂C䈧C䊠C䌁C䌴C䍙C䏕C䏙C䐋C䑫C䔫C䕝C䕡C䕫C䗗C䗹C䘵C䚾C䛇C䦕C䧦C䩮C䩶C䪲C䬳C䯎C䳎C䳭C䳸C䵖C一C丁C七C三C上C下C不C丙C並C丨C中C串C丶C丸C丹C丽C丿C乁C乙C九C亂C亅C了C二C五C亠C交C亮C人C什C仌C令C企C休C你C侀C來C例C侮C侻C便C倂C倫C偺C備C像C僚C僧C優C儿C兀C充C免C兔C兤C入C內C全C兩C八C六C具C冀C冂C再C冒C冕C冖C冗C写C冤C冫C冬C况C冷C凉C凌C凜C凞C几C凵C刀C刃C切C列C初C利C刺C刻C剆C前C割C剷C劉C力C劣C劳C労C勇C勉C勒C勞C勤C勵C勹C勺C包C匆C匕C北C匚C匸C医C匿C十C卄C卅C卉C卑C協C博C卜C卩C印C即C卵C卽C卿C厂C厶C參C又C及C双C叟C口C句C叫C可C叱C右C吆C合C名C吏C吝C吸C吹C呂C呈C周C咞C咢C咽C哶C唐C問C啓C啕C啣C善C喇C喙C喝C喫C喳C営C嗀C嗂C嗢C嘆C噑C器C噴C囗C四C囹C圖C圗C土C地C型C城C埴C堍C報C堲C塀C塚C塞C墨C墬C墳C壘C壟C士C壮C声C売C壷C夂C夆C夊C夕C多C夜C夢C大C天C奄C奈C契C奔C奢C女C姘C姬C娛C娧C婢C婦C媵C嬈C嬨C嬾C子C字C学C宀C宅C宗C寃C寘C寧C寮C寳C寸C寿C将C小C尢C尸C尿C屠C屢C層C履C屮C山C岍C峀C崙C嵃C嵐C嵫C嵮C嵼C嶲C嶺C巛C巡C巢C工C左C己C巽C巾C帨C帽C幩C干C年C幺C幼C广C度C庰C庳C庶C廉C廊C廒C廓C廙C廬C廴C廾C弄C弋C弓C弢C彐C当C彡C形C彩C彫C彳C律C後C得C徚C復C徭C心C忍C志C念C忹C怒C怜C恵C悁C悔C惇C惘C惡C愈C慄C慈C慌C慎C慠C慨C慺C憎C憐C憤C憯C憲C懞C懲C懶C戀C戈C成C戛C戮C戴C戶C手C打C扝C投C抱C拉C拏C拓C拔C拼C拾C指C挽C捐C捕C捨C捻C掃C掠C掩C揄C揅C揤C搜C搢C摒C摩C摷C摾C撚C撝C擄C支C攴C敏C敖C敬C數C文C斗C料C斤C新C方C旅C无C既C旣C日C易C映C晉C晴C暈C暑C暜C暴C曆C曰C更C書C最C月C有C朗C望C朡C木C李C杓C杖C杞C杻C枅C林C柳C柺C栗C栟C株C桒C梁C梅C梎C梨C椔C楂C榣C槪C樂C樓C檨C櫓C櫛C欄C欠C次C歔C止C正C歲C歷C歹C殟C殮C殳C殺C殻C毋C母C比C毛C氏C气C水C汎C汧C沈C沿C泌C泍C泥C注C洖C洛C洞C洴C派C流C浩C浪C海C浸C涅C淋C淚C淪C淹C渚C港C湮C満C溜C溺C滇C滋C滑C滛C漏C演C漢C漣C潮C濆C濫C濾C瀛C瀞C瀹C灊C火C灰C灷C災C炙C炭C烈C烙C無C煅C煉C煮C熜C燎C燐C爐C爛C爨C爪C爫C爵C父C爻C爿C片C牐C牙C牛C牢C特C犀C犕C犬C犯C狀C狼C猪C獵C獺C玄C率C玉C王C玥C玲C珞C理C琉C琢C瑇C瑜C瑩C瑱C璅C璉C璘C瓊C瓜C瓦C甆C甘C生C甤C用C田C甲C申C男C画C甾C留C略C異C疋C疒C痢C瘐C瘝C瘟C療C癩C癶C白C皮C皿C益C盛C監C盧C目C直C省C眞C真C着C睊C瞋C瞧C矛C矢C石C硎C硫C碌C碑C磊C磌C磻C礪C示C礼C社C祈C祉C祐C祖C祝C神C祥C祿C禁C禍C禎C福C禮C禸C禾C秊C秘C秫C稜C穀C穊C穏C穴C空C突C窱C立C竮C竹C笠C箏C節C篆C築C簾C籠C米C类C粒C精C糒C糖C糣C糧C糨C糸C紀C紐C索C累C終C絛C絣C綠C綾C緇C練C縂C縉C縷C繁C繅C缶C缾C网C署C罹C罺C羅C羊C羕C羚C羽C翺C老C者C而C耒C耳C聆C聠C聯C聰C聾C聿C肉C肋C肭C育C脃C脾C臘C臣C臨C自C臭C至C臼C舁C舄C舌C舘C舛C舟C艮C良C色C艸C艹C芋C芑C芝C花C芳C芽C若C苦C茝C茣C茶C荒C荓C荣C莭C莽C菉C菊C菌C菜C菧C華C菱C落C葉C著C蓮C蓱C蓳C蓼C蔖C蕤C藍C藺C蘆C蘒C蘭C蘿C虍C虐C虜C虧C虩C虫C蚈C蚩C蛢C蜎C蜨C蝫C蝹C螆C螺C蟡C蠁C蠟C血C行C衠C衣C裂C裏C裗C裞C裡C裸C裺C褐C襁C襤C襾C覆C見C視C角C解C言C誠C說C調C請C諒C論C諭C諸C諾C謁C謹C識C讀C變C谷C豆C豈C豕C豸C貝C財C販C貫C賁C賂C資C賈C賓C贈C贛C赤C走C起C足C趼C跋C路C跰C身C車C軔C輦C輪C輸C輻C轢C辛C辞C辰C辵C辶C連C逸C遊C適C遲C遼C邏C邑C邔C郎C郞C郱C都C鄑C鄛C酉C配C酪C醙C醴C釆C里C量C金C鈴C鈸C鉶C鉼C鋗C鋘C錄C鍊C鏹C鐕C長C門C開C閭C閷C阜C阮C陋C降C陵C陸C陼C隆C隣C隶C隷C隸C隹C雃C離C難C雨C零C雷C霣C露C靈C靑C靖C非C面C革C韋C韛C韠C韭C音C響C頁C項C頋C領C頩C頻C類C風C飛C食C飢C飯C飼C館C餩C首C香C馧C馬C駂C駱C駾C驪C骨C高C髟C鬒C鬥C鬯C鬲C鬼C魚C魯C鱀C鱗C鳥C鳽C鵧C鶴C鷺C鸞C鹵C鹿C麗C麟C麥C麻C黃C黍C黎C黑C黹C黽C黾C鼅C鼎C鼏C鼓C鼖C鼠C鼻C齃C齊C齒C龍C龎C龜C龟C龠CꙑCꚉCꜧCꝯCꞎCꬷCꭒCꭦCꭧD𝼄D𝼅D𝼆D𝼈D𝼊D𝼞D𠄢D𠔜D𠔥D𠕋D𠘺D𠠄D𠣞D𠨬D𠭣D𡓤D𡚨D𡛪D𡧈D𡬘D𡴋D𡷤D𡷦D𢆃D𢆟D𢌱D𢛔D𢡄D𢡊D𢬌D𢯱D𣀊D𣊸D𣍟D𣎓D𣎜D𣏃D𣏕D𣑭D𣚣D𣢧D𣪍D𣫺D𣲼D𣴞D𣻑D𣽞D𣾎D𤉣D𤋮D𤎫D𤘈D𤜵D𤠔D𤰶D𤲒D𤾡D𤾸D𥁄D𥃲D𥃳D𥄙D𥄳D𥉉D𥐝D𥘦D𥚚D𥛅D𥥼D𥪧D𥮫D𥲀D𥳐D𥾆D𦇚D𦈨D𦉇D𦋙D𦌾D𦓚D𦔣D𦖨D𦞧D𦞵D𦬼D𦰶D𦳕D𦵫D𦼬D𦾱D𧃒D𧏊D𧙧D𧢮D𧥦D𧲨D𧻓D𧼯D𨗒D𨗭D𨜮D𨯺D𨵷D𩅅D𩇟D𩈚D𩐊D𩒖D𩖶D𩬰D𪃎D𪄅D𪈎D𪊑D𪎒D𪘀B!!B!?B..B0,B0.B1,B1.B10B11B12B13B14B15B16B17B18B19B2,B2.B20B21B22B23B24B25B26B27B28B29B3,B3.B30B31B32B33B34B35B36B37B38B39B4,B4.B40B41B42B43B44B45B46B47B48B49B5,B5.B50B6,B6.B7,B7.B8,B8.B9,B9.B==B?!B??BAUBBqBCDBDJBDZBDzBGBBGyBHPBHVBHgBHzBIIBIJBIUBIVBIXBKBBKKBKMBLJBLjBMBBMCBMDBMRBMVBMWBNJBNjBNoBPHBPRBPaBRsBSDBSMBSSBSvBTMBVIBWCBWZBWbBXIBccBcdBcmBdBBdaBdlBdmBdzBeVBffBfiBflBfmBhaBiiBijBinBivBixBkABkVBkWBkgBklBkmBktBljBlmBlnBlxBm2Bm3BmABmVBmWBmbBmgBmlBmmBmsBnABnFBnVBnWBnjBnmBnsBoVBpABpFBpVBpWBpcBpsBsrBstBviBxiC(1)C(2)C(3)C(4)C(5)C(6)C(7)C(8)C(9)C(A)C(B)C(C)C(D)C(E)C(F)C(G)C(H)C(I)C(J)C(K)C(L)C(M)C(N)C(O)C(P)C(Q)C(R)C(S)C(T)C(U)C(V)C(W)C(X)C(Y)C(Z)C(a)C(b)C(c)C(d)C(e)C(f)C(g)C(h)C(i)C(j)C(k)C(l)C(m)C(n)C(o)C(p)C(q)C(r)C(s)C(t)C(u)C(v)C(w)C(x)C(y)C(z)C...C10.C11.C12.C13.C14.C15.C16.C17.C18.C19.C20.C::=C===CCo.CFAXCGHzCGPaCIIICLTDCL·CMHzCMPaCMΩCPPMCPPVCPTECTELCTHzCVIICXIICa/cCa/sCaʾCbarCc/oCc/uCcalCcm2Ccm3Cdm2Cdm3CergCffiCfflCgalChPaCiiiCkHzCkPaCkm2Ckm3CkΩClogCl·CmilCmm2Cmm3CmolCradCviiCxiiC°CC°FCʼnCμACμFCμVCμWCμgCμlCμmCμsD(10)D(11)D(12)D(13)D(14)D(15)D(16)D(17)D(18)D(19)D(20)D0点D1⁄D1日D1月D1点D2日D2月D2点D3日D3月D3点D4日D4月D4点D5日D5月D5点D6日D6月D6点D7日D7月D7点D8日D8月D8点D9日D9月D9点DVIIIDa.m.DkcalDp.m.DviiiDեւDմեDմիDմխDմնDվնDאלDاٴDبجDبحDبخDبرDبزDبمDبنDبهDبىDبيDتجDتحDتخDترDتزDتمDتنDتهDتىDتيDثجDثرDثزDثمDثنDثهDثىDثيDجحDجمDجىDجيDحجDحمDحىDحيDخجDخحDخمDخىDخيDسجDسحDسخDسرDسمDسهDسىDسيDشجDشحDشخDشرDشمDشهDشىDشيDصحDصخDصرDصمDصىDصيDضجDضحDضخDضرDضمDضىDضيDطحDطمDطىDطيDظمDعجDعمDعىDعيDغجDغمDغىDغيDفجDفحDفخDفمDفىDفيDقحDقمDقىDقيDكاDكجDكحDكخDكلDكمDكىDكيDلاDلجDلحDلخDلمDلهDلىDليDماDمجDمحDمخDممDمىDميDنجDنحDنخDنرDنزDنمDننDنهDنىDنيDهجDهمDهىDهيDوٴDيجDيحDيخDيرDيزDيمDينDيهDيىDييDيٴDۇٴE(ᄀ)E(ᄂ)E(ᄃ)E(ᄅ)E(ᄆ)E(ᄇ)E(ᄉ)E(ᄋ)E(ᄌ)E(ᄎ)E(ᄏ)E(ᄐ)E(ᄑ)E(ᄒ)E(一)E(七)E(三)E(九)E(二)E(五)E(代)E(企)E(休)E(八)E(六)E(労)E(十)E(協)E(名)E(呼)E(四)E(土)E(学)E(日)E(月)E(有)E(木)E(株)E(水)E(火)E(特)E(監)E(社)E(祝)E(祭)E(自)E(至)E(財)E(資)E(金)E0⁄3E10日E10月E10点E11日E11月E11点E12日E12月E12点E13日E13点E14日E14点E15日E15点E16日E16点E17日E17点E18日E18点E19日E19点E1⁄2E1⁄3E1⁄4E1⁄5E1⁄6E1⁄7E1⁄8E1⁄9E20日E20点E21日E21点E22日E22点E23日E23点E24日E24点E25日E26日E27日E28日E29日E2⁄3E2⁄5E30日E31日E3⁄4E3⁄5E3⁄8E4⁄5E5⁄6E5⁄8E7⁄8EA∕mEV∕mEm∕sF1⁄10FC∕kgFm∕s2FبحيFبخيFتجمFتجىFتجيFتحجFتحمFتخمFتخىFتخيFتمجFتمحFتمخFتمىFتميFجحىFجحيFجمحFجمىFجميFحجيFحمىFحميFسجحFسجىFسحجFسخىFسخيFسمجFسمحFسممFشجيFشحمFشحيFشمخFشممFصححFصحيFصلىFصلےFصممFضحىFضحيFضخمFطمحFطممFطميFعجمFعممFعمىFعميFغممFغمىFغميFفخمFفميFقلےFقمحFقممFقميFكممFكميFلججFلجمFلجيFلحمFلحىFلحيFلخمFلمحFلميFمجحFمجخFمجمFمجيFمحجFمحمFمحيFمخجFمخمFمخيFمميFنجحFنجمFنجىFنجيFنحمFنحىFنحيFنمىFنميFهمجFهممFيجيFيحيFيممFيميFئاFئجFئحFئخFئرFئزFئمFئنFئهFئوFئىFئيFئۆFئۇFئۈFئېFئەFําFຫນFຫມFໍາFཀྵFགྷFཌྷFདྷFབྷFཛྷFྐྵFྒྷFྜྷFྡྷFྦྷFྫྷF′′F‵‵F∫∫F∮∮FほかFよりFキロFココFコトFトンFナノFホンFミリFリラFレムF令和F大正F平成F明治F昭和Grad∕sG〔S〕H(가)H(나)H(다)H(라)H(마)H(바)H(사)H(아)H(자)H(주)H(차)H(카)H(타)H(파)H(하)Hrad∕s2HاكبرHاللهHرسولHریالHصلعمHعليهHمحمدHوسلمI′′′I‵‵‵I∫∫∫I∮∮∮I〔三〕I〔二〕I〔勝〕I〔安〕I〔打〕I〔敗〕I〔本〕I〔点〕I〔盗〕IアールIインチIウォンIオンスIオームIカイリIケースIコルナIセンチIセントIデシIドルIノットIハイツIビルIピコIフランIペソIヘルツIホールIホーンIマイルIマッハIマルクIヤールIユアンIワットL′′′′L∫∫∫∫LアルファLエーカーLガロンLガンマLカラットLカロリーLギニーLキュリーLグラムLクローネLサイクルLダースLパーツLピクルLフィートLベータLペニヒLペンスLボルトLマイクロLミクロンLメートルLリットルLルピーL株式会社N(오후)Oجل جلالهOアパートOアンペアOキロワットOサンチームOバーレルOヘクタールOポイントOマンションOメガトンOルーブルQ(오전)RギルダーRキログラムRキロメートルRグラムトンRクルゼイロRパーセントRピアストルRブッシェルRミリバールRレントゲンaصلى الله عليه وسلمোৌୋୈୌஔொௌோೀೇೈൊൌോෞဦᬆᬈᬊᬌᬎᬒᬻᬽᭀᭁᭃ𑄮𑄯𑍋𑍌𑒼𑒻𑒾𑖺𑖻𑤸 ೋ ෝDDŽDDžDdžFلآFلأFلإF가F나F다F라F마F바F사F아F우F자F차F카F타F파F하IメガL주의LギガLコーポLヤードO참고OイニングOシリングOページOポンドRエスクードRファラッドೊො≮≠≯ÀÁÃĀẢǍȀȂḀĄḂḄḆĆĈĊČḊĎḌḐḒḎÈÉẼĔĖËẺĚȄȆĘḘḚḞǴĜḠĞĠǦĢĤḢḦȞḤḨḪÌÍÎĨĪĬİỈǏȈȊỊĮḬĴḰǨḲĶḴĹĽĻḼḺḾṀṂǸŃÑṄŇṆŅṊṈÒÓŎỎŐǑȌȎṔṖŔṘŘȐȒŖṞŜṠȘŞṪŤṬȚŢṰṮÙÚÛŬỦŮŰǓȔȖỤṲŲṶṴṼṾẀẂŴẆẄẈẊẌỲÝŶỸȲẎŸỶỴŹẐŻŽẒẔàáãāảǎȁȃḁąḃḅḇćĉċčḋďḍḑḓḏèéẽĕėëẻěȅȇęḙḛḟǵĝḡğġǧģĥḣḧȟḥḩḫẖìíîĩīĭỉǐȉȋịįḭĵǰḱǩḳķḵĺľļḽḻḿṁṃǹńñṅňṇņṋṉòóŏỏőǒȍȏṕṗŕṙřȑȓŗṟŝṡșşṫẗťṭțţṱṯùúûŭủůűǔȕȗụṳųṷṵṽṿẁẃŵẇẅẘẉẋẍỳýŷỹȳẏÿỷẙỵźẑżžẓẕ῭΅῁ǼǢǾǽǣǿẛǮǯᾺΆᾹᾸᾼῈΈῊΉῌῚΊῙῘΪῸΌῬῪΎῩῨΫῺΏῼᾱᾰᾳὲέῃὶίῑῐῖὸόῤῥὺύῡῠῦῳϓϔЇӐӒЃЀӖЁӁӜӞЍӢЙӤЌӦӮЎӰӲӴӸӬӑӓѓѐӗёӂӝӟѝӣйӥќӧӯўӱӳӵӹӭїѶѷӚӛӪӫآأإؤئۂۓۀẦẤẪẨẰẮẴẲǠǞǺẬẶḈỀẾỄỂḔḖỆḜḮḸỒỐỖỔṌȬṎṐṒȰȪỜỚỠỞỢỘǬṜṤṦṨṸṺǛǗǕǙỪỨỮỬỰầấẫẩằắẵẳǡǟǻậặḉềếễểḕḗệḝḯḹồốỗổṍȭṏṑṓȱȫờớỡởợộǭṝṥṧṩṹṻǜǘǖǚừứữửự῍῎῏῝῞῟↚↛↮⇍⇏⇎∄∉∌∤∦≁≄≇≉≭≢≰≱≴≵≸≹⊀⊁⋠⋡⊄⊅⊈⊉⋢⋣⊬⊭⊮⊯⋪⋫⋬⋭ᾈᾉἚἜἛἝᾘᾙἺἼἾἻἽἿὊὌὋὍὛὝὟᾨᾩᾲᾴᾀᾁᾷἒἔἓἕῂῄᾐᾑῇῒΐῗἲἴἶἳἵἷὂὄὃὅῢΰῧὒὔὖὓὕὗῲῴᾠᾡῷऩ ऱ ऴ ైේゔがぎぐげござじずぜぞだぢづでどばぱびぴぶぷべぺぼぽゞヴガギグゲゴザジズゼゾダヂヅデドバパビピブプベペボポヷヸヹヺヾᾊᾌᾎᾋᾍᾏᾚᾜᾞᾛᾝᾟᾪᾬᾮᾫᾭᾯᾂᾄᾆᾃᾅᾇᾒᾔᾖᾓᾕᾗᾢᾤᾦᾣᾥᾧ𑂚 𑂜 𑂫 B´C ́C ̃C ̄C ̅C ̆C ̇C ̈C ̊C ̋C ̓C ̔C ̧C ̨C ̳C ͂C ͅC ً]C ٌaC ٍeC َiC ُmC ِqC ّuC ْyCÅCṡD ゙D ゚D΅DΆDΈDΉDΊDΌDΎDΫDΏDάDέDήDίDόDύDώDאַ5Dאָ9DאּEDבּEDבֿMDגּEDדּEDהּEDוֹ=DוּEDזּEDטּEDיִ)DיּEDךּEDכּEDכֿMDלּEDמּEDנּEDסּEDףּEDפּEDפֿMDצּEDקּEDרּEDשּEDשׁQDשׂUDתּEDײַ5Dاً]DآDأDإDذٰ}Dرٰ}Dـً]DـَiDـُmDـِqDـّuDـْyDهٰ}DؤDىٰ}DئDۓDۀE ̈̀E ̈́E ̈͂E ̓̀E ̓́E ̓͂E ̔̀E ̔́E ̔͂E ٌّvE ٍّvE َّvE ُّvE ِّvE ّٰ~E⫝̸FΐFΰFשּׁRFשּׂVFـَّvFـُّvFـِّvFक़ Fख़ Fग़ Fज़ Fड़ Fढ़ Fफ़ Fय़ Fড় Fঢ় Fয় Fਖ਼ Fਗ਼ Fਜ਼ Fਫ਼ Fਲ਼ Fਸ਼ Fଡ଼ Fଢ଼ FྲྀFླྀFデH𝅗𝅥H𝅘𝅥H𝆹𝅥H𝆺𝅥IྲཱྀIླཱྀL𝅘𝅥𝅮L𝅘𝅥𝅯L𝅘𝅥𝅰L𝅘𝅥𝅱L𝅘𝅥𝅲L𝆹𝅥𝅮L𝆹𝅥𝅯L𝆺𝅥𝅮L𝆺𝅥𝅯Â̓Ă̓Ȧ̓Ä̓Å̓ẠÇÊ̓Ē̓ẸȨÏ̓ḶÔ̓Õ̓Ō̓Ȯ̓Ö̓ƠỌǪṚŚ̓Š̓ṢŨ̓Ū̓Ü̓Ưâ̓ă̓ȧ̓ä̓å̓ạçê̓ē̓ẹȩï̓ḷô̓õ̓ō̓ȯ̓ö̓ơọǫṛś̓š̓ṣũ̓ū̓ü̓ưἈ̈́Ἁ̈́Ἐ̈́Ἑ̈́Ἠ̈́Ἡ̈́Ἰ̈́Ἱ̈́Ὀ̈́Ὁ̈́Ὑ̈́Ὠ̈́Ὡ̈́ὰ̈́ά̈́ἀ̈́ἁ̈́ᾶ̈́ἐ̈́ἑ̈́ὴ̈́ή̈́ἠ̈́ἡ̈́ῆ̈́ϊ̈́ἰ̈́ἱ̈́ὀ̈́ὁ̈́ϋ̈́ὐ̈́ὑ̈́ὼ̈́ώ̈́ὠ̈́ὡ̈́ῶ͆ἊΆἌΆἎΆἋΆἍΆἏΆἪΆἬΆἮΆἫΆἭΆἯΆὪΆὬΆὮΆὫΆὭΆὯΆἂΆἄΆἆΆἃΆἅΆἇΆἢΆἤΆἦΆἣΆἥΆἧΆὢΆὤΆὦΆὣΆὥΆὧB̀3B́3B̓3CᅡCᅢCᅣCᅤCᅥCᅦCᅧCᅨCᅩCᅪCᅫCᅬCᅭCᅮCᅯCᅰCᅱCᅲCᅳCᅴCᅵCᆪCᆬCᆭCᆰCᆱCᆲCᆳCᆴCᆵD̈́3C゙C゚Fཱི'Fཱུ'Fཱྀ'7 $l4:ZFC0^zh(}+2Jb6vZ*<@Favlԏ&9#fvP6*n& d@t/-Bs;V,L5,7L!gMDWf_> h@CTaXY^c7?I^)%Rv]m' MnYX4*&KΔV ߅<ƽa"ѱ Ń.J).Bxpgb-5#'+0hҧ|jޖ C07cY0l =5KU_Oh pG g6CICg7,;f>c+A  J[@So`kvK­ɶjUAlcQt,X,j-b(u @3(m՞f8LKT}F-piq7kq6uBZFy~0:xw6/)9w8wP1ryTMFkF-dmJn TӅQoķ"Tmc3vkmYs_5p_Cc)ieZ . zB渒)J;ee5^xvIuEøhd:]j'])K<8"ue^ ?o?vD"RG}g}OFrâz>mR|6PdFˬ؜G&9B0񅖕OORh$'(F"_ EKɔ (0@kWBہv)0:S&z.yba9`."*CDNf6~xsv`Nř4DU,ޔx%=Y}n<#L(5W$Z PQq;P##܋&P%u@7y3`K2CVYh#pXLZTs\oς.TF,N+H+dx;q $CkXі$\7N`@/DpcFY''s ʋq&Ro=uؿEuwqwU1O459A}t޾[9!M;*Ej(weŁ(9z U+@ (-0=ֵi zw,61y|Wkp!|D =\9R"R;܃)k:b؀Lk-qhn5dbSxƼZY|~Ń .;0~+g4 }-So\$WI˴_qoY$-g (Znng 0f 4으=((:+g.bp'?Q]B84Jj7ާ ~ަUW]/2.,{ W5ڜHX Ӈ&њFóoJ蝘6 G?dYqI g?:n^ jA8w@BbP2yx(.0OVNˇ}J#_I j!bľapN| Hqbܜ)f4戯M(V&,Yrf,Q-ܮc\e "Inh6AsOy)p{JYUXd)?N`(sN樫6mnRܙ>hе ?n8(Dxxle$=ybi)"jDodžT ] :;vq;ɄϤ({ +"@h$$}nacQk{tRE +,iwVIVΆٮm?@RI+1 ;,}Fs~Zzך[$b^EC*[ ȭl^+zYrt)!xڶ'M"3tzq?8u }6I8%4O +n O=;$N^ H9rŐtʚMRN/ӯL&Kxyݳ .VA?9S<@l.1q Aԕ^:zb G 2V{["jr١fB-u5rǘc; u>1ZKt6\t]Y?KMNgAIvfFB\N30d5M|kvJ~IV/W7bk j˝8,aJN҈)o֧LFeb#2@Ah,NZ\E`x96#!p߅<"R[Kl>H3_HE>.4Y%p B; 3w%}ʑYj =Uޢj֕G_hT)*w6J>!}|Y_fٷCQpKLӤ]J761g#jX?sJS{UxlV^#>L} - X2GM뜃hD۱w*5tb~Wf1'Yq.hŇQ?V{F6`PvOS 6M1 Q^oť_ƶcC<l3 7=M)$&|򾽬H Pqnܟ@f(l}>RvR#O"kge;g?_L򊭘$E|uyp;DWrɤe:99OqR6mOr\lAl"+eIj9r{2E1U4Zs ij^ Sf!tTIH[G{GZw!4NZ},ӍcEmE87ymZ2f:opq{ha@2Ⱦf0Tz.m?$Sc.vzw kpdł؞[O8:bp$ GU zOe6mϔDLlkC[.RƹaғRQa˞VeuP`tGqv9NC໻@s;ώn(&[ϴjyEh}9@zbq%FNv²jA=RZ9?DqM #.<B hZ(_alȳ$}]zUgxXSvrQo{π01;B5Ky$hC>)긳jS,iZfX-KOpk߃.<[1dɡ s"xLԮH-ñ*WaT)rх#iْu륓J 5&9>-st\u"#M-kBq+x:㡋4m(FMsIey:m/H+ X 7JX 0tmN- q>JVF`q,7HEAp^Vkix7WQW~CogY ϔ=wHh 6b58fxG&D@eU0X`b*lpرq1%I]:C\{Ǘf#"Y( xmyao\OT$6d9珗\Wz~jYlT%8]{nӫ&t.*)j8 ӺE#;99 ;')cU!IC0_$N+ U'|]쭷_ 0MeAEg0\.EțW\H:^Mcui S-q=EV@8?XEۡ"(myzu]G(bL{B'~fy* b&x˰Om}xAbCXi}ҡױ'Hګ[@f }LjN ^{P\'[un\/jhuLumT_ ~pz!ImH|Bxk0<)tݽrvZrgr [mNق™9ai$M0I n %^C)UACOO?3dPQv^PlswuPm]2=DQ Wx N2$lUbjDP .l t/b5^:-N\^O4XoT,σ܈ be(rKe֐vOtdK.M-|`~dܟ0ZD"%qlhx_]^8y18媿NY9-#TJ>Ǻlk4#׺a8jH]jȻ?<47RD%c􁚾 t.QӬJ_:2ћ| ܋sEE,1ʱ(~~vB֔>Dd !ygUSʼn9B5YdϑW1nךfm Kyl4SMnPT]Ft$"}36yjOܥsdoC;fKOE3]3ҸȧvO4GH;HJ5VB3VZ͸=% ybvƢ ?=5' tx IBϳdWKՃ }[=Ky0^jA0VtBȖfDԵI@I:a}([Y#79WtO^Q$>_ߟN(͖WaO–P1Wa{)ʨl1H8z0'S$.H~ܓ98L)WYDeϬKܣ7/GUFe&K\O#7)'<~#s1h:Q`fTiAy KLRAu} LPta5IO<`!zZг ,mgYP򵺀 CN:gje5:I0Q%}PvX~3ePP.CR2AO{u6|wYpf5*n[ )`hΰ:V}Q%s1s59ěbp6 ˠBQAิFNW (wJU* {ȗ| /b0@ eUcʟߝ\W"q-'Ck;mnC#29|BL0i*PqʒT)QH.^g}ɭ -E߬fo|n9d_gÈj*C Xk@ "M"Bkv>?B*&\+\! FЧ%>PsaZ?G=y,mtep6ўc- 6>5B;MYC |$1pN WIs_jlqԾR{(26(:}*bw4bB޽/Ry?ҕq诌'\>WzvIB?cJeAr GdMilmǴ2YczLv~X[ Yeuan WRpwbl%f̀]v Ŵh#12)GM_rA\z^d25?uzu~ N2b\C[u]#+T4LӴ2 vX|.L]W%j7$34RLwiwՏҚ-uk8-&?G#ta*9}cPLj_6NGu*'>H`$YZ*&B`n,|9GjK4)U6;G.nkҺw^`:·W~+m(ْ#E/tpUey8P|ۡ0@#'I)SIZ;e 2{R˒):uaeV<*d?- XK@Kܨfe?4^en/.,<y% 58;'7HiZ/ 6{kl[tDY)QG(ުӱˣ͋j /tmI΀D[/yt, n mW[ EOc̅ZgPhqg.*|^"0$ 0TY~Te>@M^@Oh٧/dӪpp=ӕT>E"xofBȮFEA߀oZ!1zTZXjtkY+H$PŒ|F$r܂`Hn{^\ pߤrovf37@hXʻ$v=Hѭö:3u\ pN*<">@N=Ps[IIܤF!>GLi}3QGtzl.lw;4sƒRgQ{$ZQӶNYv{zeΪfh7IP7pC:5{ a_\*.#˹{-4QA}%EM&+C!^|ZB AUPƼ:u>nd<;CԥG/МޡH47ɘNO+ 5az_\#<9:$IY̔ZpR 0~LZ;>2:"9*ylRNzO5^ʼ-Yi kN.>0 +ZUK]^|㼂5::NʿG_szNǶC.䥺ΩOtH]; t&c=Sx4Xef7HoB7wVHe602(qHZjʉmLmUKbSofai#+T㷽*أͲqK5b/gC~7:L~7Oo99.%BÀ"0P#10+sAP-iON+n}s ތBBe`3ۃ,zk Lm۫Ep3(wMYҳ*r09A)eZ}2\0'Eu;#!Spd#*(%&"u` <3 Q=oNr u:Nz_kB v*-wSlem%w0TY z99`kOGem%HVSE0I 'Ld=R @/ºF3b<3 wZ!U$%5Qa{l!VRL'U>0 }=˶\̋htDWmo~{L7cѽE抆։TұT3bIcBXh`\vba61lx޿O*j @*t;ծTVv$[ #oTE=h"YGy0Z@D7i#M4U@d }ri/ ;z8CTn("l|qh~Ӹ7 ٶq1]\"*YjOYW+=8L.#MIbbq3`Y??. _S9@Vx L 0_mRq2-!Q/lUr$IO69jŁ}l괹@i04FK=$d+٘,Vۿ]'&@q8g%6rot_nD P8$oV>2` WZTkW MEK~df &GRѡ DG$"U\CÒT=]|#OdQz β4<"{ay oMaǜKRHc %rk qG[ U/'dKW IJ76{BࠍQʋ͙-SG2ǤFtDmqm i_3ȥ?]8nt J+*AKd z,.nN2WDTQNΡ]\՛^|RsAVy~(iz<9Ty'd8Eۄar?$z1ɡҤ$[yx<{;X c-uF*au7<luz#*5Ad}RJI$ Eع,ɟ8QN*N{jת R.a1LÛ-Y0!^WsЭ5zCBL|7&v v>KwحɋY}0vdzvQiU-/+<(O1Hs4t ҿ:_Pbk8Ck9+/e# ~4LT9Ӥ2dvnS'jTX"JUwk`fg[pd dVFǓ‹-9;ͳ,'jK zD~%iF >xC /p<1zcXLO+1Yu yp7&SyB닋/x8B >j4vM#Ŧ̟*:9Mɴ9WrajRT0;خ:cn|pUDjaUE<@ DbV`G0;s`12a~Q!]y**;o+"{8U[wnڑ$ H9'C CE=28x[P+fXM;~XNSXx#xѝSv8{qK&F;pez+4`3`{Jҙ(($&;kkw!;&j*D+qd098H/3הUlóbt q|bitm֌7/!}ukHpigr--eIWd\eIĊ̩ʔ{Q'iYcOZ|aw@٘C[Vh79mM{l ==Ia6„J̇#>ZAkZ{;jwwAj_Ќ *GQT+/1_\#>-q2UN}W7.Tl(ʐ@.yZ݄,2™m\c$-eY P'=*yv]důb\Vd^T枫"~BTЍ(k -Y7;e`2}_r N)e>:ҖPdLziH||O>v MMXfT5DbsERcWle澫Y)K+KP1ހ w|{|؃uQtmF$ +2,N!9k5 KpF2}-˴Z,M޳{,"}x:!am* {Q9޼H nfu+la'*hzV=/h.ˀ;2e{Ij6ز5UX݂66B>0YҕBdٹ{ 1wH)M2WV0S(F5Sź_h#u Za.EcU!)^PYMfDR=ǚY?ɎPG'Mq eg wO&T=Z\ `<'Nd~ydsFM=Mp{Kr>[$.W0q@QODTnaCZW@ho OQ*Eԕ==(D?Rg cD!jHԯ#5Z|UF_5]L-Y԰Q80IadΨd<߹'[&ϱ&HΡ}4(idwaJGc- *inB窵1 W>50oݕCfO4~-R.[e/O<#OQO\TW#/}WyXJPJ4p7&أ_|}Q/曌bE)f0)w c[§y'C+^58%Uh.g9+,pHGV2pB 9Gj?,`?{.4XnJIE B^`@_:Ue@ 4um;m\95'# -`>wD0(_hp1*ΒX;|FYT`^"풊Mv ^*v{v/ѨwZ@Z?lm]?> kj"(f=G }%pkC6ZLm ? }1 06c}ڶ.최5-kg *߱ʛM;Hv5ɶFEG[:(3ZC;ҔKmg O/Yᡩ{P.~x8"agmXA]/> <+Fj5vIEyJ*0xtΥ2XvfIv:̙ t# R|q_,IWmR% >GDFz/W֚Tk\c '::H~'bstR&ʓM>U צ*xmmz 6 @S 'GG"bB+Pc$_|nGDj 9')Uv(Xɫf[uQ} d$Ay|a/ڤ\ejիrz;YҲ_-dUnD:yLm#jEؕ/IF9&`f TA兊D42lA9ばL4O5FuC7PW.c?.>H-iɦ=N V_ T2+?.KzC 5,Nl5{ʏ.瓀JZx8'*tvy/ҁߩP:lY7,:${%UDndXg&BcRI>3f_߿$b`L}Nt]OSct(k}W ye" b~4`d"\hLټɋ#Rk}H"Jo ^a={jy3 +NHkj*`1sчEXKmAJe4&FNN(Nr1 ױd\2x:_:BCրG,v'Pa1.ށ;w9<ڇKTs!=~4!+䟎CǹEQҿ:䉷ͩU{XMQ1R 6%FqBVw"?{.yl~R&\*Pnv5 o}ʮeDRyu쏕E2UdO,Wcȱgr}6M,F薬 "Ӊ벅YP,Z*okޛj2L_pS& B +=1+^՚"4S?Y,mr=BV|}kCeL| ;NYn*^s+qk*D_gņq|o?$VߔqW w7*pvI x*g;=[/ըv F-,>Tc: sNe-w "Rvn x&Fr$`U{l`s-i&D9|mFhf1!Q((G,L䫬 :a7UKñB,NqtM@5,-cfb#AשVBO]x_InkAY4*R?5aw,Yh0yUڠlh a!i ~3L[#NoKOF74N# pV6^I?F\ŽU}?}' O0 ,+esu5VNc|X߆Nʜ@ZB오BSuZVWy'πO6\۶+2`jȭ'NMJ_2Cǫof  y(E+VJRi`ʂ%0 у)Ͷl8k_u`4#iUr+lKet(g%߂5tyR/\9c]Y~L=i!^iA ώ\QnH#7֝r2&8-c@ho+9Qxt{J `!:sjL ] -)"vLT~m)aw>ګe~9kBŗwo"D#A>2I9x$ԇSBQF%/bJ%ibF3K E7[K^(St Qe`!z e5MFб 0#;立w%<}$qTU./RbSa*Q,mΫX2 3\*v>T92DŽCVBxO(p+~a1R#]+2pPzkBY8]')+[a6vV6n$MDĝH8أݲ^p6VsD(7\pzˁVqR̲i󰽺&r;!(Z^q @+lc ZnRGQI|p!Q %𼗏K/W<&`$ٗ_vI9~-!؟؃l)F3(ji(|ߡ$p@;#ГI\KQ IN-ӭtAE]&%H>MLuR&]6prַi%E _q]I;|PSaۂ:M#z7󼩶:{>DT`(l$JV`z(Y,}k?sϞfM+Z\-)]8M&T<jf!PP7ۇIǨ9 2 MZ=!>,w:FS qN8#D^l|jM=c΁UiJ L.j|l"dX'U%}gel'OD)J#?6ﰺut_i>&@/Cnn!yxJ-"nn}tfX{ynApjE.'۝i(0`|-.\ŽdJvOp=dώW6k>iG~:ͯYb 68.l;(M4i]{U\P7(}3c?  w;zDdwehA'a"uNSJx@ԉyxe}n"b=ꐄ0^9xu*)i^*Z呏ڗo]ᛋHăe5U638`-%6`:7qBȺbIrsb@bG{F/EM T"1f>87b$KX)K +Іw aRy].vf`]@ &0ҸVg.byH+(5C'Dim}[4 [PJ ƚm/1TJa~ӌ6}al]#߅S9c^ub+6,,o6<tCFZ.Q)PM~[uq7ZT~Dr,-Pç1߸ù)=.ÐǼa>5HP%Y#i?kOvge6ܬ!`Smo7P( ' !&3ˤ<&%CanT.B/zA&DU ob3<]pd57$>bqp)[!&]*jUK;%?c/z# =^g#ڹS9/+mQO˿t/"_`/H8fW(TaԐu9#\nDUa_*ׁٜybVZ*ұ $9kAr2(!yv"%as2""3xn, tH+a+0&yΞ9ׁct0+^M[y4Cє,TD/>t⬅k\7rǿ?D=_xb[vX[S;{g;].J$V&*e$'c* \jIj9yJcb anb߀LZsY^c^Yʹ³xSLpc~@_#w[MR8 %KM?xtBb-'ܝ)v.x58C^ 8%-'T0sA*4af&3r.R%>bĻ@̄JUx$Y^fT'!R1[g/Ypmq$5iC+E"/48%.Yl'{N&hd0 \&=\!)2ޛm D>Ըl9R'xUy$p\M4೟Ėd(1^uH: 4RŁE^Y!+쉺6nu~?;|u1a(Z f+>B(:ʃa"@1~QuQqO=[@1P]%sh|Z=pKP/iQkVoLtL> 'gHDCS%~0_W4uKT`7G11"&jD \r<ѬBQo"{flfMx1A#IkN~Gnt坞V*|߳ľ@ #cg}{kmۇmThωa"ѨHjcrCC!Quykb0R~1Y8%Ǩ+\c] }PFu+J9r86&^%IhܴF\}6#SWG+%]} x g$vl0b=Ep̶h%h3?x-$6#8q T$?kAN5 m[2,ơ)hC,H҂F/47dx w|_hB;d1j>9ѐ*Tl/I*C=G$S)}Ƈ%:dqEǺ7rmz16q>qINJ6Bhha<ہIMLO~`Kj7RG<"QM^! $gWz D+U|?c(!qL!w+{xACr.|~׋+W ŘaQm]n^#^BpKk6hG:HTR&OPjN;Lm!)nNL? >Th&(`&G\9 +{1=) V9P o͍9?mjB$A[Fsv76 ;f)>A4g,$z@EAuC0ɀG[TݤB 74qߡ+DG=egEM/Rs0kgU>>4Xq$t]6*cP2)vWlgjnw`<"-&c -o#T\o;0w~f.~Pzd YeSU[0Za͠2ۇ!mBOV]qZ{Ft% $GG2jNK;(?*Q8^Ƴd$M}9 Jst\AbLm{~#orG@"Xbl8[0e;鮿w"J'l~^E% +H KܼͲR<>Gk\v6!y >~c5.pěرCхꈡ%RbuO#b~+703J\juJj1Z/ϵ$㡭B .-"?A}P$=L}Wž5rǬ)WI 'xk ٨7gg0bnVT> NZ8Ukkd*9oGB?3E)r:4g!~9P`5/n':f>&lϷdsD 4uqr4) ZwU8G[@$奦-s\~3h8rPٵ Fz[Y'7,γe Üj6ŕ6'T>1G<o`NYIf"s _ecnyiQ9eās037BL?*j5IҜxj:/@1x8Fv3yգjiEp4^x$k:BJ"2mU`riPV88б b5LʙmW R)j?&1*brζ5z5ǣ (2: $]73z[zNA8Nq~lM8=ʿ$0jtV'ñyUǪ]릁ϣ4s C1Ť=Nm$aTЕ,EukWwԃ9@nvחSxsz!iI:iAVvc$d=%'9:'Iw?)=^fkƙ&Mk]Me"F0q|SU.1*ëؖPn TI<Zڭ®ou1dEt{oNNE56l=db( , i+\Ai[uLBGi{HPڲ5[@9s& -.}A hľ8xO6 a18Κv:k\_$۲Iͽ\na 35Yi{nҡMV{ >7hY.%uvMlI.\{&SڨcÉ@+&p3PMdKɺ, |N2`ݣCјn50S;J@*6'Dbpi9 :B}npɆ撋 ;3QP iOz xv4E$S$soFg@---@--@--@-- -@-`---p--GGGGGG HHHHN.--dG4H$HdGC. .1-w- --@Y./-`------ -`U.@-M8-@-H-D.--- \.---pMNNNNNN`-D.r- -@-`-` /8 -@ -H -P -4H`----@-@--- -@------`-- -@---- -@-`------ -@--`---`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-`------ -@-lO|OOpOOP}-PPQHQLQ -tQxQ%-%--QQ---`-S. -` /S. R8L@-`-@/K( L(>(>(TTG.XT\T` /` /` /` /` /-8LG.(( +-VVVV-- --|G`a0(tGa `%eh-ep-ex- .2nT6e-Y#e-ee-e-i$e@-eH-eP-eX-e`-eh- ex-e-e-y:e-e-e-\h` /lh` / sCD9 WED9^Kw, e-H@(HD(e-e-^b7ha`б /б|/б/ бxD.J./i-i-i-i-i-i-i-@:y0f uWO#1tNj81k8LGe-e-;Y g(g(g(e -e(-e0-e8-ZJ!NeP-e`-Јep-{e-`n` /"e-e-e-e-e-F0ђ&&e-e-e -e(-e0-e8-e@-eH-eP-eX-e`-eh-ep-ex-e-e-0sA-e-e-e-e-e-e-e-e-e-e-@s` /e-e-e-e-e-e-e-e-e -e(-` /e0-eP-eX-e`-eh-ep-ex-e-e-e-e-e-f-e-e-e-e-e-e-e-e-e-e-e-e-q-e -e(-Ћ` /e0-g/=rq+ =*=!y0~[fDyFy#'1[?N"4=!o?ˀ;aN"m8m8Ӕ>=i+Z.[Y6o$"@N"T'1m )KU=! p$%12v=!'-W12%,K5=!N"4^#HY6+qc7N"$ڡeP-_#e`-Ne-e-e-e-A;e-e-e-:d[6F /(e-e -]_#e -- e( -e0 -Es$ NNNNe -e -e -e -e -e -E4Q"_%b-/ e -=%e!-e !-e(!-e0!-e8!-e@!-eH!-eP!-0v` /eX!- ^  +&^:^ep!-ex!-;e(-e(-[d#d G.(G.e )-e@)-eH)-eP)-\/q Jep)-ex)-e)-<&[0e)-e)-e)-e)-NDD6"e)-e)-e)-)e*-e*-%~b#e@*-eH*-eP*-eX*-e`*-̳{ire*-e*-e*-e*-e*-̳{e*-B/P` /e*-e+-e+-e+-e+-ASon" ` /e0+-e@+-eP+-*e`+-KhH.H.H.H.g(g(g(e+-e+-[d#` /` /@` /` /e+-Y ` /@` /e,-`I.e-i-i-e-// A/@|(@@@-@q-`:(+(`@( @( @( :(-;(2(3(+( +(`0( ;(0(0(-0+(@+(P+(`+(p+(+(+(+(+(`C( C( C( (`;(/@/@//@/@/`/// //`K( //////G/`/- -8( //+(///F/@/@/////@/ ///@/ /`-;;-+(R(33x*( -} D( s(`N( -==@( ( q)z(pp=(/@/@/@/@-@-- - @-`- /6/6/ //6/6/@/ /@//6/6/6// // /// // // / / /// /// / // / / // /// / / // //// // ///`///`ս/`ս/`ս/`ս/`ս/ //@//Ż/ U//// /// / / (/`// / ///` / / ///@7/@/`//`X(@@^(@((( -N(N(>( ( p(@3( *( `2(*( *(*(q-q-q-/ /@/@/ v/@/A//`Z/@/@//@/@/@/@/@/@//@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/`D/@/@/@/@/@/@/ /@/ / / / / / / / / / / / / / / /@/ / / [/@/A/ / 9/ 9/ / / / / / / /@/@/ / / / / /A/@/@(//'///&/&/&( `3(@-`-((-P,(X(-33(4(-q-(((*(((P(X((((`((h(p((( (((//////@B/ / / / / /// //@F/@/ // // //d// // //@// /D/////////// //// //@//`/@/ / / / / / / /@///E///////// ////`/ / // // / /z/D- //@// / /z/E/E/ // ///`c( D( (((-///// /@///'/'///////////// // // // // /// / / /E/E/E/E///// // // // ////// / / // // ///// // /  1(( ( ((( ($(((/ / /Y(BB(/Cp,(,(,(,(,(,(,(,(,(`>(///`//@////@//@-/@T/@T/@T/@T/@T/@T/@T/@T/@T}- *HH(XX(PP/ --$$/C//(( (H(L(8(P( -( ((( (((0(8(/2//@-///&/@I///(=(((X(/ / ///@////S//V((@- O( / T/// T///@/L/`F/$/@/L/`F/$/O/`/@/@|/@/@/@/@/@/@/@/@/@/@/@/@/`$/`$////////`ս/b/`ս/O/`/`$/// / //E/N/N/,/,/K/,//K/ /K/$/F/b/ / %/ %/@//b// / // T/// T//////////`ս///`ս/@///@O/@O/@O/@O((0r--/W//////1// R()(//(I( /'/'/'K( `- `R( (///F/////` /p(-((/ / / / / / / / / / / / / / / / / / / / / / ////W.//a(-0^-`O(9( ( ((@r-Pr-`r-/@/ /@5/@//@/A/@51(1(1(/2/( (<(////2//&/'--- /-/`-/'/@,/-/ ./ .-//o/ /o/@8/8/p/o/c/λ/ t/c/λ/ t(/`/`2( 2(/Ż- /0/0/0/0/0///0/0/0/0/0/0/&/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0 .(/1(((///Wr-((P.(0(8(@9(?(`9(`.(@(p.(.(H(P(X(`( ?(.(h(@?(9(- //@2/2/D///4//4//4////D////4/@5// (((/`6/%/&/o/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/`S/ٷ/ٷ/T/`S/ٷ/T/t/{/{` //*/*/t/Y/`ؽ/Y/*/0/0/0/0/0/0/0/0/0/0/ /*/*/`ؽ/ /`0/ /0/0/0/0/0/0/0/0/0/@ڷ/@ڷ/ /0/o/0/@;/@;/@ڷ/`S/`S/@ڷ/`ؽ/@ڷ/`9/`ؽ/`ؽ/`ؽ/@;//o/ / /9/:/ :/*/0/:/*/@/@ڷ/@;/9/@;/:/@;/ :/@;/9/@;/:/p/0//0/ /p/ /0/0-`i)))/@[/[/Z/ /K/M/L/L/ٷ//t/ / / /@]/ /*/`ؽ/1/`0/׽/\/tb(]]/o/@8/8/ #/ / / q-9-H(P(8///h /` /L L L 90/$(//'}dS hS dS/D/,&/@///r-r-r-r-hUxUhU|UlUxUlU|U/@F/3 P/ P3/ P3/ P3/ P3/ P3/ P3/ */ */ *d'/0/0:0G4G@H9/[/a//v / /9/N/ /( //o//4 / / /@ /}/}/R// / / /9/ //9/ /JJJKKKKKK L/@ `Z/@ `Z/@ `Z/@A`ZPLN NNMMMMM(( y(L (L (_ x(h (h x(q $( ( (m(u(( ( 0(=(`(((j"/ pNN-- ---tOPPPQ/" `Q/cλ t/cλ tT,U4UV/`SٷT/`SٷT/`SٷT/`SٷT/`SٷTVVV\8XYZ@[H\WYZ@[\4XYZ8[@\WYZ8[[,W8YD[[(W4Y$[[W4Y$[[xWtYD[[tWpY$[[pWpY$[h\XYD[d\XY$[X\WY$[\X4ZD[\X0Z$[\X0Z$[P]YZD[L]Y|Z$[@]X|Z$[\(XYD[\$XY$[x\XY$[]XHZD[]XDZ$[]XDZ$[p]$YZD[l] YZ$[`]YZ$[\XX ZD[\TXZ$[\HXZ$[[WYD[[WY$[[WY$[8\WYD[4\WY$[(\WY$[\xX ZD[\tXZ$[\hXZ$[\WYD[\WY$[\WY$[[lWlYD[[hWhY$[[\WhY$[0]XhZD[0]XlZD[,]X`Z$[[LWXYZ[DWPYZ/@;0]/@[[Z]8ʬ\   ` a/ `  -2 : =@ x  90[ EN >( JNO(00ONY(BBPPP 3 P` /QQQO p  T    |[W(YZ[W(YZ[ W,YZ[$W0YZ[W0YZL\WY[P\WY[\\WY [`\XY[T\WY[\|X$Z[\X$Z[\X(Z [\X,Z[\X,Z[4]XpZX[8]XpZ\[D]XtZ`[H]XxZd[<]XxZd[l\ XY[p\XY[|\XY[\ XY [t\XY [\X8Z[]X8Z[ ]X!1 ,˚ žt  (((@0(>D J_behknqh` /k(X` /$!& !& A& a& /ľռ|@ռ{ُ&.07!/#1I"!J"On !x <:K^:90߶@x(y(kk *?80;@g TU TTCU U4UU2UU= UUB6]ܼ:6 -@----@----@----@----@----@--@----@----@----@----@----@- [   f )UUUUUU?eD.,twz}"&P ҟfϜ< <jzʠP 3\ A`Ah  t MMMNN TU VVVV VVVVUUUUV$VXVXVXVXVXVVVVVVVDVDV0V0VV T@t-`t-t-t-t-t-u- u-@u-`u-u-u-u-u-v- v-@v-`v-v-v-v-v-w- w-@w-`w-w-w-w- TM-~ X -Ef KG@:%GWL, S, k u5u;W.Z67 T)zZ:`f.lrx7 >$T)zZE`f.lrx~uxѶR :Y^c>hįʯЯ BFS  mĬ֯ ѶR :Y^c>hįʯЯ BFS  mĬ֯ 0( A( `A( A( A(  B( `B( B( B( C( J( @;( J( K( M Tdkʚ;2#   (  Jh& <wp hht  zZ !s JZhӇ@X.X.X.P mP=ۣ'OO+   "dP};;(;(;(;(<( <(8(I(  8( @<( `<( <(,iWL 9 T,H X j& y :,Ku,*: 0 %G.:Wau -:  DuFF F%s9FL! F7<F& _F *7F? Fo A-o0A-o@A-oPA-o`A-opA-oA-oA-oA-oA-oA-oA-oA-oA-oB-oB-o B-o-oz-oz-o-o@-o-oz-o{-o {-o@{-o`{-o-o{-o{-o-o@-o-o-o-o@-o` /o{-o-o{-o|-o |-o@|-o`|-o|-o|-o|-o|-o}-o` /BUe 4  ls ] zťʥ ϥHԥ? J 7e      ٥ ޥ U ! mu.. ; 7 >$)ʤΤZ(RFl4t Fdp1 VFPG,pFFpxxFF hB ;r! FҤ2S T֯F0 VY}m   O 8 D C g u *!:/K/;J 0J Z h (h w I  ٗ e   L    ? 3A) f;!;!L"[#[#9m$~%{&&?'T(|()j**9(}9(}2( :( :( @:( x `:( `:( `:(2( @(  2( :( , :( 8 :(+(aΟPFp d o 9  ]$ ez ex e[ePF@ ePFePFF m(S  P3\ 7ʬ77$}PF 7z PF PF- $: 2 PF PF3̛$ ̛$ $8 PF V  F r ԝl 6Cadgjm = K vݝ,X e WL""'  #r | "]k1 jL  >}L L| |1 ¡#r ԝl 6Cadgjm = K vݝ,X e WL""'  #r | "]k1 jL  >}L L| |1 ¡#J-U 8GZ& b +-qWWQo7!CJ"wu<-7!& 7!   ' 0 9 B K T ] f o x                   # , 5 > G P Y b k t }                   ( 1 : C L U ^ : D N X b l v                  * 4 > H R r lݝ$WL' $k1 | ضԝ۷6CHgKNϐf6K We W| ve e pe e Ue ue "r"Ρ| ϐ| a| $| 6!| h | | q | }| љ| v | I)g#,¡¡() adQjTWZm+ u+ £Ws]s`Ds' i| ]FX /S5 PF (LThPF   `~w;wm/CJ;a) w~/Z =he  , J!VJ{  P Rh p ) ;g ] +5 ɧ<Z!Oj Z\ *ZiJ/w !.ghj!|h;  <&<{ 8<~%iGw9&m$R/~%j%19;!+J<|J cz!w xK̳(!xqJ7x'\#) Qf'J\#ih>Z!//-AL"RZ\<h !/n<Y/hfZ h %J.text.noptrdata.data.bss.noptrbss.go.fuzzcntrs.go.buildinfo.MIPS.abiflags.gnu.attributes.note.go.buildid.elfdata.rodata.typelink.itablink.gosymtab.gopclntab.shstrtab