ELF4 4P4 (444xxxddx>x>oo` Qtdp```x., _o \ FFp 0X0X@X@X|@B 5`C``T !   r*    @@   o$xxd P*p`` SGo6zgBHrexXJgMWmzyWsA7/Ur9yG8TJ9j3p8Nx_Fe2c/-mUUjElsu6LHsUSjxtXi/vdg1Ky7AtRQKlP7UDbeEGNUKMﳯU{R%t'w%%{  += % ' '!$ !$+'4'!$ !$%%5'!8F$%(B$e0` F, C,`5'!0CŠ%(%0+'!H$%8'$0! , ,! "+'!H'$!H!H$)%tJ5t%HDTHLu`J5?P%8'8$ <6$ <6$8w% X@K%D%n-!h$ $8j`dh$' <)5%P@@D4X<#X$X#`$`+h#h 'hk% Xkq% `q $#X#`$`!XlX H+p!$!"B1@!T VŽl @ d4"HCp8#!CXB$<!!C!0 BTpt$x\'ptx\'+= % 'LddeT9$8'$'!$ !$P*(''!$7W!$B$8<$*-!P8<04!H%!8G+(%!('%,!(($8',0$(4'('<'!$7W!$B$0(p g!(D<6$8<6$H7%P'@4<#@$@#P $HI+8#8'8% @q)% H)q $#HI$8#@H!88@'p!$!B0@<@X"_  X%"%  X  LPT@4'p8!"D!$<!A0@<@\"_  \$"$ $\  LT@a!$aa!$aD0!'"H'<!$<ط!$j += % 'ddep9$8'$'!$ !$*(''!$7W!$B$8<$K-!X8<04!PD!8+ D! G%,! ($8G,0$ D4'('<'!$7W!$B$h0 p g! 0 <)5'PL8'qL!8\P&Pj& <6!8W<6!X<6+`!Xl'P@$8' $ d<6$8<6$ '\QY'X`$X>%8'8$ <6$ <6$8w% @K%D%n-!h$8K$ dhp$' <)5%P@@D4\<#X$X#`$`+h#h 'hk% Xkq% `q $#`#X$Xm!XX H+p!$!"TB1@"%X 6t d"B$"lCDc$C$c,!Ch<Cc0`<`TTd[  $`  CdX dh4CHdp8E!e\c$<F!e0 <@b[  "`$A dH\CE19'8$8g%f'`$<6$w<6$(% `!D$D"B$"!D$"+!8x`'x`'+= % 'pd%0$ p$$g# g# $ p0+ @DHLt%%l'!$&,!f&8+@F,i+P!J9$8%8BX\00p g!0hnjƌ'8'0<6$0<6$8%hnjƌAI'H $H'>%8'8$0<6$87<6$0%0B1>%0B)i,b0@'!0Ȍ)0 $H*%@(Ȭ@' $%%%('$+P!B%&8,+@F+P!J9$8%8eB9F%8BA,8@'!8*08G008p j!8猀<6$8<6$PWBXBP g%PUU%8!8+P!Pj\ !XKdT %PL!PG+8G!8g!8G0!( $0pg*0%% l'&$+@!%f&8+0F,h+@9$8%0#B1>%0B)M,F0@'!0ƌ(00000p h!0dȌƌ<6$0<6$@(l' %$+-!Pjd#`$` #h$h+p#p'p% `q% hq $#`#h$h!`` !Xl $lkk%k$0$@ %H %$  %$  %$  %(%$  %\pPT%@$$,!@(4h<#`$`#h$h+p#p'p% `q% hq $#`#h$h!`` H,q)%$0T$(P!8*h1` 6  \pXtt,6xB` pCD $#%('$'!$ !$\Xt6%$  %$  %(('%8'!$7W!$B$8< %-!hM8<04!`!P+@!@H%L-!@ ($P,0$@ 4'('<'!$7W!$B$%%&H&P%HIe 0Hp J!HI*)<6$PW<6$H7%HI NBQ%H*B)(-@ @'!@  0 $8%8@' $% $  % $  += % ' "%g`$+ B$ $pD0+R`# `#D0&`'$% %( <4ǬǬ$+@!(% &&8+0,(+@9$8%0"0f0p '!0njȌ'8'@<6$8<6$@%8(a $ "'<!$<з!$j <!$<ȷ!$j += % '7<@"_  #"# D@CD%?`C` C$% % < %_  "% "x abx ab "(b ,b<@4b_  $"4d"! b$a''+= % ' "!$ ,[ 7  "$# $&E&d%b @! !6$  ,04' "4C(p8D!d4!c$<B!#B0@!$,0$4',0$4'+= % '< "9@C+`,#r`($%(B%0&(@#DD0 , ,##&8 8' E$00 , 0 $#B0C B, %%F" "B("   4 ,[ / < "$# $&E&d%b@%! !64 !8%<@"4C dp8D!4$c$<B!B0@c4< 8!EB$!b0`B%8"<$B$8"B,!D<"< @"$g  &"# $&#8'<@"#_  "#  8'+= % '"@C0$+ ` q ' Xp '+= % 'L!P$ $!$e $#"!0$"0 !,8P$ $e 40  LP%(%0$+@!0%(g&@+8-i+H%)9$@ %8 (,08p h!8@%8T8 cZ $LAH'$,@!H))1 4H'q*%<!PHl1J$8!H,)%!@(i1 D<,TB $" 84P<Dg 4 LP(,$+= % 'H<CB@ e <"@(@% %(-DDe# 0$( , (% ì$*0f!0 G0!0<nj_  #'$"8'$+8!(% &&8+0,(+@9$8%0 $0F0p '!00%0$,0!@14H@q %<J!H'K1`)8K!@ %!8H14,,VDB (@,4g <@( $+= % '<!$ @7 < `<c$ @ #$!$7W!$B$a de c$(,$D(5 048%%D0Cap$!a0!$ X "$+A!#%%%,& C+C,(+(8$ %d`480 <  _  #! H<'+= % 'PY "#%bT@"E@"@ !"#'@'`L4!$<6$W<6$wTT@L,VŽ!@' @P" B8@%($?0( , ( $(! 9$8'$'!$ !$=%('($(%<6$8W<6$(%(.%O%-!x$`$P%pL4Ό#x $xO# $+ #' & r% xq $#P#xO$x!xxpq%!pύ&x8!XH'%('($(%<6$8W<6$(%(0%O%-!x$`$P%pL4Ό#x $x# $P+ #' % xq& r $#xO#P$!xxpq%!pύ&x8!X$\H'%('($(%<6$8W<6$(%(0%P%-!$`$P %xL4ό# $P# $,+ #'@1& 1r& r $#q#p$!0€xq%!x&&%0%`L'%('($(%<6$(<6$8W%(2%P%-!$`$P %xL4ό# $ # $,+ #'@& r1& 1r $#q#p$!0€xq%!x&&%0%`$dL'%8'8$(<6$(<6$8%(G$$m-!`$8g$(%X`4ˌl#h$h#p$p+x#x'x% pq% hq $#h #p$p!hh Xmqk%!Xll&`LHL\a| K  P`LtH,' <)5\!$p'%8'8$(<6$(<6$8%(I$$m-!`$($8g%X`4ˌl#h$h#p$p+x#x'x% pq% hq $#h #p$p!hh Xmqk%!Xll&`L\LHa| K  P`LtH,' <)5\!$$p'%8'8$(<6$8w<6$(%(PPK%T%n-!h$8j$(Xht4' <)5%P@TP4l<ʌ#X$X#`$`+h#h 'h% `qk% Xkq $#X#`$`!XlX +p!$!"dB1@"% 6| t8"<!d!C!0 Bp'%8'8$(<6$8w<6$(%(RPK%T%n-!h$8j$(Xht4' <)5%P@TP4l<ʌ#X$X#`$`+h#h 'hk% Xkq% `q $#`#X$Xm!XX +p!$!"dB1@"% 6| t8"<!d!C!0 B$p'4% ,%?2% .%@% A*% B,% C.% DE:%(6FD%0<%(GB%0>%(H%0I:%0J<%0K>%0LMJ%8'FNT %@HL %8'OR %@HN %8'P%@(QJ %@(RL %@(SN %@(TUZ %HiV Vd %P\ %HiWb %P^ %HiX%PjYZ %PjZ\ %Pj[^ %Pj $(,8wb$0','!$7W!$B$0 Q 8(` ` $$d4'+= % '("C$(# B8@"#"#"#" #"#"#"#"#( "$(# Q   $$"(" B8@$$"'+= % '','!$ !$a<%0'!0ǬŬ!$%(0"$4'!$7W!$B$a4 Q <(` ` $$d8' 0,'< $+0%(%8$ 0(!(+= % '%8'ȬǬ$(B ($ Q !0 A $$A(A !8 $$A,0'pa""@ ! (!<0B$@ #+#  (D!O%+/0 $* @%H''!$ !$A% ' $ $ $<c4+b|`&<6&W@<B$&A@X"!LTJ H DLTJ L @ HDL @y  w)f%08&0&0f'(B%8(D%8(F%8@&8&8B$!$$+0D,B$!"$&2% &4% !%$DF2% F4% B%D & &$B0!0&Ɛ2% F$!0&Ɛ4% 0&&a&A&a&A&"'$G  "p+# % cp $##!C C(`% $C$(f,7!$$ I '׀G$ , $ 8(8B$#( DBA+@#@$8 ,  B, %%!0!A!$ I '7!$$ I '+= % '0" R# "8@    !A+a`B$ N T@\4G!$HM T"$"!0Dd$p<d$0 f!&<dd%0+0 (,A,0'   *@ $ "@B$" "$Cw$Wc$"C$#A8 e $ < `$$7i '+= % 'l!  "## D $+D#b"A '+= % '!"   <G ($ F  :<F 84 N  %%8484<5O  <9c4"C0G`D#$+3`BB0@ %!B$\!$!  #c0`#  c$(,0'$(,0'  $(,0'$(,0''>!!0  "B0@" B $( ' $( ''$( %0% %TI c$%!(+(e%! %%(% %+(/ %0%   $( #0B1$!(+0G#0$0$@ , @ % $#0&@ , @'0$($ $,048<',048<'#$B$ Bp $#$$(!C,048<''$0!"4+(d,z+8F #'!A&&p!8#A$$7!$$W!" #'+@H! !!0   4,7+D`!%8+8<@D' 0   4,BA#a $Pi c, P# !0ƌ$f%%C$+`#Dc$$ d f, $ $# d c, '$#8<@D' C,$E ##$($+`#$c$ e e, $ $# d c, '$C 8<@D'8<@D' 'PL%"T%c0`<^`e,%"B0@D"$+b@A" @    '"C8 ` !!$@$ @ !B!!A#$ "@D# !# ) 00$(!8BA!A#(!! $+0#$B$ , $ e,!$a %A B$ d c, $$b ' "B0@" W#!d8B%(%0O C,$D B$De( c#080!@1 $+P(@#('%H$0 $P , P 8  - #   !(i$$@ %8!c$e$ %b0 , $ ' !fc$e$ %b '8 ,8 8!e%!%+8d$("W!CCD*%&E4% ,%eE2% .%E% E*% E,% B%D'@'` #$"+= % '"#% %(&0+( %$$8#@$0+(#('($ 0p$ 8p $#0$(#0!(% '$$W    "$## $ D#($e+#'@$ p $# c$ cp#$C!(D@8 @B$E0+(# '!EF0+0.$# &$H , H$#8@0 , @ 0 , %f%i #$(C$?e0e0&    # '# '< !$$ += % '  $   (@< <"@B$" "$Cw$Wc$"C$#A8 e $$  %,&@8  8"@B$" "$Cw$Wc$"C$#A8 e $,"%<$&-`#% &(@$$w   ,$" #$?00 , 0 ?0 $#(08$0 ,  , 8%g%b "$&PH'<\?!$$ <,!$"<$W`D$%(7W%(% (@@  @"@B$" "$Cw$Wc$"C$#A8 e $$LR  +PH'D${  += % '<"?@ !$$$ ,5  x<`^!$T<ǁ!$ $~ x" "<@#[  #W<M_  ,-L<N_  -.M(m2j@  <@@@C_  !#A,X8(< L$$9@`W<L_  +,K$<Աc$w%w  ' $<ԱB$W$W<@LLLdefc  $%&Ad0 Dc$+`Bc0`!$|&#`H d,H08b@"02 8 04$$$!($D&0q08T 0%0$$C f0%0:f0$+8$+8 8,f$*8&(f$$8$f$0f$$+8 8@f$$f$8$f$80f$ f$ g&0{8x(x% $  H@Dc "0%% 04$$$ %@0!00! $+0HF#0$&#H!%  '+= % ' " 'C'"J '+= % '  <<#a+ a##D% A*0@,% $40', t!P "T $d �f!8F++fh !###!!"gO ($, gO ($H ,(<(<,33<33c4?<33c4 G ,( N 40'+= % '<!$! $ !$]   (@` `"@B$" "$Cw$Wc$"C$#A8 e $$<<<!$ / '!0 % '!$B$@#0d\$ P$ <\<< c$$( . ','D'!$7W!$B$ah d'+= % '<!$8  < "#< #+(##eD04p4!'p!C (@ "@B$" "$Cw$Wc$"C$#A8 e $$ <@"[  " < @<0!$J  <'<'⮴<,!$a  " ;<ʄ4@<p<!b@! a+!A!#<0<4 #(!E+8E+(<0#@H#(!!g<4<(<,<B$ J <'!$ J <&!0<B$!A<0<4"#<&!0<B$!A""<<<0!#+#<4<!D!#<#A+A# #< @dp'p@!!a' -d 0 0  !$B$C(/`#$E8E8 $ += % '<<D B!C0`$r%  !$$<!$ $% ' '+" % xx'#"B&^(@C`B@'@<`Ï[  #` %% @<`$n/XO $nAXd$d d$$$d$e8`eÓ`$ï$@<$ %@n 'T n T"@B$" "$Cw$Wc$"C$#A8 e $"!0 # '!9 < %%> @n '\ n \"@B$" "$Cw$Wc$"C$#A8 e $"!0 # '=`<`%% > %% "`n (` n `"@B$" "$Cw$Wc$"C$#A8 e $"A0 # 'w '+= % ' ŽÎ  '+= % '7Ž<`#_  "#"' += %Y '\7<@D"[  "D f0,<+8  e&(&B&D$, b$!A"#B$"B,!b"P'D${  Da b!"#$+(04 &8 $,#$!A# !$ U '4 "#D! $+!C" ' '${  $   <0!$$ $5 <5!$ $ (5 <!$$ ,5 "D"$ "?!$0  4(0B1+@d $P&q#jB)!@(%q# <(\4(!0H!@ ` $ p!d+ ! BB!fC+f!dCA$( b8 $)7 '+= % 't7"$#$T#$P#$l#$h#$d#$`#$\h!$X 9K T 9K P 9K l 9K h 9K d 9K ` 9K \ 9K xtA|AXJ  tXa\b5O   ?<G LH ?<F O ,0gO L HH  <F D@33<33c4ӿ<33c4 N  $D@33<33!4 ?<33!4N  t` `0,G,0gO L HN  ,a$0c$$,!0,0,gO LH<&7F LH5O  LH H ta b0,<` `% <<H L P T $$0,8+ *(&,$ % 9 $9 #9 t!$,0 9K t, <ᎊ t"$X4   %#L HXJ  ( % D$@$$  $( @D c @"@B$" "$Cw$Wc$"C$#A8 e $D`(d,hL' )@0 4 "@B$" "$Cw$Wc$"C$#A8 e $('+= % '$"8#@"8@!85  7!$(, EK U9 ! 7!$(, EK  7"$!$(, EK $ EK ' %% ,( 4 BB!+0@!0d$@p p# $#8h`$@p!8B8(B)<(\4 ! !(8!0+8+!!$4@Dp@!DD,4<+0$ %<& "+0"+8e,$ % # e#"+d##&"+0"+8c,$%f`%%(T#& b+0C,!+8$ % %%X\P'T"!X\P'+= % 'D4  Dde&0+8+@D,8$0%0&@+H+P-$@H%@(%0%8%@%0% %8%(#@'#HF+P(#H*Q N A%@ - $ <8H*q8!Hi<!`g!H&+X!Hi&X+h+pk-$X%X`%H%`=$<8 p8! <!8! +(@<+0+@J,$0! %( J5IHBI d $`iq#@ +`  ! !  p! B((B)!0(p# <(\4(!(8!0`$ p! +8!0B  B!! !D+8D+ ! !d!$&(d+0d,'+@G$(%(% %8H"$#$L#$H!$D J LJ $ 0HJ T "$! , ?<G  ?<H @8Tx"|!$!C0!$+C!# !b,!$+b!AeP @8G O D J P'+= % ' %@$ $"@B$" "$Cw$Wc$"C$#A8 e $< !$5   ^T <(!$AK <<  : ('+= % '<0!$J  <@!$J !A+" !#!A '+= % '<@gO ff""!<$< !$ $<($<!$D ` <,!$"<$W`D$%(7W%(%n "` W?A$ $L%(%0,,dA@   d"@B$" "$Cw$Wc$"C$#A8 e $$,APB$#D$(pttE08p (,)7P0 $0!H**$`!@18pttpA$  l ,H( $!8B%(F%$%(%(<\Q1@P%.*@D@%$, <kB$!"8!$BB0$p!"a 'b#<`j$!!(%" ( $%0%8,8/h ۆ h"@B$" "$Cw$Wc$"C$#A8 e $$,8( $<%0'|%08x$x|@(|$%08$t@(p!8 <)5$+8%@$  %$  +@9 !!&tpb l ,H(< $tg+@at^+@Z )!0& 9 9pttpA l ,H(< $ 4AD  .@8 8"@B$" "$Cw$Wc$"C$#A8 e $$<' %@4  4"@B$" "$Cw$Wc$"C$#A8 e $<'+= % '<,!$!<&7 1 '${  += % '4 ,dT ,$4,80%(' !8 #8%P?$8#(!0#!/  $K$+HM $#PX$?$8!8'*H* %H%H% &P@   , $$ @<!8 < !$>1 ('W $,AV ,dda $$ 8%%  += % 'dT $% dede W   W $' a$ #, `$!A!'${  += % '"%@ C`W $W $A@C dW W $A@% AC% a 1 ' '+= % '<< %A % <!$   "~@N  <4! <0!$ <4  <4B$d <<B$d <0!$s " <]!$ '$ 'a A <0!$ <<B$d <0!$s %%,('%#$4+( B!A   W %<!$ $ <0!$$ += % ' %% 8<*`4 4"@B$" "$Cw$Wc$"C$#A8 e $$8 %8)@<  <"@B$" "$Cw$Wc$"C$#A8 e $$8"C$#A8 e $L'+= % 'lw<,$<$0$%@%@ ;@T,#"@ Lls TL  T"@B$" "$Cw$Wc$"C$#A8 e $l ,h'%*ps!pЁ+t !2'@$P2@8d`%R&S.`$S U. $2 !!T.Q0@!!'JK $@d`@'!(ls $'M  @(!8"@Pl d"`d' $PlLpD<HX@ $\8d4`0$%8t%$  % %{  % %  %$  %  += % ' ''!$ !$A < '@pX  p"@B$" "$Cw$Wc$"C$#A8 e $X'<>B>4@K0@D$8)D',@< g$!BD0@$+0 B1 #0&}@" '@ V "@B$" "$Cw$Wc$"C$#A8 e $$@A7  c s '+= % '8w4?e$,08DAf0<f%84g&8f#0$!!@ f D L P @   ( , 0 ?!$%"+= % ' "& Cb&"@"b"$Db&"@"b"#C   '"!  <,!$-$  <,!$$  <,!$$  B#08!gcw@&,1b$!A$$7!0$#'`0$ ' 0$%#W$Ws "C$#A8 e $, '@$  $  !tCwl c$!0  r% $ !$$<!$ % "C$#A8 e $$@('<а!$ <@@ @$!#!C:t  0!8 <<,4A48('$,0 r ,4"+D@4$$48('48(' <(!$$  $:t ' @0f,1?<6$87<!(, @$<$@78!0Ɍƌ!8'P@'8 $(,F<<@4bD'T'!$ !$A<'0w',0 !a4?<6$B$ ܃ ' @d,4@$0=$$@7@C!8!(e!i'H c'` $(,@4%?<6$0 &, $@$X$8!0!%'%E"%" $($#,$CÌŌ' $#'@$¬@$ $aq $ BB /%UU,%(#<& <%<6$w<6$#<6$W%a% <!4 $ $(;70!0njƌ#@$@#H$H+P#P 'P@% @q)% H)q $#@h$@H#Hi!@ ?1#HhP'0` %8 - ` 0 (- P%0F - 8%0$$@,!8$8%8$%@% % % <& %<<6$w<6$#<6$W%a% %H% %0 k?0#HdPhp,$ , h%` P -  $- p% % % $$H+0!0$0%0&% '0#H$H+0#0'0)% H)q#Hi'P#h $PMJ% PJq#Pj$0!0?0#HfP,h $` , h  - ` &- P% D% #0 $0#H$H+P#P 'P@$ 0p#0f$0F)% H)q#Hi!0?0#Pi $`-pM/%h )- ` - h I- p % % $$P+H$!H,$H,!@%H* w# @8+H ?0#Pih,p&xL0%  )- h %` p . I- x %H%H1%0&$$P+H&!H$H%HI N+= % ' "8@7$$@$+A@$ < (,'$  (,'B$C,`!#dc' '`%(d #$#($e+ # ' B$ Bpc$ cp $##$d!C!"$(,' $%(!$&,uW0!0Fnjƌ'@'H%P(@@$%('P@Q#X $Xi#`$` +h#h 'hk% Xkq% `q $#`#X$Xm!Xl! j#P$P#X$X+`#` '`k% XkqJ% PJq $#X#P$PL!PK!PE+PC8@e$ $A@$"?0#PX`pI$ , ` X E- p%(n - %($H$@#( $(%#H$H +@#@'@$ (p#($((% @q#@!(@,6 (p#(+0#0%0 0p#0!(@$#( #%$#(@P +XE`?K1#`pixhq%) k- p $H. - x %X ,. %Xr$@ %X ` ! % $$!$% ',bW8!8G'H'P%XI`%8'X`Y#` #h +p #p'p$PJ% PJq $#P$PN$H)% H)q#H!HI!(+! H q+@#@%8 8p $#8#@ !8!0@$#8#H$H #P$P+X#X 'X`)% H)qJ% PJq $#H#P$Hi!H*!P$+PC@@)- ! H q#H+@#@%@ @q#@!@(!0@$#8@$+ $+= % '7@"$ $   '+= % 'd8XB$d$$+ (B$<!$  "" '04x $| &D!(x %+ ! | $$$(,  +($(,!($4$$(%( p+ gl !$ ]U 4 !$ 0'%  %{  %$   7 !$ <6$W$ @,<6$(&(0+0&08%87%8'$@4<6$0&0+= % '< !$"@<!$ < !$" @ $< B$A<!$s '+= % '7"$!$  "B$"ChDc4Dc4 D$!<6$7 %ae0%(%0w%0s 7 "b#s '+= % 'r"8@"8@WO%w#8`!8 7% @ dXDbbB$b bX"aa!$a'#$d8$%0w%0f8 % !$% %C$d8$%0w%0f8`% c$$% %$% wW% d f!$ $  <"!$=$  += % 'Ž#<4  <!$   '# '+= % '8$<$8!8$(!(%!$<+07%0!0ƌ0'$<+@8!88<ı88,$  $$($<`S!$'G <`SB$j += % '<!$$  <غ ! <ܺj += % '<!$$ <` ! &  Ω 7 C< $E &o  #$! %$&#A $"'"'   '"""  '@ $C  $''$' <B$ ( ' 'a  $>@ <!$a % $'+= % '( $     <B$Cw$Wc$t  "<@c$&C@!!%$  (A,'+= % ' <@  <ۙ!$.$  "Cc$C"Ca$C$!"3@C8`B8@$" <@!$$  $C  $C  '$"  !<   $ ]  %8($$  , (8 <c ("@B$" "$Cw$Wc$"C$#A8 e $$,t!8@   ,"C$#A8 e $4'0BP"$T!  !$('a ,' *@Pl  P"@B$" "$Cw$Wc$"C$#A8 e $$! \<0!$  <\$0<0$<0B$A  \"tB$C!t!7$"0$<0!$<0< %%( > $0%(%$L<<$$<Ȍ )94  % $%X7W%X+``HdX  ˬ X!$  Xab<0!$<0$$0LdH $ $  !$ $&$7$&$!8 e $   ,T$"  Tab<0!$<0 , <0D<0!$s D l@  $#"+ #(0#8# @88 <5!$ <;!$ <0 <<(%(%0%8%@Y)$<^XB$%% 48<]$0<`<$!$ <$!$ <`84# l!$$  p''!$ !$Alp$t0x|(48h'   #Hj!P+`G#X+Hi#Hi!H !$!@,B$%8 @)*J9@.$< $*+%`j($<J$%%%%   <0!$ (@0z 0"@B$" "$Cw$Wc$"C$#A8 e $$ ,"C$#A8 e $$d(h<'<!$%$ '  @@$ 'b #DB$b!, a!$a a  '+= % '!&>3  %$ '/ N "<@c$&b@ <@c$"hV <@c$"&C`xAa !x  ' (%(%048d8d$$%@%H%H  $%@%H$%@%H) $Ì`c$ì $d$w$Ìd$Ĭc8`eÓ`$ï$$+  ˬ "@B$" "$Cw$Wc$"C$#A8 e $$(a!$a 4$$%@d   <0!$ %4(,l!$$   %<8l!$$  <l"f@ %$&@" "@B$" "$Cw$Wc$"C$#A8 e $$!$< ''+" % '% t"<0c$d0WD A$ {  <$ <$0+(tp x|S  pxt|<< !$ 1  pt <40p2c8`<0!$AK  %" `t& Cp+*b,$a%A#  <0c$ 9K t"/@"%@pt% C%0   t%(% p# D#e+D#bA%% $$<<%`%% L   <0!$ 9K <0!$ 9K <<%"  5 Y<0!$  <0!$s  a  / $A %<$$  <(  c "@B$" "$Cw$Wc$"C$#A8 e $$'a $A 4$$  4(  c "@B$" "$Cw$Wc$"C$#A8 e $'$ LPT<0!$s  L' L a $A 0$$  0(  c "@B$" "$Cw$Wc$"C$#A8 e $''  %@$$  @(  c "@B$" "$Cw$Wc$"C$#A8 e $'' X"B$'  8$$  8(  c "@B$" "$Cw$Wc$"C$#A8 e $'d' d ''<!$%$ <!$%$ <7J!$($  %H8$%( D'<XH8<$$   8< c @b@B$b b$D$W$bD$dB8@e“@$¯"#  t! (,0 %$ 0( r $ 0( @$!   0$$  %  "@B$" "$Cw$Wc$"C$#A8 e $$$lB%C%lC$ViB0 <@$$CD_  #$@@O < %%> 0$$  ( s ()@0 $c "@B$" "$Cw$Wc$"C$#A8 e $0$a ( s  ,'+= % '< %%> 0wHd$$$(8~$@4 $  $  0$$   $"@B$" "$Cw$Wc$"C$#A8 e $l!%"%l"<0!$ 0X <\0@%XA%  ,@ $   < $ $ = ,"@B$" "$Cw$Wc$"C$#A8 e $ 8' !l 0 <!$%$ 0   dt @$  $$   "@B$" "$Cw$Wc$"C$#A8 e $l!%"%l"    '+= % '< %%> %@  "@B$" "$Cw$Wc$"C$#A8 e $  ,0(  ' "B$"$$k48<  84A48A<<A$$  4"#+C`#+b @ <0`wd$$$%8%8%8D(@ $ˬ "@B$" "$Cw$Wc$"C$#A8 e $  7"#"B$"<0"$<0!8( <0!$ !@"@B$" "$Cw$Wc$"C$#A8 e $<0!$s '+= % 'Ž 0"<""!  %@ C "@B$" "$Cw$Wc$"C$#A8 e $"  '+= % 'Ž Ò   " '+= % ' ''<0<6&7 < %%> $`d8d$$%0%8%8%8%8=@"@B$" "$Cw$Wc$"C$#A8 e $ % ,$$  < !$"W$7B$'  $  "@B$" "$Cw$Wc$"C$#A8 e $l!%"%l"<0!$  H`I,d$,$(4njȌɌ&8Ɍ&@ %8<0!$$ I "$C,!$$,4¬$!b¬!,ŒPT$  4"#B$"B,!C",    .@#( H ("@B$" "$Cw$Wc$"C$#A8 e $$,$Cd$Db8@e“@$¯L8'<3!$$ <!$$ l'+" % '<Ŀ PCTD%`'C`dc%% e$*0%%< B$  < B$B$#c0!# $ ''!$ !$A' 2$j $ += % ' '+= % ' '+= % ' '+= % ' '+= % ' '+= % ' ','+" % '<ij!$"@h@C`T'X   !l !(  <0!$$ K \ ď$'H'!$ !$L'H'!$ !$h"l 8%4! $!  %%%%%  ' d $ 'X\ `d$ % %% 4t)`T  T"@B$" "$Cw$Wc$"C$#A8 e $$  <0<0%(A<0<04G#HaLP!P<0+(E@ qL!@H#P+Hi#HIHp!@ !0!(<040,<0<0t$76!0$ ,0t8%84;@(P$  d!t!P( 1 P"@C$# #$d$w$#d$$c8`eÓ`$ï$4,0t8dt, $t!0! Bdt %@X" X"@C$# #$d$w$#d$$c8`eÓ`$ï<44t%@ %@  "@B$" "$Cw$Wc$"C$#A8 e $''t!  (@Ïtc 1 "@B$" "$Cw$Wc$"C$#A8 e $k '+= % 't"R@,C &a `Cc8 `t ,@@ 'A <!$ $  <,!$$  <-!$$ 5 <!$ $     (d$$%0%8%87+@$ ˬ $"@B$" "$Cw$Wc$"C$#A8 e $$(a!$a $$($@"@B$" "$Cw$Wc$"C$#A8 e $$$$ !D!8$$@#0j<C $@ , @+0"^<掀H!0'@$$fGF!@$$H#0D<C 8 , 8+0"9<X f$!A7%7!8$$@#0`<C $@ , @+0"T<掀H!0%fGF!@$$H#0><C 8 , 8+0"3<X f$!A'7$7a'!$ !$A <!$$   DT D!$8J 0#" ` D!$J C D "$B0@ C0`Hd8A48 DJ  LPTX\`d@'$$W8 DJ LPTX\`$d@'D `DPL H$%$+H  $"%+P@J,@$#P W J1!PK8`,($<   ,D($<$$!%+H& !# $"$+ LPT< !$X\`d@'D,F8#@H0#X_ $H+(#8G!Hi*`h+@%#h%%`(,%@ *8&+0A %%%P%X % 40#  g8b@#8H<#h o $H-4#@!H*`+8K% %8%`!8%*h+h:h!hm%h *h!h+h-#!g?<6$ ! !A@D+G +  LPTX\`d@'% %  %%  <$!$0$ %%{  %%   <!$<$ %%  %%{  %%   %  %  $  %  %%{  %%{  c$`8Ō+8%4Ō8!(<[  ' %$8nj&8%( J 04`%{   += % '`< !$ 6$CB <@C_  !#A   $ ' '+= % '<$!$!<(B$B@CB%%$ $  6 < <  ''$  % "B@$  %<!$!+ "" #$% # "  & d$e%0G%0%(%@%%  &8 % +F@$$ @<@_  !" ""#(<`(#_  "#("<`#_  "#"<$_  #$# @<`(C_  !#(A" @<`(C_  !#(A<@,"_  %",%0<`0#_  "#0" @<@0"_  %"0%&&"%c8`B$&"< (0g  !"# $(0.0 @<`,C_  !#,A <@,_  !",<@0,#c  !"#0, &%B8@!$&'XE\G@D&(&@)&(D&(!@5XG\E (< @("g  &"! %(&("@ D %+ D& $ D& $3 3 '<!$@ '+= % ' e" @"tB+@WB'@H"$B$$WB8@$B CD B +   <3B$$ 38 "WB$Cw$Wc$!7!$ ''<@D A  @0D4,5  ,M "@CG`(A5  '('!$ !$A,!<' ;  ,C(c8'@d,C.$&wf`<@D < ,5   (!"# "$ "(@"8'<C8`0!"8@$&7 A,$ 4 !; 8'C8 `<̿`8' 5  <0'A , 5  8'8' <@!$$ < < "!$$  <\r!$$ '<ij!$! @ ,D !0 $0AP% pA@ @ $'  $$'$'' $ %% <H)`8  8"@B$" "$Cw$Wc$"C$#A8 e $<HL!APD'<!$ $ ${  B$B $+0tdc`C0d,?@ <B$!A, P  ,s H C00e,<$!ee%0 @Q @%%%0H%Čdd# d%Hg%${  %${    0(@, \ ,"@C$# #$d$w$#d$$c8`eÓ`$ï 04+(w%%u!$+$ += % 'H% L%%%0%8%$%0%8% %*@%%@c`%%H%0% !*0gtB$%02@C8`D +a`!cȏ+@hȏ+h`+O`!"!TX@'Dd 4 HLTX@'#HO $H $#(!I# $Ȍ*H %@Ɍ&PI@(,08<$   48 (,<0$TX@'%%{  %%{  %iB83@"()@!$!aBK$+ GD8$KB8@$ MD8$TB8@$$%(]@DH4'@DH4'@DH4''L    @D$H4'@DH4'@DH4''L    @D$H4'@DH4'@DH4'2=%(B$"@,('L D A $ $( ,  +"$&(d+d,$%a" (A0,bp$p0!a!"`$*`K%X%` %X% +`b+`JyPp#`g#hG%#` J%g $PL!P%%%h %p%x$:Y+ _ r! +8+W8&p!8<_  $(+"`&p!"& @)(<@"_  $"$ '{  *&%* % RS&H+i*H.$J% +3*$% T +!&%@%H% % %@%H % % {  %% {  %   <!$$ {  <!$$ += % '"$*b`B$ '   "$A'+= % '("@,4d& @d@('% $%@'0'!$ !$!B b$,0$ '$ 4'+= % '(,$ $  <,<0# 0 #+(# B+B$%d $ '$ $'+= % '@D$ $  8$<,H#A+A<0##b@%" D!0`$"p< B$!ALh  (,048$$ ('$ <'+= % '(,$ $  <,0#+ <0#(# (@'%d $ '$ $'+= % '<"$$"2@04$ $  < cp $#'<,8#(+0<0#8#0:*@5%( $($ '$ ,'$+= % '! [ ("C8`C8` C8` 'C8`  '<Ա!$!!0!, 'B8@  '!$!!0!, ' !l !( %     ' '"B$"7"$Cc0/`Cw$Wc$<c$c`Cw$Wc$"C$#A8 e $"B$"<B$B+ "@B$" "$Cw$Wc$"C$#A8 e $+= % '<@$ $  40D,@!0`$"p< B$!A$  D, $(40 $ '$ 8'+= % '8t"0<C0$ $  07 $$! $+(!( $(,! $(, $ '$ 4'+= % ' $$ $   $  '+= % '(,$ $   <$<( $ '$ <$<(#$<$+a!"<($'+= % '8<$ $  0,<!0`$"p< B$!A$   $(<$<( $(0,$ '$ <$<(#$<$+a!"<(4'+= % '(,$ $   <$<( $ '$ <$<(#$<$+a!"<($'+= % 'DH$ $  L",B@<$  $<$' $j !$%0<!$$'$ * "$0@B$@P$T!8%$ B$$+b D ' ɯ HL8'   #,?`P(T$ `<6!$H4'!E%( !0$%8wǠ1@>%$! ( ,g,$0! !C$ (%L'`'!$ !$a <c$LHTDX\dPp`L'a l'%   %   %   %   %4{  %  %  %4{  %4{  += % ' < !$  ɞ < !$s '+= % '$  7$'$  (,'(,'+= % ',"@$0% %(0 $ع  $%(%    %$0 ! e,  !A,Ť ('%$  += % 'T dga!HS ,4!$DX\` d $ (  E4+0@F$!( E$ E E $4+@0+@)F$<6!@G$@T*+!@%` !h$%pWi @v %P%Y ) m-N-$h!X!@ e% E $+P@+P@<6!@G$@H%X !@%`!h$%pW%Q ) M-1!h!@ % Ew $+P@+P@<6!@G$@j!@%`!h$%pW%Q ) M-1!h!@ % E $+P@+P@<6!@G$@j!@%X!`h$%hWk%Q l) L-1!`e!@h % E $+Py@+Pr@<6!@G$@,_ !@%` %h !p$%xWϡq @~ %P%Y ) n-O-$p!X!@ e% E+@I#8<6!@G$(!(*0%`D&8@<84L   L@8<T4 E!( E%($(0!0&ƌ0 ع  $0ThlptP'%%  %%  %%  %%  %%  %%  %%  %%  %%  %%  %%  %4{  %%{  += % '"G !E  ! !0 `a$#c0!C''$%  += % ' "B0@%:"B0$+b`$+b `C8`,"$*B8&@("$$B8@$"$0"$$+b `B8@@"$$"$C8`$"$B8@0"$ "$'@"B0C8`B8 @ !!E  '' !!E  'BG !E  '',"C 7&"`Cc0$0& dDS @|S @&" | K   d0% :d0$+($+( 8,d$*8&(d$$8$d$0d$$+( 8@d$$d$8$d$80d$ d$ 0%0:0$+8$+8 8,$*8&($$8$$0$$+8 8@$$$8$$80$ $2'XG !E (X!pG !E (&AC p K ; DQ $+ ,$+ $+ $8:"d"& 0 d%0 %@&H)  i)1 4$$$% %0!0# )1 4$$$%8%@!@%P $T%K'!80  a!E @ !|!E @&A | K  (d(&0@%'' a    % $!$B  '"8@"8@$a$&" %  a   ' a    (!(B&"!,%'$+A @!8  a   ' a   '"87@"81@(a(&A'  a!E @ !|!E @&A | K  (d@%S''"8(@$'$''''$'$' <Ϧ!$$ D   <:!$$ ,$@*0$(b+0"$f $@p(!0+H"y ,l$!(`!E <`!|!E <&AW | K O l!`B  = l!bE <`!|bE <&"% | K  ld`& ccc0+0+ &d`'''''$'{  {  0$@*0$z(b+0"~$f8(!0+@"u0d$!\G |\"G x|!E <tx!E <&AE t K = |׿ <|x׿ <&A' | K  d"( h\"( h   '''$'{  {  8A%$T P*P$@P!X+`'8a! B   '"d0%0% f04$$$ f%80! 0!#+ GZ# 0'$ #0G!d"0%8%  04$$$ %@0! 0! %+(H7#(8/$(#8H! HL%4$LH*(&(!@e+P'@4!B   '$'%{  %  %  %{  += % ' 4w d$<4(B($(p#(E(! !,7$$E0(!    $ %$0 ! e,((!A,"@B$" "$Cw$Wc$"C$#A8 e $0'%$  += % 'X'$    +Ac8&0*8,$% ` 48<,'#"(#+"#a$ $B$  '+= % ' $ (~ $B,  '+= % ' ] '+= % ' $ ' ! !+= % '_  '' &"`<`d  -  c   ''+= % '  '+= % '  '+= % '  ''(0*A`%+@$,& #! 0Ep<#!E - $,   4'4'4'+= % ' "@$( 04$ <'!$(0 4SE <'+= % '& '+= % '& '+= % '< ! $ - $  '' -   ''C,`% @dt&0$& + ," ("4 "  <+B,<+ $D%b@%%  $ $%%0 <_  !& < _  !% %(C<_  !&  "C82`!"8*@!8 <!$$ < ! <j  <%Y!$#,`Bd,]<ང$!dd%0$($8'$Db' % %(@t<(k!4  <\t@  t"@B$" "$Cw$Wc$"C$#A8 e $$xXA`<889<% %(> % %(pV p"@B$" "$Cw$Wc$"C$#A8 e $$xX$$%8 e $W" z   \ <ؤ!$' '3 4'' 'd{ݯ ߯,%Ï~ Ďݏ' '4 ''%(C!ClD  ݏ'Ď#'<' ¯^]$َ ?  4ݯ ߯,ï(֯Ǐ> ?  ( ?    ݏ'@X 4%%$+ <$ $+ b>$&D;@?b?$&D6@@b@$&D1@AbA$&DB8+@BbB$&&@DbD$&!@HbH$&@LbL$&@PbP$&D@TbT$& @XbX$&@\b\!&A!,  "d&@b!&"!,  !B&A!, "d& @b$&D@b!&A!,  "d&DI@b$&DD@b$&D?@ b $&D:@b$&D5@b$&D0@b$&D+@b$&D&@ b $&D!@$b$$&@(b($&@,b,$&@0b0$& @4b4$&D@8b8!&A!,  += % '" #& &%b @$$#&bB8@%%#&bB8@((#&C@,,#&b @$ K % '$ "!d&c&b%"!, += % '"d&D4@b$&/@b$&*@ " d&$e& %D!@"d&$e& %D@b$&B8@b$&B8 @ b$ !$ $ K % '+= % '"d%& e&E%D@b$&@ b $& @b$!$$ K % '+= % '8  % !$!$$ K  '"d%& e&%D@b$&D @ b $&D@b!&A!,  += % '"d&D!@b$!$$ K  "d&@"d& @!b&"!8 ' '+= % '$ K  % !$!$4 K  '"d&@b$&@b$& @b$&D@ b !&A!,  += % '"d&@b%&E @!b K % '+= % '"d&@b%&E @!b K % '"d&-@"d&$e& %$@ " d&$e& %@b$&Dd%& %D@b$&D @ b $&D@!b!!&A!8  += % '"d&D@b$&@b$&D@b$& D  ! c K % '+= % '"d&1@b$&D,@ b $& '$e& "d%& d%& !c K  !CB K % '+= % '$"! dc N ] $" d ! c N N  "$d!c N ?  "$d!c N 0  "$ d$!$c N !  ("$(d,!,c N   0"$0d&DB8 @1!1b&"!8('('+= % '" d&@ " d&@b$& @"d&@% %$'$ D(!A$!CB! K  $+= % '"d&D@b$&@ b $& d%& ~d%& yd%& t d %& o$d$%& j(d(%& e,d,%& `0d0%& [8$8e& V@$@e& QDdD%& LHdH%& GLdL%& BPdP%& =TdT%& 8c! K  % "c! K  4!4C8B K  %<!<C@B K % '+= % ' "d&@ " d& @b$&@% %$'$ D(!Cd!A!b K  $+= % ' "d& @ b $&@% %$'$ D(!Cd!A!b K  $+= % '" d&@ " d&@b$&@b$& @$"$d&@% %$'$ D(!A$!CB! K  $+= % ' txt @Cd0 c0 `4 % %%% %%0c8c`PL N& @ !86 A Lz  0! "#S`C8+`#c0c8`P"" !\<2!$  <8jB$"" "<@\[  \""|'P"$"(!`<P!$  <kB$"$"( "<@`[  `""|'$+bQ`C8)`C8Q`P"0"@!h '+= % ',7@ b $&D9@$b$$&D4@(b($& D/,!,c  % 0"0d&D@4"4d&D@8"8d& D%<!<c  %%% '+= % ' W '+= % 'W '+= % ' "'C'"!  ' !"!(d+"!!!+%!A $d%d' $#%A$( #"#(d+"##(E#&+E#" '`$D&d'`$a%A$( " (b0!0+8@!8H!0+0H!0H!H'+8'P!8!0+0!0bpq!$!" += % 'HL N  $ HL N !8 HL$ <0 4N  0 4N  +e` lpX'dh ?<N  dh <N  h<6$7dd_ TP LH N  \ `N  LH C<N { TP N  HL?<% ITP ?<N  TPHLTP <F TPLH ?<F TPTPLH\`7] THG Y %% PLTPLH\`[ D@0LPO HTD@0%@|\` <N * `<6$7?<\ N #dh N #&"!8 lpX'la%$0?$+(0$*0ce$0+(4 '0?0#%D?!0 %A?b0%A$ '0?0%b?!0%A '4 '0?0%C '4$ '%%' $b!0%"$ '4 '%{  += % ' d%(<`w$!(%0,t0./0@(<?$!(*8&a$+8A{g%@+ +( 4 '$*(&>a%$0?$+(0$*0ce$0+(4 '0?0#%D?!0 %A?b0%A$ '0?0%b?!0%A '4 '0?0%C '4$ '%%' $b!0%"$ '4 '%{  += % '$ #$ !ce(#$a%%$,$0'4,0'$*0 +04!0Ɛ08%(+%$`(##%#E$!d :d !"$&C @4,$0',0'%%  %%{  += % '  #$!ce(#$a%%$$$('4$('$*0 +01!0Ɛ08%(+%!`##%$!Dd !" &C @4$$(' $('%%  %%{  += % '$+ $+ "q $%7A?a0$%7A$ '4+ w< 6! w$+ $+ "P $%7A ?!0$%7A?a0$%7A$ '%0%(<6$(%%*($j+($x!(#%0, %$<`w$ <?J%%@<`w$!(%88L0!@*HB ./0@()$ <?J%!(E+X$N`!Hi)+X+,`+((8%$+H9 !($0? $+(%8!$+($'!(#$0+(% ' ' ' ' '$ '%{  %%{  % %{  %{  += % '$#(/0!(ef2%(f4%(f6%(fg:%0g<%0g>%0%(<6$(%%*($j+($x!(#%0, %$<`w$ <?J%%@<`w$!(%88L0!@*HB ./0@()$ <?J%!(E+X$N`!Hi)+X+,`+((8%$+H9 !($0? $+(%8!$+($'!(#$0+(% ' ' ' ' '$ '%{  %%{  % %{  %{  < CI$+ +d8-d8-c8`$$!$# '0!D$Ic8$`$% Nd8id8 $% %($%(=nc8`#(`$%  c$* a! C$0$+( $0<$!0eƐ& %a8 $ <$$$*0!0EƐ$0$+8 $0<U$!@&0%($!, $8 8 `<< !$+= % '(`)` +8$ -8$(e$%%(%0 'B$*8AA!@%H_*9@.*9@1 g$g$0*-.@9 $+PI*@0%9  g$g$$g$ g (  ,!(g e$ e$)e$$ 'B e$eA+(Av!( 40e87E$*0)!0Ɛ+8E$$ -8E$$$*0+0P!0Ɛ0,9$+0%0 ' ' '&A  '$ '$*@!@%H0*-@+P @'(  $Pp!@ % $_(9 $$d0Fp! $d%%%{  %%%{  % ${  += % '4H 0+8$% -8$$%%E$*0"!0Ɛ08F$!0Ɛ 40x8$$p$$%($ $e$%@ %($ $e$%@%($ $e$%@%H%P%X%`%h%p%x%%8<@DEFHL,'$*\@!s%_:$.:N@ $%x u&2 $+"0: `% $*@($Hq$!H2(!`U+!h2%+H %1k% $8.2 s6t2a.f$+*H I  %s&s2!`i+H!hI%$k% $e @%x 8,0xpK@+H !H)0 )5)1&8@$*80!8+8 $$ -8$$$*(+(!(0,9$+(%({8<@DEFHL,'8<@DEFHL,'8<@DEFHL,'8<@DEFHL,'%0#0%0.+8%8 |  8<@DEF HL,'8<@DEFH$L,'%%  $*H !H)%P 0K-`+X `'(@ $Xp!H+%% $_I9  $$8Ep!x%(%%{  %%{  += % '$ d$d6$*(X(%j("% %(%0("% %(%0'$H*#J! $P* +, P J%$JWP`$px , H1%$ $1. ` P - p x $#8@ , @%@%!p.$( %B%O% %(c`#(i8(@) 8 @ !$H) !, H a, (%%!%A% ,04 '('$H , H'!8$% %($#|~ !"$$d <*@$ <⎀ !B|~ #"$$de5,#  <*($+(v <⎀ !B"$($*8F #$#A|~ $(#A$8 , 8$*% !$|~ $5  (d $#($8@$0& *- 0 , @ &@( , 8 %0&0F%0B7g#8$m$x - x %%*0$^B%$$@' ( ( @ $ $%($(E% f% %(%%0%$%{  += % '< $#A0 #40%8E($H !,  0 A, 8% - H%)% eP <@<&7 8@D$$$+ ^$*  <E$+0 <!DDB G $($ 4&< CABN%@ +H+@,$8%(%0c$f,%("! a$$$,!+ B,!,!8$"%$  <6$%"\@<%7`$dL'`dL'`dL''+" % LL' d8 @c8`<c$ I %<c$de!08@$P" , 8 @ )- P H$`b m- ` $p , p%$Xnx X , H x $#0 , %0%0#(@P , @%@ %@ $@ P%(j%$+-!Pj%0$8J$H)& C%' $<\B$ $<B$$<~B$! #+0x ''!$ !$ fK9s`G $+Xj `EK9 `GJ9 @eK9`*$%gJ9 @ $%%P% % $|%X?'V'!$ !$  $*`?'$a'#  >'| $% $*`w?'$a' # >'|w9%%P%X_@  $ (,0'W'v'!$ !$AW' $b' #ߐ G$+b `EC8 `GC8`eC8`c$a%fC8 `#d a%gC8`>'%X *@''!$7W!$B$(, 048'  $ (,0'   $(,'<!$<!$j '+" % '@'h'!$ !$A@' | B@'#b|~ l'|'!$ !$AV % G$+( E8 G8(e8 @'!$~ |'%'f8g8 $% <@'~ |'<%  d@'!"~ |'%%(l'!$ !$A@'l $pt`xd|B@'  l'|'!$ !$A@'l $pt`xd|%(G$+0 E8 `G8`e8!$f8##a%%g8`%%( * l''|'!$7W!$B$(, 048'+= % 'h% G$+( E8 G8-e8"@DH M'P'`'!$7W!$B$d(, 048lpt<'f8g8h\d*0`*8%%% L@$`$ ) * '%@DH M'% P'`'!$7W!$B$$(c$, 048lpt<'*`%#'a%@DH M'P'`'!$7W!$B$(  ,04lpt<'D!$H+ A@@ $$~ x'$ * x'x'$ ,! %89,$$ a1$a$ a$a!$$a% ${  x' a d $ %, !(a08$` ${  ${  % ${  % ${  += % 'P H$L+0D%D $$+8D,  4 B!d$@p#@(%H%(9B0 ף<> 4B0 0B1d $Xp#X  <(\5` $XqBq!Nq#1!Xq+x+p!0!0!0BX gXBY ! p+X!0fDX#X++H+pFq!p#p#Hd$%@ %(ף<> 4@P@H G%@ I%+-!X `+-`k,$ d! $08d d&e+e08$ dd$ddef$$df# '0! <e_  $%,'$%  %%{  {  h!@(0$ % % <̥400 $@pI$b# +@"1d+()ef# d# d# E'$ D! $#<e_  $%d b ( LMA$ 0s%%  %   += % ' ! %%8 $!$A 'B$% %8 *  $<500HH $XIq`` #X+h$%&h +h,%X%% % ,%(@$*g`8`  `0+$%+(`$$#(b%̌!PLL$%  nj*@%B8ף<> 58B9d $P'q# @ $K-7`Œ 4Bd$8fp# @ $,WH$ 58B9d $Pp# @ $K-*`$  B$+ " $ d +A9`#"$# #A!$* 8 8  (  8 `8 8 ('('('$('  += % '% C %(&0'8"8 D$H+@%( $+-8 $*H + %(L'h'!$ !$L' $ $ $!$ $~ 7 <<`#_  "#"<`u!$!$ $~ 7 <`<`#_  "#"<`u!$%%(*0+!0B0+8- $@p!@ +Pi @ +Xc `@$%"8@$#i A!, ' ' %%{  $*(# $0p!0nj+@'Ȍ+@ŒC8`$#'@"!, ' ' ' += % '"@#$ p$! d + ! Y $' "@ #d* !  $'$'+= % 'ba* "&D$+(?d$0p$!0Ɣ +0+0A0c#A#0a(p##$!$ Y $' a  bD* c  $'$'  %{  += % 'd,%%04$( '*8!8B8+@7$Hp!H**P @+*Xd `@$%%H !%!"!`,#"# #A$#! @%(&znj!:p<5+H 4 <)5+P'?@ @~ `!Xk!!H++X"5`!XkXp#H+&X`+X&'`(#$&!( K  4<8 0( <J5@,'$@,'%%  {  %{   %{  %%{  $% +0!0Ɛ%8&`$@,'%{  += % 'D",/@"8@@<%4+7 @< 6!7<c4+b@' $f 0C$ <@%0%8$H8'<@ L H8'*@eA+@e!@+H !H&*%X &@h$4,#!$#c$$b! L  $! $0<@ ,4$$c$A%*@*@e#$H8'$H8'%*P@#Ph+XEp`#XHk%!P+`bgJ!X+k&PK@F$!0&'Ɛ #b!$H8'c$%0%8 *@e+@eE!@%H&8g$+@7!8%@&0$ %@$H8'$*8#8f+P@#PFJ%!8+XB`!PAJ&8#b!$H8'% {  %%{  %%{  %%{  % {  % %{  %{  %%{  %* a! C$*0f$ (  @<($8H8'$H8'+= % 'p( #8`h$* &%'8'!$ !$l%Yl!"(@4dh  t`'$t`'%ph\* C$d!(D$*8G$   p\l   t`'$t`'6B700'!0Ɍ0 $8%8'Ǭ!$*0"!8%@-'%8<'!$7W!$B$d%%B$* C! ".B/0(<'!(0$ $ t`'$t`'+= % 't/ ld8$* -%$'@'!$ !$p%hBC(`4p   xd'$xd'$xd'$8 p!$(4h%5h%lh%t`+(Ce pt  #"@xd'$xd'%%%  %h%l`+(C e  #b&a xd'$xd'%%%  6B700$'!0Ɍ0 $8%8'Ǭ!$*0"!8%@-$'%8D'!$7W!$B$d$h%t$+0!0Ɛ>B?08D'!80 $0$0xd'$xd'%%{  += % 'L; D'@ !8<@ x !$D<d$*(% $<!$  0$C$(% <8%8<  PTX4'PTX4'#8#?$8'#Pa!8$%%(% %( %0*89 ,@ D % H!+(bF$ +8=80!8D!!+Pa<`,_  ,,+@!0$ ,+`!#e<e_  &%fP$TX4'%{  %  %%{   += % ',04 8$  $<@D('+= % '($%% $%0!8C%@ <`u)%!@ 'P$PE% !0Fc$%(*8a0c,`<!$  ($% 0C$4+(%$`+)$*0+@%@'\'!$ !$@'$$` $<!$g  ,%+$g$8!8'<'8@$+%840`,!<$+%840``$+@ $<!$g ,l"$!CG%0`<B$  `lh0%0'B$$*8G+@g#H+H H!H)#P*#8?$8!8<(_  '(tx|d'%%  %  += % 'd# "8@p @#$<4(*(E$Cp<4%`%0%8`"!tx\'tx\'!%!$ %@#H*H% @DHL@' `"#@@'& @'@@'LH!8D+H (<4 H'HTP!(L+8e,@< H'HTP!(L+8e,@<   @''+  '+= % ','D'!$ !$At,p$0HL\ XHL#h0@ ($$T4$ ('$'B  (!8 #'H$Lhd<@ x|P'H'4$8T,'p s?  `x|P'@Dx|P'+= % ','D'!$ !$Ap,t0HL\ XHL#h/@ ($$T4$ ('$'B  (!8 #'H$L\hd<@ |P'H'4$8T,'x ?  h@\@%|P'|P'+= % 'DHD',,$4< 8@B (( $+A @"8@ < < "8@ < <"8@ < <  <!$%%DHDHLP0'+= % '$n",@<c$!bC`A(, '  <]-c$$ Ab (, '+= % '   @''+  '+= % '$$ ,04 $' 'B $8<@(''+" % \\',''!$ !$Ap$ ,''> ($, %%( ,'+  %('''+" % ``',''!$ !$Ap$ ,''> ($'. /!%0123''+" % ``',''!$ !$Ap$ ,''> ($'.*/!(ŬDŬ$4'%0%C'!$7W!$B$''+" % TT'<''!$ !$A  <'$, (,084 '> ?!'@ABC''+" % TT'<''!$ !$A  <'$, (,084 '>:?!8T%D'%@%S'!$7W!$B$!'+= % 'X %%  !\ !  <@D HLPT $`()- ,04dhl8'dhl8'+= % '@"4+b @<!$% 48B<̄4@@ $@ qPP   pH*q#h# D#0+@0,(L $`T8'H'!$ !$a <ij <ȳPX \Z 04'% 8','!$7W!$B$`'8'H'!$7W!$B$`'8'!$7W!$B$txL'`'8'H'!$7W!$B$a`'8'!$7W!$B$atxL''+" % pp'''!$ !$A% %(%0$$%H $%X%`%h%p$%%%%L% %(%0%@%P%X%p%%%%%8%%pxt\:tlx;U # b +8dw+8oL`tY #"$ax!d#Ax  P'0$*H # $*P'@ $*XG`8x`() U!8% T!8! C!8 $#ç2 <ij!  $ $ $tx:;%lp%8\wvi (  +b #C$A#(bx! P$  $ $ $tx:;l%%%%8\% I <授Px$  $ $ $tx:;lp%%8\,(%Z8!$#ç2! <ij  $ $ $tx:;%lp%8\! $*`g&8 &8C(  <  $ $ $tx:;lp%%8\:!8  <  $ $ $tx:;lp%%8\$#070$$!0 <%&8&8((  <  $ $ $tx:;lp%%8\$#070$!0 <% <k%&8!&8F (  <  $ $ $tx:;lp%%8\m:!8 :!8  <  $ $ $tx:;lp%%8\M$#07 0$$$!0P&8!8& (  <  $ $ $tx:;lp%%8\"$#070$$$!0%(  <  $ $ $tx:;lp%%8\$#ho 1$$!0 <%Ttd$$ BY @%% !d$$ BY @%T$$ BY %% %$*0$<$\<$*H $p @ <ij  5 $'$'4'!$7W!$B$a(<$7@$@@%"@%b<6!W+b !$!A,0p n< 6!w+C!$!A K@$'#+##" u  4(0B1B)+@!@d $(p#e<(\4(!(P!@ ` $CqPp# !+ ! BB!e+(e! #(#E 048&$,'((&H+@h*8)-9$@ %84'&@*8-0)+Hi$@(%8!$+ an< 6!(w+!"!$!$!a  0!"+An< 6!(W+4!$!#!$!A%%(m<46!Pm<46+W<6!7!AT8'+= % 'L <@B$&A@ @<$W`<@@ %b@ B$'%d<6! w+!CDHn< 6!n< 6+(wF$!( %!p0q%ѡ%X%0+(+p ,$p%(-$<4pp $q#p+!2Or# $ E,!(Gm $ ( B)Xp#XK+pBy!pxq#x/h!h!p+(!(q!X @BA!@ X#XK+PK+h !(`p!`#H,#H*%P+ @$+H !H&R%  !$ $, !'-$C%,'%{  !`0o%%X%+0 +P ,-$0%0-F$ @84@!0D!@g+H!@  &H*Ph+X)-$Hi%H* *H+(,$(%(#&(*+ ,$ %`,@ @(%d@  c$/% <6!(+ !d48,?<6$w,048H','<'!$7W!$B$aH','!$7W!$B$a('+= % 'Xl$(d<$(/`\tp#(D#0#+8E#0&8#*@a+H,$8'%8<4$*8+@,$@ %8 &8#*#+D,$C%A <%(|P'T<$0w@@0?%@8 c$7%0<6!8+0!\`h<$@@ @@O% $@H' $G%@ <6!H+@(! pt#@#d+ #d;<ʄ4dp !?<6$ ?<6$(# (!08+('!!e4'h'x'!$7W!$B$  <' '0'!$7W!$B$a'<'L'!$7W!$B$a'T'd'!$7W!$B$av ,*`'T'd'!$7W!$B$a'h'x'!$7W!$B$au ,`|<P'$|h%0hB%0hD%0hF i jR %HI jT %HI jV k lb %Xl\ \ %(%0%8I<$@hq$$$+ D b!@H0D7<@4<8<@B$ D8<40"$!$ !$ADGCE F$& *<$w @@'%$@  !$%d<6!w<6+ w!C AA?<6$7A@< A[  !@<$w @@'%$@  !$%d<6!(w<6+!0a <ȳn< 6!n< 6+7$!A  0&"3  <ȳ 8+("& @C$#(/0!(,0#"!$#B$$C!D48$< ',048< '$%  %  %*A;`!c$*0F$   ($$g$$+8c$ $+`C( `,048< ',0#A$b!4#"8$< '"( @,048< ',048$< '+= % 'd, `d+8 $$#(/0!e%(%0 -8%$#070!f%(, $ $%(%%%e$X%% hlpt\'%%* %C! a$*@($H<  H<X$$$ $+HI  $PIp! $ $*XD`%(%%%' A $%(%%%+ I# %'$ #(!d $$ A$ $%(%%%$ $%(%$, $ ph:9$#@G1!h8; $%(%%@%r0 T,%%@# hlp$t\'hlpt\'% *P"E@!P#J*X`+$D8  D T0,$8 $L% $+`@ q!@H%; $*`H%(%%@%& ; $%(%%@%+PA@#($#PW $P*!j; $$; $%(%%@%; $%(%$, < $@hq! h:9$#@G1!h8 (LP%%@3%%%%(# hlp$t\'hlpt\'`!#hlp$t\'hlpt\'% *X"E`!X#k*`,$@4  @PL($4 $; $m% $+h @ q!@h%*XH`%%%%( %%%%(+8A#8$#HO $H)!(i%%$%%%%(%%$%(   %  '+" % xx'''!$ !$a8'H'!$ !$7 J8"$#070!(&8,%0%8%%%(%0fM8"$#070!(&8  $ $%@%(%8%4(%0%8%%0'!$ !$a'% *8AB!8$*H I$dL  d'H'L$$ $+Pj@ $0p!0$m$*X`%@%0%%(!@%@%0%%(+8"#8A?$8G#@"!($ %@%0%%(%@$%( $8<'!$ !$a'/8 $H'8'!$7W!$B$'8'!$7W!$B$$'%#B0!֐   H'8'H'!$7W!$B$a'8'!$7W!$B$a$'''!$ !$A'%%%  %0 *@F!@ $*P(@$pX  ('H'pX $ % $+X` $8p!8$ $*X`%@%(%8%( $%@%(%8%+@F6#@&%#PW $0!( $$  $ $%@%(%8% $ $%@%($ .J9@`%#PW J1!( 9@%@%(%P%g$|4%%P'!$ !$a'% *X"D`!X%k*`+,$lT  l$'H'| $`4 $Tm% $+hPFq!PjJ% $*hj%@%(%P%" @%@%(%P%+XA`#@%#X_ $X+!($ @%@%(%P%%@%($ .k9`%#X_ k1!( 9 ` x0%%X-%%%(%0'!$ !$a'  $8<@D%@%('!$ !$a'% *`"G!`%*h,-$hP  h 'H'x $`0 $P% $+pXfq!Xk% $*p%%%(%0 a%%%(%0+0A#@%#HO $H)!0%% $a%%%(%0%% $%0   %  8<%@%("'!$ !$a'%0 *@E!@ $*P(@$t\  ,'H't\ $ % $+X` $8p!8$m$*X`%%%(%0%%%(%0+@F#@&%#@G$@!0%$%%%(%0%%$%0%  d "8[@!8U  "$<4D!" B$#C $Cp#"$*a`$%(7Q<4@CA#0d$@q#($qH$O @DHPL$*x, 9$o%!x 9%X%h %a% -d P$>LH@%X%h$D%X%h%X%hp%@%*H -*) @ $%P%Xk%#` g 1!`L)% $%X  $J)I@jlb %PLld %PLk^ %Pj_ '\ K  \DpL> $ $hq!h+P@!PJ%X *Xd'`*P@!X k+X @*p !x+x  < <Ļ ' < <Ļ ' < <Ļ '@%($ <;!$g  $ Cp$! $ < \`%8ǬB$F(( %%8 )%#P W J1!P$$f( < <Ļ '  += % '0$*A*@"$,!bD.8$Dz8 Di8BpB8@4 8  $<@DHL(', 84 %0G,G$#@G1!@(%8B%8H,H$#HO )1!H)%@()J %@  I, I$#P W J1!P)) %HIJR %H**J,@J$#X _ *k1!XJ)@%P jlb %PLld %Pk^ %Pj.$+`K.l-yK$#X _ .k1!@!@(. %!X+`Ik#@H%#`g $H,! &`'Tt`<84\h K  `h=<>   7< `( i 7< `,  $ -!8: -!86  T!82  :!8. :!8* %$#8?0m$! ).8%1 $+p PLHD@<$L% % %|'x\ <ij  5 `'$'4'!$7W!$B$a\"8@xxdZ8"8@b$%% -''!$ !$A|''`'p'!$7W!$B$a'`'!$7W!$B$a$|' $8p%@!8$$!$%( %(BF$0 $+0% % $+D@% %$b$%(%0 $Hp%P!H*&%$$( %8BH$1 $+@(%0%;$+F@%0% b-E8+B8@b:B8@<$$p!Ap#8`'#+##" u d<$7@`@@%"@%b<6!W+b !$!"hln< 6!wn< 6+W!$!"  8&")  !8#$1 $+@(6 <5+H 0 $*0E %,X $ $+0%OI$!$#B0! g `  $#(%4<!$8$<@D '48<@D ' < <48<@D '$p$48<@D '$%  %%  %  %%{  += % '  d-8+8 $$#070,!% %(% %(׀%%%0!$%*8$>!8#$1 $+@(6<5+H , @/8$H/, @/8$p/d!$.$$p!$pd x|+ b-lp+(d%Tt$' -d T Ab  x|p!$+b t'  %   {  %  !$*8"!8%@/ 9} d; L#p`*X*`+X*E`\!X+k&@ '%pP`<6$7c,c07` ' @$ $,g$,$H($A!0%!4  #H$#k+ #d%%+ c$!0d@/  4 8 <6$7!8!,!0H<'<!$@Xd$\+8% $++* $*@+@`%h''!$ !$ah' $$ $ $ `8!a0+ AH<!$$ .  8%%`dhD'  += % '0 %%<<<@48 %  ($ 0<c$$ .  (<$@DH,'048  <@DH,'<@DH,'+= % '<!$<`!$j += % '80<`o!$0'$    LPTX\'< @'w @'+= % ' "'C'" ! '+= % '   $' !  $'+= % 'TX&bB,%aB0@%@!$"(@$$ <8!$  (BW(!$  (<c$$ .  ,048$'(!(",!   @"e&9@!b K / !C B K " "c! K  "d& D% c!  % '+= % ' / ,",d& D(0$0e& #4$4e& 85$5e& 86$6e& 87$7e& 8 (c(! K % '!B&A!, "d&@b$&D@b$&D @ b $&@b!&"!,  += % '"d&D6@ " e&1@b%&E,@!b K " !C B K  "d& D% c!  % '+= % '<$!$ 0< @<$B$D' 0D"<I!$ 4< @<IB$H' 4H"<W  8<@D$''B"" ">+= % ' "<'C'"$'@'P'!$7W!$B$a<'$'4'!$7W!$B$a   TX8'+= % ' "<'C'"<c$'@'P'!$7W!$B$'$'4'!$7W!$B$a   TX8'+= % ' "<'C'"$'@'P'!$7W!$B$a<'$'4'!$7W!$B$aR   TX8'+= % ' "<'C'"<c$'@'P'!$7W!$B$'$'4'!$7W!$B$aR   TX8'+= % ' "<'C'"$'@'P'!$7W!$B$a<'$'4'!$7W!$B$a   TX8'+= % ' "<'C'"<c$'@'P'!$7W!$B$'$'4'!$7W!$B$a   TX8'+= % ' "'C'"   $(,''B"+= % ' "'C'"   ''B" += % ' "'C'" %%<<@%% <`!$ <@[  ""%% %<!$ $'+= % ' "'C'"! %%<<@%% <`!$ <@[  ""%% %<!$ $('+= % ' "$'C'"$(, 0 48< ''B"" ""+= % ' "$'C'"$,~K  (% #+# $,  048 '@H z (+= % ' "('C'"(! $0~K  ,% #+#  0  48<$'@H z ,+= % ' "$'C'"$(,  048< ''B"" "+= % ' "'C'" <!$<`!$j  += % ' "'C'" <<!  '+= % ' "'C'"! <<!  '!(",! !!(",! += % ' "$'C'"$(, 0 48< ''B"" ""+= % ' "$'C'"$( ,048< ''B"+= % ' "$'C'"$(, | 048< ''B"" "|+= % ' "$'C'"$( ,048< ''B"+= % ' "$'C'"$( ,048< ''B"+= % ' "('C'"(,0 4>  8<@D$''B"" ">+= % ' "<'C'"$'@'P'!$7W!$B$a<'$'4'!$7W!$B$a   TX8'+= % ' "<'C'"<c$'@'P'!$7W!$B$'$'4'!$7W!$B$a   TX8'+= % ' "<'C'"$'@'P'!$7W!$B$a<'$'4'!$7W!$B$aR   TX8'+= % ' "<'C'"<c$'@'P'!$7W!$B$'$'4'!$7W!$B$aR   TX8'+= % ' "<'C'"$'@'P'!$7W!$B$a<'$'4'!$7W!$B$a   TX8'+= % ' "<'C'"<c$'@'P'!$7W!$B$'$'4'!$7W!$B$a   TX8'+= % ' "'C'"   $(,''B"+= % ' "'C'"   ''B" += % ' "'C'" %%<<@%% <`!$ <@[  ""%% %<!$ $'+= % ' "'C'"! %%<<@%% <`!$ <@[  ""%% %<!$ $('+= % ' "$'C'"$(, 0 48< ''B"" ""+= % ' "$'C'"$,~K  (% #+# $,  048 '@H z (+= % ' "('C'"(! $0~K  ,% #+#  0  48<$'@H z ,+= % ' "$'C'"$( , 048 '"d&@b!&A!,  += % '"d&D+@b$&&@b$!$DI   " d&@$b$$&(d(%& %@,!,b&A!,%''+= % ' DLR^%0%8(%@j+Hb (0@<8 $B$"48<|B$<@ 'A` ( !8# < !$ $"<@([  ("","0 "<B$48<@ ' $"x$$$ |$$'| $$ | $+PBp@ $+($+(jE$+ B8 @%A8  pTJ l hpTJ  hlpl%18 8s hd`TJ \ X`TJ  dhX\hd N +lpd hN +$A$' A8  TJ  #1 d8d8 plTJ  pl N $'D8!1!8 * * *&A!8$'D$$+ P$+" `B8@C8` B8@$1+$ 8 '8 '8 ' 8 '8 &A&d%A!,$'D,  $+"`C8`%B8@%% C8`%  B8@%$1+$ 8 % "8 %  8# %  8 %  8  8 % &A&d%A!,$' $+PBN@ $+PB8@D8B8@ V D%!1!8  ,  ,& % K $'B8@"1|+( E$+ D8 `+ D8+ 8D8R`% $1% +(8+(8& B8@<  < &D{@    &"a  dnj<enj:fnjgc'% % <)5Pp&( G$!$"(@<  $g  &!# " $t! <@(C_  !#(A ltpD $    > 8R p$~K E p%  #+e8`lW< `< !$< !$ lp< !$<@c$!$7W!$B$a8%%%8%@c$$%@ \ij |!&' I\ |"$#$`D$%('%0%!$7W!$B$$*@:8/ 8 " $0p!0 )1)5ɬ< Ɍʌg  ()! *Ȭ%  $ $%X<!$ <,' b$8 04 V  *A 048   >  <,'$<,'$A$$(@  <,'$<,''+" % pp'"0B8@%   4|08  %(% %0|46`4g00&H( plx8i0h %P $+'/ $+' 8  V <%C8k 38 A&#`% B K '8 8 8H  $+' 8 $$+aH $+' `8`BB8`B 8`BDC%+( 9 ''9 ' 9 '&"&%A!,',  $+'`8`B% 8`B% B%  8`B%  8`CD%B% +( 9 %9 %% 9 %  9 %&A&%A!,'A&"!8'$+' $+'-  8 AB ATJ  l 9` d`TJ  d` N '8 ACD BABdTJ ` \dTJ  l`\d`9 \XTTJ P LTTJ  \XLP\X N +`d\ XN +$A'8  > Hx8 > H&"!,'   0%mh  ' += % ' " 'C'"  "#! $( $(' += % ' "'C'" !+ ' += % ' "'C'" "#!  ' += % ' "'C'" !!0 ' += % ' "'C'" "C0$c8`!  ' += % ' "'C'" "#! V ' += % ' "'C'" "#!  ' += % ' "'C'"M "B0C$$+1`!!@$#A $#A  #0%8E H, 8 ), % 0 $%P 0F 0 I%X% ,- X % H8$$D %FB! + # $ %&a&E%"+$' @ > @+A`$+" $%''C8[`"0dtc0B8@"!   0t,p K 'p, K !8'B8 @ %$ $t0p ,K !$ $%'C8`%QB8,@ > @ > @+A`$+" $%'$'4!x  <c$$ Ab  <B$j <b$< V <*A0   |d < |d ^  ''8b$8  8*A0  F |d 8F |d ^  ''d $ $8Gq!Xl%%h'%p% !$7W!$B$+`#'$!d<玃`Te$$p!8d$%H'%P%!$7W!$B$+@'c$!dh<`dX!`) $Xq!X n%4'%x% !$7W!$B$+p(`q! 0<(,!$$   <\A@Cp!($+0e<TG_  T('H <6&(&<$& $bŒ(TJ $ (TJ  X$ @$d& eO( lT'+= % 'wA$+("o(!0ƌA$ 8p $#8 $#80 , 0+H"\ iP! D $#Xg d l- c% &0I !! !CBb  %"%%&(E +()9!CBb  %$$%(%0%8%@%H PXpPBq!Xk!PF8% %@%H %%( %0% +P" @#P!X+PK@   $(,' % {  {  {  += % '@"# !<  P y (,$@ < _  #!<!X&"D"# !8  L y (,$D < _  #!8"X&C"# ! H y (,$8 < _  #!X!83&A<"# ! T y (,$< < _  #!3&"8@ M7 <D M7 4'+= % '0 $ 4 9 8 (,0 ,8 (0 7 ,($<4@ DHL'('+" % 'HLPTH'h&"L`CD%(%0%8)8<@!$$  h$%0$H'<@!$$H  h%(%0HH'*@% &@\p   H'h\pPTLCHH8<@D8'l&(dR%8%@%H-8<@!$$  h8'l$%@ $H'<@!$$D  h8'l%8%@DH'*P@%0&P@Xl   H'h8'lXl@D<88`d$d+85%@%H(,04('$ 7  $'%H LPT<@D EL !H'8'8'H''&$*@[= 8  7'  $= 5 '  7$= 5 '5M> $(,0)*0 '5M> $,0$%%ƌ5f%@ $ $ $%`{hE4dl&Hk &Hi  )  *`*,%h 2|I9 <@!$  h4d$l| $ $<@!$A%@  h4d$l|%P @*p%h &phT   h4d$lhT* )< )_  ,),(% 8 4 dCc8Cd 7 d o9 4$`d &#\@ "fh*HF )%P,x8@<@!$  `4$x$$<@!$$<  `4$x%0 <*XF`%P&X(`dP   `d4P$& "<@"_  )")b""B8"\&$S@ "*0C&%8&tb8@<@!$  \t$$<@!$a$8  \t%8*@%8&@`L   \`L# "<@"_  &"&"pX'%0(F%%{  hp qh-q!pN!hk9%0%P%` %@%H 6ab c  y (,$ < _  #!6!8&A"# !  y (,$ < _  #!6&A M7 $%%{  '+" % pp'"`@\`dh\'&AL`#$%(%0%8)8H8<@!$$  \'H8$%0$<@!$$  \'H8%(%0 *@% &@f0(@   \'(@0dh`!\d \!8%\%# `lptxl' 9 |LPTX|'L' ; <\|'R: j LY L'&"\  ATP*(#E%0%4Da8 <@!$$  D4$$<@!$a$  D4%*8%0&8,$<   ,$<C A< A_  %!ELA L' M7 ''+= % '<"Q@8CD B < < <() !  $KK (,0 @P $( < < <  $MJ ,0(8 < _  #!$D4'8CD B%& ! @P $( 8 < _  #!D4'+= % 'L"Pd& D8t@ < < <% &!  $KK (<,408 < < $+@9O)-$@ %''!$ !$$+@0'S<@!$  $S$%&0a    $$%%$$%(%@Ȍ $#H(% $@q %Hiq@P K)`p $ '$N (h$ '$ $(,04nj HDL*($Gh*0%'8`<@!$$  $%0$<@!$$`  % %0`*8$%&8   %%% %(%0hh$+88G-$8%8''!$ !$$+HP '<@!$  h9`$"p#p%8''!$ !$  $(,048L <@D  $(,0p48L <@D$/| $Ap'!"dec!$!""&!  $(,0p48L <@D|!$#(`*(%!a8 <@!$$  $%$<@!$a$\  %\%*0%(T\&8F    T\h*0%0'%8<@!$$  T\$$%8<@B$!$X  T\%X%8 %xp%p )% +x(:x !xO%  $(,048L <@dDh EL !hdDdh  $KK (,d0h EL !dh  d$h(,04nj DHL%@D$(!(%+ b'  dhG $@ q'!@     $(,048L <@Dt0$lypxdh *@ tl&.   $(,048L <@dDh  $(,0p48L <@Ddh  $(,0p48L <@dDh  $(,0p48L <@DpldhS% %{  %%{  %   %%{  %  += % '0D$''! $ (*(d+(d 8 <@!$$  0$$<@!$$  0,4%8%@X!Xai%% I( +H[ #H)%#H O J$$HI!H+,b %X,d %X)N %H++X`@@%0%@!% $0!0ƌ+(d8<@'%  !PJP , P %@ $% @I$+P'@$+0(!(%%{  % %{  %%{  %  %  += % '`"$@\!cB(%e(%)%e*%e,%e@ cp $#!C\%t+b.@X@dF$0P!0$@!@&0 Q $(d Q $(%d%l$0h!0ƌB@%0@%0A%0B%0D%0@) 0p $#0!(h%(H@<t+(4Xp$H P!HI %X !Xg&Hi  Q $(p Q $(% %(%8H@<pD84 EL !PTX D84H@ <$KK (,0t#PTX H@<D8 4$KK (,0x|L'E$(!(%@)+(B$+(b $<@!$g  t%(0!0&nj'8Ǭ$*0 Q $( < < <  $MJ (,0x|L'+= % ' @#$<$+`@#8 `#8` #8`#8` !  t@ $.$%8%@p%(08 $.$%8%@f !  ` $$%(I% X$+( B8 O8X8b8b$$o8o$$x8x$$ %( $0$$088d !  8d%8$%@0$%H%% %0.$%8%@8 %H $"8 %H $8 %H $  $&%H $0&qJ%`X+`f%X%0 %H <8L`|%%%%$#hH@DdXT412 a  `8L<214T@dhXHDl\HdXh@DT41@50.: _8!,%%x%.$%%%%_:  08+%$$_$%%%5$2 $+2$$5$2$+5$2$$5$2+ $$*!$!06$2$$?$+&Qp#&!A&CF@3& B&+`P $<@!$g  P`T8L<31D$$C$!a  y $(,`T8L<31D$$%%%$0$6a \l4`T8L<hd1@XHD  -SM$<)%!@+xH!xm#X@l l- @ $#X!X#g@ @% $8>, I$ <)J%!8G+X!`% %(%%%%% {  %>$  !xm@ @#Xd% +`d$`>-M$<)%!`+x %% {  %>$  %% {  % >$  <!$l- % <)%!X+h%%{  % >$   %% %`d k ,$(xd%H %0!p0%͡%% $ (0!0Ȍ!(ŬD$L!(A$+0'(!(H&@& |&H x-|+H( xT!P*L#/p t'%{  %%{  %{    %%  %%  %  {  %  %H X+`+&X+ `X+X+`!XI$+Hi 4\%(%0@H%`L%{  {  %%{  {  w t'+= % ' "'C'"Ž#+ b" '  '+" % 00';% $0!0&ƌ+(d%0$@!@+@H<*/@#(@xthB!$C!$`$ $: = < !$ $"<B$"$"<@,($  k  ,"(#$$ %&"#$ %& <<W<`C_  !#A0'<!$<(!$j <!$<(!$j <!$<(!$j <!$<(!$j <!$<(!$j += % '<@!$ `<<,d[  $<τ$,d< $+"(`<<0d[  $<τ$0d< $+"`<<@4"[  "`<<d[  $<Ʉ$d<$+"(`<<8d[  $<Ʉ$8d<$+"`<<@<"[  "%0+8O!8 %@9 A0%@($0  $`%(!&$0$+0&$0+0&$0 $+0&$0$+0&$0$+0 &8:&8=&8?&8*&8&!8 (,`0K%k1 $+X8`(K%k1 $+X2`K$+`k0,t*)*` @4'P'!$ !$4'$$ <!$g  $0,t $*) 8 %% 8$''!$ !$A  $(0'' '!$7W!$B$aT'''!$7W!$B$a<@B$T'$ <@$0 8 8  " 0 <$0 ''!$ !$A  $(0'' '!$7W!$B$a4'''!$7W!$B$a<@B$4'$ <@$0h $*' 8) 8 % HP      HPLdP<"0 !0 B4  <!$H'0 8<0@'H,!  Pd H3 0,@t $(    t8<@'C88`PB8@!$'$' $J  X<c$8<@'H "%L(P8HD@<I8 )u)9 )t)9 )f)9 )8)9  $l$I( %H%$"f,('@-$0%0%0!@$*8#8$8 $#@HP$Ba+` #` , P g- $ X8a$8 - H%@*%8+@ '%%{  += % '\ "@%#`$$oaHLPTH'&AL`#$%(%0%8) 88<@!$$  H'8 $%0$\<@!$$  H'8 %(%0\*@% &@4   \H'4PTL!HP H!8%H<` 7 H';  % @%"@$$\@;  D`$0@,$<<`!$ < < A< [  #DC<$,  %!$+0*8,$0%0$!(B$* A ! d7%8$%8  'A@N% (1$*@+H,$H*%@ %{  %%{  '+" % xx'  d($ p$+(Ae! /%0$%0%8%@I@V% I)%+H*P,$Hi%HI % %(D0%%H%P%!p͡$%H O $`fq $#hpx%B +# - p - x %` .$ h$h-%`1$%h,%+p 8+) $*x@ %8h''!$ !$!%h' $ $ % $,g('@`-$0%0%0!@$*8#8$8 $#@HP$Ba+` #` m-$ XXa$Xl , P - H%8*%8g+@ '%%{   += % ' "'C'"' "!$*6%c$ $+(*0',$(%(".%c$ D,%('0 ,$ %  ' += % ' "'C'"D  #'B'! d$$ #d$#($$(!e%#$/@! (c$#c0B$!* "%% %%& e    &" '<!$<@!$j %%{   += % ' "'C'" !!$ ' += % ' " 'C'"  "#! $(,ǿ ' += % ' "'C'" "#! h ' "d&DB84@b$&B8.@b$&B8(@b$&B8"@b$&D@b$&D@ b $&@b$&@b$&B8@b!&"!8  "d&D@b$&D @b$&D@ b !&A!8  += % ' $%$ $d((!0!(Ȍ&@   8('+= % ' $%$ $d((!0!(Ȍ&@ ʐ  8('+= % ' $%$ $d((!0!(Ȍ&@ ʐ  8('+= % '%$+0*8H,$0%0%%$4c$`$0ep $#8@H$BY+X #X , H G- $ P8B$8 , @%0 %00`$%8'}( $<< 6&W9@ l # <`$'%p Cc$`B !DBB %D %!%"%D$%D@ Bp $#!b%#c$`! !$!B %$ %!%"%$$%$@ !p $#!a%&" ' <@D H=, (' `$+A3` #($#A# /$%!aLPTX\0' < >B$"x|<|B$T'\`X dhl2+ ( $,x|T'+= % 'LCc('`0C`PTH','D'!$ !$a,3 $('% ,' '!$7W!$B$PTH' (04!#,`$<@LH%@%P%XPDTX\`8'$<@LH%H%P%XPDT*`#+PI'@4# '#I#8'$ $!   E> (04!#,`X\`8'X\`8'%  %  %  %%  %  += % '@"@d&@DbD$&DB8@@$ K  @!$@!$$ K % '+= % '"d& DB!c  8 "d&D1@ " d& D,!c  " "d&@"d&D@"d&D@"d& @!$a$$ K % '+= % ' "$'C'"$ "! $  #`#hho $X!Xf&(%HD  ,D"H! 

-9\-95%+hg)*h@ ''!$ !$'$$ $<@!$g  $| $# $q$@!@(\ $  t%+hh $<@!$g  q$|<$ $# $ %h !h-\ $%8R  !H)(B$$$HNO )1 %+/&  $g \< _  "%T\,P$ <J%(4 $$%x%0%H !H +<`+_  ,+,,(%$+/&  $g \,< $_  "%$T\,P$ <J%(4 $$%x%0(%H !H +<`+_  ,+, $*x)9? 84%0+/&  $g \8< 0_  "%0T\,P$ <J%(4 $ $%x%04%H !H +<`+_  ,+,$D@%<+/&  $g \D< <_  "%<T\,P$ <J%(4 $ $%x%0@%H !H +<`+_  ,+,$] /9?% +/&  $g \<  _  "% T\,P$ <J%(4 $ $%x%0%H !H +<`+_  ,+,$ /9? %+/&  $g \ < _  "%T\,P$ <J%(4 $ $%x%0%H !H +<`+_  ,+,$)9? PL%H+/&  $g \P< H_  "%HT\,P$ <J%(4 $ $%x%0L%H !H +<`+_  ,+,$$ $$ $$+= % ' L'c$$%g$,'%@%!$7W!$B$0&H ,%{<B$  H%aD$($H%*(d/(D$0p!0&GHɬʬ<`ˌ_  ,+@̬ <B$@ b<d_  !$B$+(b $'B$t$x''!$ !$A< B$l'$ %04+%(48<<P'!$ !$aX\`P','!$7W!$B$$d@'<&A++= % ''0'@'!$7W!$B$a(<&(% <&  $$'% D'T'!$7W!$B$(<&8% <&0 $$*0* $40HD&H+P+X)-$PI%Pj@+0$0+ % {<8PL&H+P+X)-$PI%Pji@+0+ $0% ]'0'!$7W!$B$a<(& =<& 8'0'!$7W!$B$a<(&`% %'D'!$7W!$B$<(&(%%Œ K   X,'$X,'$X,'$X,'$X,'$X,'$X,'$X,'$X,'+= % 'L'\'!$ !$a'0'@'!$7W!$B$a<(& <& L'0'!$7W!$B$aL'0'!$7W!$B$a,'H <@L'0'!$7W!$B$aL'0'!$7W!$B$a,'n c8''''+" % tt'''!$ !$al <&(`<& D $* `#$B  <Ѩc$$ >080 $#@(A $#PHJ1 1%1 - M- n-'P'TP'!8@ @ PO P 8g 8%8%80,%(%0 $%8)+= % 'l<& d%<@!$Q<&dB`D'\'l'!$7W!$B$a0'\'!$7W!$B$a<@&`<& DH%A P!8!,!0 DLR^%0%8(%@j+P%@4<PLH $DTZf%0%8H%@+P%@08PLH $!$$ <2!$$ $b (,t'  <'+" % 'P'd'!$ !$Le$H$ +8!8/8$V+8evh '0'!$ !$Ad $ '%  ''!$7W!$B$' '0'!$7W!$B$ `' '!$7W!$B$<&( <&(<&(h$L+0A/#(Ep$l#8?$8'H!8 $*H&m 1*-@9 $+HIe  $(p$O !($C $+(8O)-$(''!$ !$ $+(' p 7T " Ǡà!$C+00 $Ǡà!$C+0. $Ǡà!$C+0, $Ǡà!$C+0* $Ǡà!$ B+`( $ǠŠB$+0"6 $GE+(&< $<:$+("82 $dhlptxH'@,DǠŠc$+(C0 $  $"<`#[  #  $"<`#[  #  $"<`#[  #  $"<@"[  "<ԇB$"$& $"<`8 <$c  $8$#  $"<`#[  # $"<@"[  "<_B$"$ < v!$4 ' > $"<@"[  " $"<@"[  "<B$"$< v!$4' > $"<@"[  "<]B$"$< v!$4' >  $"<@4 <#c  #4#" $"<`#[  # $"<@"[  " $"<@"[  "  $"<@"[  "  $"<@0 <#c  #0#"  w \'+= % ' "'C'"! ! '+= % 'M M n `$lT'@'X'h'!$7W!$B$a!$$ K  <<>!$$ K  $TX@'<@!$!$$ K d <P@C$+ CL!#B$"<@ , k  "# $, %&$"" #$0"%&$*a7 A B@D$! .8  !$$ K  Dc$#c0p!@$?$)A$R"@ B$"<"<@L[  L" "HD@%(B$"<"<@L[  L" "HD@%(B$"8"<@D[  D" "@<% B$"8"<@[  " " B$"<B$"<@[  " "  !H'$(+@1 -d (P< !$ $"| 1 |-`@(7, $+88$0% ''!$ !$ $+8'  @DH(' ,c04 8I  $@DH(' < <@DH(' < <@DH('+= % 'Td"h!X\ $ $@D8 di8kdp8eD8bdi8 ep8e48 Tdp8Pd68LT\ X!<$HLH'X\ <$B$`d $$(<!$,$04oK < 8D p!8: 6!86 < !$ `d\"#<@[  $$8 "lh"<@[  ##$?|''!$ !$|$$%!$"(v@\ $$$ w @\$P  P <(&  <,   <̄$<@c$P <0&  <4    < <P0 4D_ <̄$p "m@\<$&@FB%%0Xc$$ Ab ,dc <!$$jb $,d c <+!$$jb $04('<!$0$4(' ! "@$!!+= % '<!$<`!$j += % '80< !$0'$ <`B$< @L ($,DHLP4'+= % '<!$<`!$j += % '80< !$0'$ <@<@B$ L ($,DHLP4'+= % '<7!$ $"<7!$  $"@!8; $ 44 $ '$?C  %% (,`84 <<<c$<@c$ HLF ,  $( 84HLMB <(B$&" @$PTX<'0PTX<'@ P<7!$ $"<7!$ $"<?B$"4C8d4c $<[  ##C<d@c$<[  ##BDCHB#<`,_  ",#"( %$#$<,ʄ$% @DHL0'@D<!$H`84 <<<c$<@c$ HLF ,  $( 84HLMB ?''!$ !$A<"=\% d,%>Z%c.% 4?%e<㎬'''!$7W!$B$at''!$ !$a'% ''!$7W!$B$''!$7W!$B$a''+" %  '"0C``(BD8x B8G@abd efc aL TP%'% 'L'!$7W!$B$X'''!$7W!$B$`'! X'  'abc 1 < !$ $"<`B$" "<@[  ""@!Bc * !8,( +(!b$< e'g  "'$ %"dDH '%{  %{  %{  %{  %{  %{  %{  %{  %{  %{  {  += % ',4+"`(!d<+0(!(g< ig  &)' (f%$8$ $$^+8c8!8+@[@!@ <` g  ),* +$*8%+8G@b!c * !8,( $*8%+@$@b!c * ,( D '%{  %{  %{  %{  %{  {  += % '<d$@%!$&(47&0a#02(X4+0$80!8+H H!H *#`< -g  *.+ -+)#0($DEH('$*0%4+00$0!0+H DŒ!c * !8<@%@H('$H('f$4<@0D*8+8.!H$B$!h c ! d$<gg  $(& '4<@0DS%{  f4<@0tD!$B$! c ! d$<hg  $'& (4<@0G%{  %{  %{  %{  += % ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h$T P!!(8TX \H4D,' h$T P!!(4TX \@0<,' h$T (84P!TX \,' h$T (,  !8 l$pL'lpL'l$pL'+= % ' w(4+"y`$!d0+0o@b!dc !<d$d40<04(8+0N0$!0+@DD@Ì!GB !<d$d8<(+ "& $! +8@!ec !<Cc$CD'%{  {  %%{  %%{  %{  {  += % ',(#de( /(@(!( 0fp $#0$8 ,$ 8 '+L%$*H( $ @c &`L@k T %PM&PKY @n %X&Xla &PLc @l %`&P@d &Xl$Hi *P#@#H#+P@!$H!H&+P"@P!PK,<-Ng  +-, .{  %{  += % 'LH#a,d$0/!($C((8B<@ DP õ (%$H,0PD@<8$*   õ $$$H@PD<8+@" !@H!H+P@@!@ +<, g  *,+ -4'%{  {  += % '@0,D<8 f@0,D<@H*%*XG``+%*`g,!H#!%+`$d`!%!H+`$[Œ#!!% @ !@0,D<@0,D<!+@$4@!C!@+H$+  Œ!!% @ !d <玣hg  $'& ($'$'%{  %{  %{  %{  '+" % ' $%'$%*8׀G$׀G$'$*@p%_$%8 *@ x@@|%H%P4!8G*@ƌ  (  |'Ō !G ( |!@* x*X`,+$% !$7W!$B$a''!$7W!$B$A% % %8*@G%@C+@0$Hq!P,K%'% !$7W!$B$a$+P#t@h#%!,#$'!$7W!$B$aÎ'''!$7W!$B$4'''!$7W!$B$ `d*`p h%@Q+@=$0 $8'q!P,K%%`'%h% !$7W!$B$a+X&`$!<玄 $0 $8Gq!X,l%%h'%p% !$7W!$B$+`#'$!<玃e$0$p!8d,$%H'%P%!$7W!$B$+@'0c$!d<`!`)0 $Xq!X ,n%4'%x% !$7W!$B$+p(`q! 0<(,B$'$5+*9@8-'$-8@8@)- %@ ,)TX\L%@4%@='$ $ `d?0<%!8+H; ! d$$0!0+8/! dƐ'$%h+ $`d+"`t! #x'$%h+ $ -d |'{  %{  %{  {  %{  $*0!0Ɛ 8 +0!0$+$Ǡ+$ -d |'%{  %  += % '41 "!$  4d,(a b$  ,( @4@ [ , (8X'Xd`!(\+8e(D@ # <$048< ' 04<0B$8< '+= % ' "$'C'"$ ! $  <6!$$ Ab (, ' += % 'L$+"`H"#"%D$,%$%D$*%e&%$%$"%d$$%d!%a @@ %b%T`40%(s04%($0!ffc   $e$04( @0+899$!8g+@-B%CB%" @$+"` <.%e,%%C,'{  %%{  %%{  (0!    (e$40(@0$#@+H @ $#0&!@+P@%%{  %%{  {  &"?#0<ل$!c)0<$!(&e+0<$!(& !0<ӥ$!%!&#&aA% &?h0@ <)%!@ QJ1 $%H%X%`'%h%x%12$ -  /.  $#p1x - x%p%p1$##.&p 1.  . p%p . %`%Xr%)% -)$,& &$d0&D&b<6$W<6$ 7*6%(<6$(&(6&(&&d&a<$7<$ WE0&0&8&@K&8#%d&h#3&f&b%d&g&a3<36$73<36$ W<6$(W<6$07&8&@I&8!%d&h!1&f&b%d&g&a<6$7UU %(0:U %8G0%(;T %8G<$8%(; T%8<$8%(1Q_ %PjJ1%8R^ %Pj<$PW%8CM %@ <$@%8!$"(@L'! C/ '!FB!%%0<D%8BN%@(8#$%"&'(!0'<!$<!$j <!$<!$j <!$%0<D%8BN%@(8#$%"&'(!0'<!$<!$j <!$<!$j <!$DLR^%0%8(%@K+HC L0HD, $hijkD*4>lmnoD*4>pqrs D*4>tuvw'h'!$7W!$B$a'h'!$7W!$B$ax'<!$<0!$j %%  %%  % {   %,H$  <!$<!$j += % '"%& '$ % &`$`&`!`L&hnoz%po|%po~%p!`jjT %@H?k^ %XhA Bf %` !`$h&h!h!hDLR^%0%8(%@j+HC PL0H, $$"<)B$"D<|B$HL0'%%  '+" % \\'!$J \"$%8'!$7W!$B$a8' $'''!$7W!$B$a+A` $?'@$@I$0!HI*$PG%@ ($(8, $0'!0Ɛ$0%0&'3A$LC$H@$ V '2'!$ !$AT4'H!$7W!$B$a4'3% %0'!@N$H" $!@L$H" $!@J$H" $!0$(EŠ!$$(L% $0@,8,0!0&Š%(0!0&$0'!8ǠT@$ V 4'TH!$7W!$B$a4'3%!$('!8'H@V$P*%@H$!8T$P*%@H$!8R$P*%@H$!($ $% !$c$d(X''2'!$7W!$B$aX''!$7W!$B$aP'<!$<(!$j '+" % ll'''!$ !$AB$"<@[  "" x! $"ld d % |''!$ !$|x "#c$$+0C $ $"xh d % ''!$ !$ "#c$$+0C $ ,408$"p<H<DH@<'l B ".@!!"0,`$%70!$4+(8+8 $`$$ <@!$g  4(<4%08$@!@( $ $+@f $<@!$g  84(<4 $$@!@($( $%H<4%(]$+@f $<@!$g  84(<4$@!@(%(( $%H<4<LPTX<'LPT$X<''+" % 44'%0$+8G 8 8 %% 8 %% 2 g   -d '`0K%k1 $+X8`(K%k1 $+X2`K$+`k*)*` @0'L'!$ !$0'$$ <!$g  $ $*) %%%b$+@ $  $(0' '' $  <$&WB0 $(   @D,' $  !!8 LPTX\,' '$ F   $(LPTX\,'U 9 h <B$B$"t<|B$x|d'tx|d'$ Ab 4X$ Ab <`$H0'"8@!8 $' $J '<*!$&$ <79!$'$jb $'"dC(E`#! <!$$ \`\'&d`\'\hd!(`+8eXHp !$$ Ab \%%DHLP !D`H <B$LP< |!$S$D' $J <Čc$-$ Ab -$<Č!$hlT'+= % ',  !0  <c$7$ <c$$jb $48('<!$47$8(' '+" % xx'6 B/, $+08$(%\'x'!$ !$ $+(\' 8U *`D&`%,0 @ K  % HL0 , dhl<'48PT <B$48$H' $J lptP'%%  %%  += % 'h  <`Y!$p\ `U} "!0`\`fW  (, @<`Y!$p\ `~ (",#<`@#_  @$#$%%` `\c*c8`$%#(@d.8< h$#8?0! h8L<`Y!$t U} "!0`L8fW M 04 D<`Y!$tL 8~ 0"4#<`D#_  D$#$%%(* a<& al # $*(* c$!$0(@%([x|X'PTL8 <B$PTU T6& wO6&@<%&88 < < i '<c$&(8*   '6&w`E($8D5' 2D-$"<'B$"PTX<|B$\`,'@<Pd Tc B @n  $"<'B$"TX\<|B$`d<'H'\'!$7W!$B$<$$H%0% h<C$%'!$7W!$B$a<$  8<$ $ H'\'!$ !$a$HLP8TX\+0 $ c$+(% $< P!$g  $$(p$!e<,(< P!$8 (,8 $%(%!$7W!$B$ 0TX\`d<'H$nj,Ȍ(Ɍ4 P$$H'!$7W!$B$a'H''!$7W!$B$a9[   <`$ _ `'|'!$ !$ $4'''!$7W!$B$@dhl0ptx|<6c$'$ <6$ _ d` DP@D ' 0 4TX\`d<'$(,`'4'!$ !$l''|'!$7W!$B$'''!$7W!$B$(,04<,c$`'$ <,$ _  $TX\`d<'$TX\`d<'$TX\`d<' TX\`d<'c$$% % h$%H'%P%!$7W!$B$ !|DHD '+" % LL'0 $+0z$+0$+0]8  H%k"$ +@bF+@AAplƌ#8##a?$'!$  "C$#$E$+0+0%&!#B$# '$d!a$ lp "B$".8 "D%8! 0  $ <++6&W `%0GHB%8HD%8HF%8HIJ %@ IL %@(IN %@(IJR %H*JT %HIJV %HIJKZ %PKK\ %PjK^ %Pjlptx|%l''!$7W!$B$de*% e,% e.% ef2%(f4%(f6%(f g:%0 g<%0 c%$Ĭ(Ŭ,ì'3&u>?3&u? ss& s8!34!<b&Da&|xt@H@S(p`@3(m`HDP@<L apah iJ %@  iL %@( iN j kZ %PKk\ %PKk^ lmj %`ml %`mn noz%po|%po~pq%q%0qrs%Ss%rctu%u%uvx%x%xy |%< |%ș |  a %a %s% %(%0 %8K%@%H%P0%r%X%`%h<%p%pa%%q?%%q@%rA%rB%rC%r!%!F+%!t! +h!(m$hF%F'$Q%h-o !0+h!8%p%@% X h L PX d |L PX ` xD HX \ tD HX X pD HX %"`%` CDE FGH'<!$ <B$"$" $ "<@  7<@  $" $"<`#_  $#$   $" $#<$_  %$%<`W!$  $" $"<@  , 0  $' $(  $'  $'  $''+" % '"!B  @ N r7''!$ !$ $+@%7'7'  ,$(0 ' ' ''+" % @@'PNVT R ($a$e$$<$8D$4B$0DH  'P ,DH< (8 'P (DH4 $0 'P ,(DH  'P    !8 T$X@'TX@'T$X@'+= % ' ,( 4"B$"(,,( 0  4#c$#0   4"B$"8'+= % '$!$  Î `"$ !$*A`'+= % '$%  (,  A$0* a(,  ,(0$% *(@(%0%8&! *( # ,(0$'  !#  !(,(0*@e+= % 'TP#"c8`XX# a8%p! bB !($*0#0%8%8% %0@ PX @% T*@!B<HŽ#c$ @  <<&$# 4*(*($HL  PX4@*F * HL # X4@* * HL # D'T,* A!$!AB@HŽ @  @,@b$$Lb$8 ,8*C D'%P0* #!(!#B@HÎ `  @A$(@0LB$8 08#$*C`D'+= % '@<#"D#a8&(C *(b#(",%0M!(##0"(#( %80#b#"$%(!!% @%$@$8*00'!!% '$@ 8 (*@!!% @&$@ 8,*8#C+= % '("$$ ,$*0E%0'B$ ($ ,*8"%8B$ $ ,%8(+= % '4 ,!0$ @C$8*(d2E$*0 ,!0<!CC$B$    ,B0<!$!d$ @ ('('+= % '84#" #$$'! $C ,0  $$ 4$,!0!b ,0 4 #$4a('+= % 'PT`\X$$% %0%8PT<#@ $*P(@`,!"HD@ 6 @#$PTDH<  #8`D% %H$PTH Dh $H#"D#a!$$8"!8PT  p 8HD"!!@% PcTB$ `!8HD"!% 8PT  %(D"!wPT T (H#"D#(!,8*@e04PT <^ 40*A!8(E$DPT*#!$ <^ #!8H(!8L'  L' y L'+= % '$!(,4 ,"$0c$B$* b% $c( `% ,c$* b%($B( @!8%(,$!( !$B$$B( @8$< '$c( `!$B$`6!$*A`%$B(, @%`B$*A`% $!(, !8% $!(, 8< '+= % '$!(,4 ,"$0c$$!( "$#$,6B$* b% $c( `!8% ,c$* b%($B( @%(,8 '+= % '4"$8% $% (&)&(CF#(a2(=,!0B$$ 4#"c(`$g8# a($$<<('B$ *(C%(,!0B$ !8 8%(4<('$<(',!0$ $$ 48*(,!0$$   48,!0$ 4$`,!0b$$   4+= % '84#"#(`@!b$ $p $# $( ,f$ ((' ,!0! &$4$d$* $@K@S&PG<%8&8A @N%@(&@ I&8K@T%H*&8'@L&@ $ *8# += % '$TP#"!a@ $(ep!b! !%(M2!(> ,(a$e$$@$<D$8B$4HL $' 0HL@ ,<$'  HL8 (4$' 0 HL $' $  !8 X$\D'X\D'X$\D'+= % '$!(0,  8"B$",00,$!(4  8#c$#4$!(  8"B$"< '+= % '(!$$c  `"$!$*A`'+= % '$%  (, y A$0* a(, y ,(0$% *(@(%0%8&! *(  ,(0$'  !  !(,(0*@e+= % 'TP#"c8`XX# a8%r! bB !($*0#0%8%8% %0@ PX @% T*@!B<HBL#c$ @ <<&$# 4*(*($HL  PX4@*F * HL  X4@* * HL  D'T,* A%$!AB@HBL @ @,@b$$H!Lb$8 ,8*C D'%P0* #%(!#B@HcL ` @A$(@0H!LB$8 08#$*C`D'+= % 'D@#"H#a8< &0C*0b#0"0%8P!0##8",#0$%@2#b#"(%0!! @&$D (8<*84'!! ($D 8<$,*H !! @'$D 8<0*@#C+= % ' "'C'" ! ' += % ' "'C'"% " + b$!d$+("bc!$$! K * ('{  %{   += % ' "'C'", "+ b$$!de+0"!"$fb< @b'g  $"& 'd%& '{  %{   += % ' <4$+"` <0c@c$ $"'$, $"<$* $"$( $"$& $"$$ $"< 0<_  0#!<- M 0$" $" $  $"< 0<_  0#!<< < < <% $"0$ $"+$ $",$ $"$ $"$ $"< 0<_  0"!<4'  %  %    %  %    += % '<!$  "<@"_  #"<@<_  !"<$'+= % 'M $$ $" $ $"/$ $"5$ $"<$" $"$  $"$ $"< $<_  $"!<('+= % '  '+= % '<Ꭰ< VB$,'  "!<c$$ Ab 04(', $  < !$ $ 6&W@6&W@6&w`!$B$0' $J PTH'$@@%!@ &P"@$ $ L$+= % 't7('x| -d dhtB$" < < <"#<@Cc  $!# $$#A<+!$  $"$"<[B$" < < <"#<@Cc  $!# $$#A<+!$ /$"$"<c$# < < <#$<`dc  %!$ %$"a<+!$ 5$"$"<B$" < < <"#<@ Cc  $!# $$# A<+!$ <$"$"<2c$# < < <#$<`dc  %!$ %$"a<+!$ $"$"  !@D '+= % '$(, } <`0 48@  !@D '0 48V>  !@D '+= % 'J (%%% 9 </@ <`<@$%(%0D4<@!$ <!$g  % %(%0D4<$,@   X$,<%%% %(%%(6&W @ ptd'!#8:`!8 <7!$ 8 $" ptd' $AA  @C  ptd' $AA  @C <τ$G%8&`l $AA  @C <τ$G%^$  18W=l:,`<|4_  !"<!$ 4|h% H!$ !$$ptd'> ptd' $AA  @C <τ$G% $AA  @C <0τ$G~%E $AA  @C <τ$G%h$AA  @C <τ$G%v<!$&ah (!hAA  @C <΄$G8%@hC<`C_  !#A@6&w(`!$0$4(' $"! <B$ $B$"%''!$ !$a|B$"048<|B$<@ '048<@ '  %{  %%{  += % '<`!$ ,48(H$ $,+` (< <`c$ (,D#$!$7W!$B$a0&0F8$B,@!$$ += % 'nprtx|d  X`d   XDdHL@%% C$HL#c0!#D$ @#% 8@H rtx|rntx|p$lnprtx|\' <  C`D<<$ s <_  !%@$"<%B$"<|B$'܏  @q(!By ' '<'!$7W!$B$a"$ < `<,!$'  %''!$7W!$B$q  ,D <`@`<8d[  $8`a6&0{<$&Fv@\`<@X_  !"X,(6(&dhl   s @*$AA @',,!5 3W X''h'!$7W!$B$a,!,6'%X''!$7W!$B$ `h l<*$AA <''+$AA !P"T!<*]!$H$' $J '%%{  q &$%$'''!$7W!$B$a d X-`\D*$AA @D8 0'% ''!$7W!$B$ '0'?'!$7W!$B$` '% LPTXH'%@C$! #.8TXH'  $%  += % '4 J D!H L8<@ DH ( $,,B$"<|B$ '!  ptP!"!B @<`!$ $"  p"PBCBc$  `P!"!Bp t @ "xC`%$% |BB8@P"CB4! ! P  !!`l'E'!$ !$a BxC|FB >'$ $$(? ,04l  <\B$|4C cPBBCDB<$|'  0:@$(T,Xl!  <$|' TX$"<%B$"<|B$'$OLg)%+X "`| $< 4!$g |< _  "%$%8%H%PD@0p$!F<x< 4!$<8!$ xD@<8!$?$?T@ @B$B(@?'$  $"x#$$%+0d $<!$g x< _  "%%% %($$0$@ ! 0#$+  $+ $+ [F`c8s`* `% % $#070!0c$ $+`*'$'  !8$%x$`'$'   *c8c,xH'$'   u` d8 c8`X!$'$   x\d% '$'   `x$+ . d8c8`'$'  p r`k|'$|'  b _`xd8"% 5d8"% .#c8`d" #(d/$(e#0 !( l#p$<`h#_  '#h'%  -$+ a*$+ !)d8*c8`"% "`'$'     +d8&,c8`!$'$   xd% !$'$   xdhl'$d'   h`x3$+ ,2d83c8#` $('$ '   xYptx'$p'   t`x9d85 d8 #(d/$(#0 !( #$<`#_  '#'% Wc8`!$'$   $xC 8%{  %%{  $x$(%(%  ($#8?0!8$$( $$_ $+ AX %A '$'  !8x= :de$f+8 $<`!$g x< _  "%%(%0%e$)!( <䎒_  &$t'% %{  %%{  e,$@(!(hN,h(%(% dl$#8?0!8$hld$1: $+ A3"% ,de$f+8 <!$g x< _  "%%(%0$%t'% Y%{  %%{  '$'  9 d(% % $#070!0c$$ $+A`,%$+02%$+8%#$$$+!8$$$$@ = x#$$'+@d ?\Sth$(?hldDdi<=$=\S tp h!$!(  $"*$+a` $+a(` `b#8`+b #8@`l!$'$   pd$#8`#8`#8#`<bx\`d'$\'  y ``t'$'  p m '$'  Z W T@ -d Da< @d_  "$@b$)+$+aX`##8`,b)#8&`hb(%(% $#8?0!8$$!k $+0c2%(je+#8`d(% % $#070!0c$$= $+(a5*% T%3$+ak`,#8T`3#8k`f8$#(/0!(%4f(% % $#070!0c$$ $+(a %X$\$'$   $%t!$'$   d$` #8`#8`R0!$'$   $-$%C0$M''''''''''''''$''%%{  %%{  %%{  %%{  %%{  %%{  `Q`hlp\'$h'  = l:`PdLe$Hf+8 $<!$g P< H_  "%H%(%0%Le $(plp$!(h<玹_  &''$;%{  %%{  %%{  %{  %%{  %{  %%{  "#! += % ','T'!$ !$AD$'h@@ 8<!$*A  $"$+aI` `$b#8J`X\`|'$X'   \ dhlX'$d'   h \@d -d a< d_  "$b$*#8`b9#8K` #8`SH6&W@6&W@6&0<$& "+$AA !P"T!$"<0&B$"<|B$`dX'$!$5 %(V8,a  % !(C!0+a \V$AA $" X; cd$c(!ecB(%(%)%*%,%@! cp $#!%P$$,U <4+ "NB!C <0!a!@!$*A ($AA P$AA T !|  <*c$$ Ab @\Ǡ$+8Hn)ɠ$#(/0!0$$]*Š+(HTĠ$#!0%!*(% &("   LPT4'$"<&B$"L<|B$PT4'LPT4'$( $(<]!$H$$' $J LPT4'%{  %%{  %{  %%{  %%  $XIX k%!X l&hJ% 08@f+= % '0"@#dB$&  < <8<@DH '!$!$#(/0!e  $ $BN   < <8<@DH ' 8<@DH ' < <8<@DH 'T'+" % 'Dd(Ud8=*% 0b$+0"fǐ$*HH" ci$#P W J1#Xg#Gl%#h o $hN$!PF!h)8LP%3 < <HL,' < <HL,'+`8#`A#h*o $h# !hm+x*+x## #x$x!x+P'%%  %%  %%  %  %%  %  %%  %%  %  %%   <!$!$0$4('"8+@"8@ $ <@B$ $<-!$$ ' $J 04('6&(c<$& ^<$&> aBR:  '|''!$7W!$B$a'|'!$7W!$B$a $'D E - "<6&W`@!$!Ž @ ($(+"&`@$!e!$+A`,#(#@0/$(!(#A @@  ,$48<'  {  %{  += % 'LXTPd`\$ $ P%0@%@%HLXT#P $*`j4)*<8D! o D%$LXTP8<@ ! b #8 `8d$TP<%*`)%8,L!PT X<8  ,*))<) %$T+8@(P!(+@FL 7@H!H')+( X8F %88*)tTPL  X8q 0<#"8#($)48*@e*g+L$cPT X@6 +!80G$8*+L$BPT X!$@6 +!8<0)'! Τ H'!  H'H'%%{  %%{  @H!H&* +$$*@ +@@@!@+H # A# d$$&%%{  %%{  += % ' +"`@!(+0@(!(gf%$$$$*@+@@@!@i+@ $*@+H W@P!PKl%h +Xl`+@y@@!@r  I$$'+(a@!DAd,$0 '%{  I$$ 1+@C@@!@ :$*@+@;@@!@i+@ $*@+H% W@P!PKl%h +Xl`+( a@!DAd,0 '%{  %{  %{  %{  %{  %{  %{  %{  %{  %{  {  += % ' +"a`@!(+0W@(!(gf%$$$ i$$ 1+@6@@!@ -$*@+@.h@H!H)+@ $*@+H Wj@X!Xl%h +PL@, '%{  %{  %{  %{  %{  {  += % ' d$$%!$)(* "&HB #H2))9 +Hw $@P!P+X%m`@X !XlMLm#PJ)Q@#H)) $-( '$*H +H[ @H$!H+XEQ`w)@P !PJ+H* ( '$( 'M)%*P(@+P%@W@P !PK,%@` !`%p %x +p% %{  M W@P !PK)%@` !`%p %x +p% %{  %%{  % %{  %%{  += % '(`\#"!a@ $(ep!b! !%(a2!(M 0,L!!e$f$$D$@D$<B$8PT X(' L!!$4PT XD0@(' L!!$0PT X<,8(' $40L!PT X(' $(  !8 d$hH'dhH'd$hH'+= % 'd$+("`@(!( +@V@(!(+ ,$,%$e(+H; @H!H&+P3@%@H!H&)+($%@cw+(@(!(+8"bW@!fc+C@B$%0 '{  %{  %{  %{  %{  {  += % ',(#de( /(@(!( 0fp $#0$8 ,$ 8  '@P!PK,+L%$*H( $ @c &`L@k T %PM&PKY @n %X&Xla &PLc @l %`&P@d &Xl$Hi *P#@#H#+P @!$@H!H&+P"@{  %{  += % 'HD#a(d$,/!($C($4B8< @1 $%$D(,4@<8 @8!8 c 1 $$D<4@8 +8"!8@@!@+H 0'%{  {  += % '($  I%@ @H*%*XG5`+%*`g׀!H!%+`#8@`!%!H+`#/̌)@`!`+H, %X ׀!+@#@@!d!@+H# Ɍ7 @P!PL%h %p +h ' '%{  %{  %{  %{  += % ' d$$$$*H % ',j*Hd +H @H$!H+P@ W*@X!Xgl%h %p +h%%{  %%{  += % ' w%a$(*"`0Ž@$!#! @ ($' `#$0$ $48,<'$0*(b"+(b>@!$!Ž @ ($(+"&`@$!e!$+A`,#(#@0/$(!(#A @@  ,$48<'  {  %{  += % '"d& Dc!   "d&D c !&#%"!,% '+= % ' w%a$(*"`0Ž@$!#! @ ($' `#$0$ $48,<'$0*(b"+(b>@!$!Ž @ ($(+"&`@$!e!$+A`,#(#@0/$(!(#A @@  ,$48<'  {  %{  += % ' $ K   " d& D% c!  % '+= % ' $ K   " d& D% c!  % '+= % '< !$ 0< @< B$D' 0D"?0@8 <?)%!8' $*XF`+X`+8$*X `,` $+(e $*($(&(" <` [  # $(,'+0%;!0Ɛ(+0b/+0A*# ##A#a'$$! :d $!#c$+(b!bB$( $(,'%{    %{    += % '$(%T $(!0&+8b+8F#F# f#$f!# L <!$#C*a  < <B+(bT+(AN#0#7$0&#A#a! < [  ' %8%%%@%(%0! $!0$+0b%+0A #@#G$@(#a!$% %(%0%8%%G$!8$$(,048< '     %   += % '8 $=  < &"8@0($ , <  $   "$,! b 8 8$T$%%,%<@$D$HLP4'(, $0 % %(%<@DHLP4'$!a! !8 $*$ $!a! !8 $$#+  %<@DHLP4'%  <!$ nj$($*@$!$*H $<(6!H+@ $4*@$ <5*8$$0Ȍ80<HɌ $'%%P%%( %%H8% 0T< ː<`|@ <4!$$ !| #$!dc c8`$%@#Pb%|@+A`#0%7$0&#A#!(!PA08<% %T`+"k9`DHŒ [  @H+b D% D $$! 8$%# #H+0dLP ǐ "$L 6!DLHP4nj0Ȍ!H,ʌ+X` !$$ K  $< B$e(0a<3Y!$ K  %%S0 #8` #88`I 6&0<($&0%O8,% 8$f8a8l8 s8e8$% uab! !8C "sB8>@"tB8:@"rB86@"iB82@"nB8.@!g!8* X\l "$! <B$X\<Ȣ!$ $X' $J <, Ab (X\l "$! <B$X\<բ!$ $X' $J <, Ab l8d)0PX\4a8b <B$X\ 7<@"_  #"#'BH./\'p'!$ !$A/@4L|dK`hL< )$+P ^@+P!X@<lP:\##((/$%!A$   $<%(\ %%%(% njP :$ 'BP+XI` $Pjq!H*1(!(!% %   %  % %  += % 'T d@Pd(%(4'H'!$ !$g)%+X #`0 $< |!$g 0< _  "%TH'%8%H%PdP($@p%!@ < ,< |!$4' dP(TH'$,4'%H%!$7W!$B$fŒ+@Oƌ@p!0ŬɬX hlh@\ce\B@+H2 c(p!e0bbl``$ptx|L'tXx\|`L'dthxl|pL'%%  %  += % 'Pd(4'H'!$ !$fnjȌ%Ɍ+P!@0 $< |!$g 0< _  "%H'%0%@%HP(Ȭ$8p$!<,< |!$4' ,P(H'$4'!$7W!$B$e+8:8p!(d T@(T@84\XX %cbB8+@bp!C0`AA%\hlp$tL'%  %  += % 'Pd(4'H'!$ !$fnjȌ%Ɍ+P!@0 $< |!$g 0< _  "%H'%0%@%HP(Ȭ$8p$!<,< |!$4' ,P(H'$4'!$7W!$B$e+828p!(d T@(T@84cXbB+@"hH&p!@(0hlp$tL'  %  += % '@( 048 <D $04 $DW  $(HLPT,'048 <D  $(HLPT,'+= % 'Xd,<'P'!$ !$$<fnjȌ%Ɍ+P!@8 $< |!$g 8< _  "%P'%0%@%HX,Ȭ$8p$!<4< |!$<' 4X,P'$<'!$7W!$B$cb+(wap!A`"d#<`\ #_  \%# %C8`0( \Ch0&a 0(,%(`%00(%(%0`,0'0 `C8`&`$"'C8` `<6&w` $"B8@@ B8 @ B8 @ <6&W@ $"l@ptxT'%  += % '<"#$ !<)$$ <B$$ $<!$($,b 04@D8' += % '0"<*b@  '< >!$!$!$Pi. $+PI@( $+PIa@$'9$'0  $X "B4"$X @$#(/0P!(x%%>%(%0('9l'@0G(g?8  %>%(%0x"B$"$X xC0#@#$#!0P!>%(%0)*9&@+ $+PI@.'9+'0$X $X @$# '0P!%>%(%0xc$ z@@$# '0P!%>%(%0xL\ $+PI@?*9@['9o\'9'@0G(|gC$+@2A8B8C8nR $X @#$#!0P!A%>%(%0x $X @#$#!0P!A%>%(%0xQ8-b8z8= $X @#$#!0P!A%>%(%0x $X @#$#!0P!A%>%(%0xA$#B0!b<!$ $ P @'&< Tt!_  (!<`!$ x@P>Tt(8$%H%!$ !$<`!$ x,"B$,"@P>%Ht$(H(<hp 9@P95 $$`+ (,0``@P $tĬŬ<Č_  #$ìx x@P>%(%0E@Ptx $$' (,`@P $tĬŬ<Č_  #$ìx x@P>%(%0x<" @t< c$ w x"<`t td%g  "$# %b#P@ <% A@Px x@P>%(%0 - /%>%(%0x**9@$ +*9@$?)9 $> A$#B0!b $( 8,04%>@Px^*9@'0 $X $X @$# '0P!%>%(%0xn{*91@|'9|" @#$#!0P!A%>%(%0xW4  @Px x@P>%(%0;H` |  x{$ @$$#!0P!Ax%%(%0%$$+0*8*8x$ P@ `$H( 8,04x%$@Px?| '?| '<`!$ $"<+;B$"$ "<@P[  P""<@B$?| '4?| '?| '?| '?| '?| '?| '@#d+b} L<`!$ $"< B$"L "<@P[  P""<@B$?| 'j x#  x #$$+ bB"x x"B8(@<`!$ $"%(%0w '+= % ','!$Ž ŽŽ(I i@$< >c$& Cc$U$  .@D$T+(d0+(A48#A,#"$"P!ADO4 , D%e%X\`dH'PTO4 $ <`!$ $"<B$"T "<@P[  P""X\<@B$`dH'X\`dH'E,A$#(/0!(Lǔ$%@ L%@%8%%(%TP "!(4 v  :$*8)'8>-'88(0 "' $%i$*@U(8" 5($i!8K "5($m(8"$$($s!88 "5($TP%;:&8*( A!@"'8@TP%)":!8 @$"L$X @$"L'X\`dH'TP% X\`dH'#A+(A%<<`!$ "$"` <4DH$L8'#8!`CAc8-`Csc8)`Ccc8%`Cic8!`Cic8` << <8DH$L8'#8`@#`@Č<Ō$8nj+H$ dtp $<%!$g |@< 8_  "!8t%0l%(%8dp<Ŭ$ ! <_  #%Dx'{  += % 'LdP/`P%!$nj*8' nj@!808IDhFCLhHi)*@(9@h<i)%8j+X "` $<%!$g L@< 8_  "%80/`P8%H%PL<i(%@!@H<  _  ')  $+PIk@<*9S@: Dj@Lb $+XB-`HkkX*Xl `* $X $X+HI ,Li*hi%X Hi&p-   0L/`P8< $X $XŒ)$+XI` ˌ͌#h#pA%#h H o $H-!H+%"9@5 ' +L/`P8<%H0*9 @ v  )&H%)- *9@ $  )9_  8+H H'  T \d $:Q (0L/`P@h<i)%8j+X #`8 $<%!$g L@< 8_  "%80/`P8%H%PL<i(%@!@H<  _  ')<!$@!('8`%%H$!`! 8,H4pd$ $T%8%0Y%9`(# `$#`("$+"!`$!%$%%%%%<!$e$%0D'%8%!$7W!$B$p''!$ !$p'D'X'!$7W!$B$+@$ $P&q!H<lh 48A  4mA D (,47B <e  "C(`$@$Hc @ "#+ C$$0p!0%\`dL'\`dL'8p!0ǐ$+@ 88nj%G8 8ƌ+8$H<Lg 0`Î֎Ď#(A#"$"!a 8!A <+04,(4 `+@0!0ƌ+H +H #0L!P&#X_ $ ! dD+`jlDhl $(' $J tx } p'+= % '(,< <@B$(,<-!$$(' $J $ (,48 <B$(,$ (' $J @D0'+= % 'd XT`\TX 4$\` $44$0 e$$+08?,$0%08'L'!$ !$$+@8'<!$  $ 40(%8 (%($ 40*@"<@c$ $gp!a,A$  ,bb<d_  !$a@'%@)P!HI(%*H )+P @$$*@G$+ e $p!#d+(D a!"!hP'%%{  %%{  %*Hh  %+P#}@$!X+`Buk!`&Xl`+X%h` $X(ql%!`,+pM\P !PL+`R!X+l+hIk`!XJj+X%;` $X(ql%!`,+p/h!p+x%!X+o+O΍kP !K* %!PLJ*`P%P+`!XJ%j%%{  % %{  %%{  %% {  % %{  %% {  %%{  % % {  % %{  % {  % %{  %% {  %%{  %%{  %%   += % '8 <B$$<تB$(,<0<!$$ <!$$<@!$ $ (% <B$&"` c%%d `"@"@<` 8(":@0CD$E&!+8d!,( $<!$g 0< _  "!,(%(%% D$!F<`C_  !#A4'4'%%{  += % 'PH"L# H 8"$(#$P`(8D,,$&(4(G%(L' 4 (<@DH,(",! <B$<@4( <B$DH!$$ <0c<_$ "| ! H  !$ $0 ,$ H̙ 8<!$ 8<>!$ $<,!$$0 ,$ H̙ @<@!$ $"<B$"@<>B$$ #B$ " T!<!  T!<! <_!$ $  ݛ  Tnj%8 D L?\%0dƐM  3''4 L?\T><0HLP  <B$ $0AL?\THL錠> <p <̳$%% $   "$!<$c$$jb B$ $+0"@x $<!$g  x@A$!a%<@"_  $"$L$  {  += % '$CBĎ 0c<_$ "| ! $(! $A '+= % '֎  '+= % '֎  '+= % '0 Ž$Î8@  <$ $7!  <!$ $  0$8@$@"!B @ <!$ $ * !8$8@%(0$! !( % !$$ $0c<_$ "| ! H!<`YB$a\ !8 $ %F8'A8 'L8 'S8'E8&&a8 &l8 &s8&e8f8%a8%l8 %s8 %e8%%;5`4 $+(87,$(%H'd'!$ !$ $+(H' t@$8+(D<#07$0(!@'#HD4!0FH+Xh`+X`*X)`%H%X %H% ,&`    8H$<( 4&0)h!8% % D@L3  m@,d<`w$! 0*0F<?$$!&'0@ <?$! $*@Si+@(+ $*@Fch,$+>`$d$8*(D/+(bM4!0e$Ǡf$+@B!0$Ƞc$+0b8!$f(c$D@%@%84% < < < < <%% % < <%%(  < <($%% PTX\0'%{  %{  %{  %%  %  %  %%{  %{  += % ' " 'C'" "! B @' += % ' "8'C'"8! "!B<@ DHLPT @$(,0X\`d4' 7+= % ' "4'C'"4 8<@ DHLP_ $(,TX\`0' += % 'M (%'&'!$ !$a$$ '&'!$7W!$B$a'!$ !$a$$$ '&'!$7W!$B$a< (<_  ("!<⮡  LDH \ 7 "4 7<@!$x4|$HLP4l $( (0TXh! 7h"4<`Yc$48(<0@4'\$#tp$"l  dh xy h"B$""!0 #\ `'h7<*!$$  `'tN "0K@ ,' ''!$7W!$B$aD !(< !$,'$ < B$K9`&K9h`+X""`)8#X"!`d#pMw$N!+p 4D 9&9o*p4+pl#pl!x#Ç$` !`l+/@L<  $"%hlk%% %P%8%% l h! *A  0! ' '<'!$7W!$B$a '''!$7W!$B$aJ`L$lXT! !8 X ,!X  %'% ''!$7W!$B$%T !8+ L$l| "B$"x+@'>ip!H#$'!$7W!$B$a<`<*!$ <*!$' %!$7W!$B$%'P'!$7W!$B$ax|T'% %{  % %{  %%{  % %{  %%{  % %{  %%{  % %{  %%{  %{  {  ,'+" % '`h+"@`L$ ap\! H$%8'%@%!$7W!$B$p+H') Hap!%< <*B$ <*!$' L$\`hH)$%!$7W!$B$!'P'!$7W!$B$!%l)%H*$!$7W!$B$A'P'!$7W!$B$A%)%8@+P@Php!H*$'!$7W!$B$A+P'@Pip!<@<*B$ <*!$' L$\`%*P(@%;'%!$7W!$B$+P@hp!H#$'!$7W!$B$atÎ''P'!$7W!$B$P'''!$7W!$B$ `*`c8\`%L$ )%*P(@%<'%!$7W!$B$+X'A`ip!H#$'!$7W!$B$atÎ''P'!$7W!$B$P'''!$7W!$B$ `*`\`%L$ >xT'% %{  %%{  % %{  %%{  %{  {   '+" % 'td$x%%&(gj&0#02(l+0$L$@ph!P(HK%%`'%h% !$7W!$B$a+X`%!(#@<`<*B$ <*!$' txL$hlH+$% !$7W!$B$a'\'!$7W!$B$A) #0($|}`'$*0%Cl+0aL$8ph!HH*%%X'% !$7W!$B$A$+H+K $!H#$'!$7W!$B$a|Î''\'!$7W!$B$P'''!$7W!$B$ `*`c8x%t@K`'$`'!$7W!$B$'\'!$7W!$B$%txL$hl|*@+@bp!iH$$'!$7W!$B$c$!iH#$'!$7W!$B$aÎ''\'!$7W!$B$P'''!$7W!$B$ `#a'!$7W!$B$a<㎚`<*!$ <*!$' txL$hl|%% {  !$7W!$B$'\'!$7W!$B$%txL$hlp!#H$$'!$7W!$B$c$!iH#$'!$7W!$B$a|Î''\'!$7W!$B$P'''!$7W!$B$ `#a'!$7W!$B$a<㎞`<*!$ <*!$' txL$hl%% {  %{  % {  %{  += % ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h$rN P!!(8TX \H4D,' h$rN P!!(4TX \@0<,' h$rN (84P!TX \,' h$rN (,  !8 l$pL'lpL'l$pL'@'+" % 'DwLX+"`L$ apH! H$%8'%!$7W!$B$T+ 'ap!eH#$'!$7W!$B$adÎ''<'!$7W!$B$P'''!$7W!$B$ ` a`d$dXT`TXL\+0L$8pH!8H$%P'%X%!$7W!$B$!+8Dp!hH#$'!$7W!$B$adÎ''<'!$7W!$B$P'''!$7W!$B$ `a`d$d\`L+ "LL$(pH!(H$%@'%H%!$7W!$B$+((5p!H#$'!$7W!$B$adÎ''<'!$7W!$B$P'''!$7W!$B$ `a`Cc$Ch@'%{  {  % %{  %%{  %{  {  += % '#de(/(@(!($ 0fp $#0$8 ,$ 8|'H)$,!$7W!$B$!(0'x'!$7W!$B$!%% $*H( $@c &`L@k T %P&PjY @n %X&Xa &PLc @l %`&PL@d &Xl$Hi*P#@#H#+P;@!H$L $XHq!,H+$%`0'!$7W!$B$a+X,%`H*q!(<鎰  <*B$, <*!$(0' ($ L $% % {  %{  '+" % xx'#a,d$0/!($C((B  P (%$,0'H($% !$7W!$B$8<''!$7W!$B$  P $d$;+@"@!@L $P!q!PHK%%`<'%h% !$7W!$B$a+X )`$@(q!8<莻4<*B$ <*!$8<' 8$4'%% {  {  ,'+" % 'pl\t`h!$7W!$B$!'P'!$7W!$B$!pl\t`@H*%*XD`+%*`dP!H#!%+`'L $hqL%!H.$'!$7W!$B$!%+H' %!H#$'!$7W!$B$aÌ''P'!$7W!$B$P'''!$7W!$B$% ` apl\t`pl\t`!+@'iL$Hq!H)$'!$7W!$B$!!C+X'U`q!H#$'!$7W!$B$aÌ''P'!$7W!$B$P'''!$7W!$B$% `#a'!$7W!$B$a+@'>ip!@#$`'!$7W!$B$a<`t'% %{  %%{  % %{  %%{  %{  {  += % 'd$%%&(g8j&0#02(+0$$@p!P(K%%`l'%h% !$7W!$B$a+X`%!(T#@<`PD@ "d& D7 ! c  - "d&$e& %"@b$& $$$e& c! K   ! C$B K % '+= % ' "$'C'"$ "!@$ Pt (,04 ' += % ' "'C'" "! ' " !#A+= % ' "'C'"`b a* "` ``  %%%-  r   nv 'ptx|<!$< !$<!$#$p' $J ' nv ' A  ' A  '+= % '@3 4D84` <$( Mr * $+ b5 "@$,  @( 0'D'!$ !$A$0(48<l B@,D<B$#$0' $J |h' O |h'% 0'D'!$ !$048< @D<B$#$0' $J |h'c8,`#c0l < $!<$&0  @ O |h'% 0'D'!$ !$048< @D<B$#$0' $J |h'+= % ' $y V B&" @a($)'")f !'% ''!$ !$B c<B$#$' $J B'H''!$ !$AbH' H''!$ !$AbH' /%''!$ !$B c<B$#$' $J B'#H' H0 "<!(L"!Î `! B 0D< (~ 0"<@D"_  D#"!'#H' H( "!Ld$Ďc8 ! B~ $"<@8"_  8#"!'#H' H< "!Ld c4Î ` D, 4 ! B 0@D ,~ 0"<@@"_  @#"!'+= % '< !$ ltx | & < !$l H  ,'h'!$ !$a< c$,' p'p'$,' ,, "$! 0"! (< ^!$$ ~ <B$"<`(#_  ($#p'+= % ' " 'C'"  $(, 0 48' += % '< ^!$ < @ < ^B$4' 4"(,0 <"B$> 8<$'+= % ' "$'C'"$' < ^!$ <@4[  4""(,0 <"B$> 8< ' += % '`T+ C#C%0B%8D%8F%8%0<6$0%0%%%*E`+E`!c%0, <`$!cH`C$<`$!c%88eg0!@*HX c0@I$  c8`H % ( $,LPTX\8'04A  @I!0Ȭpnj#@+H.  nj@)!(%(< p<8/%0%%0@&]8 i  $40'0p<#@+H  @I!0Ȭ pnj#@+H  nj@)!(%(   $Q'(!4'0p<#@+H  @I!0Ȭpnj#@+H  nj@)!(%(<p<4 (<l'$ d$0p! &!0Č%$"b+0(f8p!0Ȑ $Ƞb+0a!  " + b'%{  %{  %{  {  += % ',d$/ `d$d< A!$$$  $,b$d<d_  !$a$ebe$eXa&0"E8#E8B8+@i 48<(' 48<('r 48<(' $! < KB$ $<^!$,$ ' $J  !j %%{  %%{  '+" % ``' "@   dh%% %d`h`d%@!!dh$d4h`d$e+0DD$$8FpX! h< c`F$% l'%H< !$ < J%!$7W!$B$A"+P@*!PGJptx|$"@%/ +@"@p!PJ"+("w%!<H< A!$l' H$4$X%(l''!$7W!$B$LT(J$+X "` $< A!$g < _  "%4$X%P%(T$*@p%!(<< A!$l' T$4$Xl'%@%'!$7W!$B$A%("+@$! ("+(%8p!($l'%H%!$7W!$B$8$%($e+0Dw@$$8FpX! h\c8)!HI$*)+P]@)Pp!HI +&`c%H,T! K 48,@$X\T%H )+X`4$o"+(*"(p!E%080E$C% -d  <B$,'%'<'!$7W!$B$p'l$h <!$$ H $(%'% ,'<'!$7W!$B$p','% '<'!$7W!$B$p'!$$|!$ <{!$+$ H $(%'% ,'<'!$7W!$B$p'l$h 8&9 P$ 3T#$X  HL3:# HPTXz$ ( $,8N`9#>`P TX= $ (48H9ǐLCd8c8`P$& 48 PTX   48\`D'\`D'\`D'<@A < KB$<@ 0"0\`d<!<`B$\' >  00  0*AN #0`  tx|  0*AN |#0`  <<&%+D*%c,$C%" PT !$$ ! @80  H $(ptX' <Ϩ"0 !0 B4 "0@!$D0< $!dHXBL!$P<+!$$D' $J `a< a_  "!bN `XA$< `@B$ !0< B$!A$<!$$ ' $J <$Ꭰ $"X0'L'!$ !$AB< c$ U} "$% 0'!$7W!$B$'0'L'!$7W!$B$;`d' \$$x EF   \Pl '0 0"2 'w '+= % '0<|!$$$!! !8  r  0"B$" 4'  , s   "@$"$ #c$#"$4'4'{  '+" % HH'7#$0'!$7W!$B$aldhe$df+8 $B$ < B$!A$(t!(|x$+(b1x\A$+(")X!!T`\"$+b \$8,'8,'8,'8,'8,'  {   {   {  += % ' A # 5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ8!$+0"$!$!!8 $Ta $Ta$ ' ' '{  {  += % ' A # 5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ 8!$+0"$!$! !8 $Ta$Ta$ ' ' '{  {  += % 'hbpa+ "pdd$(p!0ƀ%8$*80"8@aI!8S a bd!Dd!c!b: '08#0A(!$+0"=$!!!8 bd!Dc!b ' 8!#0A(!$+0"$!! !8 bd!Dc!b$*A!8 ' ' '{  {  {  += % '"@"B,%@dd$",$"<@"[  "<҉B$" 'd0$@%$%&$08 $&&$$'$@d$%008 $$$% 08 8 &&$!@b@0B8@$$'$ _ 1 ( '( '( '$( '#$ ۏ  $" @#$   $( '( '( '+= % ' "%$*,`B0C8`B8_@"#$% 8 $'"#$% 83 $'B0C8%`C8` B81@"#$ D $'"#$ a $'"#$% 8 $'<!$8" ?8 %x$S@8N]$+ [8]8 B`8&0$+89$$5%?$+,$+ #8;%%%,';! :';%x$?';]$+8 ['; ]'; {';}';$8'%%8 8$>0<&$ !#" 1  <d$+ DDL<D$LP0H! "$#&'%8%%D/%, :4 $&HI)-%`%p.%x%H%@  :8 :5: $+ !@9):L$+Ȃ !;$+~`!cc8`DD4n 0$+e!@9'%@*2@ $*2J9@ $*2J9@ $ *2J9@ $%P!XE&Xbk-%hm%0 $ $c%H%@ _j$bbbb``````` @```@`@`` ```T@'%{  %{  %{  %{  %{  %{  %{  += % ' < @"#$%g  "#$ % $4C`8D0E#$<`#_  %#%@C`DD<E#$<`#_  %#%LC`PDHE#$<`#_  %#%XC`\DTE#$<` #_  %# %C% $* bc0d8Kc8`dC`hD`B  4  $pC`@$DDlDtB    $('xC|DB 3  ('('`CdDhB $ k ('c0d80dC`hD`B    $pCN`@$DHlDtB  = ('(' c80`dC`hD`B    $pC`@$DlDtB   ('('$('+= % '(d$ e* " & (a b+ "*d! $ b$$+(e! $ b!$+ "b!"$"(a!$(a$ ' '{  %{  {  += % '"A%# `#* C&C `# `r  #&C`r   ''#*b` $Wr '$" $#'+= % '4 $"@ $Wr  $8 '$$,*C@( 0' s  8 '5""6$C" $8 '+= % ',*" $( 0' s  4 '$ $4 '+= % '$" @ $Wr  $4 '$,*C@( 0' s  4 ' $4 '+= % '< ,d $Wr  ,@(',$404,0$*("+("!(%0=$+8,$+8 $8j&,+e$0$+8_$0+8Z=8U[$+8 $0$+8K[8 F]8C_8@~8=0,9$+85A,Z$+8.a,z$+0 %_8"-80$708$008$)08$"% 8$' s t @('``$@(' $4,0` $+0C !$!$%$Wr 0 C0 c,`0B$7B$,Wr  "0!0 B,@0!$7!$,Wr @('@('@('%{  {  += % '0 (d $Wr  0(<$'( 84,%%8(4,%%808 *H +H !H) *9S@?=@iHj*HI8 %+H !B B8/@   0+"`,! a0$08$08$ 08$% !   ' s  0,$ *94@ *91@*9 @ %+XA`!PJJ9%@*9B@ %+`a!h9 %+x!pΑ9.@*%+Pu@!@9! '9 r D 0(4,  's 0 ($  2 0(4,  ' s  (`%%,% 0&<$'<$'<$'<$'<$'<$' ``a $a$<$'%%{  %% {  %%{  %% {  %% {  {  %%{  %%{  += % ''$('$ $_   40,(8%%8 <$'4(8%8, *H +H@ !H) *9Y@EC H*HI> <I$*H 8 %+@"%!! !8/    0+"`,! a0$08$08$ 08$% !   ' s  0,$ *94@ *91@*9 @ %+XB`!PJJ9%@*9B@ %+`b!h9 %+x!pΑ9.@*%+P@!@9! '9 r Z 04,(  's F ($2  M 04,(8 +8"g!!'!8 '$Wr 2 04,(  ' s  (`%%,% 0 <$'<$'<$'<$'<$'<$'<$''$'$ _  ( $<$'<$'{  %{  % {  %{  % {  % {  {  {  %{  += % '"$4'$ $_  (%H0'(<* CC8@ 1  4Ld<8 (<+ "8!($+(@8$+("8 $+08$$$(+8u!8 8 88 $+Hc !@98"$+P"T@!Xkk9 `$+hH!`9<@ `$+H3 !@9"8\8 8,eDRO iHj*HIJ HI$*0D  (a$<+"`8! a 8 4\$Wr  <8(+ "! a0$08$08$ 08$% !( @(' s V <8 @(' s K <8,!,$$$<48$(+8!8琀00$090$090$ 090$%@%8 $< !(\$Wr :  $*AV`$* a$ $8 $84b$Wr 4a$Wr 40$Wr  $*( !8 4t$Wr 4n$Wr  !8 4v$Wr 4f$Wr \$* a5$*( %8 %8N4e$Wr 4r$Wr w"%8 \%864\$Wr h4"$Wr _$*(%8 %84_$Wr L4N$Wr C( %89) %8-$$$*(4*0 4u$Wr $4U$Wr $ 4x$Wr $B$ 4h4P$Wr 4L$Wr M <8%H0'H0'H0'H0'"$4'$ _  4 $H0'H0'!PJY?J1!8j)%*P(@!P&+XB`-H0'H0'$$ 4 @$ A,$ C"0!0 B, @0!$Wr 7!$Wr % {  %{  {  {  %{  % {  % {  % {  %{  %{  %%{  %{  %%{  {  += % ',W (d 8? 89 838 $+(ABe8-$8>+(A2f8 $+@&h9$*&+ d8$$$$D#0c$' _  ,$($%$4 '$+0!0eƐ08 84 818 $+@!8g琅8%8-$+@!Hg))9 $+XA`!PjJJ9@ $+8!0fƐ8 $%+$$-$ ' _  $4 '4 '$+0Z!0eƐ08 84 818 $+@C!8g琅8%8($+@3!Hg))9 $+XA&`!PjJJ9@ $+0!e!!8 +$$$%%{  %%{  %% {  %%{  %%{  %%{  %%{  %%{  %% {  %%{  %%{  %%{  %%{  %{  %%{  %{  %{  %%{  += % '|$('$ $_ + (,0 4  ($ $( 40,$8$'8$'8$'0$(4, *@v+@!@ 94  91  9 $+P"u@!H))9% 91$+P"f@!Xkk9 `$+hZ!`9N@`$+@E!8琩8  's ! ($   0(4,  ' s  (`%8$'8$'8$'8$'%{  % {  % {  % {  % {  %{  += % '>$('$ $_ + (,0 4  ($ $( 0,$$8$'8$'8$'$%0, *@+@!@ 94  91  9 $+P"y@!H))9%  9- $+XBj`!`9 $+p^!h9 R`$+HI !8琩8   9%0 |  0+"`,! a 8$ 8,$,%(F +8o!8 8=$+8c!0Ɛ 84H*0/ =  0+"L`,! a0$08$08$ 08$% !  4 ' s  0,(%(:8$'8$'8$'8$'{  %{  %{  {   4 's  0,($ 8$'!0+8!8%@ 94  91  9 $+P"o@!H))9% 9@$+P"`@!Xkk9 `$+hT!`9,H@(`$+H? !@90$09$09$08$%84 2  (r  0(,x8$'%{  % {  % {  % {  % {  %{  %{  % {  % {  % {  % {  %{  += % ' 40,(%%40,( *@+@!@ 94  91  9 $+P$@!H))9% 92$+P$@!Xkk9 `$+h!`9@`$+@!8琩8  's I ($%  J 40,(#@ +8$Y!!#!8 #$Wr  $ ( $Wr !8 40,(  ' s  (`%$k8$'8$'8$'8$' r  ($8$'8$'%{  %%{  % %{  % %{  % %{  % %{  %%{  += % 'C*`C`$CCDC4A$< `   |t o /8|t £ 88y|t  |t Ȥ ' A D !  #d0 c0`4% %%|t o '<*!$$ $ $(,048<@DHLPZ '<;!$'$ <;B$j #@D0 $X' $J  <B$j 8  '+" % TT'"@ $$ d !,%($'%0`Cfc86`8Y$*`CYc8 `DE8DS8$&`Cec8"`Csc8`Cod8 Df8Df8 yc8 `Cec8 `Csc8`$%c8%%% %% "8@!@ 9&@$!H) )9 #H# )%$di# '$$ ! <g_  $'d# #@%$dh# '$$ ! <h_  $(d%@%0%@%(%%%%{  '+" % dd'- h $8 8 888I(E$+0Y($!( ,($+(bL(# $%'<@j!$ x4($|tpl,%p%x % `dX%H%P\T% %`%0 %X%(% %h%8J 4`dh0,@PHL@%<% %H%P''(E$+0($!( ,($+(b(%$''!$ !$a$$E FG(,0EFG48< E$F(GW<  $pB$0e!EEFB4d$ '!$h $$h< h[  (<'% h(e,f0b#$b<@b[  "<B$badgTD'TD'TD'%{  {    %{  {  {  <'+" % 'H-  $8#$%HnjȌ%ȬŒ+@"0,(ŒH$#p!A!!8!,!$ H- ~ #d8Ad8>d8; c88`H,"(#c$$$+(C $< ?!$g H,< $_  "!$%% (#b$! $CL$ Ÿ PD' $H '<@j!$d8; c88`,"(#c$$$+(C $< ?!$g ,< $_  "!$%% (#b$! $C$ Ÿ ' $ '<@j!$ $pB$0!EFB4# '!$$$< [  (<% (,0$<@[  "d8; c88`,"(#c$$$+(C $< ?!$g ,< $_  "!$%% (#b$! $C$ Ÿ ' $ 4'<@j!$ #d8? c8<`,"(#c$$$+(C $< ?!$g ,< $_  "!$%% (#b$!$C Ÿ ''$ #$ %('<@j!$ tw l' tw l'f3.8/&$+@!0Ɛ.8&&$+@!0Ɛ.8 !$2  pPp$> tw l'abdfg:9 ,8 gH$0q$!0Č Œ<<$Tt'X\`dhT'@4' Pc[c8`pXb`a+ "6Td!({8]8}8,8-8 \c !$2  pXb`a+ "Td!(?8e$ \c !$2 p  tw l'Xb`a+ "Td!(:8e$ \c !$2 p s tw l'Xb`a+ "Td!(*8&8!8|8f$- tw l'>8f - tw l''8"8\c 2  pCpXb`a+ "qTd! -87?84:81,8.[8+]8({8%}8"#8&8*8!8|8>8'8 "8 %8@8`8cXb`a+ ".Td!(-8 &$+8!!0Ɛ 8 8Lf?8:8\c !$2 !8p%%0 abd$e!$$e< e[  %<$ e(d,a0b+$a< a[  !"$,(p$!EE FB$'$$'< '[  '<2$ '(%,&0"$<@"_  #"#"#$"#$'$'$'%{  '+" % TT'd$ $'bh*H= biJ$%A%d''!$ !$ $dhlptx|'d'!$7W!$B$$' #L bA$+ "3 e! dde$+(#$'J%%8% @+XB`T $`Kq!`,$*   %&h% %  {  % {  '+" % HH'$bde$f+8 $<|!$g < _  "%%(%0%e$EpB$!"$!$ !$AM <`d_  "$b$ ddp''!$ !$$pefgtx|efg|e('p'!$7W!$B$$(' #L $''+" % TT'"@ "B$""#$$  } bA$+ "}d$(p$! B. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabdabd'b+ ">ab!B<]c$ w `d''!$ !$$defghlpefgtx|'d'!$7W!$B$$' #L $''{  {  += % 'h"#$$  t hbA$+ "td$(p$! B. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabdabdld'b+ "5ab!EB<]c$ w h `'`'!$ !$A'( @h$' #L $ld'ld'ld'{  {  '+" % HH'"#$$   bA$+ "d$(p$! B. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabddab'b+ "Qab!EB<]c$ w `a$a a   "#$%(p''!$ !$pt$x |('p'!$7W!$B$$(' #L $''{  {  '+" % TT' F q : $ AAAA "#$%(d''!$ !$dhlptx|'d'!$7W!$B$$' #L $''''+" % PP'bA$+ "d$0p$! C. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabdabd'b+ "lab!FB<]c$ w $d$dbA$+ "RacpB$!"!<]B$ w #+ b<"%  """ "#$%(h''!$ !$hlptx| 'h'!$7W!$B$$ ' #L $'  {  {  {  '+" % TT'bA$+ "d$(p$! B. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabddab'b+ "Eab!B<]c$ w $ aaaa "#$%(d''!$ !$$dhlptx|'d'!$7W!$B$$' #L $'{  {  '+" % @@'dG a+ abd$e$`< e[  % `(d,a0b6$a< a[  ! HXb`a+ "Td! 8= 8:$a$$a<  a[  !!8/ $a$$a<  a[  !<< !$ a4(a0,a,0a$a< a[  !08 @%d d!$%3$"$$"<@ "[  "8"'$+@n!H))9 *$+XBb`!PJJ9)@V !$+0"N! 8 d"@$g  '%P@X$`%+0$T&!8 86 83 8 $+P$@!H))9' 8" $+XD`!`9 $+p!h9 ` $+P$@!H))9 4 818 $+H !@9%8<$+H !PJJ9 @$+`d!Xkk9`( $@$+8! 8d$( $g  P@'$%&DHL< `$!<<tx|<'t' plhD'  dd $g %%%(%0%8%@%HB''$"$$"<@ "[  " $+P5@!BB8@   dXT$g  TX'''%{  % {  %{  % {  % {  %{  %{  % % {  %%{  %%{  % %{  %%{  %%{  % %{  % %{  % %{  % %{  % %{  %%{  {  %{  % {  %{  %{  {  %%{  %{  %{  %{  += % '(def@,% (efh@, de$g  (,@f*@&%% *@% Xb`a+@"Th!@ 9Xb`a+@"Th!H) *94@ *91@*9 @*$+XB`!P JJ9%@)9 *$+XB`!` 9 -$+p!h9 `!$+H" !(!!8  da!( $g | (0"$! o 0!@9 )$+P"2@!H))9 &!$+("! 8dd $g  $48HD0,)ddL* L, '% '%h@$#+ b@Ď%  '  !   d@$h($ `d0 0 4 %(%%%(%%08 0 0D%     , Z , "(@<;!$ , CDB#$<`[  "" 7<@"_  #"#<@!$8 |p'tx!  <ͥ$$ <%!$ $ $b ,\(B$ !0< B$!A$<!$$ ' $J 04(' <!""!04('+= % '+"s`! a 8* ,V~$+(#8 %$+0\!(e,$+(B,8 %$+0F!(e,8$.8*$$+(1! d8 %$+0%!(e88!$+ "!a!"8@$!8!,%!8% '{  %{  %{  %{  %{  {  += % '+"W`! a 8: 87 84 818 %$+0>!(e8%8%&$+8/!@f9 )$+P"#@!Hi))9  !$+("!a!!8 $, '{  %{  % {  %{  %{  {  += % 'P'!$I  P' @D '<)1!$$ <!$$Ab @' $J HL<;!$H'$ <;B$j += % 'P'!$I  P' @D '<)1!$$ <!$$Ab @' $J HL<;!$H'$ <;B$j += % ' ",'C'",0 !%@% <*C`<>B$ !0< B$!A$<!$$ ' $J  < !dab04(' += % ' "'C'" ! ' += % ' " 'C'"  "#! $(r ,' += % ' "'C'"7 "+ b/$ $p!f+8"$p!"$%ghb<@b)*kw  $"% +')(*de&'( '{  %{   "d&DB8 @b$&B8@b$&D@b$&D @ b $&D@b!&"!,%  "d& @b$&D@b!&A!8  += % '"d& D!c ʐ   " d& D !c K % '+= % '< ^!$ < @$< ^B$8' $8",04 <"B$]#  <@('+= % ' "('C'"() < ^!$ <@8[  8"",04 <"B$]#  <@$' += % '<$$+@t!($$$($g $8%  8 $e$0,1 8`$$0+P(E@,!XIe%% ?0<%!8$!(%$&8k)%+X`+ $"!LX   < !$\< c$txt'|$#4'p'!$ !$a<̲!$'X'2H''@ $3%D@<$!$PT<`!$X  ta<xd_  "$xb0 a$0b$< deg  !$" %ab   "! <$<9B$"<@ <c  #!"#<'$(E0B< 6&WB+= % '"$><:c$  ' 3 "@'"!j += % '><8A4C `d < $njc2 <a< @a_  "!@b'$@g@%!@ &P$ @c$  $@g@%!@ &P$@c$  %8D4B @E <@$njB  c  `$HHH )%!H*&XE`B$@ " $$K  D"B0L#M$"%c0&b@%N < <' '+" % xx'L"@% P!'%D@<"@!B  @L+("<P_  #&PD< D $ DAHAD!#HALA <`fB$"<@(< (Cc  <$!#$A%%C`<,dB$"<@(< (Cc  <$!#$A%$,< 6B$ <@B$<B$  @D0'<!$<`!$j += % ' <`!$d  @`d% $'!$7W!$B$$$%*(8EF%8$'4'!$ !$ <`)%&PL@$Pp$%%0$'!$7W!$B$a!<@<8<`!$$' 8d$<@4' <`)%%D'X'!$ !$DHLlXpPtT vÎ'D'!$7W!$B$ `\'@B<>@,.02.`<>@B$&(*)0,% d 0 K dd$+(Ay$&$7$0=D!H#PA!(p+0ii+0(b#07$0h!0&*X`%8 &P @H   $pdHDh<>@B468:6!0'$$4 ,_ $t`'t`'% ${  P!PD   KLMH%8$ (,@!@ +P@ ,@ $%{  ${  %%  %   += % '$+(A$&$7$0&9#@A!(4!'(0+Hb +HAz ##$a!*0%8&0e"   $+0ba+A\` #07$0!f*0%8&0e   8:<>(`c$f$ ,`!$"#$%'% ${  8!8ȄɄʄƄ%($ &,0!0ǐ+8g , $%{  ${       += % ' d%$+(A>e$&$7$0&#8A!($$+@-$  Yf  e$ee ,!bE$%0%!$ !$DFbB$b'% ${  %%{   += % '$w( $,: !$%($+0E/c$$7$0#(E!f,$+8f$  Yf %#$!$ !$adb '%%{  %  ${  += % '$( %,-(!(!00$+0b%+(A$#A#a%$/$%! :d , '   ${  += % '4<T6! w/I<$4 ! d<T6! !# $(p7a'!$ !$A '4   8:<>8:<>'+= % '8'>'!$ !$A '4    8:<>8:<>'+= % '('.'!$ !$a %(4+,`''!$ !$A$0`A0 A0!0(*,.(*,.'%K#,w` >4 ''!$ !$!$ -,:?0! $0K&,V!0#ƐFF0%840J,&K, $0K$,=!#!0 (*,. (*,.' (*,. (*,.'('!$ !$a$)'K${  K${  K${  += % ' d b$+(A4c  (,'   += % 'd@ b +(Ac#A#(#/$(! #aC(,`e,(f8%c,c8f,$+`%e, c8`c,% ` :d <$'b + ADc# A#"$A!a(6@"C,2`#E8%B,B8E,$+"@%C, `B8@"B,%@d B8@$'$'$'   += % 'ld"C$$* d<\$[  $<τ$\$$d$DH!$PT r lZdTeVfXg468:e$+(468,.02d0! 0d+ `%  468:$&(*)0dd$T'P!$7W!$B$vĎdc'T'd'!$7W!$B$ " <>@B<>@lTVXZ㤔<`\_  6!\  ptxh'lDHd##$L!$T L$ O $+b Lptxh'  <!$<(!$j  += % 'PlChD$!$*(#!(08@HpED5<!P@HD*0#U<VŽ%0''!$ !$  @" 468:468,.02.@468:$&(*)c0c,%`<@+A6`D# ##APl#ap$"H!<h_  "&hTX\L'V< \A_  6!\V  TX\L'  += % 'lCTpDXhE`%,h'x'!$ !$a`pTtXx'h'!$7W!$B$aL@BDF "$&J AL!dTX`*0#?LVŽ%0''!$ !$  @" @BDF@BD8:<>:@@BDF02465c0c,%`  "$d%% l@p@< hA\C_  !#h@=1$%.8A.83+@$#pO$$xO!@*x.%H&ph   K$<ϥ$'$  <! 0+ $% @BDF024650$%$8h<\[  $<τ$\<\d[  $<τ$\dddd%8$d%%!!$*(%> %,V(!((*,.$+(bDE$/$(E()!@1#Hb!(+Ph5@+P.@$#@$_ $0!0F*P @%@ &H \X`   \X$d`଀ࠀ$+b '  %%  %  %%  ${  <!$<(!$j += % '<`'@BA0$%$8$8 V++ a% k<\[  $<τ$\䬈% !% `<\_  %&\<\[  %<ϥ$\dd+ b[+ AV# #'$ #A#a!"+(bH+AC`#(A#"$A!#(@$$&A `   $%%'d$$'!$7W!$B$aÎd'''!$7W!$B$ `" tvxztvxTVXZtvxz468:9c0Zc0fc$c0c,`Z0%(%%% %K%, <$!0%Ɛ?0!0$0K$+0b$0+ A$$'$ #A#a! |Ŏ''!$ !$   "dfhj''!$ !$A|'''!$7W!$B$adfhj "$&J e|+Aq`#Alb# Apd#"$"!A<@hb\dc  !"$ha<!ef0+`$%`@BDF02465c0$%#8 `#8j`< \[  ! e,X(!(%(*,.$+0F$7$0()!@1#H!0F+P6@+P/@*$#@$_ $8!8G*P @%@ &H \X`   d\X$`  $+d '%  %%  %%  %%  % ${  <!$<(!$j += % 'X`''@'P'!$7W!$B$a8:<> "$&J Xĵ  \`dT'X'+" % '4'D'!$ !$a0<4@8D <,+8"  <! H'4'!$7W!$B$a $$# ,o`(0=09QR\! %(f&  %$`'`'$*0]l+8<h!0Ɛ,QX`'\%\%X`' $`'X$`'<!$<(!$j %%{  $*@ +@ !@-%( %%{  '+" % tt'wd$ta$px'!$7W!$B$vÎ'x''!$7W!$B$ `" dfhjedfh\^`bd$+ }dfhjLNPRdP! 0d+ `$% \^`bDFHJI0d$%$8dV$8-x'pt!$7W!$B$'x''!$7W!$B$adfhj "$&Ƞ (`@''@BA?!0 > %%$'<!$<(!$j <!$<(!$j += % ' d%(,,,*!(! %bC$c0<$!@c,`($,'!  ($,'(,',=%(4e$0<$! @,$!!$,bC$c0!@c,`($,'!  ($,'($,'(,',Q%(He$0<$! @,8!!$,]d$0!0@,$Ő)!$,MbC$c0!'@c,`($,'!  ($,'($,'($,'(,'($,'($,'%@ < B$!A!($,'$  $  $  %%{  += % ' d%(,,,*!(! %bC$c0<$!@c,`$$('!  $$('$(',=%(4e$0<$! @,$!!$,bC$c0!@c,`$$('!  $$('$$('$(',Q%(He$0<$! @,8!!$,]d$0!0@,$Ő)!$,MbC$c0!'@c,`$$('!  $$('$$('$$('$('$$('$$('%@ < B$!A!$$('$  $  $  %%{  += % '.d, ! #,`@ < B$!A!$'0!@E+Hh +Hz #HO $HI!H8*J9 @+k9`+k9`$  @%8%8$  "" "$$=C(`<@  ,d(d\de$f+8 $< !$g \< _  "%%(%0%e$ p$!< D< !$0' D\0'@'!$7W!$B$0'`'p'!$7W!$B$d4<!(! $dr X'+= % '$%d$0%p! $ '%8%!$7W!$B$d!0# $d$d e+ b* "+ " | '{  += % 'D"L##C$@D L P B$"<|B$<@<`a!$<'$ ab##$!" -d %% ( 0  <B$< B$ 3 (L P$T,X4'@D -d LPTX4'%%  B$"<`m!$ $ {t $"<`#[  #  $"<`#[  #<\xB$"$ $"<`#[  #<.B$" 7<@ "_  #"#M  $  $"<@"[  "<\xB$"$  $"<`#[  #<B$"$ $"<`#[  #<.B$" $ $"<@"[  " 7<@ "_  #"#M  $ $"<`#[  #<B$" 7<@ "_  #"#M  $ $"<@"[  "<B$" 7<@ "_  #"#M  $  $"<`#[  #<B$" 7<@ "_  #"#M  $  $"<@"[  "<B$"$ $"<@"[  "<.B$" 7<@$ <#g  $#$# "$<('+= % 'M $$<`nB$' > $"<@"[  "  $"<@"[  "<B$"$<`n!$$' > $"<@"[  " $"<@"[  " $"<@"[  "<B$"$ <`n!$$ ' > $"<@"[  "<B$"$<`n!$$' > $"<@$ <#c  #$#"<3B$"<('+= % 'T"B82@"Chc8-`Ctc8)`Ctc8%`Cpc8!`BsB8@XCc8`BChc8`Ctc8`Ctc8 `BpB8@dhP'`.@  Tc`HL ('6&W`<`B$&" @7=<6&W `<B$&"-@$$'#8`An!84 Ao!80 An!8, Ae!8( $HA$%!8 As!8 At!8 Ar!8 Ai!8 Ac!8 At!8 $HA$$HA%4TH$HA%4THx<A!$$ K  <<b<\8d_  \%$8e''!$ !$a' C$+(#t $!$!$ '$ <3!$ $$ ' $"!$(*"`xhl < n!$T'' ! $|t'|t'x%* # hl  B$% |t'$$%(*(D$xhl %&A $|t'+= % '".@%b$#<4(!*C`hl  $('$('<!$<: $PATD+<LG_  %'LE  d\x" !B @ @B\ "%dx #< 6& <!$&a @x ~V<6& <3!$&a@x m׋<|6&0Y<$&0d<&`<&`$& $&%b7@48<@$"(!  @"5@<"B8$@$L$PTX<!$L'$ h@"8)@"8@!8  <@  HLIP'+= % 'H"8#`x H8W4C$@4D$0%($%8w%8g D0 H8@0%($'%'%8 <@!$ <@HHC_  !#A%8@0%($$%8(I PI IP) )  $`I+H <jW%wJ%@T1 H8@0%($<"! B @<w H8@0%($<  H8@0%($L (P!^  %%LP@0%($%@%8H8P #`# `! $$ H"$ <  7<@<"_  <#"#@"W$7B$@4T1    g *@8PC`M <@PC_  !#PA8"P''!$ !$a<`Yc$P' -''';T1 9$`;>% $? efnj <% *ƌTLeP$c$+0?80808 < <+8 < <%8%@< .!$%n< 6+w!$!a %% / X ,@6 LPT D'D'<!$<@!$j += % ',Z <+!$$04jb $8<('+= % ' B$"$'$"@$"! <!$D  ' 'w '+= % ' "'C'""W$7B$@T1 '+= % ',+ "  D !H 8!8 <4C!$,$0 ',0 '{  %{   += % '$ "(7@ CD"%D$%D&%*#" a0  <!8  <B$$ K  ( $04'04'04'!$*0$/ &8"$+0b0+0A+ <#8#?$8!88 <$ K  ( @$"$ "8@" @, 0 <@("[  "( ,"@("Cc8`%A@bAB8:@bRB86@bCB82@bHB8#@,D8B8&@ @"<"<@"_  #"#!$ "a@#`c%*CW@"C`%C de<$&8d& (df<_  &'df< hijk  &'( )*```Cc$C!;x  s 0<@/!$ I<B$"<@[  ""CB s <@xC_  !#xA/ '''!$7W!$B$ad"$< <@!$' ''!$7W!$B$a/Î `' W<  W<  <"@"<@"_  #"#  !< jB$  8, 9; 'w '+= % ' " 'C'"# '+= % ' "'C'""W$7B$@T1 '+= % ',%$$% w7% dD0 $H  B$"$"<@H"_  H#"#%<!$ ,B$"dhA +\ `'DA M <@ddDC_  !#DADA<`jB$P "$%0'!$7W!$B$a0' HDB$@+ " $ W< L "L P'(0#(d8!(7*`%!$,<4(,$08<4(0+"a`$!A"<`#[  # 0!$0   T A (0#"8!A TD!<`jB$X'  $TD!<`jB$X' > W< @@btB8:@btB86@bpB82@bsB8.@(C,BH  1 HM $'  @$`%l''!$ !$A< .B$l' %+$ , !H ,w '(",!LB @ !  %4'X'!$ !$$<<$8D@$4BL@A|A<!$ |"<@[  "" CB #<`[  "P"<!$ $"$PTL`Cpc86`BsB8.@"B8&@"Chc8`Ctc8`Ctc8 `BpB8@%%+'#  %(% 8'% '!$ !$A $bf(,04b8'+= % '$" !:  D%($,!<   `CRc87`BIB80@"@B%$@" Cc8`BB*B8@"B8@%  !<[V!$$ K %%% %%%% $,"$0"$@"w 'w '<8!$$ J w 'w 'w ' "!<c$+@'>ip!@#$`'!$7W!$B$a<`<@!$@ <@!$H`' HD4@%!$7W!$B$%`'p'!$7W!$B$at'% %{  % %{  %%{  % %{  %%{  % %{  %%{  % %{  %%{  %{  {  += % '+"@`$ ap|! $%8`'%@%!$7W!$B$+H') HDHap!%@< <@B$ <@!$@`' @$H|D)$%!$7W!$B$!@`'p'!$7W!$B$!%)%*$@!$7W!$B$A<`'p'!$7W!$B$A%)%48@+P@Php!@*$`'!$7W!$B$A+P'@Pip!<<@<@B$@ <@!$<`' <$H|D84%8*P(@%;`'%!$7W!$B$+P@hp!#$L'!$7W!$B$aÎ'`'p'!$7W!$B$'L'\'!$7W!$B$ `,*`c8H|D84%$ )%4*P(@%<`'%!$7W!$B$+X'A`3ip!#$L'!$7W!$B$aÎ'`'p'!$7W!$B$'L'\'!$7W!$B$ `,*`H|D843%$ >t'% %{  %%{  % %{  %%{  %{  {  += % 'd$%%&(g8j&0#02(+0$$@p!P(K%%`l'%h% !$7W!$B$a+X`%!(T#@<`PD@<@B$ <@!$Tl' T<D$@P8+$% !$7W!$B$aTl'|'!$7W!$B$A) #0($}'$<*0%C+0a$8p!H*%%Xl'% !$7W!$B$A$+H+K $!#$X'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,*`c88<%@K'$'TLH!$7W!$B$Ll'|'!$7W!$B$0%<$8*@+@b0p!iT$$Pl'!$7W!$B$c$!iL#$HX'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,#al'TP!$7W!$B$a<㎚`<@!$TL <@!$Ll' <$8%% {  TLH!$7W!$B$Ll'|'!$7W!$B$4%<$84p!#T$$Pl'!$7W!$B$c$!iL#$HX'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,#al'TP!$7W!$B$a<㎞`<@!$TL <@!$Ll' <$8%% {  %{  % {  %{  += % ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h${8 P!!(8TX \H4D,' h${8 P!!(4TX \@0<,' h${8 (84P!TX \,' h${8 (,  !8 l$pL'lpL'l$pL'+= % 'dwlx+"`$ aph! $%8L'%!$7W!$B$t+ 'ap!e#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `, ad$dxttxl|+0$8ph!8$%PL'%X%!$7W!$B$!+8D40p!h#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `,ad$d|0l+ "L$(ph!($%@L'%H%!$7W!$B$4+((50p!#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `,aCc$C40`'%{  {  % %{  %%{  %{  {  += % '\X#de(/(@(!($ 0fp $#0$8 ,$ 8PLD')$,!$7W!$B$!(0'@'!$7W!$B$!%% $*H( $@c &`L@k T %P&PjY @n %X&Xa &PLc @l %`&PL@d &Xl$Hi*P#@#H#+P;@!H$ $XHq!,+$%`0'!$7W!$B$a+X,%`H*q!(<鎰  <@B$, <@!$(0' (X$L  $P% % {  %{  += % 'hd#a,d$0/!($C((TBX\ `l : (%$d,0l`\XT'($% !$7W!$B$8<'L'!$7W!$B$  : $d$d\l`XT;+@"@!@ $P!q!PK%%`<'%h% !$7W!$B$a+X )`$@(q!8<莻4<@B$ <@!$8<' 8l$`XT4\dP'%% {  {  += % '|H@<!$7W!$B$!@`'p'!$7W!$B$!|8@H*%*XD`+%*`dP!H#!%+`' $hq%!.$`'!$7W!$B$!%+H' 480(%!#$L'!$7W!$B$aÌ'`'p'!$7W!$B$'L'\'!$7W!$B$% `, a|08|04!+@'i$Hq!H)$`'!$7W!$B$!!C+X'U`D8q!@#$<L'!$7W!$B$aÌ'`'p'!$7W!$B$'L'\'!$7W!$B$% `,#a`'HD!$7W!$B$a!8 $<4CB$%%%{  {  %   += % ' " 'C'"  $(, 0 48' += % ' "'C'"8  +A1`##$#!#AC$!$ %c% $+( 8 d$0 $+ c$c0$+`%%$<7SB$$( '   += % ' "$'C'"$ !(48 < @DH '+= % ' "$'C'"$"! B(, 0 @48< '+= % ' "$'C'", !048 <@DH '+= % ' "$'C'"$" B !(, @048< '+= % ' "$'C'"$ !(,  048< ' += % ' "('C'"(# ! (",!(B,0 4 @ <@!8%<+(?!0!(@8<@$' += % ' "'C'" ' += % ' "'C'" ' += % ' "('C'"( "!, 08  48<@$' += % ' "'C'" "+ b!!""! B @ '%{   += % ' "'C'" ! ' += % ' "'C'" "+ b!!""!B @  '%{   += % ' "'C'" "+ b!!""!B @ '%{   += % ' "'C'" ! ' += % ' "'C'" "+ b!!""!B @  '%{   += % ' ",'C'", ! $ <@yB$ $<!$$ ' $J 04(' += % ' "'C'" LP Kw H"CD$E+0d8 $0$+(A7,F$#8D# d$# '$$!%$+@f@<X8  s!8  C83`C8`C8` Hl  $($ Hl R $($  Hl . $($$+bL`C83`C8`C8` Hl 6 $($ Hl  $($ Hl U $($$+b4`B8@ Hl w $(,% %%% Hl ( $($mC8V`C8=`pt <5B$pt<!$$p' $J <\  ): $+f`8`B8`B8`B8`B8`EC% $   l $+8E  )A  $+f`8`B%(#8`B%( 8`B%( 8`B%( 8`CE% 8`B%( $ `  l $ 8?  );  8`8m`CBATJ  h''!$ !$h'$ f$$@$  $( -d  l $8  ) 8{  w480  ):  $+& 8 A%"8 A% 8G A% 8 A%  8 AB 82 A% %A+o  8(  )$  8 8 ABATJ   N  !8o 8 琛,H80GH  xLH|,0 9 F $*HI 0*9@1*9B@F)9 T*99@f*9w@t)93 w 93 T*9 @Rk9 `Uk9`Ek9` @rJ9 @uJ9@eJ9@t)9S r)9O u)9K e)9G %8%@ $ 9? F*9@Ak9 `Lk9 `Sk9`Ek9&`@aJ9 @lJ9 @sJ9@eJ9@f)9 a)9 l)9 s)9 e)9 %8%@%HS%8%@@$  d@$   d%#$+# %8%@< < !$  $" "0B8@%lh lh  p  <"0 !0 B4  <c$ p$k A9# <"0 !0 B4  <c$ h$k Nd0  %C(,0 $( T0 `d0 7XT $(  \W "$ #$`' '!$ !$A''!$ !$A 7~'M 8T''!$ !$A "<@\"_  \#"48"<#4! <`V$8 6 ($-@$+8 $ <$!$H<@!$L$P4 8'B8*@"dB8&@"oB8"@"tB8@"eB8@"nB8@!v!8 <`!$H<@!$L$P4 8'HLP4 8'"!HL$P4 8'w 8'+= % ' " 'C'"8 '+= % 'P CD}EzDCF`4C`%%% Q( < < <0B, i B$+ " $<!$g  D$ ! d(<,_  ,&%% %%P < < <0E4B i  P%(0'H'!$ !$F GB048<@D$H< B$0'$ P<@τ$  TX\`L'c  TX\`L'+= % 'D !@CBH J < 48@" #!  <B$48<!$$4' $J $(,0@4d0c$(,0<@!$$'$ LP<0B$TX<'"!LPTX<' LPTX<'+= % '`",48<@<B$4<0B$8" #!  <B$<@,<<!$<@!$  $8YAi!8 Cnc8 `Ctc8 `C1c8`C6c8%` Cnc8 `Ctc8 `C3c8`C2c8` An!8 At!8 A6!8 A4!8 !X   <B$  <@B$l'!8  $8YAi!8 Cnc8 `Ctc8 `C1c8`C6c8%` Cnc8 `Ctc8 `C3c8`C2c8` An!8 At!8 A6!8 A4!8 !T   <B$  <@B$l'!8   8<$' !(A8<$'+= % '! $   $'+= % '$7/     8<$'(7 CB / 8<$'+= % '7/   $   $'+= % '$7/   <B$ (,048 '+= % '<!$  ,04 <B$>  8<$'(7 CB / 8<$'+= % '7/   $ `  $'+= % '5 < !% #$" "$"$ !$"$ $"$ $"$ $"$ $"< <_  "!< '+= % '0'@'!$ !$A/ '''!$7W!$B$a0''('!$7W!$B$a0''!$7W!$B$a,'+= % ',_  ('+= % '','<'!$7W!$B$a ('+= % '','<'!$7W!$B$a ('+= % ' $*AS@"8%@"nB8@"aB8@"nB8@"oB8@!s!8 7<@"[  " ('+= % ' M ,0 '+= % '$(gO  A $+## a8 @ B$L P$T(X,H4D0\'8'<$9@ $%6D860D8P8A8 N8 I8C8d8p8a8n8i8 c8$%$0%(_8  $*aT`: !8K AW$*a" AI#8 `CNc8 `CFc8`COc8"`W!83 AA!8/ AR!8+ AN!8& %Ai#8`Cnc8 `Cfc8 `Coc8`, w!8 Aa!8  Ar!8 An!8 $,A#8`AP$*aW`E$*a* AD#8`CEc8 `CBc8 `CUc8`CGc8W`E!8 AR!8 AR!8 AO!8 AR!8\ AF#8`CAc8 `CTc8 `CAc8`CLc8_`P!8 AA!8 AN!8 AI!8 AC!8d e$*a2 Ad#8`Cec8`Cbc8`Cuc8 `Cgc8`$,Ae!8 Ar!8{ Ar!8w Ao!8s Ar!8o $,AgAf#8`Cac8`Ctc8`Cac8 `Clc8`$,ANp!8N Aa!8J An!8F Ai!8B Ac!8> $,A6!86 AD#8`CPc8`CAc8 `CNc8 `CIc8`CCc8`d!8 Ap!8 Aa!8 An!8 Ai!8 Ac!8 $,A$% <@(' $048  <B$ $ ("<@0"_  0#"#!#i  x| $"<@,o"_  ,#"g'+= % '!$ $~ 7<@"[  "<4+ << 6& wY<$& $ ''!$ !$a $/|''!$ !$| $'|'!$7W!$B$|''!$ !$|$'|'!$7W!$B$''!$7W!$B$a''!$7W!$B$a'><6& w <$&($ CB|''!$ !$|$ <c$'|''!$7W!$B$a'|'!$7W!$B$a'A<6& w8<@$& $Z "#!  %|''!$ !$a|$<`!$'|'!$7W!$B$a'|'!$7W!$B$a'E!$ '$ <B$8<@D('0`Ctc8,`Cdc8(`Coc8$`Cuc8 `Ctc8` $<!$ '$ <B$8<@D('0, vÎ $ $ `<$8<@D('+= % ',0 c  Cc$c0$+`$?0<%!8+H !H%'$0!0+@ -d LP<'%%{  %%{   += % '8'L'!$ !$A33'$ F :@3N?0<%!8+H !H%'$0!0+@ -d l'%%{  %%{    += % '<'P'!$ !$8'3'!$ !$3$+(b$' F %<'% '3'!$7W!$B$<''!$7W!$B$TX4'  !$+A@"8 @!8 !$$ "8@!8 !$0$4('C8)`B8@< DB$ < B$!A$<;!$$ ' $J 04('<]!$0$4('?0<%!8+HC !H"'G$0! +@  -d %%{  %%{    += % ' " 'C'"  #$'!$7W!$B$a$' += % ' "'C'" %$C'!$7W!$B$.'C'W'!$7W!$B$B7'C'!$7W!$B$-$+(bb@ $+(87,$(`'|'!$ !$ $+(L`' X\?0<%!8+H !H%'$0!0+@  -d %%{  %%{     += % ' "'C'"/ !$+A@"8@$<>B$!8  $!$$,' $J hl\'${  += % ''`b a+("6e8&p!L%$ '!$7W!$B$b a+("#e8&p!L%$!$ !$ e$ eg&( `  ab&A $a$ a\'{  {  <!$@*Hf %X&0 P$aq   ,P$ `e`P$ba+ " d('p!4''!$7W!$B$d$de& `a b&A $a('{  % %  %  %%  += % 'w &0M  *@#0#8!0cw &g,`  *8e#e#(e!$*` !@c$b+" ` !A '{   <!$C,7`#$$p!CCD& & %`CDL!@H+?! !CC D@!@H+?! ! C EF@C CLCC  $'%${  %$  += % ',(A0CD D  <M LM O L H$,$ d L$"L<H"pL!"LOO `?<M D04$ d OO ><M DM O  $#D8CpD!"DP<L / T8D / $"40!d+(d!(C0LB/%D#$ !$T / TDL / X'X'+= % '"@'"$!$ /  / '+= % ' "$#$#$ !$<!4 / <!4 / <!4 /  / '&"* "+8c,$8% (*A+$C%A  &"* " +8c,$8% *A+$C%A $$$$$$$$$+A & C*(b,&8$0%(&8 +@(*(,9$0%($*C$$%" $$$$+= % ' $(,48 <@B$ $<@ <@B$(,<[!$$ ' $J DH0'+= % '"d&D"@b%&E@"e&@!b K   ! CB K % '+= % ' "<'C'"<3 "#$ # !(,04 <@B$(,$  <@B$04<[!$$(' $J @D8' "d%& e&E%D0@"d&D $ e& %'@b$&Dd%& %@b$&Dd%& %@ b $&D$d$%& % @(b($&,c,!&#%A!,  "d&B80@"d&D d %& %'@"d&$e& %@b$&Dd%& %@ b $&D$d$%& % @(b($&,c,!&#%A!,  += % '",+d,8$ %$d,$$" a$   ' '+= % ',$+A0d,B8$Dj@$+AB8$D2@$+AB8$D@%a B$7$ $ B$A$ $ 7<6&`SB$E$ $ m5'%@%!$7W!$B$aR% $*"z@$+P@lSh $ #0#H)O $H)!8*H %0&P' @$   , $+0a !"!+"!a <$@('<$@('<@('%  %  %   %(  = W `+(## C#b$C!b W  + A#A#8&?$8G+HD&P+@J-$PI#!0%8 l~$+XH` $. $*`h  ''!$ !$A' $$ $<@!$g  ~% %P  $ %` !`, $+x-9$x$+1:$0 %Z9<$++,$%0*[+(dU$*I%i'}'!$ !$!}0*`%%% i'&F`   $~ $ $$$}'P$%%%i'!$7W!$B$!  #$#t#t!0$>9%-98%h< !$ "(@& C $   $#(/0!<_  "&"$$ $ $$$%0=>% $+-R:$Pa 9%%H $)% $$%=> 9%h79 ^   ~| #($/$(%##!0%$ $ $$$=>j$+1:$09%9%hY $+p+,$p%pH+(dB$*p6%pT'h'!$ !$h0*@%%% T'&&@   $~ $ $ $$h'e$%%%T'!$7W!$B$ #c$a#S#s!0$$= $9$++,$%0r<7!$ @+ b$*(%(?'S'!$ !$SG0*@G%%%?'&H    $S'('%8?'!$7W!$B$%('<'!$7W!$B$~ #$#G#g!<|nj_  %'|Ŭ% $ $ $$$%0=> 9%5<6&%/d$ $1, #(/$(#D#d!0$$%=>O `  ~ #($/$(%##!0%$ $ $$$=># < <$ '$' $J  ' 'gT %@ L %8'hR %8GN %@(5%0<%''!$ !$!''!$ !$'%8'!$7W!$B$!< @?$+%+,$#%" <@B!40T bp0!"$a@DHL <B$@D<@`!$H<0!$LǠ &$L0$D$'!$7W!$B$+@f $$+A* e,$%D@%>$*`d,%,$ %@%$$" bp !A(CD4!(+ 8!+(!%&(#*#,$%# $ A%@*B,<,8$%C@ !%D$'$D$'+= % '|@x@!.%E N$D@(pD!(<$<@$ $ $@(,04S 8Hpt  X  T$  P<!$$  h@$\d$h`<0!$ ?$">8"<@XTP c  X"T#P$"#$hd\` $#"< @Hs  %"#H $&'(%"#  ,!PddhcTX \` $.( 8!8 P"@!B\`  @PP<0C4D'('0`%( c$\&0c,!`&d%`r`\0E4DC`(E,DCD$E+0d $<)!$g << _  "!P%(%% D$!<@d_  @%$e1 `3 ` ``$Cc$$C.@"@ܩ PTX  L'$"@TX  L'<!$<о!$j <!$<о!$j P"!B<[!$$ $ @<40`&(d*0d\+@G,$(%(04<@!$ 0"$0+A/D4 4/!"4   ! LC&#`4A+CdD%&`8D+D%a$D$!dD$!dD& <C  $\"pc$! fg &0 &8X %0c3f1p8%8%P!!7(!$/ " #+( &8F*@,$(%(%0%  $\X%8%Pp lm%p no&*`+h.$h%`zabc##+ #d   "! B @X !7!$/ !78 D !$/ 4 @  @C < $B"@Pd\eLeTfB\g`hXcLP  $(, @pM P"<&T!H&%AC a7(!$/ " #+( &8F*@,$(%(%0%  C$# d#(+d# j !  $AT#aCp!AT!C!+b!" , Da  $Ap@b D`P`T`< LaXb_  !"L`\```X`$a a b @b!  ddhe$H%0T''!$ !$S<8!$TH'XL\ `(dh0l4ptx|"(#<,$@!D%(B$$*0F8PT!e+C!d!b T'  DP<@8H!8 $H'$ <!$<Ⱦ!$j p'+" % 'ÎdŎƎǎȎ ɒ$ʎˎ ̎(͎,Ύ0ώ$p8Td&*1.Ps+t$5%2  X\*`8<H25&+`*0.$`%0"#0t#`+f#`vx&$*ș/+$%< &!<&*/9+4$?%ș 3$w $$q ! - <@!$   n@C <0$Bd"h#%C9@$"6@"B$""B$""@$""@$"3 '  , !8ddhc _ @4*7A@8"! B @1   8!ddhc  $'+= % '>  4! '+= % '%C8`"B8@" !$!0$+Am "$C`CD%(A%$$-`  2"@,"(#d+0h&@*H-$0%0&#d#+#Ch2 f $ ' '<!$%0GHB%8HD%8HF%8HIJ %@ IL %@(IN %@(IJR %H*JT %HIJV %HIJKZ %PKK\ %PjK^ %Pjlptx|%l''!$7W!$B$de*% e,% e.% ef2%(f4%(f6%(f g:%0 g<%0 c%$Ĭ(Ŭ,ì'3&u>?3&u? ss& s8!34!<b&Da&|xt@H@S(p`@3(m`HDP@<L apah iJ %@  iL %@( iN j kZ %PKk\ %PKk^ lmj %`ml %`mn noz%po|%po~pq%q%0qrs%Ss%rctu%u%uvx%x%xy |%< |%ș |  a %a %s% %(%0 %8K%@%H%P0%r%X%`%h<%p%pa%%q?%%q@%rA%rB%rC%r!%!F+%!t! +h!(m$hF%F'$Q%h-o !0+h!8%p%@% X h L PX d |L PX ` xD HX \ tD HX X pD HX %"`%` CDE FGH'<!$c$X'$ <>$ _ `$'7   $'   '+" % ``' P84/ '''!$7W!$B$a<'''!$7W!$B$a@<<$7`@@'%@  !$%<6! w+!#DH;<c4d0,ap,!a?<6$W0! b+=!$T'$ <>B$ _ $'7   $''+" % 88'g W  R |<>!$ | <@B$ʵ ,+ $ `de*0,*@;<6+H)9$8%8%0%%&tx;<!4 d ;<c4at(#(+ bp!fx##da!$C$$,;<6!(!% w<6!(7F$w<6+8!0''!$ !$ <ȳ㎘''!$7W!$B$<@?c$ eb$< <@!$' ''!$7W!$B$ f e<e_  '%gh$ $*@_'s'!$ !$s0*P@%( _'&P @   $s',e$5'_'!$7W!$B$%5'I'!$7W!$B$0,*0xJ'^'!$ !$^0*@%(J'&@   ^'Ad$5'J'!$7W!$B$%5'I'!$7W!$B$ $$$aDp!"(a' <@B$4\D `@ $ ( ,4ptx3T X'4ptx3T X'(ptx3T X'%   w X'+= % ' "'C'"ŽW<@B$ 3 '+= % ' !(  7<@`Td"#$o  d%"`" #T#$%"#<@!$ "<@PL\ k  "P#$L %\&"#($%,&<}!$ Oz ''!$7W!$B$a<   h"$dg  %$# "$eh#kN l!  <  @"D!(B @ <l!$ [ 7<@"#$o  %"" ##$%"#<@!$ "<@ k  "#$ %&"#($%,&<}!$ Oz ''!$7W!$B$a<  h"$dc  $#"$`h#  < g  #!" %kN @"D!(B @ <l!$ ['!$7W!$B$a $C pc<}$t x{ xt%d`l'pVD  l'l'+= % 'tde%A%*@%@A!@ %0'%P%!$7W!$B$!40&X*@+Hk-$Hi%@  $' @jP'l'!$ !$PTX'x''!$7W!$B$de c<3$ P'$  (,$tì Ĭ<`_  %!Ŭp''+" % dd'"!B @$ %G'% ''!$7W!$B$2'G'['!$7W!$B$7`"# !<}$b$ B,!AOz 2'F'!$7W!$B$a!G'% 2'!$7W!$B$a\''!$ !$A!$ `<`!$ <@``C_  !#A<`!$ <@ `  (C`g  !%$ #(D<Ah"i!''!$ !$a< c$$wd$a$'!$7W!$B$1d$a$'!$7W!$B$cB$,$ $ `p'k%*`h ` !`&`L $oa@d`\pLHh0D<@!$ ld@D  <}B$lb<@b_  !"at"!B< $!$=$ $ @t",@' '!$ !$Ap\`hHLd@D <@B$'$ tCBc<B$ `t<"CB@d9#.`t''!$ !$?%@%% %0%8%H %X=?>@@HD|<xL$ @- $  |+Ao`x#0%7$0$+@9,$@ +Pk,k9$Xi%Xj#A#!($0h$>$+@9$@ k,k9$Xi%Xj$@h>$k8%Xd ` $+`c9$`m,9$h%h$` $? $|x?>m,9$h%P $+p9$H$HI i8%H$ i8%H$ 8ƌ  / ,e (|+A`x# #'$ $$#A|#ax!HD<? P' $ % @+ =>?  "[  >?'''      += % 'T"!X \8 X "^$ ' $J DH8'DH8' $(,<7!$<G <7B$ $4G <7B$(,<!$8$ ' $J DH8'+= % '"<#dc#$HEDF+8*@,$8'%8 &8,*@+H$8'%8%(%0&%<#`d\c%&?!8+(!(C0&@*H-B8/%(+8$8%8'%0%(|%&`!)H |("Lb0b4c$B$! @l!7| C$B(!$ / h!|CB zB |"@dcD$%Q'!$7W!$B$'Q'`'!$7W!$B$a@L |L#6`dDe$0c$Q'%0%!$7W!$B$LÌwTe$Ea$A'!$7W!$B$$ 'Q'e'!$7W!$B$a%'A'P'!$7W!$B$aI |0",!C,* +($(% *(@&,$%e$`%$lp<"l#tdBf"x!h!$ T'+" % '0C`Cc$ $*a`C*`L'('!$ !$apt$$x <ѯB$$$(%04%d<䎠''!$ !$ C@'T'!$ !$@''!$7W!$B$T'@'!$7W!$B$X'@'!$7W!$B$@'X'h'!$7W!$B$a?$0'8%0%8,n$'%!$7W!$B$a'''!$7W!$B$a\d ''$'!$7W!$B$aX'''!$7W!$B$a c@'T'!$ !$@'X'h'!$7W!$B$T'@'!$7W!$B$X'@'!$7W!$B$@'X'h'!$7W!$B$a;:6<L%0&D%8=J%0&F%84>%0<''!$ !$! FP'd'!$ !$P''!$7W!$B$!d'P'!$7W!$B$'P'!$7W!$B$P'''!$7W!$B$<`&0'''!$7W!$B$)% *)@!P'J@P )9L  )9H  $F+= % 'H"# $!(+'!!b@$+e* F,$f%O`Dd'a& A*",c+e$b%" < r!$  $ " 5$"<B$"<@B$LP@'LP@'d&0D*8,h+H$0&%0%%(eb" $%&! s $LP@',048 <@B$,0<@!$4%F8'A8 'L8 'S8'E8&&a8 &l8 &s8&e8f8%a8%l8 %s8 %e8%%;5` $+(87,$(%'8'!$ !$ $+(b' @8+8D2$a#8#Dd #D$D!"<@_  !"a b! &d!E+!" a&A&D%A  a$ at't'%  %(%  %  %(%  $!$&('@'H%@(0l@<8 4< !$ h@"<"| # 8@#(d+04<#H+Pe#H*&P"*X"J-$0F%0f%H%(%0%*P ,%0FG!+0D!P(x,l!PF{@+Pu@oj$f#@#PDh #PG$ 0Q! p!PF<_  $,DL!pN!H,+ ! D&n& % `$D$GD G$$c,b8%% l%( yt'"@(b4a8d$+ A,d$f#8$#A(b#,b$A!&<@$b_  !"$a$4a$8a0`t'  %(  %  %(%  %  %( %  += % '4%C8C`C80`B8@,!70 8<('< B$ < B$!A$<!$:$ ' $J 8<(',!70 8<(',!70 8<('+= % 'H%C8`C8C`B8@D!<"#!< }$ y  % %%#"(<dec$"8! < }!$ { <"#(!(%$!f+!C" 8LPT@'D!<"#!< }$ y  % %%#"(<dec$"8! < }!$ { <"#(!(%$!f+!C" 8LPT@'D!4"#!< }$ y  % %%#"(4dec$"8! < }!$ { 4"#(!(%$!f+!b" 8LPT@'< B$,< B$!A0<!$:$,' $J  <B$j += % '0%C8)`,!"@B%@$"%%< r!$  $ " A$"<,!A"!,b0ad# D+De#%#"$+D* B8!,$"% a7!$/ 4"!$!C8+(8+b p!!a!"<&"*"b,$%"@0'${  += % '84d0d$a$0'!$7W!$B$'%Aabd! + e!!A! D+!"B'%C<d@d ba$HH )%!H*&XE`$@ @\4$1`8  |dxDEHB lpt#HI+PI  #+#*$(,0 L4@8<DHPx|lpt!A!+A!ad'l'!$7W!$B$'l'!$7W!$B$'B$|*CC`x!!d< $d"e<6&0 < $& <$Z< 6&( <$& < $<$<$X$XA$  6@|$xXnj+@dh` $<!$g  x`h|$!b` t$ "  "$!B @ `$6 '''!$7W!$B$a<"@! B$ @%$# b+(d#( %@'''!$7W!$B$Ax'('H'!$7W!$B$a&`E+ $*(E-$ % ! (#(d+e+ ! # #%(%'''!$7W!$B$W !@ !0+X!0#h +`+(+0 !0F!0!0!f!e##l$  #(+ $ ,##dc$c$ `!dx''!$ !$ & <$ *r'('!$ !$,04't '%(''!$7W!$B$ $(,-0'('H'!$7W!$B$ TX\`d$h$lp{ x't''!$7W!$B$('x''!$7W!$B$ pt2? p'('l'!$7W!$B$t,04'$XIX k%!X l&hJ% a'E'!$ !$A>'$ F hCD$E+0d $<`!$g h< _  "%% %(hD$!>'% %E'!$7W!$B$ f~a$bB$$ f$b#B0!"<@b_  !"a h!G'C 'E'!$7W!$B$ah !'%)'='!$7W!$B$< !$lǐ$<Ǡ$ ;ǐ$<Ǡ$%8%&(0,%% $T1 %&(,0D$Œ!Ì Č %&(,0D Œ!Ì Č d&=dPdLeXf&8* ,Tg+(8$(% Ddx%% DaHbw l'$;a@aeR=ePeLfXg&@*(-Th+08$0%(BDde0hf4%8@%@!'d=dPdLeXf&8* ,Tg+(8$(% Ddddd4he8%0H%'a $%8Da $%1$>a;b@=b@%&9a<9!$  C D#$$#( # <`@C_  !#@A\A'C $ $<d%d e' ?<6&(% %>d<a$ ;d<a$%d$w$ T1  @ab!d e d$<d$ ;d$<d$% $ e$w$ T1 $,lapb ! ,"#B$ ! @ $<@('+= % '8" #4lp$&!!8",+!#!A( <@ S 8"@,4b( b4>b>@<`l!$ [<@B$"<@8[  8""4cDEFG B s  $DH0'4\!('C DH0'DH0' DH0'+= % '%$,% w7% dD0 ,04 8 ,<d% d e' ?<6&(% % >d$<d$ ;d$<d$% $ e$w$ T1 $, ab!d c $<@('+= % '(D"@l"p!$B,dc $04 @q ,"#( =@TX%b @"#X&0E*E,T+f$e%b@"#TXPLX&0*,T+fc8$e%b @lp ! ,(=5@>,@$=<9!$ (C D#$,d c$ #$#<`@C_  !#@A\A$'C 8<$'8<$'8<$' 8<$'8<$'+= % ',@DHLPQ%$4% w7% dD0 4X<!$$($',$9a :bW@% 9`<!$ 4C D#$@Cd c$ #:BHL@ !"$!!@ <& b*b8+a,$a%A!  dT abB$$db#B0!"<@ b_  !" aD$H,'DH,'DH,' d$abB$$db#B0!"<@b_  !"a`+X7`*%+P@ $< !$g  \T@0,P %P !Pj<`K_  )+Ih('<@"_  #"#%.% %  %( % %  <!$$ $ @" @''!$ !$a<ѯB$$B$$$  "%@'('!$ !$a 7<@\"_  \#"#$h$' $c','d'!$7W!$B$ `$h$''+" % 'h@B'$'!$ !$a<|c$' plh%%( <8' plh8<r$%@'%H%!$7W!$B$ƌnj ʌ&X*`+hjk-$X%Xl`% &+E*0!,$A% %8 %PD4njƌX@<|B$'  h"! B @. <@!$ <7!$'G <7B$b<d_  !$ah"!BH% !  H" !B  @"(@$#'& b   H" !B @d'#'2'!$7W!$B$a3@ D'%%  w D'+= % ' "'C'""W$7B$@T1 '<,!$$$$<@+= % 'H''!$ !$A<B$3 <c$& Ck $ $ #d,`<$"Ddc%!   3`80('B$"<@ _  "#"#( B, @ g  !  CD` .`N B@I G@<8<<!<_B$)$  5<8<<!<\ B$$  #<8<<!%F8'A8 'L8 'S8'E8&&a8 &l8 &s8&e8f8%a8%l8 %s8 %e8%%;5` $+(87,$(%'4'!$ !$ $+(k' <!$$ K  !"<c$&b@%  !<B$  %('(''+" %  '''!$ !$A'8 @'''!$7W!$B$a'%%% 'c$!$%(%% A%(!e$0 $+0  $ p..! '%(% %E,('!(D$(%'%${  += % '<@!$ %F8'A8 'L8 'S8'E8&&a8 &l8 &s8&e8f8%a8%l8 %s8 %e8%%;5` $+(87,$(%'4'!$ !$ $+(1' < < B$"<@"_  #"#h"W$7B$@T1 <@!$$ $ $ @07 P"<@T"_  T#"#<@!$  <7!$8'G <7B$ b<@b_  !"a4"!B 4"<@8"_  8#"#"W$7B$@T1 '+= % '78"$8#$% $%0W%0FD0 D!<`|B$ '  "W$7B$@T1 '+= % '0p878"$%$%(Ww%(E8!$D0 8Z h"<`l#_  l$#$8@!< |B$Q' > h"<@l"_  l#"#<^!$ Z 8d<He_  H&%7$!$ T1 <@!$ Ldhl  <`B$Lb<@b_  !"a`"!B$#<`#$_  #$  $DaH('"$#<`#$_  #$  $DaH(',!0B4 8<@Dx <@00C_  !#A),!0B4 8<@Dx <@00C_  !#AH(',#wC`c%D% ..66*(%c$C #wD%(Fǀ%8#(..$*8Ew`c%%(#e%!a!M} <@00C_  !#A,!} H('!} H('(EwÌ`c%Č% #d%!`!} <@00C_  !#A,!M} H('!M} H('H('%b@bd ef&"$ %,B!def c Dx <@00C_  !#A$Da+= % ',"/@0B!  ,"" "<@"_  #"#0$CZ<|$ $" @8a' '$} ,"# !48<('+= % 'wĎ+(" !Abde c"$% #$ '{  += % '$! %(B, 048~  < '< '+= % ''0!,B4 8<@''y{ <@,,C_  !#A' A!$A@ @< A[  !@D('+= % '0< ,Ž#$ %!48< @ @$6 $!,!0B4 8<@Dy{ <@00C_  !#A240A8A<A@ AD H(',!0B4 8<@Dy{ <@00C_  !#A,7A !%C`c%&&..* %!$A 7A #%D%(#e$*(Oa(e  48< @ $)  0J0!,B} <@00C_  !#A,!M} H(',!0M} H('Ž#$% !48< @ @$,  0H('0!,BM} <@00C_  !#A,!} H(',!0} H('$DA>*0%c$#7A !%C`c%&&..* %!$A'+= % '"C< $Eg  !%# $A# %%(`c%66>>*0%($#7A !%C`c%&&..* %!$A'+= % '<"#$ !@$ DHLP $ <! @BD HLPT} y!<!s @BD HLPT} a<"@@!D HLPT} <TCD$E& '()+Pd&@40,(@T! $g T< _  "!<0,4(%(%% D$!hif g! @cD HLP} 8'+= % '0,CDE B48< @ $!,! %-0B4 8<@~  ,! %0B4 8<@~ ,D('+= % 'dl78 Z<4!$\l`\'d$tH"<`xL#_  x$#L$"'T'!$ !$aptc' !pV$Btx @'  l "$#B$c$`DXw lX$ ( <@ "[  " d h'w h'+= % ' " 'C'"8 '+= % 'T78 T!%'L'!$ !$aXd!' !XV$B @'  T8 P'+= % 'T78 T!%'L'!$ !$aXX!' !XŽ\` @'  T8 P'+= % '$78 Z<|!$$'$8"0& b*b,4%,+(8$ %D@4&8#< ,"0$$%8!+8GB$+0B,G/(%(! ! $!& b*b,$%C@(B $(W$"@0",#8$&(*,4%+$d%b@ !!'C  ' 'w '+= % ' " 'C'"8 '+= % '<#TXD78 Z<!$,D0,'<$#!HHBL Py B 48LP -+8D0D < $2 >",@ -d PTD'>${   += % '@ " <c$d& % D% %$+ "ud$$+ "la!$# '0! $B$ c  "$0+ bQ4#(#0a$$#(/$(E( ,!(%*P@%@&P@    04( ,!($+0a(##ec$B$#$"!)* C%& a     !E!$8$'$8$'%  %%  %{  {  %{  {  += % '<!$ 4< !$ D"H"<@@[  @"8"< B$<8'!$ <@!$% $+8A&Ġ$<% $+8AĠ".% $+(AĠ$+ Aà$@('%{  %{  %{  %{  %{  %{  %{  %%{  $ <B$ $<߉!$$ ' $J  <B$j %{  %{  %{  %%{  %{  %%{  %%{  += % '4'D'!$ !$a0wd "" "$$=C(`<@ <M_  !" <M,'+= % '< !$ < B$'+= % '8#LPTX < !$3 < B$&"Q` $  [$"$"<@"_  #"#M <`B$!$ $~ N$" c#,+ f8,$0% WR` $ <@$!%&' !DHLPTX\`d0' DHLP8T<X@\0!@E+Hh +Hz #HO $HI!H8*J9 @+k9`+k9`$  @%8%8$ <..+0M <(0!(,A !('08%+("5!&%& 0"8@!8" <@!$ 4"<@0[  0""$ "@g8%8O P'd'!$ !$a PTLX\<`H$`<@$dp'P'!$7W!$B$a$+H# ,< $<@!$g X< _  "!<0X%8%@,@$1!0¬ Ĭ< njȌg  !'# (ì@&:8G0F < !$D~ "#c$$+(C8 $<!$g 8< _  "!%% #a$!0"<@@o"_  @#"gHL <B$HL %@X $+H()9WJ-$HI ''!$ !$!$+Hr ' <!$  ,hX' '!$ !$a< .c$' X%%h%% ,0%H $$%@% 0 <+ Q $(,0LHp`4!"!,' < !$$tXjb $P*A`L l K  LP#(d/$(el!#P% l%@#/e8E8 *c8`4%(%0[4" B2@ <B$4!" ! <B$<̓!$-$' $J PTX\`,' <B$<,H!$$' $J PTX\`,'%(%0lP''!$ !$a< .c$' ' @7CB@% $!'('!$ !$A\<vB$Xt4+ Pl@<D H$8(\`\"T@="?@$"!e(:(% &+8( ADDh#d$ <<ӄ$' 5 @"@x@="_@!< .B$<ݬ!$ $U} O 4"8! $  !0<ݬ!$$0F |<@!$ "<@0[  0"x"< !$| ~ $""<@x"_  x#"#C& % $ E: 9 '$ E: $ 9 ''!$ F  4a< 8a_  "!8b'+= % 'p/|"@CB%%v D8|de<<$<@$<`;B$<@B$ < B$&" %@ 6 D8 @|C`D<<c$<@$x D8HL $@.W|de<<$<@$PAl \`dhld\\'0' $$,(  |"@!<<B$<@!$r t'P"@]<`-B$T "$XT'p$/@,@C)`!L<!$ <@L[  L""@VŽ%''!$ !$c!  4  " d&D-@"d&D(@"d&D#@"d&D@"d&B8@ " d&D@$"$d&B8 @%"%d&B8@&!&b&A!8% '"d&@b$&D @b$&@ b !&"!,  += % '"d& Dc!   !B&"!,% '+= % 'Q ! "d&D@"d&D@"d&D@!b&A!,%%''+= % ' "$'C'"$!\` d hlp '+= % ' "$'C'"$!!(, 0 48< '+= % ' "('C'"('`'p'!$7W!$B$a?  tx$''b$d''!$7W!$B$a?+= % ' "<'C'"<$'t''!$7W!$B$c'$'4'!$7W!$B$a  8'+= % ' "<'C'"<c$'@'P'!$7W!$B$c'$'4'!$7W!$B$a  TX8'+= % ' "<'C'"<$'t''!$7W!$B$c'$'4'!$7W!$B$a  8'+= % ' "<'C'"<c$'@'P'!$7W!$B$c'$'4'!$7W!$B$a  TX8'!(",!<@!!(",! += % ' "('C'"(`d +?  !hlptxy$''B"" "+?+= % ' " 'C'" !X\ ` dh'+= % ' " 'C'" !!$( , 04'+= % ' "'C'"!HX '+= % ' "'C'"!!X '+= % ' " 'C'" !X\ ` dh'+= % ' " 'C'" !!$( , 04'+= % ' ",'C'",!dh l   $ptx|('+= % ' ",'C'",!!04 8   $<@DHL('+= % ' "'C'"!LP  '+= % ' "'C'"!!  '+= % ' "'C'" !HL '+= % ' "'C'""! B @'+= % ' "'C'"!HL '+= % ' "'C'""!B @'+= % ' "'C'"!  HL'+= % ' "'C'""!B @ '+= % ' "('C'"(,,c'\'l'!$7W!$B$ ` pt$'+= % ' "('C'"(dc,','<'!$7W!$B$a  @D$'+= % ' "('C'"(,0c'\'l'!$7W!$B$ ` pt$'+= % ' "('C'"(dc0','<'!$7W!$B$a  @D$'+= % ' "('C'"(,4c'\'l'!$7W!$B$ ` pt$'+= % ' "('C'"(dc4','<'!$7W!$B$a  @D$'+= % ' "'C'"!"! B $ @'7'AA AA+= % ' "'C'"!"!8B @ '+= % ' "'C'" "!  ' += % ' "'C'" "!:  ' += % ' "$'C'"!$( ,0 48 '+= % ' "'C'"T"P#* +(F,$(% X! s '+= % ' "$'C'"$ $!! !8  f  0"B$" 4'  ,wg   "@$"$ #c$#"$4'4'{  '+" % HH'7#$0'!$7W!$B$aldhe$df+8 $$'("&< @"&g  %"( &%$'(|  0"#$%&'"#< @"#g  $"' #$%&'4<,'4`"\$$X%+0D $(t!(|x$+(b1x\A$+(")X!!T`\"$+b \$8,'8,'8,'8,'8,'  {   {   {  += % '.{ A o{ 5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ8!$+0"$!$!!8 $Ta $Ta$ ' ' '{  {  += % '.{ A o{ 5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ 8!$+0"$!$! !8 $Ta$Ta$ ' ' '{  {  += % 'hbpa+ "pdd$(p!0ƀ%8$*80"8@aI!8S a bd!Dd!c!b: '08#0A(!$+0"=$!!!8 bd!Dc!b ' 8!#0A(!$+0"$!! !8 bd!Dc!b$*A!8 ' ' '{  {  {  += % '"@"B,%@dd$",$"<@"[  "<҉B$" 'd0$@%$%&$08 $&&$$'$@d$%008 $$$% 08 8 &&$!@b@0B8@$$'$  1 ( '( '( '$( '#$   $" @#$ [  $( '( '( '+= % ' "%$*,`B0C8`B8_@"#$% 8dž $'"#$% 8q $'B0C8%`C8` B81@"#$  $'"#$  $'"#$% 8C $'<!$8" ?8 %x$S@8N]$+ [8]8 B`8&0$+89$$5%?$+,$+ #8;%%%,';! :';%x$?';]$+8 ['; ]'; {';}';$8'%%8 8$>0<&$ !#" "  <d$+ DDL<D$LP0H! "$#&'%8%%D/%, :4 $&HI)-%`%p.%x%H%@  :8 :5: $+ !@9):L$+Ȃ !;$+~`!cc8`DD4n 0$+e!@9'%@*2@ $*2J9@ $*2J9@ $ *2J9@ $%P!XE&Xbk-%hm%0 $ $c%H%@ _j$bbbb``````` @```@`@`` ```T@'%{  %{  %{  %{  %{  %{  %{  += % ' < @"#$%g  "#$ % $4C`8D0E#$<`#_  %#%@C`DD<E#$<`#_  %#%LC`PDHE#$<`#_  %#%XC`\DTE #$<`#_  %#%C% $* bc0d8Kc8`dC`hD`B .~ 4  $pC`@$DDlDtB ~   $('xC|DB q  ('('`CdDhB $.~ k ('c0d80dC`hD`B .~   $pCN`@$DHlDtB ~ = ('(' c80`dC`hD`B .~   $pC`@$DlDtB ~  ('('$('+= % '(d$ e* 6 & (a b+ "*d! $ b$$+(e! $ b!$+ "b!"$"(a!$(a$ ' '{  %{  {  += % '"A%# `#* C&C `# `f  #&C`f   ''#*b` $f '$" $#'+= % '4 $"@ $f  $8 '$$,*C@( 0'wg  8 '5""6$C" $8 '+= % ',*" $( 0'wg  4 '$ $4 '+= % '$" @ $f  $4 '$,*C@( 0'wg  4 ' $4 '+= % '< ,d $f  ,@(',$404,0$*("+("!(%0=$+8,$+8 $8j&,+e$0$+8_$0+8Z=8U[$+8 $0$+8K[8 F]8C_8@~8=0,9$+85A,Z$+8.a,z$+0 %_8"-80$708$008$)08$"% 8$'wg t @('``$@(' $4,0` $+0C !$!$%$f 0 C0 c,`0B$7B$,f  "0!0 B,@0!$7!$,f @('@('@('%{  {  += % '0 (d $f  0(<$'( 84,%%8(4,%%808 *H +H !H) *9S@?=@iHj*HI8 %+H !B B8/@A   0+"`,! a0$08$08$ 08$% !   'wg  0,$ *94@ *91@*9 @ %+XA`!PJJ9%@*9B@ %+`a!h9 %+x!pΑ9.@*%+Pu@!@9! '9 f D 0(4,  '5h 0 ($ A 2 0(4,  'wg  (`%%,% 0&<$'<$'<$'<$'<$'<$' ``a $a$<$'%%{  %% {  %%{  %% {  %% {  {  %%{  %%{  += % ''$('$ $   40,(8%%8 <$'4(8%8, *H +H@ !H) *9Y@EC H*HI> <I$*H 8 %+@"%!! !8/ A   0+"`,! a0$08$08$ 08$% !   'wg  0,$ *94@ *91@*9 @ %+XB`!PJJ9%@*9B@ %+`b!h9 %+x!pΑ9.@*%+P@!@9! '9 f Z 04,(  '5h F ($2 A M 04,(8 +8"g!!'!8 '$f 2 04,(  'wg  (`%%,% 0 <$'<$'<$'<$'<$'<$'<$''$'$   ( $<$'<$'{  %{  % {  %{  % {  % {  {  {  %{  += % '"$4'$ $  (%H0'(<* CC8@ "  4Ld<8 (<+ "8!($+(@8$+("8 $+08$$$(+8u!8 8 88 $+Hc !@98"$+P"T@!Xkk9 `$+hH!`9<@ `$+H3 !@9"8\8 8,eDRO iHj*HIJ HI$*0DA  (a$<+"`8! a 8 4\$f  <8(+ "! a0$08$08$ 08$% !( @('wg V <8 @('wg K <8,!,$$$<48$(+8!8琀00$090$090$ 090$%@%8 $< !(\$f :  $*AV`$* a$ $8 $84b$f 4a$f 40$f  $*( !8 4t$f 4n$f  !8 4v$f 4f$f \$* a5$*( %8 %8N4e$f 4r$f w"%8 \%864\$f h4"$f _$*(%8 %84_$f L4N$f C( %89) %8-$$$*(4*0 4u$f $4U$f $ 4x$f $B$ 4h4P$f 4L$f M <8%H0'H0'H0'H0'"$4'$   4 $H0'H0'!PJY?J1!8j)%*P(@!P&+XB`-H0'H0'$$ 4 @$ A,$ C"0!0 B, @0!$f 7!$f % {  %{  {  {  %{  % {  % {  % {  %{  %{  %%{  %{  %%{  {  += % ',W (d 8? 89 838 $+(ABe8-$8>+(A2f8 $+@&h9$*&+ d8$$$$D#0c$'   ,$($%$4 '$+0!0eƐ08 84 818 $+@!8g琅8%8-$+@!Hg))9 $+XA`!PjJJ9@ $+8!0fƐ8 $%+$$-$ '   $4 '4 '$+0Z!0eƐ08 84 818 $+@C!8g琅8%8($+@3!Hg))9 $+XA&`!PjJJ9@ $+0!e!!8 +$$$%%{  %%{  %% {  %%{  %%{  %%{  %%{  %%{  %% {  %%{  %%{  %%{  %%{  %{  %%{  %{  %{  %%{  += % '|$('$ $ ) (,0 45  (|  $( 40,$8$'8$'8$'0$(4, *@v+@!@ 94  91  9 $+P"u@!H))9% 91$+P"f@!Xkk9 `$+hZ!`9N@`$+@E!8琩8  '5h ! ($ A  0(4,  'wg  (`%8$'8$'8$'8$'%{  % {  % {  % {  % {  %{  += % '>$('$ $ ) (,0 45  (|  $( 0,$$8$'8$'8$'$%0, *@+@!@ 94  91  9 $+P"y@!H))9%  9- $+XBj`!`9 $+p^!h9 R`$+HI !8琩8   9%0A |  0+"`,! a 8$ 8,$,%(F +8o!8 8=$+8c!0Ɛ 84H*0/A =  0+"L`,! a0$08$08$ 08$% !  4 'wg  0,(%(:8$'8$'8$'8$'{  %{  %{  {   4 '5h  0,($ 8$'!0+8!8%@ 94  91  9 $+P"o@!H))9% 9@$+P"`@!Xkk9 `$+hT!`9,H@(`$+H? !@90$09$09$08$%84 #  (f  0(,x8$'%{  % {  % {  % {  % {  %{  %{  % {  % {  % {  % {  %{  += % ' 40,(%%40,( *@+@!@ 94  91  9 $+P$@!H))9% 92$+P$@!Xkk9 `$+h!`9@`$+@!8琩8  '5h I ($% A J 40,(#@ +8$Y!!#!8 #$f  $ ( $f !8 40,(  'wg  (`%$k8$'8$'8$'8$' f  ($8$'8$'%{  %%{  % %{  % %{  % %{  % %{  %%{  += % 'C*`C`$CCDC0A$< `   |t  /8|t  88y|t  |t  ' A D !  #d0 c0`4% %%|t  '<*!$$ $ $(,048<@DHLP '<U!$'$ <UB$j #@D0 $X' $J  <B$j 8  '+" % TT'"@ $$ d !,%($'%0`Cfc86`8Y$*`CYc8 `DE8DS8$&`Cec8"`Csc8`Cod8 Df8Df8 yc8 `Cec8 `Csc8`$%c8%%% %% "8@!@ 9&@$!H) )9 #H# )%$di# '$$ ! <g_  $'d# #@%$dh# '$$ ! <h_  $(d%@%0%@%(%%%%{  '+" % dd'g h $8 8 888I(E$+0Y($!( ,($+(bL(# $%'<@j!$ x4($|tpl,%p%x % `dX%H%P\T% %`%0 %X%(% %h%8J 4`dh0,@PHL@%<% %H%P''(E$+0($!( ,($+(b(%$''!$ !$a$$E FG(,0EFG48< E$F(GW<  $pB$0e!EEFB4d$ '!$h $$h< h[  (<'% h(e,f0b#$b<@b[  "<B$badgTD'TD'TD'%{  {    %{  {  {  <'+" % 'Hg  $8#$%HnjȌ%ȬŒ+@"0,(ŒH$#p!A!!8!,!$P Hg ~ #d8Ad8>d8; c88`H,"(#c$$$+(C $d8; c88`,"(#c$$$+(C $ $pB$0!EFB4# '!$$$< [  (<% (,0$<@[  "d8; c88`,"(#c$$$+(C $ #d8? c8<`,"(#c$$$+(C $8f g tw l''8"8\c #  pCpXb`a+ "qTd! -87?84:81,8.[8+]8({8%}8"#8&8*8!8|8>8'8 "8 %8@8`8cXb`a+ ".Td!(-8 &$+8!!0Ɛ 8 8Lf?8:8\c !$# !8p%%0 abd$e!$$e< e[  %<$ e(d,a0b+$a< a[  !"$,(p$!EE FB$'$$'< '[  '<2$ '(%,&0"$<@"_  #"#"#$"#$'$'$'%{  '+" % TT'd$ $'bh*H= biJ$%A%d''!$ !$ $dhlptx|'d'!$7W!$B$$' ] bA$+ "3 e! dde$+(#$'J%%8% @+XB`T $`Kq!`,$*   %&h% %  {  % {  '+" % HH'$bde$f+8 $ab!B<]c$ w `d''!$ !$$defghlpefgtx|'d'!$7W!$B$$' ] $''{  {  += % 'h"#$$ * t hbA$+ "td$(p$! B. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabdabdld'b+ "5ab!EB<]c$ w h `'`'!$ !$A'b @h$' ] $ld'ld'ld'{  {  '+" % HH'"#$$ *  bA$+ "d$(p$! B. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabddab'b+ "Qab!EB<]c$ w `a$a a   "#$%(p''!$ !$pt$x |('p'!$7W!$B$$(' ] $''{  {  '+" % TT' F  : $ AAAA "#$%(d''!$ !$dhlptx|'d'!$7W!$B$$' ] $''''+" % PP'bA$+ "d$0p$! C. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabdabd'b+ "lab!FB<]c$ w $d$dbA$+ "RacpB$!"!<]B$ w #+ b<"%  """ "#$%(h''!$ !$hlptx| 'h'!$7W!$B$$ ' ] $'  {  {  {  '+" % TT'bA$+ "d$(p$! B. $e$$e< f[  &<{$ f(d,a0be< a[  !<{!$aabddab'b+ "Eab!B<]c$ w $ aaaa "#$%(d''!$ !$$dhlptx|'d'!$7W!$B$$' ] $'{  {  '+" % @@'dG a+ abd$e$`< e[  % `(d,a0b6$a< a[  ! HXb`a+ "Td! 8= 8:$a$$a<  a[  !!8/ $a$$a<  a[  !<< !$ a4(a0,a,0a$a< a[  !08 @%d d!$%3$"$$"<@ "[  "8"'$+@n!H))9 *$+XBb`!PJJ9)@V !$+0"N! 8 d"@$  '%P@X$`%+0$T&!8 86 83 8 $+P$@!H))9' 8" $+XD`!`9 $+p!h9 ` $+P$@!H))9 4 818 $+H !@9%8<$+H !PJJ9 @$+`d!Xkk9`( $@$+8! 8d$( $ # P@'$%&DHL< `$!<<tx|<'t' plhD'  dd $ %%%(%0%8%@%HB''$"$$"<@ "[  " $+P5@!BB8@   dXT$  TX'''%{  % {  %{  % {  % {  %{  %{  % % {  %%{  %%{  % %{  %%{  %%{  % %{  % %{  % %{  % %{  % %{  %%{  {  %{  % {  %{  %{  {  %%{  %{  %{  %{  += % '(def@,% (efh@, de$  (,@f*@&%% *@% Xb`a+@"Th!@ 9Xb`a+@"Th!H) *94@ *91@*9 @*$+XB`!P JJ9%@)9 *$+XB`!` 9 -$+p!h9 `!$+H" !(!!8  da!( $ | (0"$!  0!@9 )$+P"2@!H))9 &!$+("! 8dd $  $48HD0,)ddL* L, '% '%h@$#+ b@Ď%  '  !   7<@"_  #"#!(e8%8%&$+8/!@f9 )$+P"#@!Hi))9  !$+("!a!!8 $, '{  %{  % {  %{  %{  {  += % ' ",'C'",0 !%@% < *C`<`OB$ !0< B$!A$<!$$ ' $J  < !dab04(' += % ' "'C'" ! ' += % ' " 'C'"  "#! $( ,' += % ' "'C'"7 "+ b/$ $p!f+8"$p!"$%ghb<@b)*kw  $"% +')(*de&'( '{  %{   "d&DB8 @b$&B8@b$&D@b$&D @ b $&D@b!&"!,%  "d& @b$&D@b!&A!8  += % '"d& D!c ʐ   " d& D !c K % '+= % '!$ <@[  ""(  $(,0' lpm  % % %%0p<l_  #$l  !   0TBX$  @  $+b $\`$+H +D L'  w L'+= % ' "'C'"= '+= % ' " 'C'"w '+= % ' "'C'"ŽE= '+= % 'L';<!4t 0ac$0480'<$'< !$ L"<@P[  P" "(,  TX'< @' TX@'w @'+= % ' "'C'"Ž! '+= % 'M < !$ <@  7<@"_  #"#@T!` $+Ai@"8@!8l < "[  "c$C$'$ C$d8  l''!$ !$A$'h'!$ !$A H""#&C `# !   BPcH H"@LT! $+A @"8 @!8T %Y"8@@,!L    8!85 @P!L    @,!L    ''$'DA$D@h!L D*A @0!L T' '<'!$7W!$B$aTX @0!LD T' '<'!$7W!$B$adh  += % 'DHܗ "S@("$ !,TB @$+A @"8'@!, L0'"8@"8 @!8 L0'$,!,  T! !8 (" #48< @E L0'L0'" #48< @E L0'+= % ', 0  @Cd0 c0 `4 % %%% %%( Ó 48$'+= % 'H" #$#" (,08! $"4'4'+= % 'L'dh`$08$0\%0\\%0\% $T%@%@D0 `\Tb <B$"<`#_  $#$HP!    :x@H,!      w '@x  <!$ w ' w ' <B$"<`#_  $#$H,!      w '@xHX! @x ( <!$ w '"8@"8$@<$ %% <*"@%%<!""! w '!87 !  <'c$%$ Ab D| <@B$"<`#_  $#$<+(#<!a"<`#_  $#$%H,!  T! !8$ <  %% <*"@%%<!A"! w '<@(!$ "<@[  "t" <Ꭱ < B$"<`t#_  t$#$H,!  d!  XH,!  X    w 't ݛ < !$t w 'w 'Lc$%LHh! L*A H0! ' '<'!$7W!$B$a'D   $ܗ "!d!  @ܗ "!!    W P !  P  P ! "#c$ $+@C"TX $<(!$g <  _  "! %XT% # $Cpc$!fg<d_  %$eU  w '<@!$ w '%{  += % '! &<⎡ HL<@D y $ $,0(4<Ꭱ ("<`0#_  0$#$%%4,PTX\8'"!PTX\8'+= % '&"`|'dhlp <@B$dh <@B$lp< <`B$"<`4#_  4$#$  4!`L'0!8  @"5@",@ "#@"@"@! "!  7<@T"_  T#"#<0!$<`!$< . T|+h l'<`!$t' > 7<@T"_  T#"#|+h l'$|+h l' |+h l'|+h l' h'|'!$ !$A8"@B!hl,p@t <B$x|<&!$1$h' $J  <B$j h'|'!$ !$A <c$hl0pDt8DAx|!$$<@!$  <(w B$484'D$#z  $$$ $'$?C W@<@@B<@<#!$%$<' $J (0<7!$ $"xT< !$ $""<`x_  #x$#> #T#$t%(p@B $"<`#[  #<B$"$< !$' > $"<@ <#c  ##"<B$"<'7$ $'+" % xx'''!$ !$A,'h'!$ !$A [ @lp','h'!$7W!$B$a','!$7W!$B$a'$|$|ax ata&a< !$ x"t"<@[  ""<8.@<B4((c8`<8'c$<8<<<[  $<@$<<<`'c$<8<<<[  $<@$<<<8'c$<8<<< ӄ$ <!$l' L &$+ "$+ `lp,0lp48c8`lp<@vlpDHp$+ c8`lpTXclpLP]d8lp\`Tc8Q`lpdhK','h'!$7W!$B$a','!$7W!$B$a'+= % 'D"0@<@B$,  ,HD@%0 LPT<'$%8g,@B%8D%8F%8,/h$#HO )1$!(+HF (480 $<@!$g  08(4$H !H)S*:0LPT<'$%  $  7$ $+= % ',"$+b`$+b`$+b``$+". $+"  @!$0$4('$+" A8 8!$ <$x   W< <.!$,' ,''!$7W!$B$ax c  `td<a_  "!bx} pB8y@Ctc8t`Cuc8p`BnB8l@<4B$&"p@ Cd`A| B$!$ pDf8:Dr86Dm82<@!$ p!$ p琬 h,2<< !$  (A0%(, h,<< !$  (A0%(,f $+H(O  $+H(  9 SK 9 h,<< !$  (A0%(,. h,<< !$  (A0%(, 9  h,<< !$  (A0%(,9 h,u<< !$  (A0%(,  # (< _  #%0(, $+H(  $+H(1  9 /9   h,<< !$  (A0%(, $+H(& 9 u h,<< !$  (A0%(,[9 h,<< !$  (A0%(,> h,<< !$  (A0%(,$ $+H(  9 范9t  $+H(#  9  h,a$ <_  '(9G9 h,8<<!$  (A0%(, h,<<!$  (A0%(, '$  $  %%{  $  %%{  %%{  $  $  $  %%{  $  %%{  %%{  $  $  $  $  %%{  %%{  $  $  %%{  $  $  %%{  <@!$<@!$ Ȱ += % '`dh [  XH%% <@$%0 lpt\'c$*8b9!8'  9@%X %`%h  9`%X%X%`%hD-`$+88P0 $<!$g  XHDP80 $@p%!@  <  _  +)  @ 9/@%H%8%@*@T<!+!*!)!( <@ B%8$98 g,,B%8$*$'a, <<!$  (A$( '$  $  $  $  $  %%{  $  %%{  %%{  %%{  $  $  <!$<@!$ Ȱ += % '$<$&(,(0$$  $+PGM@ $+PG+@8 g,$<_  ('8}g,$<_  ('8@ $8@ $ 8T $ $+PG&@ 8@m $8:a,_ <<!$  (A$(~8" 8 g,>B%8$l8 g,,B%8$]$Za, <<!$  (A$(B '$  $  $  $  %%{  %%{  %%{  %%{  $  $  <!$<@!$ Ȱ += % '<$& $f !$$S&' #$+@)8f,MB%0D%0>%08f,6B%0D%0>%0(8 <_  '&8<_  '&'$  $  < !$<@!$ Ȱ += % '$<$& $.,0!$$%8 #e,!<< B$  @(A '$  <!$<@!$ Ȱ += % '4!$g  t$0ap$!<掣< >!$' t$ 8<@DH(' $j <B$ $<>o!$*$ ' $J 8<@DH('8<@DH('t'+" % ' ''!$ !$''!$ !$$$  $+H';  $+H' 8 $g,%$ $8_ g,$ $8 g,$ $g,+8$ $ $+H' 8 g,$ $ g,$ $8 g,m$ $8  8 g,Z$ $$ $~ > P''L'!$7W!$B$aPTX\`dhlptx|'$ $E ''!$7W!$B$ ''!$7W!$B$ '$  $  $  $  $  $  $  $$  += % '$`<< Bc$!$# '0$!   @4A#, `<< Bc$!$# '0$!   @4A #,`<< Bc$!$# ' 0$!   @4A$#,`<< Bc$!$# '$0$!   @4A(#,`<< Bc$!$# '(0$!   @4A,#,`<< Bc$!$# ',0$!   @4A( << !  4A#,x`<< Bc$!$# '0$!   @4A#,Z`<< Bc$!$# '0$!   @4A #,<`<< Bc$!$# ' 0$!   @4A#,`<< Bc$!$# '0$!   @4A#,`<< Bc$!$# '0$!   @4A#,`<< Bc$!$# '0$!   @4A#,`<< Bc$!$# '0$!   @4A( $+@8<< !  4A( 8@<< !  4A( << !  4A#,f`<< Bc$!$# '0$!   @4A(  $+@4 $+@8<<!  4A#,+`<<Bc$!$# '0$!   @4A(  $+088,'%$  %$  %$  %$  %$  %$  % $  %$  %$  %,$  %($  %$$  % $  %$  %$  %$  $  $  <!$<@!$ Ȱ += % '$<$& dZ,(0c$$Ifgb$+@8 $+0"A:%08$+0"1:%08 8$$$ a<<c  `(A$%  '{  {  < !$<@!$ Ȱ += % '(,@9   "#<@"_  $"$048$' 048$'+= % 'L> "@%('D'!$ !$a$,"$E#$+($ $<!$g  L$$(!(e<[  & $*# a8 $<.Fc$2 a8 $<1c$* $<Фc$% $* # c8`$<1c$$ <"# !,04<<`$%$F'+@#t $$ J ': 08!8 %08 08&%%%p!73/+ <@ $ J '@l$fK9 ` 9:`9%@ 9 ` 9.`%@%0%8)<840, <@ F  <!$2'% '<'!$7W!$B$''!$7W!$B$X\'<!$ |HD LN  <!$|'% '<'!$7W!$B$''!$7W!$B$X\'''<'!$7W!$B$a''!$7W!$B$aX\'$%  $%  $%  DLH\TP%p%h%`|<')```'p'!$ !$`bcd%x*x<ä!$ $ J %% %(%0J@40<,!$ d"c"b"`4+ bD,a$B$#c0@! [   %% %(%0%%%%8%@%H]<ä!$ $ J %% %(%0. %+P@pxl $8,08'''!$7W!$B$as % 0123012,-./,*-<%g4%(.:%6%(4%d<''!$ !$'''!$7W!$B$''!$7W!$B$<& % %'','!$7W!$B$<&8% <&  $$% * $$% '','!$7W!$B$|''!$ !$'''!$7W!$B$<,&@(<&@( |''!$7W!$B$ <|''!$7W!$B$'0'!$ !$'|'!$7W!$B$0''!$7W!$B$LX '$','!$ !$A"# $ 5l '' '!$7W!$B$a'','!$7W!$B$a''!$7W!$B$a''!$7W!$B$a<&bH@<& dC% >8,08'''!$7W!$B$as % 0123012()*+(*)<%g4%(*:%6%(4%d<''!$ !$'''!$7W!$B$''!$7W!$B$<& % %'','!$7W!$B$<&8% <&  $$% * $$% '','!$7W!$B$h'x'!$ !$'''!$7W!$B$<,&@(<&@( h''!$7W!$B$ <莰h''!$7W!$B$'0'!$ !$'h'!$7W!$B$0''!$7W!$B$LX '$J9@ #*B%+PbT@! -d LX '$ #j,;@<< !$$  LX '$k $+Xj=`K9` J9a@ #j,@<< !$$  LX '$F #j,@<< !$$  LX '$+ J9@ #j,@<< !$$  LX '$  #j,@<<$!$$  LX '$ $+`j $+`[L9@J9@ #j,@<< !$$   #b,t@<<< B!c$!$$  @T<!$ <"T" LX '$ #*B%+PbF@! -d LX '$L9L9@J9@ #j,$@<<!$$   #b,@6<<B!c$!$$  @:<`!$ 6":"LX '$J #j,@<<!$$   #b,@4<<B!c$!$$  @8<`!$ 4"8"LX '$ #j,@<< !$$  LX '$ $+`@ J9@ #j,{@<< !$$  ' @LX '$ #j,Z@<< !$$  ' @ LX '$J9@ #j,6@<< !$$  LX '$ #j,@<< !$$  LX '$w$  $  $  $  $  $  $  $  $   $  $  $  $  $  $  $   %%  %%  += % ' $"<`#[  #<+[B$"$   $"<`0 <$c  $0$# B" !< zB$ > B"'+= % '&& B< zc$ > B" !< zB$ > B"'+= % '&& B< zc$ > B" !< zB$ > B"'<!$$$(+= % '$'H'd'!$7W!$B$a'$'4'!$7W!$B$< & $$'H'!$7W!$B$a<@ hD'+= % 'T'x''!$7W!$B$a@'T'd'!$7W!$B$a$  9 $0<c$4$  PTH'+= % 'et87cec80` Cc8)`Ce|8!c1c8`C<̥$&e`%-@4A@X";@\!B @3 c$$ Ab ,!$0+(<4@< $<!$g  %(% 4%@&$0!0ì<`Ì_  "#¬%%%0%%%(%8%% %0%%%8% %(8 Ʒ ( 8 $LPTX\D''+" %  '<!$  T''!$ !$a$*a`%X''!$ !$<4X\X'%>0!80$#@), (''!$7W!$B$ah'('8'!$7W!$B$a%04%(< 8'!$ !$a@DH8''!$7W!$B$$'+= % ' "\'C'"\ $#$0'!$7W!$B$a'0'T'!$7W!$B$a ,`X' += % ' "@'C'"@ $#$'!$7W!$B$a'?|'d'x'!$7W!$B$a'd'!$7W!$B$ac$''!$ !$'|''!$7W!$B$q ''0'!$7W!$B$a|'''!$7W!$B$a'|''!$7W!$B$as $+"`de*% e,% c'd'x'!$7W!$B$$%d $+ D'`'!$ !$%_%%'$+(NDE*% E,% E.% ' %&,2<=>?<=>@ABC''!$ !$a@*&A<% 4%(B:% 6%(4C% <掤''!$ !$''!$7W!$B$a'%%{  !$$(,D'!0$$Ǡ$D'!0$ ,$@ @'8Ǡ$%($D'{  += % '(,$ g<`tc$$'$ @(, 'E  (, 'w '+= % ' ",'C'" $"@B#"@B! $'$  (''+" % ll'  \'' '!$7W!$B$a< !$ "<@[  ###<`[  $ $#<`[  $$#tx#$|#<`[  $ $$#<`[  $($0#4$<`[  %X,%<#@$"$<`xt[  % 8!<+(bDP$4+8XTX $<!$g  T%0<%8%(% $@p%!@< \ _  \*)  $P4XD% %%(@h  %%  %%  %{  += % 'L HCd08G8D P % %%B<!$0 $%):8#H(E,4L#$#(/(0:%00!(+8f"@ < $$%$%PTX<'$PTX<'%  ($  %  ($  %  ($  $  $  H'+" % 'BCDED $+"`@ dB $+ " dC$+ " dD$+ "dE`'p'!$ !$B2.CD%(<%0DB%(>%04E%(hl?@A$+ Id>$+ )d?$+8d@$+8dAT$#8?0$L'\'!$ !$A>b ^ ?t %Xnl %`@r %Xn %`5A%XTX<\!8$+X(^`'L'!$7W!$B$A"%d''!$ !$'''!$7W!$B$''!$7W!$B$''!$7W!$B$'''!$7W!$B$ap `'''!$7W!$B$at'''!$7W!$B$a<wt'Dc$$$ K `'''!$7W!$B$a<&(,'<%('''!$7W!$B$a' `a$ ,d$'!$7W!$B$'''!$7W!$B$''!$7W!$B$<厘&(!'''!$7W!$B$as d($@ $&8   @' !$7W!$B$d$46L'%!$7W!$B$'''!$7W!$B$''!$7W!$B$<厘&(" '''!$7W!$B$as d($@$&8   @ L'%!$7W!$B$$&<'''!$7W!$B$a(,04<$(<$,j <$04('$  H''!$7W!$B$s d($&0   (>|d$468'!$7W!$B$'''!$7W!$B$<厸&("<&(''!$7W!$B$s d($ &0   (8d,.ŠĠc`<<<=<$+"*`<$+"!`=,04  8<@ F DH$'DH$'%{  {  %{  $%  $  {  $  $  '+" % 44'$+"`d.B/0X$+("e0"% 0(0:%00+  $+ "| d $+ "s d$+ "jd$+ "ad '0'!$ !$:6L%8'D%0J%0F%84%0(,<0:%0 '%8'!$7W!$B$ '4'!$ !$ '''!$7W!$B$4' '!$7W!$B$|}~$+ Gd|$+ Gd}$+ Gd~$+ Gc''!$ !$a|2&}D% <%0~B% >%04% <*% ''!$7W!$B$a''!$ !$a' '0'!$7W!$B$''!$7W!$B$a ''!$7W!$B$a' '0'!$7W!$B$ap `2%(0+(bE,E$c$#070! ''!$ !$&`' '''!$7W!$B$a''!$7W!$B$a'''!$7W!$B$a' '4'!$7W!$B$a''!$ !$'''!$7W!$B$ '''!$7W!$B$a''!$7W!$B$a'''!$7W!$B$a' '4'!$7W!$B$a''!$ !$'''!$7W!$B$ 'd'!$ !$a(''!$7W!$B$H''!$7W!$B$'C x''!$ !$h<ք$x|'''!$7W!$B$<3$ ''!$7W!$B$,0' 'd'!$7W!$B$ax'xu8 ''<!$< !$'$  )T %@HL %8'*R %8GN %@(5+%8'pt " 8 P!$08 / 8'''!$7W!$B$a<4!$ ,A$0C$< ($ w<,a_  ,"!b08 L'L'+= % ' PTt   PT <@$  6`(@$ , H< !$ ("<@@H_  @"H#"," #$   $L' 0$<!$$  8<`!$ <$"#$<D[  8!<@!$P' <D8$%%P''!$7W!$B$ 0  `<r(@$ , H< !$ ("<@@H_  @"H#"," #$   $L' $L'<!$$  4<`!$ ""$<`<D[  4!<@!$P' <D4#%P''!$7W!$B$<a< `B$k <<  _  #! @<!$ $L'<!$<0!$j !  $+= % 'L"Q@"#$!  ; 8L#+ bQ!DT@XDP< <'$8' $(e/ ,40` \`dH'8\`dH'\`dH'\`dH'!PT X \`dH'  += % '0"%@(8$<(4  '$  $@ @@DH,'8@DH,'!48 < @DH,'! $$+= % 'D;lptL7"$%$%(Ww%(E!$D0 Lh<\B$<"$@<'D$;"#$!  lpt*`L#l+ b-! PTX`d h$\(e/ ,04lpt;D H';D H'  w H'+= % ' "'C'""W$7B$@T1 '+= % '@+\`H7 "$%$%(Ww%(E !$D0 Hh<B$8<8'@$+ "#LPT X!$* HdX$0fPL$\`+@ D'4%,%0PHXL.+H8  $@ q!@ +XA.`,4b#E# $#( B$/$%!a   \`+@ D'\`+@ D'%  %{  w D''+" % 44'Ž|BB''!$ !$a$X%Pnj'$+H  $$%H%8%@P`HL$P !P*<`K_  !+A$X%?@AB%0d't'!$ !$?B@T %*L %@ AR %AN %@(5B%!lp$ LCX'D'!$7W!$B$!P+ˬĬ`` $$ % %8PH%@!@(<` _  &+& (`: (,D%$Xd|'4'H'!$7W!$B$$c$d'4'!$7W!$B$xc$L+ C4'H'!$ !$'|''!$7W!$B$q 4''0'!$7W!$B$a|'4'H'!$7W!$B$a< `< !$|' |''!$7W!$B$aPd $C `L`L $$X%%0|''!$ !$<ᎌ%@''!$ !$!|'4'!$7W!$B$$ LC@','!$7W!$B$!2# $ ɬ $ˬ`` $$2# $ $%%8 `HLB%!"<H_  &(FB$X"'$P%PT|0$4'%!$7W!$B$aC%$Xd|'4'H'!$7W!$B$$c$d'4'!$7W!$B$xc$|+ C4'H'!$ !$'|''!$7W!$B$q 4''0'!$7W!$B$a|'4'H'!$7W!$B$a< `< !$|' |''!$7W!$B$aPd$C || $ ldpd<a_  "!b'  %%{  %%{  %%  %%  += % 'dt+ "k $ $pp! |+(A`#0%7$0&-%@k#A! #&(($+(8,!00(+HC $!1+H; #@(G$@#H !@H+Xf/`jk%a1+X&`#0##$a!&&` K  -'$  e6708/@&($+0+0e./0670&('$+0+0c&d0`'$+0+0e&($+0+0e.B/06B70&(t$+0+0c&dc`hf(p!(e`0!(0&(,l$,! 0+ Ae#A%_@" %6+" '$'''6!&F#@4@%+"`+A % '$''''''''  %{  %%{  %{  %%{  %{  %%{  %{  %%{  %%{  %%{  %%{  %%{  %  %  %  %%   {  += % 'E $$ $$D!(A<#8@+@eJ#@#G$@(@H!P!#Xa8!@+hj<+hE50,$ ##"#e$! 2 0<+A`$(@#($# /$%8!%, 1 ' !0!,H4'  %%  %  %  += % 'l2d3e,a!(t+0" $8pp!8|+P!@#X!#`*g $`,T!p0<#PA!8#`L'pX#p!*ph,.n $  lXT2aP $  dl(,T#et\+0" $8pp!8`D%`!c+X!`(  ""<@D#_  D$#$+'' '!$7W!$B$ahc@!"!0L+A7`$(#AP#"$"<@!$ 1 !"$+ b,.%$ $p''%{   %%  %%  % %  %%  %%{  H %%  % %{  %%  % %{  % {  %% {  $  %  %{  H  %{  += % '`XT%A$*0$ f( $8p!8 %*H# 4L#PjW $PC#@!H*( )@*^ _ k1k9 `J1J9@ *J9)@<) (FG19(9%*\ h$s& `XT $L%4\ ds& `XT $L%4G@%*'2'!$ !$a$+H #8#@ % $#8?$8!8' ) 

L%8,x|%' pH!@2P0& $L4d`T,h $x|* & p!(*@%% d#n!S+ !+ $r!u+#Ș$ș## !+" *V %%%HD80<@XP&   $4D`T,Hh $x|Pd80 $X<@Lm;d.&'#3!$+`%`!` .&'#3!$+`df +`{ 1 < A,m D$@e$#(/ 0X!($+8$^' <>4D`T,Hh $x|Pd80 $X%@$.9&'#3!#y$+"+  n+ r+A#8$<!#A+`"#`)g $`!`&    4D`T,Hh $x|Pd80 $X<@$p`q1r'3!`+##8$!+B   &`$ r %1+`6!`$$n+`#`8g $`,#!`+$+# '$ ! *\%%%&   84`T,Hh $x|Pd0 $X<@$nr# 0!f! $+`"p#`ig $`l@!C##!`+<b +[ $ #I#F#0"$A! 2 0@+bC r+ A=$(#0##A#a7$&X!& 1 rt!A!0<+A#`#A@# $'$ X! $+("0<<&\'\'{     %%  %%  %  %%  %%  %  %{  % {  %  %   %  %{  $%  %{  $  %%  %{  $%  %{  $%  %  % %  %%{  %% {  % %{  %%  %%{  %%{  %%{  %{  += % '20!da0(+(AF#(A,#8&?$8$!8 $+P%7@J %(+H". !H c$a0+"%`!`%+A`#&#A# $a! 01 ' ba48 '  {  {  % %{   += % 'F'N'!$ !$a D( 

 $(< $$ >  $

%04'%(|<厄't'!$7W!$B$'t'!$7W!$B$<& % '''!$7W!$B$$'% ''!$7W!$B$`'p'!$ !$'''!$7W!$B$<&8<&8 `''!$7W!$B$ <现`''!$7W!$B$''!$ !$'`'!$7W!$B$t''!$ !$t''!$7W!$B$$t'Df*%%%04 < !$g  4%0,(< c$ $ ,(>('H'!$ !$%%% %%% e8e4f%8%@%(%%(''!$ !$<''!$ !$'%8'!$7W!$B$<&0% ''!$7W!$B$$'%0'!$7W!$B$L'\'!$ !$'''!$7W!$B$!<&PK@<&PK @L''!$7W!$B$! <ꎜL''!$7W!$B$!''!$ !$!'L'!$7W!$B$T'h'!$ !$T''!$7W!$B$!$T'HPh D%'$'!$ !$`!%+`0 < !$g  H%80,(< c$#E$p#(/$! $ ,( '% %(%%@$'%!$7W!$B$a''''!$7W!$B$aX f$@b$HD@LfPc"@$'%!$7W!$B$a''''!$7W!$B$a f$@c$HD`' : 8<!$L w<a_  "!b!B9 $ 'w '+= % ' "'C'""W$7B$@T1 '+= % '$7 C`(#w< `CDg  "#" $BB@(#!aB !& aC< ([  (! A< [  !A#<$c  #"$C"A7<` #Dg  "# # $"Ca!$a,' LBX `]= @dP+0% %(%0<8D4L!$ g <B$ P$"4% $%08D!$#!0!acB$ dhlH'!$B$%*@'c$(+Hg $+H 8@<0,L! $g  @8<,0$H !H#$#T+a@$+((L! $g  T(G$8!8c$%dhlH'%%{  += % 'X!\` d]= 8 HX!PDhl p]=  D$#(/0c$#070P!(H$JK!F!$%0%`%hPtHxD|T'tx|T'%@PHLD@,0<4(+p*0+p(!%+pX! $g  HL<@PD04(,%p!pȭɭA$#@G1!($+p #%+pX! $g  HL<@PD04(,%p!pȭO%ϭH%+p+ h% c$#pw1JK!N!$%p+( %+@0XB $g  PD04"$!HI% !'+`8 <G!$g  8PDPHD!   X!PH D]= tx|T'+= % '("(d&)@,b,$&$@.b.$&@0b0$&@2b2$&D@3b3$&D@4b4$&DB8 @($ K % '+= % '$ C  !$$ C   '+= % '7 !$!$7  % 0!$0!$$ K  '+= % '"d&@b$& D% !c  % '+= % '7  "d&D@"d&D ! c&#%"!,''!+= % ''','!$7W!$B$a0'+= % 'X"i<c$D\H`LP"i<c$<@ !<`!$ i<<B$"<@X[  X""i<B$048D'$<'(0',M  <!$ <@ [  ""$'% VŽ @"$#$d(< H!$ <@h_  "h#"d"#lT'+= % '7Ž<`0#_  "#0"'+= % ', '$,AŽab!+= % ''','!$7W!$B$a0'+= % ' "0'C'"0 #$'!$7W!$B$a''('!$7W!$B$a4,' += % ' "0'C'"0 #$'!$7W!$B$a''('!$7W!$B$a4,' += % '"d&@%$ K  '+= % '8B  "d&D@"d&D ! c&#%"!,''+= % '$ C  !$$ C   '+= % '"d&@b$& D% !c  % '+= % '"d&@%$ K  '+= % ' $%$ $d((!0!(Ȍ&@   8('+= % 'B$'$"+*9@8-'$8@8@)- %@N ,)TX\L%@4%@='$$ `d<B$hlP'$ `d<B$hlP'#%$"#!$*a`$ `d<B$hlP'"$+A`$ `d< B$hlP' @ ``dhlP'<@DH<'@# X\T% $*(+(K!(d%0%8o$+0=!(e$0 $+8$0$+0$ $0+0$%0$+(!(d$0+@ $0$+8$ $0+8$%8)%(<<'&0<'<<'HD%@+P@8* $?0<%!8+H; ! d$$0!0+8/! dƐ'$%h+ $`d+"`t! #x'$%h+ $ -d |'{  %{  %{  {  %{  $*0!0Ɛ 8 +0!0$+$Ǡ+$ -d |'%{  %  += % '41 "!$ RR 4d,(a b$ RR ,( @4@ ~[ , (8hX'Xd`!(D\+8e@(D !$$   p"@#$$B$"$#B0!b<`#_  "#"<d8 P<& @x!$|+ Att $!$$   @"@#$$B$"$#B0!b<`#_  "#"<8, 4<& @cDH L<m!$ $}!$ $!$$   @"k@#$$B$"$#B0!b<`#_  "#"<8, 4<& @48 8 HLD)DH L!$$   @"Q@#$$B$"$#B0!b<`#_  "#"<8, 4<& @LHDDH L!$$   "a@#$$B$"$#B0!b<`#_  "#"<|, X<& @ 8\ !$+ A $B8"@(B$,+ b$$ $,B8"@(B$,+ b$$ $!$$   H">@#$$B$"$#B0!b<`#_  "#"<<( 4<& @%0%%(TPLX\`D'LXP\T`D'$%  $%  $%  += % '<dd8XD$H+0@@ $!$$   <";@#$$B$"$#B0!b<`#_  "#"<4( 0<& @HD@LPT8'@LDPHT8'$%  $%  += % 'x"c@"B$*b`C8Z`B$+ b|| $!$$   H";@#$$B$"$#B0!b<`#_  "#"<<( 4<& @PTLX\`D'LXP\T`D'$%  $%  $%  += % '`"@"B$*b`C8Z`hB$l+ bdd $B8"@hB$l+ bdd $!$$   l"@#$$B$"$#B0!b<`#_  "#"<\0 H<& @8\ t!$x+ App $!$$   x"@#$$B$"$#B0!b<`#_  "#"<Tl| <!$$<!$s $(u$*b`B8Z@B$+ b|| $!$H$L4'<>!$H$L4'<.!$H$L4'<.!$H$L4'<!$H$L4'<!$H$L4'<!$H$L4'<!$H$L4',0<!$ $,' $J HL4'$8f $8p$!8'&PI@c$   %<`d8 c8`<@!$H$L4'<!$H$L4'!$$ K  $!( @C   $<`!$(' >  $<`!$(' >  $<`!$(' >  $'<`!$('' >  $&<`!$(&' >  $%<`!$(%' >  $$<`!$($' >  $#<`!$(#' > $"$"<`!$("' > $"$!<`!$(!' > $"$ <`!$( ' > $"$<`!$(' > $"$<`!$(' > $" $<`!$(' > $" $<`!$(' > $" $<`!$(' > $" $<`!$(' > $"< (<_  ("!<,'+= % '  !    $' $'+= % '4!  6  $'  $'+= % '\!` $ <! $P!, @<  8%($ 8(! (*A^  !8 ,! @ 0D\c` ` 0$!D  LP <B$LP<9[!$$L' $e 4H%0$@, < <''$%  $#!0 `y@#c0c,c09`z`C4%%@'T'!$ !$@D|HLPTV` !"* a@ *(e(yy$z| 5 ( $,<\8!@x @t' \<8t'X4<l!$ 4X<B$ t, @ !  !  dhlp <B$dh4 "%lXptx <. p $jb $'!$%(%H% tx *A ''!$ !$a c ` | >$""< z!$,"' > }$"< ,<_  ,"! 0"#c$$%%+0C+ $ 4"#d$%+0D( $4$> 4"#d$%+0D( $ ,"#$&! 04K9 $,< _  #!('+= % '\c$`+(X%X $  )8 $+H  $ ,"#! 048< $,< _  #!('+= % '@D N + 8"$<+ b44 $ ,"#! 04 $0 $,< _  #!('+= % ',$> ,"#! 04 $ $,< _  #!('+= % 'D+m<!$4L8P<4'D$+% &f" B0Y@%B8U@"#c$$+(C $@$%0 $+ D)%$+P,@0+* $*XD`%(8'T'!$ !$%8' $$ $ h!#x$|!T T t' 'D'!$7W!$B$ahH"$< l< !$t' lt''!$7W!$B$aLX`d|$\H $9@H z pH H  <!$$/   <B$j %% {  %{  '+" % pp'PdX%%!$*($Pe+0%HLLe4$8&p!(\%$1 $+@((08E0P$T! $k \0"PC<`TC_  $#TDLb$HX\4$"0X$\! $l \0"XC<`\C_  $#\DLb$HX\4$0,<&H  <408&H g G &@`\dTP$~K N d% #+#A \%#0!P$T!P T h' 'D'!$7W!$B$a\0!7("$< `< !$h' `h''!$7W!$B$aHTX4$?'@H z dH H  <!$$/   <B$j %{  += % '@\d0%%!$*($\e+0%b$Xe$8p!(4,%@<'(b (%("%$@04$,*H *+X ;` (!0$ p!$8$ ! $l 8a<  a_  "! b$a(b@ $(l 8$a<Ꮋ (d_  "$%% {  %{  += % 'L0d<,e0  <$ % 4b8e<f@gDhHcX\  $ ( 0L<8e8PT%,`dH'4%0L<8PT*@E&8h+HH^ 44a($Cp!"@  @" &C`! K   de$f+8 $<@!$g < _  "%%(%0%! ,"' 4[ #$% t'!$7W!$B$abc%+0&(!(+("<$@&p!@ 8%E$*0%%$+08!8ጀ8!8+@&{  %{  %{  %{  += % '('<'!$ !$A d(% %($ s %('<'!$ !$8<'('!8!$$*0&,$ s %('<'!$ !$8<'7'!+= % 'b+ " b`<$> <"#c$$$%+0C. $ ,"#c$$%%+0C+ $ H"#t!(d&+8ED  p"#X!(d&+8Ed  P"#|!(d&+8EL  h"#D!(d&+8EP  d"#c$$$%+0CB $ `"#d$%+0DP $ \"#d$%+0DP $ ,"#c$$%%+0C+ $ "#!(d&+8E %%($$ ` P'<!$$ Ab $> "#!(d&+8E  "#!(d&+8E  "#c$$$%+0C/ $ "#c$$%%+0C/ $ :l$~K - % #+#  $  < $nj l\ $ ( 7#$'!$7W!$B$ax'''!$7W!$B$a4' deX!8h+H h   $<`!$(' >  $<`!$(' >  $<`!$(' >  $'<`!$('' >  $&<`!$(&' >  $%<`!$(%' >  $$<`!$($' >  $#<`!$(#' > $"$"<`!$("' > $"$!<`!$(!' > $"$ <`!$( ' > $"$<`!$(' > $"$<`!$(' > $" $<`!$(' > $" $<`!$(' > $" $<`!$(' > $" $<`!$(' > $"< ( w<a_  "!bA+C! %  %C  %C h 6Î <@\\C_  !#AH@%(<d hl p$t(\ 4 8x|L'0Dx|L' <  <@LLC_  !#A%TC4B!@D HX\ `$d(\ ,408hlpt<' <  CD$E+0dX $ CD$E+0dX $Ǡ0$,$% %(%%%& ,0H<&@!B( &i B$+ " $Ǡ0$% %((%%*0AC0P@<,!D L8H4P@< tx&i <L&" <&"!  B$+ " $Ǡ0$,$% %(%%%& ,0H<&@!B( &i B$+ " $Ǡ0$% %((%%*0AC0P@<,!D L8H4P@< tx&i <L&" <&"!  B$+ " $Ǡ0$,$% %(%%%& ,0H<&@!B( &i B$+ " $Ǡ0$(%(% %%*0AT0XD@,!H T<8PXD@ |&i  $ %%%   48& b51`$$~K % 0% #+# $ "p+#4%a !p $##!A $Ap@!$ !#<!AD('@H z 0H H 04 8<!$$/   <B$j += % 'HLP dh&i < T&d \/`&8[W0@,8$~K H X% #+#; @,0 \8&i \! C+0$4  ! R  Cp $#+#%A Bp#!C $bp@B$!A!$o ,Ŏ $  $Z$|'  !\ ` $ (\ 048[%X"|d<4Yt%p hpMtp[F 6 pt$ $(,0 4 TP@d<4Y%@tp%H[|H8<@D<4%X%` %h %H[%d%@%P|Y <&x Zx <   |<4xZ/dY |'$h % |<4Z+A`g < <['' < <Z' < <[' < <['T!" ! B  @   $k l['   += % '"@T!" !B  @|<xh d&A@<&A@<&A@<&A @<&A@<&A@ > !l R L6|xh d$ L` dp $# +#%C cp#! $p@c$!b!A!$ &i  Ŏ  |xhd $( 8V ,04 &i   L`&i P  ln P#"(L&(D`D< *!$ L"D"$+@ 87787 87%(h+@"p!a"B0P!+`C8`!C8f`!C8`!C8`!C8Q`#"%&+*c,$#%Al`' $+8k $+@8%@8%@%@ 8%@  8%(%@h+0"p!a"B0P!+`C8`!%#C8`!% C8`!% C8`!% C8`"#% C8`!%&h++B,$"%#l`'$$+8> 8 DXTJ  DX $h+8"p!a"B0! C8`C8`"! LH!TJ  LH N l`'8/h+8"&p!a"C0$c8` @T!  @T K * l`'{   $9 ''+" % ll'" ! K   " !D@4 K   0"0,<8E8   0,<8d40($+8 $$+88 $+8 8@nj+88t0@#0@nj@%8+8" !  D@4  0,<84@B8 @'m 0<84@%H''!$ !$PHL''H'j < 80H'?k  D@4 <80 $k H'k  ' <T'?k   > !<    (@T'?k    (@  '@!0"8@!8 T!  !8 ' <-!$ <-c$!$7W!$B$a'T! !8 ' @!0"8@!8! 0T!D  !8 ' <.!$ <.c$!$7W!$B$a'0T!D !8 ' @!0"8@!8 T!  !8 ' <-!$ <-c$!$7W!$B$a'T! !8 ' @!0"8@!8 8T!L  !8 ' < .!$ <4.c$!$7W!$B$a'8T!L !8 ' <0!$ <0c$!$7W!$B$a'!0!8 8T!L !8 ' <+!$ <+c$!$7W!$B$a'8T!L  !8 ' <@,!$  ' <.!$ <.c$!$7W!$B$a'|''!$ !$A  '%|','!$7W!$B$'|''!$7W!$B$'$! T @ ! < B$!"PX! <\'x'!$ !$AT@ <~B$\`<}!$dPh<~!$l<< B$!"p !tx<_T!$($\' $J  <B$j += % 'T'd'!$ !$AL BP @B8@% LH!P !8q LX!P % $*b`$*bP`$*b(`#0d8c8`T' <!$ <c$!$7W!$B$aH'T' < !$ < c$!$7W!$B$aH'#0c8`T' <!$ <c$!$7W!$B$aH'T' <!$ <c$!$7W!$B$aH'$*b%`#0c8`T' <!$ <c$!$7W!$B$aH'T' < !$ < c$!$7W!$B$aH'#0d8$c8`T' <!$ <c$!$7W!$B$aH'T' <`!!$  D!0 "8 @"8!@@"!@!TJ  I TJ < HLPT4' `$~K 3 0% #+#& 4  <"0 !0 B4(dc<$   <@D$'@H z 0H H 04 8<!$$/   <B$j += % '$(, 0  <B$&"!,4'" #$! " #$! += % '4 !8 !8! 4 !8  @!  ! ! <% 4!8  %(% %%$ <1!$ ,"<@0 $ c  0" #$$"""# $! M  (,04X(!7< @8$!$< {B$(' 8(,04$"(#,$0%$'P 'L T''D T'w T'$"+= % ' "'C'""W$7B$@T1 '!<*B$ += % '` !d `(!X Pd  %%PX4 0! T H(' lp c$B !$$jb $%%@A< A_  #!C%%4"8$X\X@ <8[B$"<`#_  $#$T! !8 ,!  T! !8 %<8[!$ $ '"! $ 'tA$t,!  h! t*Ak ,!  0!t ' '<'!$7W!$B$a<`!$ $p @XT! $+A `#8`!, #$$+`#$+`!8  <<`d_  !$aX@ B @ \)@0d`!@+H (<4  <@DDC_  !#AL%!bHc  " !D K   (LC B!0$<8H K   40 $$+( $$+(8 c$+(8 8+((%088Q(08*088%0+0L" !,B @  <8(   (8<  ,40  ,  @' X!D  -  (8X" !,B @ ,! DK   (8  @<, > PCD$E+0d4 $ P"<$&(Ž! @( $,BM  @DHL ! !8 "%d,D$$$ a c, HC$c0 a c,  $#bB0A B, %$L@DHL@DHL'+= % '<@DH $,@!0  ,X!0 !0 "8i@ "8J@ !8 $4T!8 !8B 4,!8    2,X!0                 T( $XAq!H++X(3`PY!@h d(!( !+("3(4!08! * &#%+"$`<8[B$<|$"p0!A@'b+ "b!A"!O <@'{  {  {  {  += % ' "'C'" "#Cc$+ b$!dc!+" `!$! '{  %{   += % ' "$'C'"< !@DH LPTX '+= % ' "$'C'"$" B!(, @048< '+= % ' "$'C'"<!@DH LPTX '+= % ' "$'C'"$"B!(, @048< '+= % ' "'C'"4!8<@ DH'+= % ' "'C'""B! $ @(,'+= % 'M <`zB$ {t $"<`#[  #< B$"<`z!$$ {t $"<`#[  #< B$"<`z!$$ {t  $"<`#[  #<"{B$"<`z!$$ {t $"<` <$c  $$#<B$"i!$L$`<<Dd[  $<̄$Dd<$+"(`<<Hd[  $< ̄$Hd<$+"`<<@L"[  "<B$L" '      += % ' $ ( <B$$( '+= % '0$ ( <B$$( '+= % '@$ ( <B$$( '+= % '<@!$ <̅!$$<Ж!$$ ' $J <`< !$ \CBS@D <ޥ$njB^(8Dd!P<>!$ 0"4#<@D_  @$D%$( "8"%  XPX'C g @04  T<B$ 3 T`'"<@"_  #"#Xd!X'D ;$@G@%!@ &P$@B$ LH LHD%!#C#0#(e/$e!# <!$> 3@"B(@l@ /@(,@B(,6&Wx@6&W@`\T<@ACB 1 <!$@+(TXT $tx| '''!$7W!$B$aL''H'!$7W!$B$aL'  L`DX Lq!$($, '"80@"8$@"8@ $  <!$$ Ab (, ' ''+" % HH'$<$<8<<<@%8G!%E1!@+P"3@!PH>0!8+@"'!@& g'8(? ! # $  ' '!(& g$(!+("{  % {  {  %%{  % {  % {  %% {  % {  %% {  % {  % {  %% {  % {  % {  % {  % {  % {  % {  % {  % {  %% {  %% {  %% {  %% {  %%{  += % 'L E'(T<48!88@ $8'q#88$7 H!8$8#0!0 T$<5@!@%@?#80 $+88G-$8$'@'!$ !$ $+8*$' B$'+= % '<!$ <0B$'+= % '<@!$ B$'+= % '< b!$ 

B$'+= % 'B$'+= % 'B$'+= % 'B$'+= % '< U!$ < ?B$'+= % ' $"<@"[  "<0B$"$< !$$' > $"<@"[  "<`B$"$< !$$' > $"<@"[  "<B$"$< !$$' > $"<`#[  # $"<@"[  " $"<@"[  "  $"<`#[  #  $"<@"[  "<{kB$" $< !$$' > $"<`#[  # $"<`#[  #<B$"$< !$$' > $"<@"[  "<"B$"$< !$$' > $"<@"[  " $"<@"[  "<&!B$"$< !$$' > $"<@"[  "  $"<`#[  #<{B$"$< !$$' >  $"<@$ <8#c  #$#"<{B$"<8('+= % ' $"<@"[  "< B$"$ $"<@"[  " $"<@"[  "  $"<`#[  #<B$"$F  $"<`#[  # $"<@"[  "< B$"$B  $"<`#[  #<B$"$@ $"<`#[  #' > $"<@"[  "<8B$" $< $"<`#[  # $"<@"[  " $"<@"[  "  $"<`#[  #<B$" $4  $"<`#[  #<)B$"$0  $"<@"[  " $"<@"[  " $"<`#[  # $"<@"[  "<ZB$"$(  $"<@"[  "<{B$"$& $"<@"[  "<B$"$$ $"<@"[  "  $"<`#[  # $"<@"[  "<(B$"$  $"<@"[  "<̣B$"$  $"<@H   $"<@"[  " $"<`#[  #<B$"$ $"<@"[  "<1B$"$ $"<@"[  "<B$"$" $"<`#[  #<+ZB$"$  $"<@"[  "<B$"$ $"<@"[  "<3ZB$"$ $"<@$ <|#c  #$#"<+EB$"<|('+= % ' $"<`#[  #<B$"$ $"<`#[  #<B$"$ $"<`#[  #<B$"$ $"<`#[  #<B$"$& $"<@"[  "<+!B$"$$ $"<@"[  "<B$"$" $"<@"[  "<0B$"$  $"<@"[  "<2EB$"$ $"<`#[  #<B$"$ $"<@( <#c  #(#"<B$"<,'+= % ' "<@"_  #"<@<_  !"<$'+= % ' " < c$d&J%B A  <B$&"1  "B8@%!!$$ K  @c$#c0X!<$`<@B$$'`'c$$D\b0eLF(In80d8,o8(t8$s8 :8A$#B0!E-{ !$%$* a$` \DF(%<{S!$$ K 0\DL%,  F(%''!$ !$D$I$%(>'%8 ''!$ !$e$$%'%8 h$!@. $ %%(%0%8 %B+@m=!c  $0 $ C$+(# $= $*0= @''!$ !$' $$ $  <@$.s<_L5 > ?0<%!8+HC) !H"'G$0!0+@ -d @a< a_  "!bPT<'%%{  %%{   "! $'+" % ||'?0<%!8+HC) !H"'G$0!0+@ -d @a< a_  "!bPT<'%%{  %%{   "! $+= % ' $(,4! @: \:8 %+P-  $*0@@ 8'T'!$ !$8' $$ $%  % %  %  %%  % %  %%  %%{  += % '8 DL*"`+"D`@!A@PTX0' < 4A@@ABa !$t*A`xpt DB+00#@+hlm0m0!h%%+X5`DD%c0 1+c-`1!k$*XK`+XG`!Xg$+X"?`!Xha$+"`5<!$ $"<B$"$0<B$48'<!$ $"<,)B$"$0<B$48'a0!!$048'{  {  %{  %  %  += % 'XT\`%%%T\@%X*@40L$*H +H #H#PW $8!8 $+XI`:%8'%H<!$ $"<,Yc$#40LXT\ $%@%8 <)% * %*X`+X`#X#`g $@ !@+`K B%@h%X<!$ $"<,Yc$#40LXT\* $%H%@ <k%u`1!X(*`p8D@0 $+hO$+8-<!$ 0LXT\D8 $@<)$%`4<@!$ 0LXT\D8 $@<($%`49<($ <@%<!$ 0LXT\D8 $@<($%`4~ $+h.9<!$ 0LXT\D8 $@ $*PI@%H%<$+P@!!%808-8 VB$"<|B$X\D'f%0*@P$+Hh +H #Hf#PW $0F!0 *-u@%PR ʐJ9 @ ʐJ9@*-c@ $%PJ@$+P@84@ $<!$g  (,<@84 $XGqk%!X+ $li<鎴 i_  &)HGE<`C_  !#AX\D'J% K)`!XFk`?0 <)%!8'+P'@!P$G$0!0+H  -d |,a<(d_  "$(bB&aI%%{  %%{   `H$tx|d'ph +0dtx|d' <  4 B!d$ p&d'`HL Bi00#H+@*00!@%%(+@IB$H00+@ %%(0!!"!$,'+= % 'x7e 0 $x! $  x!,  $  x!( $  %4'p'!$ !$$804 @,<$H<$DP(LXT`\hdx" !pl4'$ a |t'+= % '@DHL7e  @`@'&d`@'@@'LH!0ED+@f<,T  d,8C$D$E$F$('|'!$ !$$,($4 %% <!$ $"<8B$"80<4%(% <!$ a d$c  $ @(PTX,'PTX,'PTX,'PTX,'%{  %  %{   += % ',"!0 48<   @$LPT('LPT('+= % ',w<$$4*(D+(A#(A8#8&?$8'0!8$+H% eLN %%(<!$ $"<8B$"4,80% %(<!$r $*8E +8ug! %% <!$ $"<(c$#4,80%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,80% %(<!$ ac    @$LPT('LPT('LPT('LPT('LPT('%{  %{  %{   += % '8"!< @DHLP $z (, @0X\`4'X\`4'+= % ',w<$$4*(D+(A#(A8#8&?$8'0!8$+H% eLN %%(<!$ $"<8B$"4,80% %(<!$r $*8E +8ug! %% <!$ $"<(c$#4,80%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,80% %(<!$ ac    @$LPT('LPT('LPT('LPT('LPT('%{  %{  %{   += % ',w<$$4*(D+(A#(A8#8&?$8'0!8$+H% eLN %%(<!$ $"<8B$"4,80% %(<!$r $*8E +8ug! %% <!$ $"<(c$#4,80%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,80% %(<!$ ac    @$LPT('LPT('LPT('LPT('LPT('%{  %{  %{   += % ',"!0 48<   @$LPT('LPT('+= % '$#$*0C4+0"^!8B'$+@R!8'$BN%@ +HF !8'$DL%@(+H: !8'$B&% +@.!8!$+ "&!&%%%<!$ !$"%%(<!$ $"<8B$"D<@H% %(<!$Y ac    C@< C$B@ DH   )@<(C,D0B @DHP T$(. ,0 @4\`d8'\`d8'$\`d8'$\`d8'\`d8'\`d8'\`d8'%{  %  %{  {  += % '8wH$$@*(D+(Ar#(AD#8&?$8'<!8$+H%d a,.%%(<!$ $"<8B$"@8D<% %(<!$? ac LP $z (,$@8 C$D(B <@D $ @(X\`4'X\`4'0X\`4'X\`4'%{   += % 'HwX$$P*(D +("eL!8%%(<!$ $"<(c$#PHL% %(<!$ $*8E +8g! %% <!$ $"<(c$#PHL%(% <!$o $*8D +8va!(%%(<!$ $"<(B$"PHL% %(<!$F ae g$h(ic T $(\,`04$ 8<"@H,C0BL PT   @$hlpD'hlpD'@hlpD'hlpD'hlpD'hlpD'%{  %{  {  += % ',"!0 48<  $4%%) ," !0 48  $4%% LPT('LPT('LPT('+= % ',w<$$4*(D+(A#(A8#8&?$8'0!8$+H% eLN %%(<!$ $"<8B$"4,80% %(<!$r $*8E +8ug! %% <!$ $"<(c$#4,80%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,80% %(<!$ ac    @$LPT('LPT('LPT('LPT('LPT('%{  %{  %{   += % '8wH$$@*(D+(AV#(AD#8&?$8'<!8$+H%H a,.%%(<!$ $"<8B$"@8D<% %(<!$# ac LP $z (, @0X\`4'X\`4'X\`4'%{   += % '0w@$$8*(D+(AS#(A<#8&?$8'4!8$+H%E a,.%%(<!$ $"<8B$"80<4% %(<!$ ae c j $ @(PTX,'PTX,'PTX,'%{   += % ',w<$$4*(D+(AQ#(A8#8&?$8'0!8$+H%C a,.%%(<!$ $"<8B$"4,80% %(<!$ ac   @$LPT('LPT('LPT('%{   += % 'w$$$*(D +("ee!8%%(<!$ $"<(c$#% %(<!$( $*8E +8?g! %% <!$ $"<(c$#%(% <!$ $*8D +8g!(%%(<!$ $"<(c$#% %(<!$ $*8E +8g! %% <!$ $"<(B$"%(% <!$ $*8D+8E#8E #HO $(!($+H' gNLJ%(%8<!$ $"<8c$# % <$%8$s$*8E+8D#8D#HO $ ! +H' gNLJ% %8<!$ $"<8c$# %(<$%8$;$*8D+8E`#E#8?$(!(+0"V a%%<!$ $"<8B$"%<!$ 48<'48<'48<'48<'48<'48<'48<'48<'{  %  %{  %  %{  %  %{  %{  %{  {  += % '8wH$$@*(D+(AV#(AD#8&?$8'<!8$+H%H a,.%%(<!$ $"<8B$"@8D<% %(<!$# ac LP $z (, @0X\`4'X\`4'X\`4'%{   += % '8"!< @DHLP T$z (, @0X\`4'X\`4'+= % '8"!< @DHLP T$z (, @0X\`4'X\`4'+= % '8"!< @DHLP T$z (, @0X\`4'X\`4'+= % '8"!< @DHLP T$z (, @0X\`4'X\`4'+= % '8"!< @DHLP T$z (,(@8C B< @DLP T$z (, @0X\`4'X\`4'0X\`4'+= % '8"!< @DHLP T$z (, @0X\`4'X\`4'+= % '8wH$$@*(D+(AW#(AD#8&?$8'<!8$+H%I a,.%%(<!$ $"<8B$"@8D<% %(<!$$ ac LP T$z (, @0X\`4'X\`4'X\`4'%{   += % '8wH$$@*(D+(A#(AD#8&?$8<!8$+H% eLN %(%8<!$ $"<8c$#@8D<% <$%8$$*8E+8D#8D#HO $ $! +H' a<>%% <!$ $"<8B$"@8D<%(% <!$ ac   $@%%i 8 "$!< @D  $@%%H 8(",!< @D  $@%%' 80"4!< @DLP $z (, @0X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'%{  %  %{   += % ',w<$$4*(D+(AQ#(A8#8&?$8'0!8$+H%C a,.%%(<!$ $"<8B$"4,80% %(<!$ ac   @$LPT('LPT('LPT('%{   += % ',"!0 48<   @$LPT('LPT('+= % '0"#! 48<@ $ (8 %% PTX,'PTX,'+= % '8"!< @DHLP T$z (, @0X\`4'X\`4'+= % '8"!< @DHLP $z (, @0X\`4'X\`4'+= % '8"!< @DHLP $z (,$@8C D$B <@D $ @(X\`4'X\`4'0X\`4'+= % '0w@$$8*(D +("Ce4!8%%(<!$ $"<(c$#804% %(<!$ $*8E +8g! %% <!$ $"<(c$#804%(% <!$ $*8D+8E#8E<#HO $(!($+H' gLN %%(<!$ $"<8B$"804<% %(<!$ $*8E +8g! %% <!$ $"<(c$#804<%(% <!$  dg8 -)9     @804<%( $PTX,'$*8D +8y$a!(%%(<!$ $"<(B$"804<% %(<!$: (a,c S  $@00C4D8B 48< $ @(PTX,'PTX,'$PTX,'PTX,'PTX,'PTX,'PTX,'PTX,'%{  %{  %{  %  %{  {  += % ',w<$$4*(D +("e0!8%%(<!$ $"<(c$#4,0% %(<!$ $*8E +8g! %% <!$ $"<(c$#4,0%(% <!$ $*8D+8E#8E8#HO $(!($+H' gLN %%(<!$ $"<8B$"4,08% %(<!$P $*8E +8^a! %% <!$ $"<(B$"4,08%(% <!$&  ac$8d-8    @$LPT('%LPT('LPT('LPT('LPT('LPT('%{  %{  %  %{  {  += % '(!% *8$+0b9+0A4##$#!a&$`   %%<!$ $"%%(<!$ $"<8B$"@8D<% %(<!$= (a,c LP $z (,"@80C4B< @D   @$X\`4'X\`4'0X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'%{  %  % %{  %  % %{  %  % %{  %  %{  %{  %{   += % '8wH$$@*(D+(AV#(AD#8&?$8'<!8$+H%H a,.%%(<!$ $"<8B$"@8D<% %(<!$# ac LP $z (, @0X\`4'X\`4'X\`4'%{   += % '8wH$$@*(D+(A#(AD#8&?$8<!8$+H% eLN %(%8<!$ $"<8c$#@8D<% <$%8$r$*8E +8g! % %8<!$ $"<(c$#@8D<%(<$%8$G$*8D +8ig!(%(%8<!$ $"<(B$"@8D<% <$%8$$*8E+8DB#8D#HO $ $!  $+P'5@gVTR% %8<!$ $"<8c$#@8D< $%(<$%8$$*8D+8E#8E#PW $(E!(+P'@gVTR%(%8<!$ $"<8c$#@8D< $% <$%8$$*8E+8D#8D#PW $ D! +P'@ gNLJ% %8<!$ $"<8c$#@8D<%(<$%8$q$*8D+8E#8E#HO $(%!(+H' $a<>%%(<!$ $"<8B$"@8D<% %(<!$= (a,c LP $z (,"@80C4B< @D   @$X\`4'X\`4'0X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'%{  %  % %{  %  % %{  %  % %{  %  %{  %{  %{   += % ',w<$$4*(D +("e0!8%%(<!$ $"<(c$#4,0% %(<!$q $*8E +8tg! %% <!$ $"<(c$#4,0%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,0% %(<!$ ac 8   @$LPT('LPT('LPT('LPT('LPT('%{  %{  {  += % '8"!< @DHLP T$z (,@@8C B< @DLP T$z (, @#$@* C+ AB# AD#0%7$0<!0$+@$48$NɠLɠJɠȠ%0%@<!$ $"<8c$#@8D<%<$%@$f$*@F+@C#@C#HeO $#!+H( (NiLiJih%%@<!$ $"<8c$#@8D<%0<c$%@$`$*@C+@F#@F#HO $0&!0+H( ,NɠLɠJɠȠ%0%@<!$ $"<8c$#@8D<%<$%@$sf$*@F+@C#@C#HeO $#!+H( 0NiLiJih%%@<!$ $"<8c$#@8D<%0<c$%@$;`$*@C+@Fb#F#(/$(!(+0"X4%%<!$ $"<8B$"@%<!$ X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'0X\`4'0X\`4'{  %  %{  %  %{  %  %{  %  %{   += % '0"#! 48<@ $ (8 %% PTX,'PTX,'+= % '8wH$$@*(D+(A#(AD#8&?$8<!8$+H% eLN %(%8<!$ $"<8c$#@8D<% <$%8$$*8E+8D#8D#HO $ $! +H' gLN % %8<!$ $"<8c$#@8D<%(<$%8$W$*8D+8Ea#8E#HO $(%!(+H'V a<>%%(<!$ $"<8B$"@8D<% %(<!$# a c LP $z (, @0X\`4'X\`4'X\`4'X\`4'X\`4'%{  %  %{  %  %{   += % ',w<$$4*(D +("ne0!8%%(<!$ $"<(c$#4,0% %(<!$H $*8E +8Ha! %% <!$ $"<(B$"4,0%(% <!$ ac 8   @$LPT('LPT('LPT('LPT('%{  {  += % '8wH$$@*(D+(Ar#(AD#8&?$8'<!8$+H%d a,.%%(<!$ $"<8B$"@8D<% %(<!$? ac LP $z (,$@8 C$D(B <@D $ @(X\`4'X\`4'0X\`4'X\`4'%{   += % ',w<$$4*(D+(A#(A8#8&?$8'0!8$+H% eLN %%(<!$ $"<8B$"4,80% %(<!$r $*8E +8ug! %% <!$ $"<(c$#4,80%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,80% %(<!$ ac    @$LPT('LPT('LPT('LPT('LPT('%{  %{  %{   += % '8"!< @DHLP $z (,'@8C B< @DLP $z (, @0X\`4'X\`4'0X\`4'+= % '8"!< @DHLP $z (,@#$@* C+ A# AD#0%7$0<!0$+@$8NɠLɠJɠȠ%0%@<!$ $"<8c$#@8D<%<$%@$Df$*@F+@Cf#@C#HeO $#!+H([  NiLiJih%%<!$ $"<8c$#@8D<%0%<!$  $*@C+@F0#@F#HO $0&!0$+H($ $LN ɠȠ%0%@<!$ $"<8c$#@8D<%<$%@$f$*@F+@C#@C#HeO $#!+H( &LN ih%%@<!$ $"<8c$#@8D<%0<c$%@$`$*@C+@F#@F#HO $0&!0+H( (LN ɠȠ%0%@<!$ $"<8c$#@8D<%<$%@$m,0    W@#$@* C+ A# AD#0%7$0<!0$+@$w84$DFȠĠ% %0<!$ $"<8B$"@D<%<$%088$<!    @$X\`4'X\`4'X\`4'$X\`4'X\`4'X\`4'X\`4'X\`4'X\`4'0X\`4'%{   %{  %  %{  %  %{  %  %{  %  %{   += % ',w<$$4*(D +("e0!8%%(<!$ $"<(c$#4,0% %(<!$q $*8E +8tg! %% <!$ $"<(c$#4,0%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,0% %(<!$ ac 8   @$LPT('LPT('LPT('LPT('LPT('%{  %{  {  += % '8"!< @DHLP $z (,@#$8@*0C4+0" <!@J ($+H !@($JV%H*+P@!@ ($LT%HI+P@!@ ($J6%0+H !@!$+0"!0Š%%(<!$ !$"%% <!$ $"<8B$"4,80%(% <!$% ac ݀  $4%% LPT('LPT('LPT('LPT('%{  %  %{   += % ',"!0 48<  $4%% LPT('LPT('+= % ',w<$$4*(D+(A#(A8#8&?$8'0!8$+H% eNLJ%%(<!$ $"<8B$"4,80% %(<!$r $*8E +8ug! %% <!$ $"<(c$#4,80%(% <!$H $*8D +8Oa!(%%(<!$ $"<(B$"4,80% %(<!$ a c    @$LPT('LPT('LPT('LPT('LPT('%{  %{  %{   += % '@"$8*(1<+ b^+ AY##$#4!a %8%0%$($ !$%0% +8",!%!%%%(<!$ #$"#A # $'$ $! $+("1%A%A%A%% <!$ $"#A # $'$ $! $+("1%A%A%A%% <!$ $" $"<`#[  #<B$"$(< !$(' > $"<`#[  # $"<`#[  #<]0B$"$&< !$&' > $"<`#[  # $"<` <<$c  $$#' > $"<`#[  # $"<`#[  # $"<`#[  #<\B$"$8 $"<`#[  #<^B$"$6 $"<`#[  #<B$"$4 $"<@  7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  "<B$" 7<@"[  "< 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  "<|B$" 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  "<B$" 7<@"[  "<B$" 7<@"[  "<B$" 7<@"[  "< B$" 7<@"[  "<B$" 7<@"[  "<B$" 7<@"[  "<B$" 7<@"[  "< B$" 7<@"[  "<$B$" 7<@"[  "<(B$" 7<@"[  "<,B$" 7<@"[  "<0B$" 7<@"[  "<4B$" 7<@"[  "<8B$" 7<@"[  "<@B$" 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  "<\B$" 7<@"[  "<`B$" 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  "<|B$" 7<@"[  " 7<@"[  " 7<@"[  " 7<@"[  " 7<@ <#c  ##",d,%& 90$0e& 42$2e& /4$4e& *<d<%& %c! K  (!(C,B K  8!8C<B K % '+= % '#e ! "d&@"d&D@"d&D@"d& D c! K % '+= % '#e = "d& 6 d %& 1$$$e& ,($(e& ',$,e& "0$0e& 4$4e& c! K  !C B K % '+= % '#e ! "d&@"d&D@"d&D@ " d& D c! K % '+= % '#e  "d&D@"d&D@"d& D c! K % '+= % '#e ! "d&D@"d&D@"d&D@"d& D c! K % '+= % '#e $ "d&  d %& c! K  "c ! K % '+= % '#e T "d& M$e& H $ e& C$$$e& >&$&e& 9($(e& 40d0%& /4$4e& *<d<%& %c! K  ,!,C0B K  8!8C<B K % '+= % '#e ! "d&@"d&D@"d&D@"d& D c! K % '+= % '#e !B&"!,''+= % '#e  "d& D c! K % '+= % '#e  "d&D@"d&D@"d& D c! K % '+= % '#e  "d& D c! K % '+= % '#e ! "d&D@"d&D@"d&D@ " d& D c! K % '+= % '#e  "d& D c! K % '+= % '"d&@b$& D !c K % '+= % '"d&@b$& D !c K % '"d& @b$&D@b!&A!8  "d& @b$&D@b!&"!,  += % '"d&@b$& D !c K % '+= % '"d&@b$& D !c K % '+= % ' "'C'" !   ' 7'A7'AN7'A7'A{N7'A7'AN7'AV7'A7'A{N7'A7'Ao7'AU7'AKU+= % ' "0'C'"0 !48 <@պ $ (DHLPT,' += % ' "('C'"(- !8CB T D8< F T4< 8_  #&8*@LP@BLPB$H4<@D  04S  $(,$0 ,( '$  PT8'+= % 't $<\>B$p \Dd „ @|xS H@dhl \D LPTXPL 'H@ Ab XTL'$  `'+= % ' $!$ ~!$ ~<~B$"<@[  "" D$'<!$s!$ $ K  % $C(`A$+Az`!A<,!$$ K  % %  !8  % %P<ԅ!$ $ !$? <ԅ!$ $x !8 %  ` { ,  `X\d|4 |'$j $ @0 %(%0%8%@%H''''<'D%p%H0%P%% h*X`xtl%!  t+( $<!$g  % pe$(!(<@_  !"x!$4 Blptx <@B$lp <@B$tx<\!$$l' $J l!  %''!$ !$ 9@x`t\ <B$` "%x<7!$1$' $J %'P'!$ !$TX\''P'!$ !$a@#$'!$7W!$B$a$TX\' <B$<!$:$' $J %'P'!$ !$TX\'+= % '|/G2 tx <@B$txD K /@C<6& w $@HL@BHL  `@0''+" % @@'|''!$ !$A$<B$|<`  8  } 8 > e / |'''!$7W!$B$a"$< `@<@!$|' @%|''!$7W!$B$D'p'!$ !$<Ʉ$D8H$T<@$$ D'<@c$K5 `' '8   ' ' $' '$' '$' '$' '$<'$'w '+= % ' "'C'" ! ''+" % ``'# $ S $ $ } $ <$j @($ $  %''!$ !$a<υ!$ $$<$''!$7W!$B$ah''!$ !$A<!$h$l$p猄$h'''!$7W!$B$a''!$ !$%L$<$'!$7W!$B$ nj8% 9 '' XtL''!$ !$$L'0'!$7W!$B$''!$7W!$B$+ gX%X $  !  \8 &@@B''!$ !$A<B$7$!$  W< `X<!$@' X@'D'!$7W!$B$aHda#$h'!$7W!$B$aptKLÎ `P'048< <@B$04`d <B$8< @```<d[  $`% %|''!$ !$#dŽ @h'($%(|'%0%!$7W!$B$a#dÎ `h'PTX\a <@B$PT`"#!   C8BL"`!@<@!$ 8"<@L[  L""< c!$X` @~ $""<`#_  $#X P4a< 0a_  "!0b  <c$ $ G (0 $ <Գ   "W$#<$hlph'$3$" ! # <$!','N w   -d dDB$' a <<c$<@c$<c$ $ G (" p"!$hc  hdf<l@a!( 3B8@$" #9`d <$njc~<@lw l'w l',w l'w l'N \0''!$ !$A|4 <B$`! <@B$\0 -d  <B$<!$7$' $J w l'$@g@%!@ &P$ @c$  <@lw l'w l'8'!$7W!$B$!$$-X$$p'%!$7W!$B$!8'd'!$ !$!$pt@Dx|HLPT_ ; <ʌ5LPPXPlqP!PK\+P@ $<`'!$g  hX$d'; <ʌ50 $XGqk%!<뎪` LH<`'!$8' hX $LHd'0 $; <ʌ5%%%$8&8$!8&H !$ ጌ%  += % ' "'C'"Ž ! '+= % 'Ž Î,04   $8<@(''+" % xx'''!$ !$A<B$<8B$ <c$  H!%@b$&D9@b$&D4@b$& D/d%& * $ e& % ! c K  !CB K  !C B K % '"d&@b$&D@b!&A!,%  += % '"d&D4@ " e&E/@"e&*@b%&E%@!b K  !C B K  !CB K % '+= % 'X'h'!$ !$ATBH@4/ <'''!$7W!$B$a'<'L'!$7W!$B$a4;<c4#8Cp8!"  <' '0'!$7W!$B$aX'<'L'!$7W!$B$aX'<'!$7W!$B$aP'P'+= % '4 "8@0Cnc8`Cuc8`Clc8 `Clc8`<@(' + $"! $ @$y   *@7`@B< t7 xx" @<0B$'a ` ,(48gO ,(G ,(O $gO , (N  @$&" <+0*8"c,$f%`%%(@<LP0'+= % 'p l"@x|h'8!P $ @$y  !x|h';<c4b4xap4!A|$h'T'd'!$ !$A  D# '# 'X, -d $<@b%&9@ b %&E4@b%&E/@"e&E*@ " e&%@!b K  !CB K  !C B K % '+= % '"d&D"@ " e&@b%&E@!b K  !C B K % '+= % '"d&D4@ " e&E/@"e&*@b%&E%@!b K  !C B K  !CB K % '+= % '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@!b K 5 !C B K ( !CB K  "c! K  $"$c(! K % '+= % '"d&v@ " d&q@b$&l@"d&g@ " d&b@("(d&]@0"0d&X@4b$4!$ O !CB K B !C B K 5 "c! K ( "c ! K  $"$c(! K  ,",c0! K % '+= % '"d&D/@ " e&E*@"e&%@!b K  !C B K  "c! K % '+= % '"d&4@b$& /$e& *$e& %!c K   ! CB K  !CB K % '+= % '"d&D@ " e&@!b K  "c ! K % '+= % '"d&Dj@ " e&Ee@"e&E`@"e&E[@ b %&EV@("(e&EQ@0"0e&L@!b K B !C B K 5 !CB K ( !CB K  $"$c(! K  ,",c0! K % '+= % '"d&DS@ " e&EN@"e&EI@"e&D@$"$e&?@!b K 5 !C B K ( !CB K  "c! K   " c$! K % '+= % '"d&D@ " e&@!b K  "c ! K % '+= % '"d&DU@ " e&P@"e&K@b%&EF@b%&EA@$"$e&<@(b(%&E7@,b,%&E2@!b K ( !C B K  !CB K   ! C$B K % '+= % '"d&D@ " e&@!b K  "c ! K % '+= % '"d&D@ " e&@!b K  "c ! K % '+= % '"d&DA@ " e&E<@"e&E7@"e&2@!b K ( !C B K  "c! K  "c! K % '+= % '"d&D/@ " e&E*@"e&%@!b K  !C B K  "c! K % '+= % '"d&De@ " e&E`@"e&E[@"e&EV@$"$e&Q@,",e&L@!b K B !C B K 5 !CB K ( !CB K   " c$! K  ("(c,! K % '+= % '"d&D4@ " e&E/@"e&*@b%&E%@!b K  !C B K  !CB K % '+= % '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@!b K 5 !C B K ( !CB K  "c! K  $"$c(! K % '+= % '"d&DF@ " e&EA@"e&E<@"e&7@ b %&E2@!b K ( !C B K  !CB K  "c! K % '+= % '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@!b K 5 !C B K ( !CB K  "c! K  $"$c(! K % '+= % '"d&DX@ " e&ES@b%&EN@"e&EI@ " e&ED@("(e&?@!b K 5 !C B K ( !CB K  "c ! K  $"$c(! K % '+= % ' "('C'"(, 04  8<@$'+= % '("z@<@&!$  <%!$ (C D#<`[  $$< X!$ <B$"<@c$#< [  $$ %<[  & &< n!$ <@_  "#"B$"<`_  #$#h "$!  !j <B$<!$$' $J %'\'!$ !$$<$$<%$$<$ h,(4<$0<<$8D<!$@$L<#W!$H $T%<% &@04j <B$04<!$$0' $J @D8' $(,j <B$ $>j <B$(,<!$$ ' $J @D8'+= % ',"@$ #! B0 %, @"!C8Q`B8@%$ !(< WB$$ 3 $ !(%<% &@04j <B$04<!$$0' $J @D8' $(,j <B$ $>j <B$(,<!$$ ' $J @D8'+= % 'T <@!$X 9K 0''/'!$7W!$B$a ptm  % % %%0t<p_  #$p  !  !$$ += % '$7("$B@B$"8@$<B$ !8 $<-B$$  lpt/\ `'Xlpt/\ `'lpt/\ `'$8&8$!8&Hh !$H Hጠw `'+= % ' "'C'"Ž ! '+= % '(!, < !$ "<@0_  "0#"4 "#8"<"$6!  @DH ' "#!@DH '+= % '"(&b @!$ K  48<'$4<!$8$<'+= % 'h "%  $"<`#[  #  $"<`#[  #  $"<`#[  #  $"<@"[  "<ԇB$"$&<`!$8&' > $"<`8   $"<`#[  # $"<@"[  "<_B$"$  $"<@"[  " $"<@"[  "<B$"$ $"<@"[  "<]B$"$  $"<@4  $"<`#[  # $"<@"[  " $"<@"[  "  $"<@"[  "  $"<@0  $"<@"[  " $"<`#[  #  $"<`#[  #<jB$"$< !$8' > $"<`#[  # $"<`#[  # $"<@"[  " $"<`#[  # $"<`#[  # $"<`#[  # $"<`#[  # $"<`#[  #<\B$"A$(< !$8(' >  $"<`#[  # $"<`#[  #  $"<`#[  #  $"<@"[  " $"<@"[  " $"<@8 <@#c  #8#"  $"<@"[  " $"<`#[  #<*B$"$  $"<@"[  " $"<@"[  " $"<`#[  #<#\B$"$$ $"<@"[  " $"<@"[  "<+\B$"$  $"<@"[  " $"<@"[  "<"B$" $ $"<@( Ǡà!$C+00 $Ǡà!$C+0. $Ǡà!$C+0, $Ǡà!$C+0* $Ǡà!$ B+`( $ǠŠc$+(C0 $$< $< J!$ ''!$ !$A   j! (,%'% '$'!$7W!$B$'''!$7W!$B$< l!@Da$%8+@"!@Ba$%+8"!@%@%%80 $*8C  < <%%H% +8$!8+H" >!H)L $%8'+H" !H)J $% +8"!H)%H$%%8 d$*8D  < <%%P%  +8ba$!8+P"|@>!PJT a$%8G+P"p@!PJR a$%+8"f!PJ%PC%%8~ $*C` < <%( +N`$!+8"Gc!8<$%+8";!8:$%g+ "1!(%(%% ,`($<#!$ $"'G'!$ !$;<!4 $>' $>' P B$#PW J1!(% % <̄4@HPP $PKq#@ ^@0%109&@F $*P@$$$$' -d "# !LH D! %P'|'!$ !$$T<F!$PH\LX$d<$` $l@"#$ ! i! *'<c$$ Ab !"+0 B$""<@ [  " "!$$ ! a< a_  "!b'+= % '"S@@ <8ŽÎĎ ŎH  $ <@!4(h 0,<c$& a48¬<A< A_  %!E!$ $"| "!Lb<@ b_  !" a!$ $U} V @% <" !0!$ $~ "<@0"_  0#"#/!$ $~ "<@0"_  0#"#$H8''+" % ||'`'|'!$ !$a`d hlp tx| ƌ'`'!$7W!$B$a(, 40/85 \L<P@T 1 a< a_  "!bP"8 @"8]@% _%T" !''"HDX< !$ D"H"<@X  Cc  X$!#$ A< !$ P"T"<@  Cc  $!# $ A\L%% %(%$ (!(D D8 D8 D$T$%$+= % ' $$ b!  !$ (,04'+= % ' $$ b! !$ (,04' < <  < < += % 'LC(`A$+A`H!AB$"""< !$ DD"<@$P @$C Fs  @'!% $#P#&@'HP% DL AC 48:$ L  Dy8 t>@D8 <!$dDhd'l$?t4!^  t"@ < <⎄?l p't"@"#$ %!<<B$<@B$ x |$({! 8,04zH@t8 $$%(P'!$7W!$B$'P'`'!$7W!$B$a @Ht< $$%(P'!$7W!$B$ 'P'`'!$7W!$B$a @Ht@ $$%(P'!$7W!$B$$'P'`'!$7W!$B$a @Ht< _  #!4w |?l p't4!w ?l p'!(Bx|  @?l p' < <⎈p'(ax|  p'w p'+= % ' " 'C'"8 '+= % '(,$7,"$Cw$Wc$a(!$  $<\B$"$'$4!^  $"@ < <(, '$"@! B @ (, '4!w (, 'w '+= % ' "'C'"7"$Cw$Wc$ay8 '+= % '(,$7,"$Cw$Wc$a(!$  $  w<8a_  8"!b\"#HB*b @7`B! 7X'+= % 'LwHe< g  $%$ &Hc'`'p'!$7W!$B$$'4'!$ !$w!$$ $+= % '<!$ $"$"e$"p$ "$ '<*!$$ $+= % '<!$ $"$"e$"q$ "$ '+= % 'i!  $!$% 8<8<$( 'B$D($c$#(/0&!%8<8<$( '+= % '< <`[  !DJ,-./+` $DJ()*++`8 $ $"<`#[  #<2B$"$< !$\' > $"<`\  $"<`#[  #<6B$"$: $"<`#[  # $"<`T  $"<`#[  #<B$"$$< !$\$' >  $"<`\  $"<`#[  #<>B$"$"< !$\"' > $"<`#[  # $"<`#[  #<9B$"$ < !$\ ' > $"<`\ <$c  $\$#<;\B$"!$ $~  <`!$X $"<`#[  #<B$"$< !$\' > $"<`#[  # $"<`\ <$c  $\$#<{B$" $"<`#[  # $"<`#[  #  $"<`T <$c  $T$#  $"<`#[  # $"<`#[  #<\B$"$< !$\' > $"<`\ <$c  $\$#<\B$" $"<`#[  # $"<`\ <$c  $\$# $"<`#[  #<| B$"$*< !$\*' > $"<`\ <$c  $\$#<LB$" $"<`#[  #  $"<`#[  #<]B$"$J  $"<`#[  # $"<@"[  "  $"<`T <$c  $T$# $"<`#[  #  $"<`#[  #<~B$"$@  $"<`#[  #' >  $"<`T <$c  $T$# $"<`#[  #  $"<`\ <$c  $\$#<}B$" $"<`#[  #  $"<`T <$c  $T$#<}B$" $"<`\ <$c  $\$#<տB$" $" $ $"/$ $"5$ $"<$" $"$  $"$ $"< $<_  $"!<('+= % ' <,<B$    !@D '+= % '$(, } <`0 48@  !@D '0 48V>  !@D '+= % '<>!$<4!$ '(, 0 48$'+= % '֎ ;@C < $B$8F8$!8&Hh B$ %<@9!$ "<@[  ""<B$ $'< z!$ += % '?$?`Sx,l$(?lph<=`Sxl$( $"0#$+a` $+a`$+aX`C #8o`* `% % $#070!0c$ $  *'$' e! !8$ '$' e!  *c8c,xH'$' e!  Y` #8` #8`xX!$'$ e!  x\d% n'$' e! t q`x$+a.` #8`#8`'$' e! [ U`V|'$|' e! M J`x#8`xb% !#8`xb% ##8`xdb #07$0#8 !0 ldpe<hd_  ($hh% ,$+aQ`*$+a"`)#8 `*#8~`xb%   '$' e!  v +!8 dhl'$d' e!  h`xx!$'$ e!  xd% 2$+a+`-#8`2#8.`ptx'$p' e!  t`xqx!$'$ e!  xu3#8``9#8`#8`x-x!$'$ e!  $xW 8?#$?TSlO`$(?`d\<=TSl`$( $"*$+a}` $+a`#8`+bM #8#`l!$'$ e! B pd9<#8`#8`#8`<b*TX\'$T' e! & X~`!x|'$x' e!  | x'$' e!   |@ -d Da< @d_  "$@b+$+aX`##8`,b)#8&`hb(%(% $#8?0!8$$ $+0 2%(je+#8`d(% % $#070!0c$$ $+(a*% T%,#8m`3#8Q`f8$#(/0!(%4f(% % $#070!0c$$ $+(a %X$d\$'$ e! X $%+#8`x0!$'$ e! E $-%x!$'$ e! 7 |d3QC''''''''''''$''%%{  %%{  %%{  %%{  %%{  %%{  XQ``dhT'$`' e! = d:`PdLe$Hf+8 $<!$g P< H_  "%H%(%0%Le $(pdh$!(`<玹_  &''F%{  %%{  %%{  %{  %%{  %{  %%{  += % '$"A@! $"'$@ $"<$>' > $"$< $"$: $"$8 $"< T<_  T#!<㮃 " <   $"0$4 $"+$2 $",$0 $"$. $"$, $"< T<_  T"!< <@ `! #$6<BJ ^ %H+\ d%Xb n%`% !@(&0!$*0% +0"!8#+@&(,0'%{  {   '+" % ``'"8@!8 3k 7<@4"_  4#"# $'w $'+= % ' " 'C'"8 '+= % '$78 <!$$'$ !< RB$('   'w '+= % ' " 'C'"8 '+= % '(,"!@4!$D8$<$ B8@$<-$$+@'>ip!p#$'!$7W!$B$a<`<+!$ <+!$' %!$7W!$B$%''!$7W!$B$a'% %{  % %{  %%{  % %{  %%{  % %{  %%{  % %{  %%{  %{  {  '+" %  '+"@`t$ ap! p$%8'%@%!$7W!$B$+H') Hap!%< <+B$ <+!$' t$p)$%!$7W!$B$!''!$7W!$B$!% )%p*$!$7W!$B$A''!$7W!$B$A%)%8@+P@Php!p*$'!$7W!$B$A+P'@Pip!<@<+B$ <+!$' t$%*P(@%;'%!$7W!$B$+P@hp!p#$ '!$7W!$B$aÎ'''!$7W!$B$x' '|'!$7W!$B$ `*`c8%t$ )%*P(@%<'%!$7W!$B$+X'A`ip!p#$ '!$7W!$B$aÎ'''!$7W!$B$x' '|'!$7W!$B$ `*`%t$ >'% %{  %%{  % %{  %%{  %{  {  '+" % 'd$%%&(gj&0#02( +0$t$@p!P(pK%%`'%h% !$7W!$B$a+X`%!(#@<`<+B$ <+!$' t$ p+$% !$7W!$B$a''!$7W!$B$A) #0($} '$*0%C +0at$8p!Hp*%%X'% !$7W!$B$A$+H+K $!p#$'!$7W!$B$aÎ'''!$7W!$B$x'''!$7W!$B$ `*`c8%@K '$ ' !$7W!$B$ ''!$7W!$B$%t$ *@+@bp!ip$$'!$7W!$B$c$!i p#$'!$7W!$B$aÎ'''!$7W!$B$x'''!$7W!$B$ `#a'!$7W!$B$a<㎚`<+!$  <+!$ ' t$ %% {   !$7W!$B$ ''!$7W!$B$%t$ p!#p$$'!$7W!$B$c$!i p#$'!$7W!$B$aÎ'''!$7W!$B$x'''!$7W!$B$ `#a'!$7W!$B$a<㎞`<+!$  <+!$ ' t$ %% {  %{  % {  %{  += % ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h$U" P!!(8TX \H4D,' h$U" P!!(4TX \@0<,' h$U" (84P!TX \,' h$U" (,  !8 l$pL'lpL'l$pL''+" %  'w+"`t$ ap! p$%8l'%!$7W!$B$+ 'ap!ep#$'!$7W!$B$aÎ'l''!$7W!$B$x''h'!$7W!$B$ ` ad$d+0t$8p!8p$%Pl'%X%!$7W!$B$!+8Dp!hp#$'!$7W!$B$aÎ'l''!$7W!$B$x''h'!$7W!$B$ `ad$d+ "Lt$(p!(p$%@l'%H%!$7W!$B$+((5p!p#$'!$7W!$B$aÎ'l''!$7W!$B$x''h'!$7W!$B$ `aCc$C'%{  {  % %{  %%{  %{  {  '+" % \\'#de(/(@(!($ 0fp $#0$8 ,$ 8'p)$,!$7W!$B$!(0''!$7W!$B$!%% $*H( $@c &`L@k T %P&PjY @n %X&Xa &PLc @l %`&PL@d &Xl$Hi*P#@#H#+P;@!H$t $XHq!,p+$%`0'!$7W!$B$a+X,%`H*q!(<鎰  <+B$, <+!$(0' ($ t $% % {  %{  '+" % PP'#a,d$0/!($C((B  " (%$,0'p($% !$7W!$B$8<''!$7W!$B$  " $d$;+@"@!@t $P!q!PpK%%`<'%h% !$7W!$B$a+X )`$@(q!8<莻4<+B$ <+!$8<' 8$4'%% {  {  '+" %  ' !$7W!$B$!''!$7W!$B$! @H*%*XD`+%*`dP!H#!%+`'t $hqt%!p.$'!$7W!$B$!%+H' %!p#$ '!$7W!$B$aÌ'''!$7W!$B$x' '|'!$7W!$B$% ` a  !+@'it$Hq!p)$'!$7W!$B$!!C+X'U`q!p#$ '!$7W!$B$aÌ'''!$7W!$B$x' '|'!$7W!$B$% `#a'!$7W!$B$a!$ $~ W< @L!r" ( @<@!$ ("<@@[  @""<`b!$'F8A)9 L)9 S)9 E)9& a9 l9 s9e9f8a8l8 s8 e8%%:4 $+88G-$8$'@'!$ !$ $+8b$' H!$ <uB$""<@LP_  L"P#" " #%%X<!$ c$$ $ <c$ < $de<| c  !"|&a b$af<>!$ c$$ $ <`c$ <$de< c  !"&a b$af0,($<>$%!$$( '! 8, K  ,$<c$'$<c$,$=!X'x'!$ !$!$$ $$|04!$d$h$lx|'<'!$ !$a<!$$ $$ %%(8<@''!$7W!$B$a!$d$h$lx|!$$ $$|04!$d$h$lx|'<'!$ !$a<!$$ $$ %%(8<@''!$7W!$B$a!$d$h$lx|!$$ $$04!$d$h$lx|'<'!$ !$A<!$$ $$ #%8<'@'<'!$7W!$B$a!$d$h$lx|!$$ $$04!$d$h$lx|'<'!$ !$A<!$$ $$ #%8<'@'<'!$7W!$B$a!$d$h$lx|!$$ $$04!$d$h$lx|'<'!$ !$A<!$$ $$ #%8<'@'<'!$7W!$B$a!$d$h$lx|c$$ $|04$d$hlx|'<'!$ !$<$$ $$@F%08<@''!$7W!$B$c$d$hlx|B$0!$$ K  %<2>!$$ K  B$$<,B$< !$'$ <|B$'!!$$ K   $A< A[  !<'!$A! "!" g  <@$C_  !#$A!,"0!  "HB(b"IB)b"LB4b"PB8b" #8`Ad#8`Cnc8`Csc8`$(A)A#@dDez<a  #8`Ag#8U`Cac8Q`Cnc8M`Cdc8I`Cic8E`< !$ !D!!$$ K b !$$ K % B$"c$$< !$'$ <|B$'B$$<|B$< !$'$ <|B$'$<4$$'lH@,e(4e%Dp8:@"@#$! @d!  F!$$ K  @"`@#$%&'! @ d$! (,%%%@uc`4T<@!$ T"<@4[  4""%<\!$d@<`!$ @"<@d[  d""!$$ K O ,"'@< !$ ,CB#<`[  ""<B$0b<@b_  !"a48('!$ !$$ $$04!$d$hlx|'<'!$ !$<!$$ $$ &%08<@''!$7W!$B$<@c$ $C$HD$lE$<+!$d$h$lx|!$$ $$04<@!$ $A$HC$lD$<+!$$' $J '${  += % ' < <'$  ''+" % DD' < <㎈''!$ !$<>$$$ < $ $04<@B$ $C$HD$lE$<+$$$ CDd''!$ !$<$d$hlx|B@'`'!$ !$a<+c$@$D$HLP$$$ < <㎈''!$ !$$@DHTX<@B$ $C$HD$lE$<+$$$ CD''!$ !$<$$Bd''!$ !$a<+c$d$h$lptc$$ d$j lcp$ `h'|'+" % '%%% %(%0|''!$7W!$B$$8$%(%*8&840dC`B,|''!$ !$ "d& 7 $ e& $%$f&(% .!c K $ (!$(!$ #  D!$D!$ #  !CB K % '+= % '"d&@"e& % f&(% @!b K % '+= % '"d&@"e& % f&(% @!b K % '+= % '"d&D,@"e& % f&(%#@"e&@b%&EB8@!b K  !CB K % '+= % '"d&D,@"e& % f&(%#@"e&@b%&EB8@!b K  !CB K % '+= % '"d&DB81@"d&$e& %(@ b $&B8"@b$& D$e& !c K  !CB K % '+= % '"d&D@ " e&@!b K  "c ! K % '+= % '"d&@b%&B8@ b %&B8@ b %&EB8 @!b K % '+= % '"d&B88@b$&D3@ b $& D.!c K $ "d& Dd%& !c K  !CB K % '+= % '"d&@b$& D !c K % '+= % '"d&B8$@b$& D!c K   " d& D% c!  % '+= % '"d&@!b K  "d& D%  c !  % '+= % 'u" '+= % ' '+= % '< !$  $"DLR^%0%8(%@j+HC \XT0, $.$?P''!$ !$AP't# P'@'$ # P' #  C8 ` ' K  % #+ #(E+E%(2%(4%(6%(#0# #' $ d&'`$b%!8D('  % %  += % ',8*A`%=@ *"L (& #% E$!0e+ %!(+-`%%%4&($%(F$!8+ %!0+ % %% # @'@'k$?@'$ %,# P7@'$ &# P '#  "8 @ ' K  B4$"S<9B4("^<%B4,",+<lB4("DLR^%0%8(%@j+HC P,| $%(%0:%0<%0>%0EF:%(6D%(<%0B%0>%(%0:%0 <%0 >%0E F:%(6D%(<%0B%0>%(%0:%0<%0>%0EF#":%(6!D%(<%0 B%0>%(%0:%0<%0>%0EF+*:%(6)D%(<%0(B%0>%('%0&:%0%<%0$>%0 E$F32:%(61D%0<%(0B%0>%(/%0.:%0-<%0,>%0(E,F;::%(69D%0<%(8B%0>%(7%06:%05<%04>%00E4FCB:%(6AD%0<%(@B%0>%(?%0>:%0=<%0<>%08E<F&(# $   *%4%,%2%f.%%0%2%f4%f&%dACE$('$?$@)$A$BCT$D&$EZ$FGc$HI$J$K$Lf$M$N$OP$QG$Rr$S;$T-$Up$VWXYZ.$[$\7$]$^_p'<'!$ !$A@$<p'(-# p'`'$ N3# p' 3# @C8 ` ' K  A$?<0B$# (,0' (k%!H+)&@ J)1H &($$*@H8F  <`4)%!@(FTJ1!PIJT %@ RJ1!PIJR %@H0!PIJ%(H  <`4)%  <`4%!8琀8  %( %0 :%0 <%0>%0J%8'FT %@HL %8'R %@HN %8'%@(J %@(L %@(&% $'!$7W!$B$a '<ޡ!$ $ <B$j += % ',"#04 8<@D $qG# ,"#@/! d!0+!f$0%'(`$%F$# ('@- $#@!0!%#@!0a%!,!&' $!$+$s@$  $(,I# !@"-$!("s!" )B - $# !0!%# !0a%!,!&' $&!+as $  $(,I# !@"-$!("s!")>- $#!0!%#!0a%!,!&' $&!+as$  $(,I# !@"-$!("s!"KS'b'!$ !$a3'B'!$ !$a)`% %  $S'&8h|x   S'|x3'$  $(,I# $*A@$3'& C   '$%  $%  @$%  $%  # `L@'O'!$ !$ '0'?'!$7W!$B$t'd'!$ !$d$Pt'%!$7W!$B$X' '/'!$7W!$B$at'@'$ `'AD# @'P'$ K W` '0'?'!$7W!$B$a'p'!$ !$a'LP!$7W!$B$ad' '/'!$7W!$B$a'@'$ P'dE# @'`'$ K `X\T'# 6  < !$ $ '$ F# @'' '!$7W!$B$a$@'8'!$7W!$B$a$,L# $$A@0('!j `'+" % ''?'!$ !$A$W(w'0$ +G# 0'KM# <''!$ !$A<'' $ 0$v># "@0'$ F# @'' '!$7W!$B$a$@'8'!$7W!$B$a 'Aj "#"%$,%$%d$*%&%$%$"%$$%$&%$%2% . &<% 4%( &:%(6% $, '%( ':%( '<%('>%(!0'8$(/!(E+!C<BJV%H*T\%PjZf%Xflrz%x%0%Q#'(")*+%, - . & / 01$+= % ' # ,'['!$ !$Ad7hW,'0$  $# `,'L# $`A@\'+= % ' # `<*Ay@XCD<+(+ <&wc,$d%X`h `% 'O'!$ !$ 'L# X`hP`\  X`\ d+G# X"C0`$$#0+(#(#C+C#c$f,!F$0% '(@$ % #"@PL# X"#B$"B,!C"lT'$lT'$y?$z@${A$|B$}C$~D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T $U $V $W $X $Y $Z $[ $\ $] $^ $_ $` $a $<b $=c $>d $?e $@f $Ag $Bh $Ci $Dj $Ek $Fl $Gm $Hn $Io $Jp $Kq $Lr $Ms $Nt $Ou $Pv $Qw $Rx$Sy$Tz$U{$V|$W}$X~$Y$Z$[$\$]$^$_$`$a$b$c$d$e$f$g$h$i$j$k$ $!"#$%$&'()$*+,$-.$/$0$1$23$4$5$678$9:$;'xL# l'<' M# ''!$ !$A' $ <'M# '' $ K  'B$"$<|B$(,'!!+= % '$# HLP TX\`d h$l(p,t0x4T# 8<@|D'+= % 'L`&8l!(T!%8X*@b+@bP<!$'$ <B$j '''!$ !$a B/%.4:BN%@ LT%H*R^%Pj !"#$%&'('<'!$ !$a,T0L($8<'4HD(' $[# @'+= % ',';'!$ !$Alph`d\<$#8?0L!0D$#@G1P!(D$H%%PHDL@<'(-t7XW,'$ ?# tX# L@< PHD,'$ $# @A, .( t7XW,'$ ?# tX# L@< PHD,'$ $# T'$  "#%b #%b #%bB$$* # $%"+= % ' B/%e780BG%0FLRZf%Xdl%`jv%hv|%Q%r%t<=>?@ABCDEFGHIJK,';'!$ !$aL'l'!$ !$aPTL\`X$hl<'d,'L' $[# Wtx| ,'$ $# p'h'+" % ' ' '!$ !$A ' $ $S#  @ $('%('8h%0hB%0hD%0c%f'0`%0GHnj&@g+8g-Ɍ+H$@ %8.$+%!# # HLP TX\`d h$l(p,t0x4T# 8<@|D'<'!$ $ <B$j <!$$ <B$j h%0hB%0hD%0c%(%fHǐ$ǠŬìnj&(nj&'8'@`%8Fnj&@+8g-Ɍ+H$@ %8.$+%!# # HLP TX\`d h$l(p,t0x4T# 8<@|D'<'!$ $ <B$j <!$$ <B$j %( G%0 G:%0 G<%0B%F(,04$!!!  $$0 0 0% @0 0C 0% !! (&,&00&(4&8 !$"(0@!AC  0(0% @( 0C 0 c0B0%C@ c0CB0%C8'!CF GB@BH?JB_Bg % %(%8i%B@ 0<&@ $LP8<"#!8'' ]# < !$8B$@$*2>%0<D%8BN%@(D#$%!&'("$ $*2>%0<D%8BV%@H# $ % ! & '("@'+= % '%%%(%0%8!$(( h i*8@ih%P#gfb e 'i@X  %8G&8g!8+@"6 a b2% .D%(4% B%(6% &$% *% ,% a%&A a\# A, '$  {  %{  += % '048 <$$7(@]# <(&"*`%'''!$ !$@# D'$ $$ #b8!dD($'& a   04' $]# ,''+" % '$$$$$$$$ $ $ $ $ $$$$x'<!$<'c$!$7W!$B$a8'<8!$# f`''!$ !$d$'%!$7W!$B$'7R# ''!$ !$a'''!$7W!$B$a'$ 'x''!$7W!$B$a~S# X''7'!$7W!$B$aX'8' $ K `'(D)J *+b ^ .lt/~!!+!!x!+h!!XoD!+`o!!A+P`!*!!!*!!*!!*!+(&! !A!d+"!C!!!+a!"!+`!"!!"!!"!!" !S+3!"!a!+#!b!a !+a!"$!A+`!"(!a!",!a!"0!a!" !A+A4!a!b8!+C!a!b<!+b!A@''+" % LL'''!$ !$a#$'!$7W!$B$at''!$ !$aT'p'!$ !$a4'P'!$ !$aw'f# t'' 4`# 't'f# ' 4`# T''f# $ 0T'f# 0!$"(@T'' 4`# 4'T'f# $ ,4'f# ,!$"(@T'4' 4`# % (T'f# (!$"(@t'T' 4`# T't'f# $ $T'f# $!$"(@'T' 4`# T''f# $  T'f# !$"(@t'T' 4`# T't'f# $ T'f# !$"(@'T' 4`# T''f# $ T'f# !$0"(@'T' 4`# T''f# $ T'f# !$"(@t'T' 4`# % t'f# !$a"(@'t' 4`# ''!$7W!$B$a'+= % '8'W'!$ !$Ad8'z# X \'7'!$ !$Ah'z# X&b@ \% %(%l`'!0DƐ!8$&0%($*00B$+= % '8'W'!$ !$A'7'!$ !$A\'z#  B8@ %%%`X'! "8'!0EƐ& %dB$ D(b0B$+= % ' '('!$ !$A0W '# 4 '># 4W% $# a! !0"ǐŠ!$#(`8 $<@,''+" %  ' C8o`''!$ !$A''!$ !$A''!$ !$A$$$''' # '?'!$ !$A' 'z#  # @@'_'!$ !$A@'& C $   %32<(L D8*Z V 4,-n 0.t,/z(0$1 3589< " # $." &<4 (JF*+^ ,d -j ./z13!!+!a!T!!+r!!!TQ!+x0!!+p !.!!.!!.!a+X1!+A!*+H*!@ !!0+8'!0!A! +(%! !d+ !d!C!D!!D!"+!!A A!+8!!a!+#!b!aA !+#!b$!b+ !C(!!C,!!C0!b+!!AA!A+A4!a !b8!+C!a!bB<!+C!a@!a+@!#D!!#H!!#L!a+B!"AP''+" % ll't''!$ !$a#$t'!$7W!$B$aT'p'!$ !$a4'P'!$ !$awt'v# t' {# t'v# t' {# T't'v# $ 0T'v# 0!$"(@T't' {# 4'T'v# $ ,4'v# ,!$"(@T'4' {# % (T'v# (!$"(@t'T' {# T't'v# T' {# 4'T'v# $ $4'v# $!$"(@T'4' {# %  T'v# !$"(@t'T' {# % T'v# !$"(@T' {# % T'v# !$"(@T't' {# % T'v# !$/"(@t'T' {# % t'v# !$"(@t' {# t''!$7W!$B$a'+= % 'H'w'!$ !$AH'C# x |'G'!$ !$A'C# x&b@ |% %(%'!0DƐ!8$&0%($*00B$+= % 'H'w'!$ !$A'G'!$ !$A|'C# 0B8@ %%%x'! "H'!0EƐ& %dB$0D(b0B$+= % ' '8'!$ !$A@W '۵# D '# DW% /$# a! !0"ǐŠ!$#(`H0$LP<'@'+" % 'L0C8s`'<'!$ !$A' '!$ !$A''!$ !$A$$''' # 'O'!$ !$A' 'C# HLP # @P''!$ !$AP'H& C0$   %32*(L D)*Z V (,'-n &.t|%/zx$0t#10p"3,l!5(h 89d<`"\#X$.$"T&< 4P(JFL*+^ H,d D-j @.</z8143568 9 < " $,$ &:6()N *T +Z ,-v j /|1!!A+A!!!!+x0!!x!+h!!+`!,!a!,!A!,!!+H!)!+8(!0!! +(%! !a!D+#!b!+ !C!"!C!!C!+!!A !+5!b!a4!+#!C!a8!+#!C<!b+ !C@!!CD!!CH!b+!!A!A+AL!a !bP!+C!a$!bT!+C!aX!a+@!#\!!#`!!#d!a+B!"(!A+Ah!a,!bl!+C!a0!b p!+C!at!a+@!#x!!#|!!#!a+B!"$!A+A!a !b!+C!a!b(!+C!a!a+@!#!!#!!#!a+B!",'T'+" % ''('!$ !$a0,#$'!$7W!$B$a''!$ !$a''!$ !$al''!$ !$a<'h'!$ !$a4w'# '4 <# '# '4' <# ''# $ 8'# 8!$"(@'' <# ''# $ 4'# 4!$"(@'' <# l''# $ 0l'# 0!$ "(@'l' <# % ,'# ,!$"(@'' <# ''# l'4' <# 'l'# '4 <# <''# $ (<'# (!$"(@l'<' <# <'l'# $ $<'# $!$?"(@l'<' <# <'l'# $  <'# !$~"(@l'<' <# % l'# !$"(@'l' <# % '# !$!"(@'' <# % '# !$^"(@'' <# % '# !$"(@'4 <# 0'('!$7W!$B$a08,''+" % \\'Z''!$ !$AZ'#  'Y'!$ !$A'# &b@ % %(%'!0DƐ!8$&0%($*00B$'+" % dd'Z''!$ !$A'Y'!$ !$A'# BB8@ %%%'! "Z'!0EƐ& %dB$BD(b0B$+= % ' 'P'!$ !$AXW 'i$ \ 'eG$ \W% A$# a! !0"ǐŠ!$!#(``B$dhT''+" % <<'BC8h`|''!$ !$A4'x'!$ !$A'0'!$ !$A<|'4'' $ 'a'!$ !$A|' '#  # @b''!$ !$Ab'& CB$   %3a?a@b %AAa'+" % 'A"P@$ ?%.>&4=':<(;)V J :+d \ 9-r n 8/ 7061524334L26H19D0" /#.$$-%*,&+'F@:*)T <L )+b 8^ (-'.v&/|%0$1#24"40!6, 9<"#|$x%6(*t'D$<p)R N l+,f h-l d.r`/\0X2T4689 < " #& %4, 'B>)*V +\ ,b -.~r02!!a+a!A!3!+Q!!0!+p!!+h!-!!-!a!-!A!-!! +@)!8!!(+0&!(!!!e+ $!!C+ !A!!A!"!A!!A !!+6!!aT!+#!b!a!X!+#!b\!b+ !A`!b!Ad!b!Ah!b!A! !A+Al!a$!bp!+C!#(!b"t!+C!#x!a+@!"|!a!"!a!"!a!"!,!A+A!a0!b!+C!a4!b "!+C!a!a+@!"!a!"!a!"!a!"$!8!A+A!a<!b!+C!a@!b("!+C!a!a+@!"!a!"!a!"!a!",! D!A+A!aH!b!+C!aL!b0"!+C!a!a+@!"!a!"!a!"!a!"4! !A+A!a!b!+C!a!b8"!+C!a!a+@!"!a!"!a!"!a!"<! P!A@!+"!AD!''+" % <<'|''!$ !$aD#$|'!$7W!$B$a4'x'!$ !$aw|'# |' # 4'|'# $ 04'# 0!$"(@|'4' # 4'|'# $ ,4'# ,!$"(@|'4' # 4'|'# $ (4'# (!$"(@|'4' # 4'|'# $ $4'# $!$"(@|'4' # 4'|'# $  4'# !$ "(@|'4' # 4'|'# 4' # % 4'# !$@"(@|'4' # 4'|'# 4' # % 4'# !$"(@|'4' # 4'|'# 4' # % 4'# !$"(@|'4' # % |'# !$"(@|' # |''!$7W!$B$a'+= % '!$ N$  $(''+" % $$'!_# !8 ''!$ !$AB'x# ''!$ !$aWcw' 4`# l''!$ !$ABWl' 4`# $b@'['!$ !$A'@'D_# C$ 9$+09$` (L%8'D%0(J%8'F%0(%8(B%8(D%8!%''8  <6!`7&h,<6+`F <=56!p!`&p 'x<6$x<6&'$`%`g #`l+Xl#XKX<|a6!`C8$?U$@$A$B]$C$DE)$Fl$G:$HI^$JKr$Lv$M $N$OT! '0$ |# 6$ $!$"J$#$$&$%,$&o$']$($)$*$+$,-$.)$/$0$1$2$3($4$5$6|$7$8$91$:$;$<$=$>$? $@`$A$B$CD~$E$F$Gz$HC$IJK$L$M$N_$OT! '0$ |# T"$C$DD @C@@@ @$@(@,@XP''+" % 'd8TQ''!$ !$ap''!$ !$a$p$tx@'l'!$ !$a'p'@'b''!$7W!$B$b,$$!$7W!$B$b,$$!$7W!$B$ 'ab8@B8|@'<'!$ !$A'B$$0$ |# ^`' '!$ !$A'B$1c$0$ |# ?@m$  'b,$$!$7W!$B$b,$$!$7W!$B$d$$  $(, ' ' '1b8@C8`B8@''!$ !$A'B$$0$ |# @''!$ !$a'Fm$ x$ e@P'|'!$ !$AWP' # 'O'!$ !$A 'C# /$+"s`!!0 /BB0&A!0,d$ P' # ",d$%(%!$7W!$B$!$7W!$B$a$"$## "   $ ( ,  '!$ m$  $('L'+" % '8!# !8 ' '!$ !$A8B'm# ,''!$ !$aW8cw' <# ''!$ !$A8BW', <# $<bT''!$ !$A'T'C# C$ a$+0a$<(< $-$.f$/#$0$1$2B$3$4d$5$69$7$8?$9$:!$;$<($=$>`$?k$@M$A=$B$C$DK$E^$Fw$G$H$IY$JK$L$M$N'$O$P$Q$R$S3$TH$U$VWXj$YZ$[$\~$]^1$_$`$a$bchB"'B$ # $"$#9$$)$%j$&x$'$(;$)$*$+\$,$-_$.$/,$0}$1$2$3$4$5D$6I$7W$8$9:h$;$<$=$>?'$@>$Af$BC$D$Er$F$G^$H$I&$J@$K$LP$M$NO?$P$Q$Ra$S5$T<$Up$V$W$XY$Z[$\$]$^v$_$`$abchB"'B$ # hC`<d` ````` `$`(`,`0`4`8`<`@`D`ld''+" % <<'d8IF\''!$ !$a'X'!$ !$a<''!$ !$a\'''b\''!$7W!$B$bD$$!$7W!$B$bD$$!$7W!$B$'b8@B8@''!$ !$A'B$$B$ # c`<''!$ !$A<'B$Cc$B$ # D@}$ 'bD$$!$7W!$B$bD$$!$7W!$B$d<  $(,048<@D'''Cb8@C8`B8@'8'!$ !$A'B$$B$ # @''!$ !$a'}$ 7$ j@d''!$ !$AWd' $ "'c'!$ !$A"'# A$+"x`!!0 ABB0&A!0Dd$ d'F$ "Dd$%(%!$7W!$B$!$7W!$B$a <"     $ ( , 0 4 8 < @ D '$%$&a$'$($)$*$+$,-!$.$/$0$1@$2$3$4$5r$6[$7$8$9$:$;$<$=$>$?@$A $B$CV$D$E9$FG$H~$I$J{$K$LR$M$N$O;$P$Q$R$S5$Ts$U$V$W=$X,$Y4$Z[$\E$]^$_k$`P$a?$bc"'B$ # <@<_  !"<d'd'+" % '<=!$ <@<_  !"<᮴''!$ !$Al''!$ !$A$%$&$'$($)$*k$+$,$--$.$/$0$1$2n$3$4$5A$6$7$8$9$:$;P$<$=$>Z$?$@V$A9$B$C$D.$E$F$G*$H$I$J$K$L$MN$O '0$ |# <@<_  !"<P''+" % ,,'<>!$ <@<_  !"<ᮄ''!$ !$AT''!$ !$A$T$X\dhlptx|$'P'!$ !$A'T'$''j$ %aq$ aq$ aq$ aq$ !$`#(u`<$Ap $;'$<$=`$>K$? ' $ z# <@<_  !"<@'+= % '< ?!$ <@<_  !"<%<A$`"(V@<E j$ $!$"g$#$$$%$&$' $(U$)$*$+ $,-$-o$.$/$0$1$2$3$456$62$7$8i$9$:t$;<7 '$ }_# @<w!C!$@ !#f# @'+= % '!$ <@<_  !"$$$$$$)$$E$%\$%%*$%=$%$<<<<_  !%<ᮞ<!$ $""""    " " " " " """$#$#$#$$$$$%$%$%$%$%$%$%$%c$%%$&Q$& $<<<<_  !'<ᮦ#8$?#d$@#A"B$<4<8<@<0_  !"<0'+= % '"$<($?(@%()$*$+@$,s$-.$/j$0$1$21$3-$4$$5$6$78H$9:;i$<$=$>$?$@5$AB$C$Dv$E$FG%x''!$ !$a $H$|<c$xd't'!$ !$$hdA$ptlL'`'!$ !$A$PL%8% ,0[ c=%8LQ %PZf%Xldl%`jv%hr| %2 %r %t   %%ș% HD %"@ %"< %A84X HD@<L84\ $`dP'+= % '8'W'!$ !$Ah8'$ X \'7'!$ !$Ad'$ X&b@ \% %(%l`'!0DƐ!8$&0%($*00B$"#&(E&0f #@$(&E+H?#8#8$0&f"#&E&" #&(E$( &0f$0&&E" # &f&E %&$H&&$&0&(%&&&"#&(E$(&0f$0&&"#&f&E "$# &(E$($&0f$0&& "$# $&F&% $+= % '8'\'!$ !$A<8'l ޕ$ `'7'!$ !$Al'$ P@`"#l 0#@$'H$(%%E+(?#8#($'8$0%fh¬ì"$ #$$P*%B ¬$%C ¬"$#$$P*%B¬$%C¬"$#$$P*%B¬$%C¬ "$$!$ $#%b$ ¬$%A$pd'%%{  += % 'l"!p j$ XPT\l" !p j$ H@DLl"!p j$ 804<l"!p j$ ( $,l "$!p j$ $`P!0Fh+ p`! T! !@X!DD\!(+D! 0H!D4L!(+D!E 8!D$<!(+D!E(!" ,!d+"!#$td'+= % '(,0 X  4<6$w8@@# %"%D<@$''+" % \\'`''!$ !$A8'\'!$ !$A'4'!$ !$A`'x$ 8'`'x$ 8'x$ 8' ٞ$ `'8' ٞ$ `'x$ `'8' ٞ$ 8'`'x$ $ 8'x$ !$"(@`'8' ٞ$ 8'`'x$ $ 8'x$ !$ "(@8'`' ٞ$ '8'x$ $ 'x$ !$"(@8'' ٞ$ 8'x$ $ 8'x$ !$ "(@`'8' ٞ$ 8'`'x$ $ 8'x$ !$2"(@8'`' ٞ$ '8'x$ $ 'x$ !$d"(@8'' ٞ$ 8'x$ $ 8'x$ !$2"(@`'8' ٞ$ `'x$ `'x$ `' ٞ$ ' '+" % ' '0'!$ !$A''!$ !$A'x$ ''!$ !$A '' ٞ$ '| ' ٞ$ ''!$ !$A ''x$ '' ' ٞ$ l''!$ !$A ''$ l''ٞ$ D'h'!$ !$A 'l'x$ D' ' ٞ$ '@'!$ !$A<'| ޕ$ pD'|$ D'p$ <%DD 'p ٞ$ D' '$ H'l'!$ !$a<%D# @'(<+ ##D8'@4H'l' ٞ$ H@$CL8$ l<$0%Fp4$0% lpP$CT$ t$0%Fxt$%xX$C\$ |$0%|$%D`$Cd$ $0%$%Dh$Cl$$ %$%Cxl'O$ xDt'+= % '8<@ DX  (!,!8+(E!($8%'0$%0!&4! +0&! !a+#!dHLPT$'+= % '8!A+b<(B7%(!(!E@(!+(%@%b!D!@ DX  (!,!8+(E!($8%'0$%g0!&4! +0&! !a+#!dHLPT$'+= % 'D@@@%A8 !(+ <8BG%8!8! @8!+8G@ /% ! !  X  (!,!8+(E!($8%'0$%g0!&4! +0&! !a+#!dHLPT$''+" % PP'"#$x $|$p$t$h$l $`$!d$\%X&P &T&H&L&@&D &8$!< X   x|8< C$ $(,0 pt@D C$ $(,0 hlHL C$ $(,0 `dPT C$ $(,0<6$ 7@@#%C %$P TX   x|X\ $ $(,0 pt8< C$ $(,0 hl@D C$ $(,0 `dHL C$ $(,0<6$(W!(!04+!%<6$(7 @ @#%a %$H LX   x|PT $ $(,0 ptX\ $ $(,0 hl8< C$ $(,0 `d@D C$ $(,0<6$(W!0!(+!%<6$(7!0+0!( @ @#%a %$@ DX   x|HL $ $(,0 ptPT $ $(,0 hlX\ $ $(,0 `d8< C$ $(,0<6$(W!0!(+!%<6$(7!0+0!( @ @#%a %$8 <X   x|@D $ $(,0 ptHL $ $(,0 hlPT $ $(,0 `dX\ $ $(,0<6$(W!(!0+!%,<6$7!0+8!@#@;%d%G !8+ @BO%@(!@! @@!!H"+P"+H@ ?% !!C!C!B<6$W4! D+!G8!@+8@P!(E!X%+Hi+(@8G%8!(!!#  $''+" % pp'"#$L %P&D&H&<&@ &4$!8@T@7%&@@'%$ X   LP48 $ $(,0 DH<@ $ $(,0<6$ 7|@@#%Cx %$tTL PX   DH48 $ $(,0 <@ C$ $(,0<6$(Wt!0tx!(+!%<6$(7x p@ @#%al %$hTD HX   LP $ $(,0 <@48 $ $(,0<6$(Wh!0l!(+!%<6$(7p!0p+0!(d l@ @#%ah %$`T< @X   DH $ $(,0 48 C$ $(,0<6$(Wh!(`!0+!%<6$(7l!0l+0!(\ h@ @#%a` %$XT4 8X   <@ $ $(,0 DH $ $(,0<6$(W`!(X!0+!%,<6$7h!0+8!@#@;%d%G !8+ @BO%@(!@! @@!!H"+P"+H@ ?% !!C|!C!J<6$Wt! D+x!G8!@+8@P!(E!X%+Hi+(@8G%8!(!!# pdl\ $'+= % '< # ,!04 8{$  $<@DHL('+= % '0"4d& !c K  4"8d& u!c K k 4 "B8P@06 ,8C DB  3 $,V$B4dec  @  <@DHL(',6$!$  <@DHL('<@DHL(' +b #(%0 8!@ !8&8$8&8'$*84$'  ` !h!x&$&p!`!+p!0+0' #h,#h$L&`,'`$`%`L!H_ J%*`B    %  += % '( *0b*8F%0+8fv   ( +0be @I80 ($d ''!$ !$!@Ht $*PI@$ '$$$$$$)$$E$%\$%%*$%=$%$<<<<_  !%<ᮧ<@!$ $"$!$ !$A< $$"[  "#8$?#d$@#A"B$<<<@<_  !"<ᮧ<@!$ "$!$ !$A< "[  "$?@$ABy$CK$DE$F$GH`$I$JKL$MNN$O0'$<B$$?$@$AG$Bp$C$D$E$FG$H$I$JK;$LMNO0'< #?"@%A$ bb<@b_  !"a<!$ $"$"[$"$"$"$"E$"$"$"$ "$ #$ #T$ $v$ $g$$$$$$$$S$$#h$$Q$$$$$%$C$$$$"$"$"O$"# $bb<@b_  !"a'+= % '" $?"@$'+= % '<  '+= % '( "$! B @ ,A@+00!0ƌ1`dhlP'$O+0x0!0ƌBX6 HX!@ެ$ T H  @`dhlP'$+8!8@ , @ $!HI) $#XEHi k- H %@  $%(% %U%%{  46&W`<B$&" `dH p!0|!0i$q<B${<-66&W@<B$&"`"#!D $  <B$D\ $8# T8dh ;# @HC DB %$!  H"!@ 8# H < _  #!@9# H" #!@ $  46&W`<B$&"& "H dp! |! !${<-66&W@<B$&" "#!@ $  @T 88# dh ;# DHC DB %$!  H"!D 8# H < D g  #!D! "$`'<\A(ALA0@b$ @ "$!BL( 0 @\ "$<!$H( <X,P4Db$ D "$!BP, 4 @X $$<)$<B$Hp|, += % 'Ž! $(;# ,'4'+" % 'X\` /$ T7<%_  "%"`%,'('!$ !$aHD@$H,'@$'B@'''$ W$ ,'('!$ !$a<8@$<,'4T],(*e  ,'  ,T(<+eF 8!B$"P<|B$TX0' # < 4!8D HL$ 4!@CDB <  $($ ,4BB8@ DHL$ $(PTX0'+= % '0!48 <@DH$ $(LPT,''+" % ||'<!$x|!x' $ ) <,'('!$ !$atp@$t,'lcl' $$ Ž< @@ ,'('!$ !$hd@$h,'``' ߭$ @8G$ !8 ,'('!$ !$A\X@$\,'T BT' x$ ,'('!$ !$APL@$P,'HCDBH' W$ x@4B8 $ !4T' .$ !4l' $ 4G$ !8@ !8ެ$ ($! D4ެ$ @0,< !$ ("$"<@D@_  D"@#"0"," #'46&W`<B$&" `dH p!0|!0i$q<B${<-66&W@<B$&"`"#!D $  <B$D\ $8# T8dh $ @HC DB %$!  H"!@ 8# H < _  #!@9# H" #!@ $  46&W`<B$&"& "H dp! |! !${<-66&W@<B$&" "#!@ $  @T 88# dh $ DHC DB %$!  H"!D 8# H < D g  #!D! "$`'<\A(ALA0@b$ @ "$!BL( 0 @\ "$<!$H( <X,P4Db$ D "$!BP, 4 @X $$<)$<B$Hp|, += % 'Ž! $($ ,'+= % 'B$"P<|B$TX0' # < 4!8D HL$ 4!@CDB <  $($ ,4BB8@ DHL$ $(PTX0'+= % '0!48 <@DH$ $(LPT,''+" % ||'B$"P<|B$TX0' # < 4!8D HL$ 4!@CDB <  $($ ,4BB8@ DHL$ $(PTX0'<'+" % ' # H!L\ `d`$ f@,,'('!$ !$A@<@$@,'8LB8'PT XW$ @@LBެ$ 4($< !$ ,70<`C_  4$#<@ c$ ,0#$!$7W!$B$a(0$4hlpD' hlpD' hlpD'+= % '@"8d& D !c K  B$"P<|B$TX0' # < 4!8D HL$ 4!@CDB <  $($ ,4BB8@ DHL$ $(PTX0'+= % '0!48 <@DH$ $(LPT,''+" % ||'B$"x<|B$|P' # < `!0B$"x<|B$|P' # < `!0B$"x<|B$|P' # < `!0B$"x<|B$|P' # < `!0R$? ' $ $ <@<_  !"<ᮨ? ' $ % <@<_  !"<ᮨ7W(#$p(C$P#$lPC$|x#$hxC$x(L%8'D%0(J%8'F%0(%8(B%8(D%8(F%8()R %@ N *\ %HiT %@H*Z %HiV %@H*%HI*R %HI*T %HI!%) <2 <2Z %H+V <2d %P\ %Hi <2b %P^ %Hi#"+" <2%H* <2R %HI <2T %HI <2V %HI#P##B'P $Pj&#'`$b%J <2 <2R %jN <2\ %HiT %C <2Z %HiV %C# d+d#+ <2% <2J % $ <2L % $ <2N % $#H###b'$& ' $%b <2 <2*%e& <2L% $,% <2J% $.%#(f+e#+ <2% <2*% <2,% <2.% #(##b'$& ' $%b <2 <2*%e& <24% ,% <22% .%#(h+e#+ <2% <2*% <2,% <2.% #(##b'$#&$' $A%a!,!0+= % 'l B8.@ '_'!$ !$A 'h& C $   $$7 ??!0@!4?d '@$ 6% tx|`'%8*'!$'($($@ , ( , @ $#H# )-  %h$i$ -!H*%%% *,{@?*0@ $#`di+`L-` 8'!`#x`LNR%pN J- ` - %` O. p %P3-r` 8'!`#O`LS%xo T- ` s. x . %`% %`-Vh !h#j#hMoOV&x R. h  r. %h . x%h%-%P8'$` $PH!PB+pBO1-!`1*$'Bp+x&`-Bp%p+pN$`%`'!p,ʡ%'!p,#PEʡ$!P$l''!$7W!$B$l''!$7W!$B$`'$$  % $  % $  <9}!$$ <B$j <!$-$ <B$j <+!$!$ <B$j {  += % '''!$ !$A'7'!$ !$A|'% $+"[` d$+ G8'w'!$ !$%@(8'!8!@a )1$!(>?0!$ %(%8'!(#$>?A#0!$!(#!0?#(`'8'!$7W!$B$'8'!$7W!$B$x'<+!$!$ <B$j {  X'+" % '0" "" "$"""!4dc X  4"! X lp 4" ! X H L4"! X  H!E$L!8+E!G $(% '@$%!(!@+ ! !E+E!$ %('@$%l!(p!@+ ! !E+E!D$ %('@$%! D@+! T<~!4 <!4X   <X   <֜!4 2<(L D8*Z V 4,-n 0.t,/z(0$1 3589< " # $." &<4 (JF*+^ ,d -j ./z13!!+!a!T!!+r!!!TQ!+x0!!+p !.!!.!!.!a+X1!+A!*+H*!@ !!0+8'!0!A! +(%! !d+ !d!C!D!!D!"+!!A A!+8!!a!+#!b!aA !+#!b$!b+ !C(!!C,!!C0!b+!!AA!A+A4!a !b8!+C!a!bB<!+C!a@!a+@!#D!!#H!!#L!a+B!"AP'+= % '<@!$! <@!$$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N $O0$13$2$30 $4,$56$78 $9:X $; $<$=}$>$?*$@$A$Bc$Cr$D$E7 $FG$HIJ$K$L+$M$N$Ov$P>$QR$S$T $UVt $Wi $Xb$Y'$Z$[$$\$]$^_ $`a? $b$cM$d$ef $gh-$i $jk$l|$m$n $o $p $q# $rg$s9$t.$u$v$wS$x$yz5 ${|}^$~$$$$$$C$=$$p$$\$$$$y$$$$$a $! $; $ $ $$$<$6$$$$G$O$B$$e $ $ $ $Q $0 $@ $2$q$$$$$$$$$$$$$M $ $ $4 $$$ $n$m$$$$ $ $N $ $$$$$$Z$$,$$T$x$$'$E$ $ $ $ $ s$"$$$$ $R$$o$F$$$ !"]$#$$$%$&$'$($)v$*+,-./X?@$A$B-$CDEF$G$HIJ$K$L$MNO^$P$Q$R5$Sc$T$UVl$W$X$Y $Z $[> $\ $] $^Y $_] $` $a $b= $cd $e $f# $g $hi $jk $lm9 $nop$q$rst $uv $wu $x $y $z{|n $} $~$w$$$$$}$I$$|$$$$$$F$$2$$$e$$'$ /$  $?e $@W $A$BCI$DED $FG$HIJKLM$N$OPQV$RSC $TO $UV $WXY$Z[$\]$]S$^ $_j $` $a! $b? $cde$fu$g$h$ijkl*$m$noU$pq$rst$u$v$wx$yz$zx${$|~$}w$~$m$$$d$1$$$a$$:$$$$$$$$$"$}$$ $'$ W$ $$$%W$&$'8$(/$)#$*+$+6$,$-$.7$/$0$1&$2$3$4$5N$6$7$89$:H$;$<$=$>$?]$@$A$B$CB$D$EF$G$H-$I.$J$K($L$M $N$Oy$P$Q>$Ro$S|$T $U $V $W $Xr $YZ $[\D $]; $^_$`ab$ci$d$e$f$g$h$i $j@ $k $l $mn$opY$q$r$s$t0$uv[$wx$y$zc${|$}~\$$$$A$}$$$s$K $ $O $: $, $f $$$$L$S$$G$E$$e$$$'$ /$ $$$%$&$'$($)$*x$+$,$-[$.$/0 $1$2R$3$45$6#$7$8&$9$:$;$<U$=*$>V$?$@?$AJ$Bd$C!$D$E $FG $HI= $Jl $K $LM$N$O$PQ$R$S$T$U$V~$WX$YA$Z^$[\$]^H $_ $`Z $a $b $ck $dT $e $f $g9 $hij,$kl_ $m $nopr$q$r$s$t$uM $vY $w@ $x $yE $zu ${ $|0 $}~ $X$$W$>$K$$$h$$$$%$+$$$$$$$$$8$]$`$$o$$'$ /$ C $?@ $A $BK $C $D $E $F$G$H_$I$JQ$K4$LM$N$O$P$QRh$STo$U$Vx$W$Xy$Y$Z$[\B$]$^_$`i$ab'$cd$e$f5$g$hi$j$k$l$mnP$o$pW $qu $r $sO $tuv$wx{$y3$z7${|$}$~z$E$$$$D$$$$U$+$ $$$$$b$$$ $/$g$$$8$$$$'$ W$ < !$  $"$#T$$$%#$%$%L$%U$&{$ &J$ &$ &$ &O$ &W$&$&$&$&$&k$&$&$'$( $)7 $* $** $* $*r $+v $+ $+ $ ,Q $!, $"-#($ %#$&#}$'($(($)(d $*- $+-t $,- $--$..\$/.$0/1%2$$3$($4$q$5%$6/$70n$809.:(;*h$<(/ $=* $>*?($@($A(B-$C(X$D($E(C$F($G($H($I(D$J($K(o$L( $M* $N* $O*P)G $Q*R/ $S*T%U&$V%l$W%X'I$Y%$Z%$[%\,'$]&i$^'4$_'$`'$a'x$b'w$c'd)e+- $f) $g) $h) $i) $j)9 $k)l#]$m#B$n#$o#p"q(p$r"s$ $t"N$u"v%|$w"$x"y&$z"${"$|"}'.$~"e$"< !$ $"$#$#z$#{$#$#F$#_$#$$$ $~$ %$ &$ &$ & '$&1$&$&$'$'$'b$'a$'9$'$(* $)[ $)P $)# $#3$#& %$!#$"%$#&( $$* $%*I $&* $'*H $(*o $)*; $**K $+*= $,*S $-* $.* $/* $0*v $1*0 $2*! $3* $4* $5*, $6* $7+ $8+4 $9, $:,f $;, $<, $=, $>,?(@%Y$A% $B,C $C, $D, $E, $F,G$$H$$I$J+$K$$L$$M$$N$O#P"$Q"\$R"$S"T*$U"$V"$W"$X"B$Y#Z#$[$p$\$$]$$^$$_$`)$a$J$b$$c$N$d$$e$m$f$g"$h"$i"5$j"$k"l($m"n%$o"r$p"$q"$r"d$s"t#k$u"?$v"w&$x"y)z$${#R$|#}'$~#"@$|x<B4"$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N $O$w$xy7$z${<'$ -d <`c$iT L %8G%0& $+P"&@jZ V %0F%8g $+XB`' '!$7W!$B$' '!$7W!$B$ '% %{  % %{  %%{  %%{  %%{  '+" % tt'''!$ !$A''!$ !$A$p@$x$t' &# ''$ &# #''!$ !$A'#'$ ,# ''!$ !$A%1#'!c.7?0BG1O)1VJ1^k1B.0c0@`'!`!ec0!(j0*$@P !PM!@(1!00#e#(47 $0p!f470p!(E!$#( `!aCd,'''!$7W!$B$a''!$7W!$B$a'%${  t'+" % '''!$ !$a ' '!$ !$a%4 0 '! @P <`6R&!PJJ!( rHq8r!8'HJ hn %HH.q#8i%)1H*q!H3PR X^ %PjPNq#H**%T W POq!H*)%$T W POq!8$!$$(&@ %$@('!8'!H)W!PACP X'q $hj pv%h $hq#Xmm%l o  $hq!!!XmM-' '!$7W!$B$a' '!$7W!$B$a '% ${  += % '''!$ !$$$'! C$(%'''!$7W!$B$a''!$7W!$B$a '@ !dB$d(D,d@ !(a <`7$! $+@W+@P@@i$O $@(!H%'!@ +XB`+X%;`@H$/$(!(%H-@X !`e!Xhn%xhq$%0 $r#h%‡ $r!h#p %‡r!p %l!`%l o hq!`%l)%*X!`%%  % %  %%  %%  %${  += % '''!$ !$$$@$*(%;%@'!e $(p$@BHN %@( $@ q#($DG $@ q!($e!$#(`'''!$7W!$B$a''!$7W!$B$a '@(!B$e(E,`@(!0# <`7$!($+HS +HL @Hj$W $HI!P'!H++` >+`F7@P$7$0!0%P)@` !h!`!x%% $2r!x%#h %1hq$xz%x $xr#h%|xq!h%J%*`A%%  % %  %%  %%  %%{  X'+" % '<':'!$ !$A@'$'!$ !$A$  $$@',0 4&# 8:9;@':'$ &# <':'!$ !$A"'9'!$ !$a$%!$$(<@'"'$ ,# :'<%$+(p#(&$7$0&"'!0$+Ha %$ɐƐ2%0+HU  $#P!+$_ $(!(+X G`0*%( J- @j,8@0@P<'!PKFc$<'f(,-0 ,f,@0!0Ťc$e(% <':'!$7W!$B$a<'% !$7W!$B$a('%${  %${  %% {  $%  %%{  %  P'+" % '%@<8( 4@$@2!%$%0 '!$7W!$B$B$" <|B$$( '($#070!0a$D$%%%(Fe, ($ $? $@ $A $B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z$[$\$]$^$_$`$hi$jklt$mnov$pqr$s$tuv$wx$yz{b$|}$~y$m$$$(';'!$ !$A(''' z% '&'!$ !$A'h''!$7W!$B$a'''!$7W!$B$a(''5'!$7W!$B$a('g'!$ !$A(''' |%  $;;(' %  ;; $8$;;;h' K  ; "8@% ;h' K  ;;;'$?t$@.$AI$BC$C$D$EFj$G*$H$I$J$K$L$MN#$OV$Pn$Q$R[$S$1$2$345L$6$7$8D$9$:u$;$<$=$>|$?^$@AK$BCO$D$E$FG$H$IJ]$KL$M$N$O$P$Q$RST$U`$VWXh$YZI$[$\$]$^$_dmOX i]xdx xD^xx^ ,td_/XY #3idinIDkasppcfnX4X5{. |.}.~.l.<..`.X" |" `# h$ $ $ TԸ'.0' 8( \( @) ) IdDoX6X7 &&&&&^ &AsIsزOpIPokfdlcch"а"|"""4""t"P""̺"h##T$#atipv4v6orhiloUpVhii jkdkkk@$ kTll|nxnnnop(pLpFd<hԢT<PCl1l2lrfpbptsr1r2g0gpmprgwgrtrdwtwdkptittr3r4r5r6r7t1t2a1a2A B C E E E LG H K PK tK K M N N HN xO @P P \Q ??\?R?p?@%@ x̍[L2 DSOsNs}h}}}$}}H}T}}}}}؟}}8}}H}}}@}Ԥ}} }}d}(}}}}`}}}p}h}}ܰ}}D}}}T}T}}}d}p}\}T}ؼ}}}}ȿ}}|}}}}}}8}$}}h}@}}}},}}$}|}}}A|B(Ct80 vxz{8}}䁃`솃؊@txT䔃ė\0h<t쥃8,حx0 XƒÃădƃȃ ʃ̃̓΃σЃtу<҃DԃՃ ׃D؃كڃۃ,݃ރD߃<X\dl@fff,ff|؅`[\X YhKdPdQrrgܔEl0l3l41<<<rbc.f.fH0f0fEfXffTftoj8jjjO8OO|OP0P3P4PDDP EP QtQQQQQCC!S0"S #SD%SkT\lT4mTmTnTRR@RR$ Rx R4 R Rd RRRRXRRRRķTXTTZZZpM[,ZZt0nbh1h2hlhd0>T\`h$<Lqkv|b(bȹbbbHbbbbbLcciL0L1Tn n4nnHnLnذnnnmixift$?u?u(@u@uXAuBuDuEuFuxGuHuIuTuT@RARDRQ$QNNvsT*3$+32333o\o`H``ErrNewURIkeyMsgAddRunTypStrptrextlocbufarrctxekmGetPuterrmacseqouttmprawprfSumckx MapAllRawderlenExpfmtmsgpadwidargnetNetTo4pfddupsetgetMTUsrcvalAs4Is4Is6andnotxorsysSysOldtypDirEnvPidpiddirrefendbssbadaddsubpcsmaxgenminpopnowrunoffobjgcwpostlsmOSsigcashaseofcaptagmidnewdefidxstrlogallputexpKeyLenNumnegCapPadSeqSecCurMaxIovDevInoUidGidhdrRttTosAbsDaySubUTCsecUseenvSetLogURLDelHasTCPUDPPopEndecnPSKMinBufhopcurencNowValkvsTLSpatrwcresreqrwssrvurlaltwmuJardstOutissrecjobcfgTTLfnsCmdReplruPrepubpinctrdecAndTagnatbbbbitcmpdivlshmulremrshsqrabsBitCmpDivGCDLshModMulNegNotQuoRemRshXorInvIntretR16R32PTRTXTrfdwfdDupIfnTfnFunMapArgIPPVarAnynumanycolCASDecIncCidCIDPsmPSMSIDRefPGNRsvMacHdrVerDstGSOtunmtuSrcViaOOBrttECNackAckoobtapvecs64dotsymCGITtlinteollexCpuECHUriISOVPCEmsoddNatsumOnedocCCCcccPosIifOifQosXdpVfsFdsFD0FD1TOSRSCGBPAgePNGbpsPTOFinpnsrngRTTMSIlnslfsOidmiblsaregMIBQUICelemctrlLoadSwapNameMaskHashTypeisV6typ_flagtimewallnbufbufpsyncnextprevsctsKindDataleafLeafConnRandTimerandOpenSealaeadhashLockconnquicvershanddataReadAddrSizeweaknodeswapdeadrootseedfindinititercertDialIsCAURIstextheaplinkheadHostCertAlgoname OnceusederrsfreepeekFlagfmtCfmtQfmtSpluszeroprecScanTo16PortZoneFiledialconnIdlewaitwrMurdRxrdTxwrTxwrRxoncereadDoneTextfilepathsortPrefaddr ConndonesizestatBitsAs16LessNextPrevportmodeModefileSeekStatSyncseekrefsinfoInfo FileKillWaitkillLinkstopwantmask*intpad1pad2nfnsftabebssptabargspcsppclnflagFuncLinediffbasegoidgopccodeargpctxtlastbitpkindlisttinygrowpackscavpushtaillesswhenmainlocktakenodenobjget1get2fullrunqbyterankcurgoldpncgoparklinewakeskiptickbitsrrunwrunuserrseqwseqselflostonesleftnbitdepsStopfillsemarecvdumpemitElem TypeGrowPathZeroAttrNanoUnixNsecUsecBaseCodePad1RdevPad2AtimMtimCtimPad4Pad5CttyPgidHopsdatezoneDateHourYearmononsectmplLongArgsRunEFindHelpRootcoreWarnWithCoreFreeLastFeedfeedBackInitmoveListUserSendAuthOrigringHeadPullTailObfs CorehookstepscanMorewrChrdChrerrwerrpipewbufPushJoinBodywildhostFormcondbufrbufwlogfflowbodyresptreetreqhbufhencPingzerrkeyspipeKeysPostsendTagsocspOCSPloopHookpostIPv4IPv6holdPeekkickSignECDHSeedQinvfipsvalsivloivhiopensealSortecdhsavedivWitoamakemodWnormsqrtutoaSqrtCopyformPermBoolCallRecvSeq2UintcalliregfregftyprcvrabidFromMBoxAAAAPackfdmudupsMtypMoffDumpIntsPtrsUsedInt8IntPNArgVarPfailcopymark InstInstexprproginstpooljobsboolbackjsonoptsDeepNodeRxIDTxIDDsapSsapdescDescVersPeerAtypbindFragUlenPlenCwndByteLeakIsIPFqdnEnumcutsDropsentrcvdacksbodyIntnentsWirecidrtorcToDS SVCB NSECSetZHintAlpnNsidconfHaltForkPlanVPC2argvSctsIntNqInvtrimopadipadseenrateExprRuneSub0signruneFlowfootnullintvmapvmustnilvSpandst0dst1src0src1tcccnsrcTreeMarkIfidVlanPkeyRoleIKeyOKeyto64GotofromCompOursECT0ECT1ect0ect1AEADhistrBufdictfreqlazy HashMapTwireenum BaseconvbetarenoErrorFieldValuevalueslotsStoreSize_TFlagKind_EqualBytesCacheInterExtrauseByLevelSuitemutexClone MutexlevelinputnoncelabelgroupcloneecdhemlkemKDFIDKemIDkdfIDinnerWriteCloseflushwriteisRSAfieldResetSetIVClearRangeivLenflagsstateentryemptycurvehellosuiteStartPrimeCoefflocalprunedepthTokenWidthlimitcountatEOFerrortokenfmtBsfmtBxfmtQcfmtSxminussharpspaceplusVladdrraddrCounttimercloseAddrsIndexFlagsScopeLabelmtimendotserroraddrsfirstRLockindexvalidUnmapv6u16IsDirChdirChmodChownchmodpreadsigMuMkdirclear*int8*uint*boolmagicminLCnfuncvaddrcutabpctabminpcmaxpcetextedatagcbsstypesdatap_Func_funcEntryunpinequalretpcstartstackbytepallocinUsestorecachetotalchecktracehchanresetsendxrecvxrecvqsendqsweptstampdrainwbuf1wbuf2spanqstatsgFreewbBufvalPCnextplocksdyingincgoschedparamsigpcsplitunionmergearraytimersleepbytesfdseqreadyrightreuseextrablockStackqueueeventAlignRoundtrunctablebuildHalenUtimeStimeIxrssIdrssIsrssNswapNvcswNlinkPidFDStateTableHoursclockisDSTisstdisutcAfterClockIsDSTLocalMonthTitleShortPrintSetInUsagegetInDebugIsSetSetFsapplycodecFatalInfofInfowNamedPanicWarnfWarnwloglnCheckSugarBuildServebReadTraceArrayFrontIsAbsParseQueryMaxTxMaxRxudpSMmatchEmptyMatchUnsetpathsPortsdebugAddTo EntrydirtyaftercoreselemsfuncscauseInt64scanpValidFlushProtomultiHTTP1HTTP2serveavailIsAckCausevlogfdonechostsLimitshiftnodesproxyreqchreqMualtMuProxyaborton100tconnpingsconnsisDir TimerIssueNamesEmailemailAllownameszonesvultrusersHTTPSitemsPurgeRulesisTLSMutexis224 CurveevictblockEncapchildCurveClassclassnbitsexpNNexpWWroundio/fsFloatIsNilSlicerunesNumInptrTostepsiregsfregsspillCNAMERetryrsemawsemaSysfdcsemaFstatFsyncPreadchansGroupBoolPFuncPGetIPIPNetIPVarInt16Int32Int8PNFlagTimePUint8UintPVarPFVisitusagempooldenseatEOTSplitPathsfilesparsefloatAttrsfrontfailfundefoutMubufioLowerUpperUnamerxAcktunFdrulesExistRealmRegexGetIpotherrcvMxlogIDOtherInt63Int31pktIDfragscode_idKeybracequotecommtownernextLToCDSOrderCoverSetDo RRSIGRcodeQtypeFudgeUinfoLeaseNdotsToSRVstackGetDBStdinKdfIdKemIdUintNm0invIsOddIsOnelimbsouterquietdedupRune0humanStyleAliasmajorminorstylemarksaliasboolvnodevtimevuintvnLead_byteisMaxnbytenruneprogsGuardFloodTrustMultiSlaveOwnerDportNoAge IPNetTunIDSportDepthMergeInputEnumsIsMapScaleBlackImagepacerECNCEFramealarmecnceIVLenissetlinkswrPosrdPosfinalcodesencapdhKEMChildChainShapesetIdindirinstrGetFd RtMsgbyNumbyKeyApplywhichPixelalphaepochcubicoperrUnwrapuniqueConfigAlign_GCDatazoneV6// 8/ //,//@//StringsecretageAddticketeventscancelconfigaesKeykeyLenUnlockincSeqcipherdidHRRrandomcookieAEADIDLengthaeadIDAcceptclientserverbufferparamsDoubleParamsDeletemacLenlookupparentinitedinitMuexpandschemeIssuerrecentbisect/4/ ////(/0////@// //byNameVerifyReasonDetailMethodTBSCSRdomaininsertNumber*[]int/B//closed//errorsreaderacceptfmtSbxsharpVintbufFormat/ /DfamilyopAddrSourcesotypeEnableServerListenunlinkPollFDTargetWeightnegatestatusactionsourcePrefixsearchrotateuseTCPCanceldialIP Dialerupdate//MaskedisZeroBitLenIs4In6addOnehalvessubOne/<//inRootReadAtpwritedecrefincrefSignalhandlerusageExitedexitedsignalCreateRemoveRenameresult/*error*uint8*int16*int32*int64unsafeopaquenfilesptrbitgcdataetypesrodatagofuncfuncIDpcfilesignedgoexitremovenoscanoffsetnpagesnelemsdivMulinListisFreelayoutrefillunpackrangeschunksallocNtimerswaiteractiveadjustsiftUpunlockverifyastateisChanisFakeperiodmodifytrace1qcountbubbleputObjptrBuflfnodemcachepcachepalloccycleslenPosvarintdivmodprocidvdsoSPvdsoPCnoCopy_panic_deferlabelscountsinHeapensurescalarreasonfileIDheaderargLenparkednotifywriternextPCframesstringCommon// //8/// /////P/@////X/@/$/p///AfinderprefixoldnewFamilyGroupsHatypeZoneIdHeaderSetLenHostIDIovlenMaxrssMinfltMajfltMsgsndMsgrcvNivcswBlocksOffsetStatusChrootPtraceSetsidNocttyChangeCookie/n/l/`/H/LayoutformatextendBeforeIsZeroMinuteSecondabsSecaddSeclocabssetLoccalledPreRunpflagslflagsiflagsHiddenParentPrintfSetErrSetOutgetErrgetOutpreRunEncodeDecodeloggerGetIntgetEnvHandlecodecsDPanicDebugfDebugwErrorfErrorwFatalfFatalwInfolnPanicfPanicwWarnlnHyConnRemoteBufferLoggerIfName ServerSchemeOpaqueClientfilledClosednextIDNewUDPstreamheightvaluesAscendInsertValues/L WriterCallerAddIntEqualsShouldFieldsspacedaddKeyErrorsStruct BufferquotedencodeendTopobjectopcodefields ReaderFramerQuotedDomainMaxAgeSecuremethodsetBitinReadremainHijackcurRequnsentframerinflowserveGgoAwayunreadreadFnskipWScondfnsawEOFmultismux121onlyH1nwriteidleAtbrokenreusedaddTLSidleMuisHeadfinish Closerlength8/SetURLExistsHasTagTestCAAgreedagreedrevokeRevokesolver SolverissuerparsedwindowcursorWindowpermitSubmitworkerunFQDNnoncesAuthIDConnIDauthIDconnIDok~DialerdialerResize/StreamisHTTPSecret/mcryptoPublic/xPrimessharedvictimdoSlowNewCTRNewGCM/rounds///bitLenseqNum////Searchboring/\andNotisPow2stickyAndNotAppendCmpAbsDivModQuoRemSetBitUint64SetIntLookupmustBeCanIntCanSetSetCapSlice3CanSeqNumOutcommonstkOffappendaddArgStrideSerialExpireMinTTLfixLenUnpack HeaderAnswerFinish////rwlockiovecsisFileFchdirFchmodFchownPwriteWritevSharedDoChandoCallHasherMcountXcountFloatsgroupsrehashdirPtrdirLenInit64RefillReseed/,CountPIPMaskIPNetPIPVarPInt16PInt32PInt64PIntVarOutputParsedUint16Uint32Uint8PactualformaloutputOptionregexpop8.NumCapsparseinputsExpandnFrontColumnbyPathUnusedSquashResultdecode8 WriterstrictStrictConnIdBdaddrNodeidUserIDCstampTstamp//?PasswdiphLenpshSetroutesmaxAgetcpNatudpNataccessNewDstRttVarAdvMSSRtoMin8(DecRefExtendIncRefIsFullRawCapIPAddrIsFqdnIsIPv4IsIPv6GetKeysampleUpdateFragIDTracersenderDoneCbMinRTTFramesdoDiallistenRetiresendMxpackertokensOnLost88 StreamInt31nInt63nint31n///\tmpoffdigestReuseddynTabexcess Config ClientCertIDRrtypecolumncomBufrrtype*dns.AequalsKeyTag DNSKEYRegexpNodeIDLabelssigBufOpcodeQclass MsgHdrOrigIdCopyToIsTsigsetHdrMinttlScopesRebootAttachDetachGetSoa S3KeysBackupRegionSSHKeysuffixStderrStdoutsocketAeadIdRandomKeyLenNegateBytesXSelectbytesX// /9//a/ Int32NInt64N/8Export/SubOneassigncmpGeqenable/2dsbyteInvertMult32SquarereduceexpectMaxCapconcatfactorrepeatnumCapAsTimeindentAnchorInlineanchorstatesopenedparserterrorfloatvslicevisYesCisYesDhangulReaderruneAtasciiFflushFActionInAddrprogFdProgIdTxRateTxQLenUmcastQueuesIFlagsOFlags IPVlanMiimonAdInfoL2missL3missVlanId/SetTOSRangesByNameSyntaxByPathIsWeakOneofsIsListMapKeyBitmapminRttminRTTToTimeTheirspacket/&SentBycflagsSetTTLSetBPFrawOptIndenttoRead//$expiryExpiryptSizescSizecalcDHsizeDHfromP2configNodeAtcreateArrayTSliceT RtAttrGetPidSocketsortedbyJSONbyTextisInitoneofsGoTypegoTypenumberBudgetsetIov///delimsConnectNewFunc*func()ModeMapPkgPathMethodsreflectversioncurveIDstartedsignalccancelcreadbufContextVersionCurveIDsessionhmacKeycreatedRootCAsTryLockdecryptencryptnextMacsendBufmarshalNetConnMarshalTimeoutextTypenewCertisEntrykeyHashnSecretkeySizeecdheOkSubjectruntimegetCerthaveSumAddCertisValidhintErrparents*[6]int*[9]int*[4]intadvanceconsume*fmt.ppbadVerbdoPrintfmt0x64fmtBoolNetworktoLocal*net.IPWriteToconnectreadMsgsetAddrwriteTo TCPConn ContextControlrawConnCompareIsValidsrcAttrsourcesserverstimeoutsoffsettrustADprimarydialTCPdialUDPnetworkaddressRLockerRUnlock RWMutexcleanupcompareAsSlicehasZonestring4string6modTimeModTimedirinfoReadDirReaddirWriteAtlstatatreaddirwrapErrSyscallacquirereleaseSuccesssuccessReleasepidWaitChtimes*[2]int*string*[]int8*uint16*uint32*uint64*[]uint*[]boolptrSizefuncofffiletabcovctrshasmaintypemaptextOffnameOffsrcFuncnpcdatastartPCstartSPisEmptytakeAllscanIdxobjBasepushAllzombiesraceCtxwaitingrunningaddHeapblockeddequeueenqueuesortkeywaitersnextSeqinSweepbalancedisposepushcntdiscardalllinkrunnextpreemptdestroyseqlockentriesmorebufgsignalsigmaskisextralockedglibcallchacha8lockedmstartpcracectxcgoCtxtcoroargbucketscomputeensuredgcStatspointerclosingstackIDmakeArgcontextcounterenabledcurrentstoppedreaderscallersChanDirGcSliceHasNameMapTypetypeOffstrconvstringsReplacepatternmappingsyscallIfindexPkttypeStoppedAddressNamelenInblockOublockBlksizeSetpgidSetcttyBackoffOptionsDst_lenSrc_lenMessageMinutesSecondsAddDateISOWeekWeekdayYearDaysetMonounixSecAliasesGroupIDExamplePreRunEPostRunExecutePrintlnSetArgsUseLineexecutepostRunEncoderDecoderkvstorealiasesAllKeysBindEnvDebugToGetBoolGetTimeGetUintrealKeyEnabledonFatalDPanicfDPanicwDebuglnDesugarErrorlnFatallnPaniclnstoragenewSink*[1]intnewPairIsEmptyPopBacksetPathRawPathKeyFileChannelReceiveSendBufpktConniteratestreamsheadPostailPosDescendCleanuprcvTimereadBufUDPConnRandSrcPortStrbufPoolhopLoopDefinedAddBoolAddInt8AddTimeAddUintIntegerOnWriteAddCoreresetAtFloat64ptrSeenencoderelemEncelseEncscannedConsumeTrailerRequestExpiresCookiesGetBodyPatternmatchesRefererhasBytebyteBufabortedreqBodywrittendateBufclenBufHandlernewConnhandlerbaseCtxErrCodeSettingtrailerdidReadcontrol RequestwritechclosechisProxytlsHostidleLRUDialTLSgetConndialTLSbufPipereadErrdialingPayload*http.IlatencyRewritebackendnet/urllockDirKeyTypeExpiredmanagedoptionsOnEventIssuersStoragelockKeyaccountdoIssueCleanUpPresentdecodeddnsZonednsNameoldCertexpireszonesMudomains ProblemstackMu AccounthttpReqReqAddr UDPConnrequesttcpConnudpConnBindIP4BindIP6resolvelookup4lookup6EndPortonEvictRuleSetDefaultKickMapDecryptnMinus2BitSizeMGFHashpopHeadpopTailprivategetSlowpinSlowcheckerEncryptoutUsedtagSizesubkeyscipher1cipher2cipher3settingsuiteIDcontextAddASN1UnwriteHeadersscratchrestorendigitssetWordIsInt64ModSqrtSetBitsexpSlowFloat32CountryCanAddrCanUintComplexConvertMapKeysPointerSetBoolSetUintSetZeroTryRecvTrySendabiTypeCanSeq2addRcvr PtrTyperegPtrsunicodeDNSDoneRefreshanswerssection SysFileFstatatRawReadReadMsgprepareInCountIsBlankElemOffInSliceKeySizePutSlotwritingPackageChangedHasDatachangedGetFlagAddFlagBoolVarGetInt8GetTextIPMaskPIPSliceInt8VarIntVarPStringPTextVarTimeVarUint16PUint32PUint64PUintVaronepasslongestmatchedvisitedFindAllLongestdoMatchresultsResolveattrSepCommentTagNamesprintfDiscardpadCharConn_idQueueIDUser_idDev_idxPacketsDstAddrDstPortBndAddrBndPortsrcAddrdstAddrsrcPortdstPortsentSeqgsoSizetcphLentunFileaddrMapportMapmaxSizeCloneTotunNametcpPorttunLoopifrNameifrDataMPLSDstCongctlbuffersAdvanceFreeLenOverCapReserveSetByteToOwnedTCPAddrUDPAddrLineNumInversematchIPDomainsGetTypeGetCodeGetCidrpresentGetBestEmplaceclearupackTimeputBackifIndexpayloadinitErrpacketsfinSentreadPosgapTreesendStrAddPathtlsConfonClosecloseMxqloggerNewPathaddPathinitialappDataGetPinghasDataOnAckedsendErrrecvErrclearerconnCtxdoWriteNumReaddecoderreqDonerawConndialErrclientsseedPosreadValShuffletempDircontenttmpfileWasIdleGetConnGotConncomposecodeLenminSizesaveBufNoProxy*dns.RRcommentcachedLSubtype*dns.DSparseDS*dns.KXVertPre*dns.LP*dns.MB*dns.MD*dns.MF*dns.MG*dns.MR*dns.MXService*dns.NSUDPSize*dns.PX*dns.RPOrigTtl*dns.RTMACSizeIsEdns0SetAxfrSetIxfrSetTsig*dns.TAKeyCodePaddingAlgCodeServersexpiredAuthURLGetUserListDBsRestoreUpgradeBaseURLAccountBillingos/execskippedsysProcessEnvironenvironLookupAdialTFOSetVersnewHMACreadLenUint32NUint64Nuint32nuint64nshiftInforHKDFverbosepermuteskipNopliteralrepeatsmessagemissingLongTagContentproblemindentsanchorsterrorsstringvstructvemitterLeadCCCisInertbytesAtdoFlushsetDoneIn6AddrSetProgRxBytesTxBytesHairpinPromiscNetNsIDBitRateTxErrorRxErrorUdpCsum MacvlanQueueIdUpDelayPrimaryVxlanIdSrcAddrUDPCSumPortLowSetFlagIifNameOifNameIPProtoDataLensizeMapMutableEndLineImportsValueOfCanSendsamplerprofileackRateisGQUICConnLenPutBackLargestECNModehistoryptoModelastAckAbandonrcvAEADTriggerIfIndexRecvMsgSendMsgNextHoproffsetcopyLenhuffSymSetBodykemBasecheckedlastIdxbuildergobTypeStructTencInitgetJSONgetTexthasJSONEditionfileRawgoTypesdepIdxskeyTypevalTypewiretagtagsizeSetLazycanLazyBoolPtrmutablemethodskeyConvvalConvkeyZerokeyKindRestartStartedBuffersrecvMsgsendMsg EncoderTCPErrorUDPErrorfillAuthparseURIfillConnPtrBytesgo.shape*[]uint8isClienteventArrblockedcOverheadhaveVersrawInputlifetimeoriginalpskModesConfigIDconfigID ListenerresponsecapacitynewPointInsecureoverflowindirectchildrenvalEqualinitSlowecSignOkNotAfterKeyUsageDNSNamesPolicieshashFuncisRSAPSSSubjectscontainshintCertLocationValidityReadRunereadByte*fmt.fmtfmtFloattruncatefmtFlagserroringwrapErrsdoPrintffmtBytesprintArgGoStringsockaddrappendToAddrPortaddrFuncreadFromshutdownwriteMsgReadFromIntervalContainsDeadlineAppendToPriorityaddrAttrcriteriaattemptsnoReloadnameListPreferGoLookupIPLookupMXLookupNSexchangelookupIPlookupMXlookupNSpreferGodeadlineresolverResolverdialUnixinitOnceTryRLockreadLinecanonMapcloneSeqOverlapsWithZone*os.File*os.filenonblockTruncateExitCodeSysUsageUserTimesysUsageuserTimeMkdirAllOpenFile*[]int16*[]int32*[]int64*uintptr*float32*float64*[]errorcuOffsetentryoffbaseaddrbytedatapcHeadernoptrbssecovctrsfuncNametextAddrfuncInfoentryOffFileLineFunctionrefStoresubtractlessThanslotsPtrstktopspsweepgenneedzeroelemsizespecialsheapBitsobjIndexflushGennextFreescavengepushBackraceaddrinitHeapsiftDownwakeTimesendLockmaybeAddneedsAdddataqsizelemtypeisSelectwaitlinkwaittailmaySweepcleanupsrunqheadrunqtailsudogbufstatsSeqwaitTimedisabledlastTimevarintAttargetpcwaitsemalockAddrmstartfnthrowingspinningfreeWaitncgocallwaitlockfreelinklibcallgdlogPerMcoroexittrackingwritebufsigcode0sigcode1guintptrdurationreleasedinStacksmSpanSysotherSysheapGoalIdleTimecpuStatsheapScansysStatscpuStatsconcreteassertedpositionfileLineFuncTypePointersUncommonuncommonpriorityReadByteprevRuneProtocolFlowinfoScope_idCoreDumpSignaledNsignals*[8]int8CgroupFDcacheEndUnixNanoflagNamePostRunEhelpFuncinReadercommandsAddGroupCalledAsCommandsExecuteCHasAliasHasFlagsHelpFuncPrintErrRunnableTraversefindNextGetSlice*[][]intproviderendpointEndpointProviderkeyDelimoverridedefaultsVisitAllGetInt32GetInt64GetUint8InConfigaddStackDPaniclnSetLevelopenFileHyClientdispatchAuthFuncmainLoopNewErrorPopFrontPushBacklazyInit*url.URLHostnameJoinPathRedactedusernamepasswordPasswordUsernameOmitHostRawQueryFragmentgeoipMapCertFileSNIGuardFastOpenclientDoSendFuncrIteratecloseErrNotEmptywriteBufprevConnrecvLoopFullPathAddArrayAddInt16AddInt32AddInt64AddUint8emptyCtxptrLevelgrow$omitZeroscanNextarrayEncBuffered*io.pipenet/httpPusherIDDataSizeStreamIDlogReadsendWritelogWriteNewTimerHttpOnlySameSiteUnparsedsegmentsPostFormResponseFormFilepatIndexSetHTTP1SetHTTP2chunkingtrailerstlsStatecurStategetStatehijackedsetStateErrorLogServeTLSShutdownSettingsnewTimerreadMorestreamIDinGoAwaypingSentcondlogfbreakErrisPushed WriterTodidCloseonHitEOFaddChildeachPairregisterMarkDeadsetErrorcacheKeycanceledisBrokenisReusedreadLoopproxyURLpopFrontidleConnaltProtodialConnConnPoolconnPoolabortErrlastIdleexpectedDirectorModifiedFilenameMetadataSmallestleafCapacitystopChandoneChanOnDemandManagersNamesKeyUnmanagethrottlePreCheckgetEmailisAgreedsetEmaillistenerrawBytescertHashGetOrderNewOrderLookPathOutboundDialFuncExitFuncconnLockinitConnQUICPortTCPPortsUDPPortsisDomainStatsMapHashFunccheckSumlastReadValidatepushHeadheadTail*aes.CTR*gcm.GCMconstSumAddBytesAddValueSetErrorExportergenerateoptionalexplicittimeTypemath/big*big.Int*big.natdivBasicdivLargemulAddWWmulRangesetBytessubMod2NBinomialIsUint64MulRangeSetBytesSetInt64validateLocalityProvinceCanFloatMapIndexMapRangeNumFieldSetFloatassignTosetRunestypeSlowDNSStartrealTypeSetEDNS0Questionresourcerwunlock*poll.FDIsStreamRawWriteWriteMsgeofErrorreadLockpollablewaitReadOutCountSlotSizeEmbeddedOutSlice*sys.nihclearSeqDefValueGetValueBoolFuncBoolVarPBytesHexCountVarDurationFloat32PFloat64PGetCountGetIPNetGetInt16IPNetVarIPSlicePInt16VarInt32VarInt64VarInt8VarPIntSliceParseAllTextVarPTimeVarPUint8VarUintVarPmatchcapnewByteslog/slogLogValueAddAttrsNumAttrsLogAttrslogAttrsExpectedRootNameparseOneSetFlagslastByteReadLineAddrTypeQueue_idtipcAddrInstanceAddrtypePreferedNMethods*tun.TundeleteAtnewItemsupdateAtsetRoutesetRulestcpPort6SsthreshHoplimitInitCwndFeaturesInitRwndQuickACKReadPortGetEntry*v2geo.xsentTimePacketIDrefCountVersionshandlersresetErrreadChanreadOncepeekImplreadImplUsed0RTTKeyPhasepreSetupinitMapsfinishedscrambleGetFrameSetTokenrcvQueuerttStatsunpackermessagesinFlightstreamMxsettingsDatagramcloseCtxgraceCtxuseCountfinalizeencodingboundarylastpartBoundaryNextPartReadFormnextPartreadFormFileNameFormNamecloseDotIsPseudoaddEntrycallEmitcheckEnduseProxytypeNameNameHashRdlength*dns.lex*dns.ANY*dns.APLNegation*dns.AVC*dns.CAA*dns.CDSGenerate*dns.DLV*dns.EID*dns.GIDLatitudeAltitude*dns.HIP*dns.KEY*dns.L32*dns.L64*dns.LOCHorizPre*dns.NID*dns.NXT*dns.OPT*dns.PTR*dns.SIG*dns.MsgOtherLenNameUsedSetEdns0SetRcodeSetReplypopEdns0Selector*dns.SOA*dns.SPF*dns.SRV*dns.TXT*dns.UID*dns.URI*dns.X25TemplateInfoCodeKeyLeaseServeDNSNameListAttemptsExchangeErrorURITokenURLClientIDMassHaltCreateDBDeleteDBGetUsageListIPv4ListIPv6DatabaseSnapshotwatchCtxfirstErrFallbackConfigIdContentsToPublicPskModesresetForlockSlowAbsoluteMultiplyPow22523SubtractPositionnewFieldCapNamesSimplifycapNamescalcSizecollapseparseInttmpClassnumRunesnextExprShortTagend_markimplicitpossiblerequiredsequencenewlinescommentsdocumenttag_datadoneInittextlessmappingvTrailCCCIsNormaldoAppendmultiSegnextMaintmpBytesSegments*[8]boolprogNameheadroomRxErrorsTxErrorsAttachedLearningProxyArpSpoofchkRssQueryRawFlagsAllmultiProtinfoPMtuDiscFlowInfoMACAddrsNumPortsActorKeyMinLinksLacpRateAdSelectPortHighPeerNameLinkTypeValidLftUIDRangeUpstreamHopLimitupstreamPrefixessizeListmergeMapNewValueFullNameMessagesServicesIsPublicByNumberIsClosedIsPackedJSONNameMapValueTextNameNewFieldgetBytesgetIface*qr.CodehighGainAckCountOppositelogLevelfromPooltypeByteackFrameSendTimeSendModegetIndexlossTimeptoCountBackwardackAlarmkeyPhasesendAEADnonceBufrollKeysused0RTTSentTimeNewTokenPTOCountEncLevelRecvMsgsSendMsgsdgramOpt*spew.t0linkMask*[19]inthistSizecodebitscopyDistcopyDatamoreBitsbitCountRetryMaxGetParamSetParamSeedSizeexpanderbyteSizeChildrenIteratorparseKeyparseValencIndirdecIndirfieldnumfreeListsendZerosendTypeAddChildMeasuredNumFilesnumFilesNumEnumsnumEnumsInitJSONnameJSONnameTextallEnumsExtendeeBytesPtrInt32PtrInt64PtrinitDoneweakTypekeyFuncsvalFuncsisObjectraceReadrecvmmsgsendmmsgrecvMsgssendMsgs Encodinggo/tokenWriteIntlastType ServeHTTP HTTPError PtrToThis net/netip *[]func() *tls.Conn EarlyData createdAt nextEvent DidResume TLSUnique ClientCAs *tls.aead NonceSize *[8]uint8 didResume buffering bytesSent unmarshal sessionId keyShares earlyData PublicKey *[5]uint8 Handshake LocalAddr sendAlert signature clientMD5 serverMD5 clientSum serverSum Temporary BlockSize nonceMask IsOnCurve Unmarshal StoreNoWB nonceSize *[4]uint8 *[6]uint8 handshake rsaSignOk NextEvent TLSConfig *[]net.IP RawIssuer Signature NotBefore rangefunc *[1]uint8 *[2]uint8 *x509.OID toASN1OID lazyCerts CreateCRL Algorithm blockSize *[]string writeByte writeRune Precision padString reordered panicking argNumber badArgNum doPrintln fmtString *net.Addr IsPrivate *net.conn closeRead CloseRead SetLinger noWriteTo *net.Conn *net.pipe localDone UnwrapErr IsTimeout ReadMsgIP WriteToIP KeepAlive AcceptTCP *chan int partition LookupSRV LookupTXT lookupSRV lookupTXT dualStack DualStack dialMPTCP doDialTCP *net.file appendTo4 appendTo6 doRelease pidSignal pidStatus pidfdWait RemoveAll os/signal *[]uint16 *[]uint32 *[]uint64 textStart NotInHeap pclntable noptrdata enoptrbss typelinks itablinks pkghashes inittasks gcbssmask startLine isInlined nfuncdata lessEqual recovered nextDefer nextFrame schedtick schedwhen sizeclass startAddr freeindex allocBits spanclass largeType scanAlloc decActive incActive cleanHead deleteMin isSending reclaimed tryGetObj deferpool goidcache storeSlow haveStack available reentered caughtsig mallocing profilehz printlock traceback schedlink lockedExt lockedInt mWaitList profStack libcallpc libcallsp cheaprand locksHeld syscallsp syscallpc syscallbp stackLock waitsince ancestors sleepWhen committed largeFree inObjects stacksSys mCacheSys gcMiscSys TotalTime stackScan totalScan heapStats *[3]uint8 sleepStub setRecord increment FreeBytes ArrayType NumMethod *[256]int tableSize toReplace WriteByte WriteRune copyCheck buildOnce Continued TrapCause *[2]int32 Interface *[14]int8 *[96]int8 *[3]int32 *[]*uint8 Pdeathsig Prefixlen ValueElem cacheZone GobDecode GobEncode UnixMicro UnixMilli stripMono initTimer ValidArgs usageFunc errPrefix outWriter errWriter ErrPrefix HasParent InOrStdin PrintErrf SetOutput UsageFunc ValueType envPrefix BindPFlag GetString GetUint16 GetUint32 GetUint64 searchMap WithAttrs WithGroup locations addCaller *zap.ints *zap.Sink openSinks factories AuthRealm closeChan acceptErr checkIdle listeners ListenUDP handleTCP handleUDP negotiate udpServer zapLogger AutoRoute MoveAfter PushFront LoadGeoIP makeCache reconnect ReceiveCh CloseFunc maxHeight maxStream newStream openQueue GetStream PeekFront DeleteAll InsertAll *[1]error getConnID immediate Obfuscate readMutex connMutex addrIndex recvQueue AppendInt AddBinary AddObject AddString AddUint16 AddUint32 AddUint64 NewTicker cancelCtx AfterFunc Available ReadBytesempty$ nameBytes omitEmpty readIndex saveError scanWhile useNumber UseNumber readValue SetIndent indentBuf StreamDep Exclusive isControl *[9]uint8 dataFrame lastFrame errDetail headerBuf logWrites PromiseID ReadFrame WriteData WritePing connError CloseConn closeBody AddCookie BasicAuth FormValue ParseForm PathValue UserAgent cancelCtx statusBuf hijackedv ConnState Protocols protocols trackConn ServeConn afterFunc serveConn idleTimer Truncated debugData DebugData Increment endStream notePanic startPush setBuffer bodyBytes writeBody findChild matchPath queuePool RoundTrip addedGzip readLimit roundTrip writeLoop proxyAuth afterDial peekFront closeIdle AllowHTTP timeSince reqCancel abortOnce firstByte doRequest singleUse readerErr closeConn idleState setGoAway *http.Dir closeOnce transport Transport IssuerKey issuerKey getConfig KeySource certCache Challenge manageAll manageOne renewCert MaxEvents SetWindow primaryNs isExpired Resolvers getDomain getClient ListZones Directory *acme.EAB provision userAgent Directory retrieved authMutex *[2]error HTTPSPort DialFunc4 DialFunc6 readyChan *[]dns.RR StartPort PrevEntry ExpiresAt evictList GetOldest PeekOrAdd onEvicted OnlineMap StreamMap getOnline Normalize readSlice PublicKey CRTValues writerSem readerSem localSize Broadcast *sync.Map DeriveKey nextNonce baseNonce fixedSize AddUint24 AddUint48 publicKey BitLength FullBytes **big.Int *big.Word setUint64 FillBytes SetString SetUint64 lehmerGCD *asn1.Tag IsRegular Anonymous CallSlice bytesSlow regAssign retOffset stackPtrs inRegPtrs framePool SliceType questions AResource Authority Ftruncate WaitWrite WriteOnce writeLock waitWrite *abi.Kind *abi.Type *abi.Name GroupSize *abi.ITab *maps.Map Immutable Shorthand AddGoFlag BoolFuncP BoolSlice BytesHexP CountVarP DurationP IPMaskVar IPNetVarP Int16VarP Int32VarP Int64VarP IntSliceP StringVar Uint16Var Uint32Var Uint64Var Uint8VarP UintSlice parseArgs SortFlags MatchRune numSubexp prefixEnd newReader newString hasPrefix FindIndex NumSubexp backtrack doExecute doOnePass *afero.Fs LogValuer AddSource withAttrs withGroup StartLine sendError MatchName DecodeNil decodeInt decodeMap decodePtr SetPrefix isDiscard ReadSlice PutUint16 PutUint32 PutUint64 Reserved1 Sa_family DeviceIdx TargetIdx SourceSAP bufsIndex numMerged itemsPool tunWriter gsoBuffer BatchRead BatchSize configure portIndex NewPacket batchLoop LinkIndex MultiPath *[3]error FullReset WriteZero familyMap portFirst WritePort NewBuffer newBuffer ProtoPort sizeCache GetDomain GetPrefix estimates timeDelta Serialize SessionID FragCount Decrement Allow0RTT SendProbe validated connIDLen listening testHooks ErrorCode ctxCancel completed writeChan writeOnce errorRead cancelErr LatestRTT BytesSent BytesLost QlogTrace errorChan connQueue sendRetry DialEarly probeSent ProbeSent Validated generator sendQueue connStats connState qlogTrace srcConnID pnManager peekTimes ReadBatch batchConn mtuFinder localAddr readFirst closeSend ParseNext qloggerWG headerLen isConnect connCount math/rand bufReader partsRead tmpshared DotReader skipSpace Coalesced Sensitive idToIndex maxStrLen matchHost ProxyFunc HTTPProxy httpProxy addUnique successesnonce Responses RevokedAtAdns:"a" *dns.AAAA ToCDNSKEY *dns.CERT *dns.GPOS Longitude HitLength *dns.SVCB *dns.ISDN Locator64 *dns.NSEC *dns.NULL *dns.RKEY Inception *dns.TSIG RRsetUsed SetNotify SetUpdate *dns.TKEY *dns.TLSA ToRFC3597 ExtraText LeaseLife *dns.Conn WithExtra AuthStyle AttachVPC DetachVPC GetVNCUrl ListIPv4s ListIPv6s MassStart Reinstall ListPlans ListUsers GetDNSSec UpdateSoa AttachISO DetachISO ISOStatus ListNodes suffixOff *exec.Cmd WaitDelay goroutine ctxResult StdinPipe KeyConfig SessionId KeyShares AddAffine *rand.PCG ExpandFor marshaled seenLossy outputLen initBlock SqrtRatio StartCond alternate checkSize newRegexp numRegexp *toml.Key LocalDate LocalTime multiline encodeMap stashExpr OmitEmpty scan_mark pairs_end pairs_top input_pos canonical indention FieldsMap InlineMap Transform copySlice setString skipASCII QuickSpan transform flushCopy insertCGJ backwards quickSpan composing RxPackets TxPackets RxDropped TxDropped Multicast FastLeave RootBlock LinkState MaxTxRate MinTxRate SlaveType Namespace EncapType OperState LinkAttrs EtherType RestartMs HelloTime FlowBased MiiStatus DownDelay PeerEqual ClearFlag ListFlags Timestamp IfInfomsg iovecList coveredBy sizeField mergeList ProtoType EndColumn getString rsc.io/qr ackPoints getMinRtt drainGain LossCount StreamNum UpdateRTT latestRTT FrameType FinalSize AckRanges DelayTime GetLength ParsedLen parsedLen ParseType maxLength TimerType enableECN maxPeriod hasNewAck isMissing ackQueued bytesRead applyMask ourParams allow0RTT *qlog.ECN Initiator JoinGroup HasValues *[316]int availRead readFlush writeCopy writeMark stepState dataBlock nextBlock freqcache bitCounts bitLength TokenTypewritei BodyBytes drainBody authEncap coreDecap coreEncap *hpke.KEM dhKemBase fromP1xP1 bomPolicy Highlight encodeInt popWriter AddRtAttr IfAddrmsg SetExtAck *nl.RtMsg Locations initDecls IsDefault AsIfaceOf AsValueOf StringPtr Uint32Ptr Uint64Ptr fieldDesc oneofDesc isPointer MessageOf GoValueOf IsValidGo IsValidPB PBValueOf DoNotCopy DataBytes sizeClass lastState expectKey raceWrite sockaddrs recvmmsgF sendmmsgF syscaller IsKeyword IsLiteral Multiline EmitASCII WriteBool WriteName WriteUint Disconnect TCPRequest UDPRequest Obfuscator *[]*string *struct {} *[16]uint8 *[1]string keyModTime *[2]string *[32]uint8 *[4]string *[][]uint8 *[28]uint8 crypto/tls PrivateKey OCSPStaple ServerName Extensions NextProtos ClientAuth MinVersion MaxVersion ticketKeys *[12]uint8 *[13]uint8 scratchBuf nextCipher handshakes peerSigAlg serverName retryCount activeCall pskBinders extensions marshalMsg PublicName innerHello transcript *tls.alert CloseWrite RemoteAddr readRecord verifyData ciphertext ScalarMult HandleData *[64]uint8 RawSubject MaxPathLen OCSPServer *[4]uint64 *[24]uint8 AppendText rawSubject constraint systemPool ThisUpdate *[5]string Attributes NextUpdate *[20]uint8 *[66]uint8doSlow *[5]uint64 *[18]uint8 *[14]uint8 UnreadRune *fmt.State clearflags fmtBoolean fmtInteger fmtUnicode *func(int) widPresent *[68]uint8 goodArgNum catchPanic fmtComplex fmtPointer missingArg printValue isWildcard IsLoopback *net.netFD closeWrite SetNoDelay *net.IPNet remoteDone noReadFrom IsNotFound ReadMsgUDP WriteToUDP ReadFromIP WriteMsgIP unlinkOnce AcceptUnix *net.Error *net.Flags *net.scope Precedence unknownOpt forResolve LookupAddr LookupHost LookupPort goLookupIP goLookupMX goLookupNS lookupAddr lookupHost lookupPort tryOneName dialSerial dialSingle *[15]uint8 **abi.Type IsSingleIP string4In6 *[29]uint8 appendMode checkValid *os.Signal SystemTime systemTime *[3]uint32 *[]uintptr *complex64 *[]float32 *[]float64 pclnOffset modulename enoptrdata pluginpath gcdatamask *runtime.g repanicked *runtime.m *runtime.p insertBack allocCache gcmarkBits pinnerBits allocCount countAlloc nextSample tinyoffset tinyAllocs stackcache allocLarge releaseAll updateHeap *[2]uint64 mSyscallID putObjFast tryGetSpan workbufhdr checkempty sysmontick sudogcache mspancache gcStopTime startTicks cyclesLost stringData goSigStack preemptoff isExtraInC needextram cgoCallers winsyscall preemptGen waitreason gcscandone throwsplit raceignore parentGoid selectDone difference inWorkBufs largeAlloc numObjects totalFreed totalFrees mSpanInUse accumulate GCIdleTime *[10]uint8 atomicInfo *[2]uint32 *[8]uint64 _interface sysmonWake sleepRatio shouldStop gomaxprocs *[4]uint32 *chan bool *[48]uint8 readerWait rotateLeft *[5]uint32 frameStore *[3]string FieldAlign IfaceIndir StructType *[][]int32 *[65]uint8 UnreadByte *[108]int8 ExitStatus StopSignal *[8]uint32 Controllen *[14]int32 Credential Foreground Cloneflags Reordering *[19]uint8 LayoutElem *time.zone *time.Time cacheStart lookupName Nanosecond ZoneBounds initTicker subCommand SuggestFor ArgAliases Deprecated AddCommand DebugFlags HasExample LocalFlags ParseFlags PrintErrln ResetFlags SetContext HasChanged configName configFile configType decodeHook BindPFlags GetFloat64 ReadConfig SetDefault *[0]func() callerSkip *zap.uints *zap.times *zap.int8s *zap.bools httpClient acceptChan deleteFunc ListenHTTP acceptLoop DisableUDP forwarding MoveBefore MoveToBack *url.Error RequestURI ForceQuery geositeMap BBRProfile ServerAddr QUICConfig UDPEnabled configFunc openStream streamType nextStream OpenStream remoteAddr activePath nextPathID writeMutex normalized debugPrint LoggerName AppendBool AppendInt8 AppendTime AppendUint AddFloat32 AddFloat64 AddUintptr thereafter reflectBuf reflectEnc sourceFunc escapeHTML ReadString FieldStack nameNonEsc parseState savedError canAddrEnc tokenError tokenState tokenStack *io.Writer *io.Reader *io.Closer invalidate writeDebug countError getReadBuf frameCache startWrite writeBytes writeFrame CountError StatusCode ProtoMajor ProtoMinor RawExpires WriteProxy wantsClose *http.conn fullDuplex FlushError lastMethod finalFlush inShutdown activeConn onShutdown checkNotOn bodyReadCh serveMsgCh writeSched goAwayCode readFrames rejectConn runHandler shutDownIn wroteFrame reqTrailer snapHeader sentHeader wroteBytes writeChunk ReadCloser *http.body earlyClose readLocked BodyCloser IsResponse ByteReadCh doBodyCopy unwrapBody readCloser addPattern multiChild emptyChild handleFunc HandleFunc continueCh callerGone writeErrCh markReused targetAddr beforeDial tryDeliver peerClosed readClosed resTrailer readerDone doNotReuse lastActive sendGoAway *http.File promisedID mimeHeader SetCookies connection copyBuffer BufferPool IsTerminal cacheIndex MustStaple ManageSync RevokeCert forceRenew obtainCert selectCert ListenHost acmeClient GetAccount getAccount newAccount acmeIssuer handleConn txtRecords GetRecords SetRecords getApiHost nameClient HTTPClient NewAccount LogTraffic ForceHTTPS DeviceName CancelRead getTraffic *hash.Hash ordInverse *[0]*uint8 polynomial SaltLength crypto/rsa saltLength Precompute precompute *sync.Pool victimSize *sync.Cond *sync.Once crypto/aes crypto/des *aes.Block *aes.block crypto/rc4 *list.List nonDefault flushChild privateKey crypto/md5 *pem.Block RightAlign IsCompound stringType isCompound *asn1.Flag *big.stack modInverse montgomery ModInverse scaleDenom crypto/dsa Parameters *pkix.Name appendRDNs PostalCode CommonName ExtraNames IsExported CanComplex CanConvert Comparable SetComplex SetIterKey SetPointer UnsafeAddr Implements IsVariadic StructType assignIntN valueStart stackBytes outRegPtrs structType Additional AllAnswers MXResource NSResource SkipAnswer isBlocking RawControl ReadDirent readUnlock runtimeCtx *abi.TFlag IsEmbedded ReadVarint *[0]uint64 lengthMask growthLeft localDepth getWithKey tombstones clearSmall IsBoolFlag AddFlagSet BoolSliceP FlagUsages Float32Var Float64Var GetFloat32 GetIPSlice IPMaskVarP IPNetSlice IPSliceVar Int32Slice Int64Slice MarkHidden StringVarP Uint16VarP Uint32VarP Uint64VarP UintSliceP shorthands prefixRune FindString ReplaceAll allMatches replaceAll *[1]uint32 *slog.Attr *slog.Kind *slog.kind removePath DecodeHook ErrorUnset ZeroFields decodeBool decodeFunc decodeUint *flag.Flag AppendByte copyNeeded DecodedLen EncodedLen Target_idx *[63]uint8 IncludeUID ExcludeUID TableIndex ruleIndex6 gsoEnabled gsoToWrite BatchWrite nextIndex6 resetRules unsetRoute unsetRules *tun.Stack LastActive portAccess addrAccess LookupBack udpTimeout ReadPacket wintunLoop ILinkIndex WriteZeroN AddrString AddressLen PostReturn Descriptor comparator LastPacket RemoveUpTo extraAcked bytesAcked HeaderSize *quic.Conn TokenStore WouldBlock *quic.path closeQueue expiration frameQueue signalRead receiveStr enablePath DestConnID closeLocal retryQueue baseServer SentPacket highestSeq AckHandler addAppData addInitial datagramID streamsMap peerParams PacketConn supportsDF runStopped sendPacket generation QUICStream contentLen numWritten HTTPStream clientConn *rand.Rand ExpFloat64 initConfig CreatePart WriteField *[30]uint8 readHeader readString setMaxSize evictCount DecodeFull firstField beginChunk HTTPSProxy httpsProxy ipMatchers TBSRequest ProducedAt IssuerHash packHeader wrappedErr *dns.AFSDB DigestType *dns.CNAME *dns.CSYNC *dns.DHCID *dns.DNAME *dns.EUI48 *dns.EUI64 *dns.HINFO *dns.HTTPS SubAddress Preference *dns.MINFO *dns.NAPTR *dns.NINFO *dns.NSEC3 Iterations HashLength *dns.EDNS0 SetUDPSize SetVersion *dns.RRSIG Expiration PackBuffer RemoveName *dns.SSHFP *dns.UINFO *dns.Error TsigStatus TsigSecret StackTrace DeviceAuth AttachVPC2 DetachVPC2 MassReboot GetInvoice CreateUser DeleteUser UpdateUser CreateIPv4 DeleteIPv4 ListPublic GetCluster Kubernetes ReservedIP NewRequest SetBaseURLexited ExtraFiles StderrPipe StdoutPipe childStdin LookupAAAA DisableTFO ECHConfigs PskBinders nextProtos *[57]uint8 *[97]uint8 *[255]uint GCDVarTime IsMinusOne unlockSlow *hmac.HMAC MarkerOnly *[50]uint8 sumGeneric IsNegative *syntax.Op calcHeight parseClass EnterTable FromParser arrayIndex fromParser *yaml.Kind *yaml.Node token_mark start_mark items_data pairs_data buffer_pos raw_buffer flow_level references serialized best_width line_break whitespace open_ended FieldsList parseChild uniqueKeys aliasCount aliasDepth emitScalar marshalDoc *norm.Form Properties SpanString appendRune assignRune initString setFlusher *norm.Iter InitString Statistics AddrFamily Collisions AttachMode GSOMaxSize GSOMaxSegs GROMaxSize SrcPortMin MultiProto TimeQuanta NonPersist AgeingTime EncapLimit EncapFlags EncapSport EncapDport PartnerKey PartnerMac UseCarrier ResendIgmp LpInterval inMiddleOf marshalMap cloneBytes ParentFile ByJSONName ByTextName IsMapEntry HasDefault GetUnknown SetUnknown WhichOneof NewElement InRecovery PacingRate *bbr.Clock pacingRate pacingGain WithPrefix timeFormat logMessage MaxDataLen AcksPacket PacketType BytesAcked LostPacket ecnMarking Difference PathProbes congestion ecnTracker nextToSkip sendWindow SetReadKey setReadKey createAEAD WriteToken DatagramID ChosenALPN genericOpt ICMPFilter LeaveGroup WriteBatch *spew.flag availWrite writeSlice makeReader *[17]int32 hash/crc32 CheckRetry loggerInit clientInit *hkdf.hkdf *hpke.xKEM getSuiteID *sha3.SHA3 endianness NewDecoder NewEncoder Expression parseTable currentIdx checkArray checkTable safeString CommonType *gob.encOp encodeUint pushWriter sendTypeId countState *nl.RtAttr Calculated RangeFiles RangeEnums MakeString StringName CheckValid IsOpenEnum allocEnums checkDecls validation atomicOnce BytesSlice Float32Ptr Float64Ptr WeakFields newMessage fieldTypes rangeInfos getUnknown setUnknown nilMessage isRequired weakOffset checkField getPointer keyWiretag valWiretag CheckBytes needsComma afterValue controllen setControl IsOperator EndMessage WriteFloat marshalAny HTTPRequest sync/atomic *[0]*string *chan error FieldAlign_ *[3]uintptr certificate certModTime poolDequeue *[0]uintptr cipherSuite *tls.Config Certificate CipherSuite ECHAccepted SendAsRetry WrapSession writeKeyLog *func() int handshakeFn echAccepted packetsSent hpkeContext echRejected serverShare ciphersuite SetDeadline closeNotify loadSession CryptBlocks LoadOrStore serverHello clientHello DialContext *[]*url.URL *[]x509.OID ExtKeyUsage IPAddresses *[133]uint8 *[1]uintptr *[4]uintptr *[5]uintptr *[1][]uint8 *[16]uint16 *[2][]uint8 crypto/x509 MarshalText addCertFunc buildChains *x509.pkcs8 validPolicy *[]*big.Int *[]big.Word *fmt.buffer writeString *func(bool) precPresent wrappedErrs WriteString unknownType *net.IPMask DefaultMask IsMulticast isConnected ctrlNetwork ReadMsgUnix SyscallConn WriteToUnix *net.IPAddr *chan<- int *<-chan int IsTemporary ReadFromUDP WriteMsgUDP readFromUDP *net.IPConn mptcpStatus *[]net.Addr *net.ipAttr *net.result *net.byName lookupGroup LookupCNAME LookupNetIP goLookupPTR goLookupSRV goLookupTXT lookupCNAME *net.Dialer *netip.Addr bitsPlusOne withoutZone bitsSetFrom *[6]uintptr *os.dirInfo stdoutOrErr setDeadline *os.rawConn *os.timeout closeHandle *[]*os.File *os.Process *[512]uint8 *complex128 pctabOffset runtimehash funcnametab findfunctab textsectmap deferreturn stackguard0 stackguard1 syscalltick syscallwhen speciallock ensureSwept memProfRate *func(uint) minWhenHeap acquiretime releasetime putObjBatch bytesMarked flushedWork raceprocctx pinnerCache newSigstack createstack waitunlockf isMutexWait preemptStop trackingSeq *[492]uint8 *[832]uint8 *[68]uint64 totalAllocs mCacheInUse buckHashSys GCPauseTime GCTotalTime globalsScan publishInfo setEventErr slotsOffset errIntegral errOverflow *[112]uint8 *[32]uint64 *[128]uint8 readerCount rotateRight *[9]uintptr *[1][]int32 badCharSkip *[256]uint8 ContainerID NoSetGroups UidMappings GidMappings AmbientCaps UseCgroupFD Nanoseconds *time.Month MarshalJSON *time.Timer Annotations helpCommand CommandPath DisplayName ErrOrStderr NamePadding OutOrStderr OutOrStdout SetHelpFunc UsageString ValueString configPaths AllSettings GetDuration GetIntSlice MergeConfig MustBindEnv WatchConfig WriteConfig getSettings writeConfig *zap.Option *zap.Logger development errorOutput WithOptions *zap.int16s *zap.int32s *zap.int64s WriteSyncer *zap.Config ReceiveLoop EventLogger ListenSOCKS GetOrCreate *tun.Server StructRoute InsertAfter MoveToFront insertValue *url.Values EscapedPath setFragment passwordSet RawFragment LoadGeoSite ConnFactory Established SendMessage blockedSent ContainsAll ContainsAny **quic.Conn Deobfuscate HopInterval currentConn TrimmedPath *func(int8) AppendArray AppendInt16 AppendInt32 AppendInt64 AppendUint8 AddDuration ErrorOutput EncodeEntry appendFloat jsonEncoder initialized *json.field nameEscHTML byExactName valueQuoted InputOffset indentValue *io.discard StreamEnded maxReadSize debugFramer stringToken HasPriority ErrorDetail WriteGoAway writeUint16 writeUint32 CloseStream activeConns MaxHandlers IdleTimeout PingTimeout WriteSubset writeSubset WriteHeader Partitioned lastSegment otherValues WithContext isH2Upgrade releaseConn writeHeader wroteHeader handlerDone CloseNotify bodyAllowed readRequest ReadTimeout BaseContext ConnContext idleTimeout byteTimeout setConnFlow doneServing readFrameCh pushEnabled curHandlers canonHeader pingTimeout PseudoValue NumSettings httpResCode contentType closeStream onIdleTimer processData processPing readPreface resetStream resetQueued hasTrailers bodyRemains readTrailer addSegments findHandler registerErr canceledErr closeLocked reqCanceler h2transport dialConnFor bytesRemain sentHeaders pastHeaders readAborted abortStream goAwayDebug reqHeaderMu closeIfIdle healthCheck ErrorString maxStreamID SortStrings GenerateKey Certificate getAllCerts ManageAsync generateCSR AltHTTPPort DNS01Solver usingTestCA loadAccount saveAccount DNSProvider getZoneInfo toSanitized getDNSZones *acme.stack PollTimeout *acme.Order httpPostJWS pollTimeout postAccount *acme.keyID *[15]string InitialTime TraceStream RequestHook MasqHandler receiveLoop eventLogger masqHandlerreadMsg~writeTo~ ResolveInfo HostMatcher evictedKeys evictedVals onEvictedCB CancelWrite initialTime *[621]uint8 SignMessage addJacobian Precomputed *sync.Mutex *sync.eface rUnlockSlow *cipher.ctr *cipher.cbc *[16]uint64 *[60]uint32 *rc4.Cipher crypto/sha1 openGeneric sealGeneric crypto/rand *hpke.dhKEM AddASN1Enum AddASN1NULL MarshalASN1 Encapsulate Decapsulate *ecdh.Curve crypto/ecdh *md5.digest application Constructed panicNotMap FieldByName OverflowInt SetMapIndex abiTypeSlow capNonSlice extendSlice lenNonSlice stackAssign LatinOffset ConnectDone *[255]uint8 authorities additionals OPTResource PTRResource SOAResource SRVResource TXTResource SetBlocking writeUnlock prepareRead *abi.Method DataChecked IndirectKey ReturnIsPtr *abi.FuncID LoadAcquire *maps.table deleteSmall directoryAt growToSmall growToTable globalDepth globalShift messageType *pflag.Flag NoOptDefVal BytesBase64 BytesHexVar DurationVar Float32VarP Float64VarP GetBytesHex GetIPv4Mask IPNetSliceP IPSliceVarP Int32SliceP Int64SliceP IntSliceVar StringArray StringSlice StringToInt getFlagType subexpNames prefixBytes minInputLen *regexp.job shouldVisit MatchReader MatchString SubexpIndex SubexpNames *json.Codec *toml.Codec *yaml.Codec *afero.File *afero.OsFs *slog.Level *slog.Value ReplaceAttr groupPrefix nOpenGroups InfoContext WarnContext renamedFrom handleEvent ErrorUnused decodeArray decodeBasic decodeFloat decodeSlice *flag.Value *log.Logger AppendFloat TrimNewline WithPadding Bdaddr_type NFCProtocol ServiceName *unix.Iovec *unix.RtMsg StrictRoute itemsByFlow routeUpdate unsetRoute0 *tun.System *tun.TCPNat Destination staleReturn tcpListener *tun.WinTun processIPv4 processIPv6 WritePacket *buf.Buffer WriteRandom AddrPortLen ReadAddress matchDomain GetIntValue *v2geo.CIDR firstPacket FirstPacket *[][8]uint8 MaxTokenAge resetTokens createdConn isSingleUse writeOffset shutdownErr signalWrite HasMoreData finalOffset pathManager SmoothedRTT PacketsSent PacketsLost destroyImpl handleFrame sendPackets maxTokenAge connContext ListenEarly closeServer isValidated perspective pathProbing connRunners DropPackets streamQueue CurrentSize frameParser GetAckFrame cryptoSetup closeCalled nextVersion *quic.sconn gotGSOError writePacket clearStream *http3.body TrackStream hasMoreData sentRequest reqDoneOnce requestDone closeCancel graceCancel addListener *[607]int64 NormFloat64 SetBoundary currentPart NextRawPart disposition Multistream multistream PutIdleConn hasNetHooks *hpack.node searchTable shouldIndex evictOldest byNameValue EmitEnabled SetEmitFunc emitEnabled proxyForURLhttpReq RequestList *dns.zlexer isDuplicate GatewayType *dns.DNSKEY parseDNSKEY *dns.NIMLOC TypeCovered *dns.MsgHdr NameNotUsed RemoveRRset SetQuestion *dns.SMIMEA *dns.TALINK PSDNAddress *dns.ZONEMD fromRFC3597 SourceScope *dns.Client dialTimeout readTimeout DialTimeout expiryDelta RedirectURL AuthCodeURL TokenSource *govultr.OS GetUpgrades GetUserData ListVPCInfo ListHistory WriteAccess ListRegions GetNodePool GetVersions ListCluster Application Marketplace *exec.Errorsuccess SysProcAttr lookPathErr childStderr childStdout *tfo.Dialer setIPv6Only *bigmod.Nat ShouldPrint matchResult *[200]uint8 readGeneric *sha3.SHAKE appendGroup checkHeight checkLimits maybeConcat parseEscape parseRepeat wholeRegexp *gotenv.Env handleTable handleValue keyFromData stashedExpr MarshalYAML *yaml.Style HeadComment LineComment FootComment pairs_start tokens_head simple_keys best_indent events_head space_above foot_indent anchor_data scalar_data knownFields decodeCount NopResetter Transformer *norm.input appendSlice charinfoNFC insertFlush returnSlice RxCrcErrors ParentIndex MasterIndex NumTxQueues NumRxQueues SamplePoint PDPHashsize ActiveSlave ArpInterval ArpValidate FailOverMac PreferedLft destination marshalList StartColumn IsSynthetic Cardinality HasJSONName HasPresence IsExtension InterfaceOf InSlowStart InitiatedBy SetLogLevel *utils.Rand MaxAckDelay smoothedRTT maxAckDelay *wire.Frame LowestAcked MaximumData StreamLimit MinAckDelay Outstanding numSentECT0 numSentECT1 ReceivedAck DeclareLost largestSent lostPackets lastMetrics DeleteBelow addToRanges IgnoreBelow ignoreBelow prevRcvAEAD nextRcvAEAD SetWriteKey setWriteKey writeRecord DecodeToken *qlog.Frame *qlog.Token KeyPhaseBit IsCoalesced RTTVariance RecordEvent AddProducerrecvMsgՊsendMsgՊ wrotePrefix *[][]uint32 Uint32Slice Uint64Slice finishBlock readHuffman AccessToken DeleteParam IPv4Enabled IPv6Enabled *kem.Scheme crypto/sha3 MultiplyAdd AttachChild parseKeyval UpdateTable *gob.typeId externalEnc externalDec GobEncoderT EncodeValue encodeArray descsByName filesByPath NumMessages typesByName numMessages EnforceUTF8 eagerValues NumServices allMessages allServices lazyRawInit requiredBit messageInfo protoUnwrap denseFields coderFields sizePointer InvalidUTF8 *coding.Num betaLastMax *p384.Curve *p384.curve EmitUnknown *[510]uint8 prepareNext outputASCII ConnectError fillFastOpen *func() bool *[11]uintptr *[16]uintptr *tls.CurveID ocspResponse alpnProtocol SessionState CipherSuites OCSPResponse Certificates KeyLogWriter cipherSuites finishedHash handshakeErr maxEarlyData ocspStapling retryConfigs RecordHeader sessionState *tls.prfFunc certificates *tls.cbcMode readFinished sendFinished masterSecret rsaDecryptOk StoreSession SerialNumber SubjectKeyId *[][4]uint64 *[1088]uint8 AppendBinary EqualASN1OID *x509.sum224 systemVerify *[1]x509.OID *[1]big.Word encoding/hex *[1024]uint8 *func(uint8) *func(int32) *func(error) writePadding *net.OpError *net.UDPAddr *net.TCPAddr *func(int64) writeBuffers listenStream readMsgInet4 readMsgInet6 writeToInet4 writeToInet6 ReadFromUnix WriteMsgUnix *net.TCPConn MultipathTCP SetKeepAlive readDeadline lookupValues *net.UDPConn ListenPacket *net.rawConn HardwareAddr *net.nssConf *net.timeout serverOffset StrictErrors LookupIPAddr lookupIPAddr strictErrors dialParallel *[1]net.Addr appendTo4In6 *[52]uintptr *os.fileStat Readdirnames lstatatNolog spliceToFile RuntimeError *[]complex64 *[]*abi.ITab linktimehash modulehashes takeFromBack *func() uint deferBitsPtr initHeapBits maybeRunChan unlockAndRun dequeueSudoG readyNextGen statusTraced heapScanWork deferpoolbuf goidcacheend gcAssistTime limiterEvent *[32]uintptr captureStack recordUnlock *runtime.mOS profileTimer isExtraInSig allpSnapshot mLockProfile pcvalueCache locksHeldLen snapshotAllp atomicstatus paniconfault inMarkAssist runnableTime gcCyclesDone GCAssistTime *[]*abi.Type *[4096]uint8 *chan uint32 *map[int]int *[8192]uint8 replacements Unshareflags Microseconds Milliseconds *[]time.zone AppendFormat appendFormat *time.Ticker *cobra.Group UnknownFlags flagErrorBuf globNormFunc helpTemplate SilenceUsage HelpTemplate SetErrPrefix SetUsageFunc UsagePadding ValidateArgs VisitParents *viper.Viper AutomaticEnv GetEnvPrefix GetStringMap ReadInConfig SetEnvPrefix UnmarshalKey mergeFlatMap searchInPath *[]slog.Attr *viper.Codec *zap.uint16s *zap.uint32s *zap.uint64s *zap.payload *[]io.Closer *[]time.Time buildEncoder buildOptions RegisterSink *http.Server httpListener FirewallMark Inet4Address Inet6Address InsertBefore PushBackList DownloadFunc checkModTime closeCleanup shouldDelete AcceptStream DeleteStream deleteStream SetMaxStream retireConnID pathsToProbe *func(int16) AppendObject AppendString AppendUint16 AppendUint32 AppendUint64 AddComplex64 AddReflected LevelEnabler writeContext *json.Number reflectValue byFoldedName literalStore errorContext indentPrefix *[]io.Writer *[]io.Reader *io.WriterTo getDataFrame maxWriteSize HeadersEnded WriteHeaders AdjustStream registerConn *http.Header Uncompressed *http.Cookie ProtoAtLeast comparePaths CookiesNamed SetBasicAuth SetPathValue isReplayable hitReadLimit setReadLimit calledHeader *<-chan bool hijackLocked WriteTimeout TLSNextProto nextProtoErr doKeepAlives shuttingDown wroteFrameCh maxFrameSize writingFrame sentPingData hpackEncoder shutdownOnce PseudoFields checkPseudos LastStreamID noteBodyRead processFrame sendServeMsg setConnState writeHeaders wroteHeaders *http.mp4Sig earlyCloseFn *http.noBody doEarlyClose FlushHeaders extraHeaders readResponse wroteRequest targetScheme removeOldest idleConnWait connsPerHost MaxIdleConns queueForDial connPoolOnce RoundTripOpt initConnPool newTLSConfig pastTrailers copyTrailers writeRequest atomicReused closedOnIdle seenSettings nextStreamID addConnCalls RoundTripErr contentRange *[2048]uint8 *http.Client *[]sync.Pool Authenticate flushPending delayedFlush copyResponse ErrorHandler lockFilename DecisionFunc NeedsRenewal checkStorage TrustedRoots SetMaxEvents txtRecordsMu libdnsRecordID json:"id" createRecord doAPIRequest updateRecord deleteRecord upsertRecord addDNSRecord *acme.Client PollInterval GetDirectory pollInterval OverrideAddr OriginalAddr CloseWithErr handleClientreadFrom~writeMsg~Tx json:"tx"OK json:"ok" ExpireBucket RemoveOldest *[63]uintptrRx json:"rx" *crypto.Hash crypto/ecdsa *[2]*big.Int *sync.Locker *sync.noCopy XORKeyStream *cipher.AEAD *[256]uint32 *sha1.digest *rand.reader Undocumented *atomic.Bool sharedSecret *hpke.Sender AddASN1Int64 BytesOrPanic MasterSecret NewPublicKey newPublicKey encoding/pem defaultValue *big.divisor convertWords divRecursive Organization *fs.FileInfo *fs.FileMode *fs.DirEntry CanInterface FieldByIndex MethodByName OverflowUint SetIterValue panicNotBool AssignableTo assignFloatN makeFuncCtxt ConnectStart AAAAResource AllQuestions AnswerHeader SkipQuestion checkAdvance skipResource *poll.String ReadMsgInet4 ReadMsgInet6 WriteToInet4 WriteToInet6 prepareWrite waitCanceled internal/abi *abi.NameOff *abi.TypeOff *abi.TextOff *abi.Imethod IndirectElem *abi.PtrType *abi.RegArgs StoreRelease directorySet putSlotSmall replaceTable *pflag.Value AddGoFlagSet BoolSliceVar BytesBase64P BytesHexVarP DurationVarP Float32Slice Float64Slice GetBoolSlice GetUintSlice IntSliceVarP StringArrayP StringSliceP StringToIntP UintSliceVar parseLongArg sortedActual sortedFormal interspersed ErrorContext MatchRunePos ExpandString FindAllIndex FindSubmatch tryBacktrack *slog.Record isEmptyGroup *slog.Source *slog.Logger DebugContext encoding/csv *fsnotify.Op mapstructure MapFieldName decodeString decodeStruct defaultUsage *buffer.Pool lastRuneSize AppendDecode AppendEncode DecodeString SharedUmemFD tipcAddrtype Nfc_protocol Service_name *unix.RtAttr *tproxy.Conn AcceptTProxy *tun.Options *tun.flowKey tcpGROAccess tcp4GROTable tcp6GROTable *tun.Handler checkTimeout inet4Address inet6Address tcpListener6 ExtendHeader ReadFullFrom ReadOnceFrom CheckBadAddr ReadAddrPort WriteAddressdeadline~resolver~ RearHeadroom NeedHeadroom GetBoolValue ProtoMessage ProtoReflect GetAttribute *v2geo.GeoIP windowLength GetThirdBest MaybeRelease handlePacket *quic.Config AddrVerified capabilities *quic.sender *quic.pathID HandlePacket SwitchToPath *quic.Stream reliableSize currentFrame streamFrames PacketNumber StreamFrames SendDatagram handleFrames runSendQueue createServer enqueueProbe switchToPath ResetFor0RTT UseResetMaps ConnectionID oneRTTStream addHandshake *quic.framer *quic.packer AppendPacket srcConnIDLen creationTime *quic.sealer appendPacket streamSender sendDatagram closeReceive closeQlogger parseTrailer rcvdSettings *http3.Error ErrorMessage responseBody ReadResponse lastStreamID altSvcHeader removeClient roundTripOpt *rand.Source *color.Color dashBoundary ReadCodeLine ReadDotBytes ReadDotLines readCodeLine *gzip.Reader *gzip.Header decompressor WroteHeaders WroteRequest maxSizeLimit successRatio *ocsp.certID ResponseType *dns.CDNSKEY publicKeyRSA *dns.SVCBKey *dns.NSAPPTR *[]dns.EDNS0 RRsetNotUsed MatchingType *dns.RFC3597 tsigProvider *dns.Handler TsigProvider HandleRemove writeTimeout ClientSecret refreshTokenOs json:"os" GetBandwidth ListVPC2Info ListInvoicesPG json:"pg" *govultr.SoaIP json:"ip" *govultr.Iso GetNeighbors *govultr.ISO ListClusters *govultr.SSL Availability *govultr.VPC BlockStorage DomainRecord FirewallRule LoadBalancer SetRateLimit SetUserAgent ProcessStatesysUsageuserTime ProcessState childIOFiles goroutineErr dialAndWrite rawPublicKey OmitEmptyPsk nextProtoNeg getPublicPtr NextProtoNeg OcspStapling getPublicObj *quic.Header SetGenerator math/rand/v2 fipsApproved resetToBytes ShouldEnable *bisect.cond *sha3.Digest writeGeneric *syntax.Inst *syntax.Prog encodeStruct *toml.strict ExitKeyValue MissingField MissingTable arrayIndexes scalar_style head_comment line_comment foot_comment tail_comment token_number end_implicit problem_mark context_mark read_handler input_reader stem_comment root_context *yaml.parser fieldByIndex mergedFields multiSegment *norm.qcInfo charinfoNFKC LastBoundary NextBoundary nextBoundary insertSingle insertUnsafe *template.JS *netlink.Via RxOverErrors RxFifoErrors TxFifoErrors RxCompressed TxCompressed ProxyArpWiFi PhysSwitchID *netlink.Can *netlink.GTP *netlink.Vrf *netlink.Vti AggregatorId ArpIpTargets NumPeerNotif TlbDynamicLb VtepDevIndex VlanProtocol *netlink.Ifb toRtAttrData *udpnat.conn IsMessageSet AllowPartial MarshalState marshalField sizeSingular mergeMessage DoNotCompare ByDescriptor IsValidValue ProtoMethods panicMessage *bbr.Profile isAppLimited IsAppLimited MaxAckHeight OnAppLimited OnPacketLost OnPacketSent a0Candidates *bbr.bbrMode highCwndGain applyProfile maxBandwidth pktInfoSlots ToHeaderBits ReliableSize LargestAcked MaxStreamNum ReasonPhrase *wire.Header ValidFor0RTT ReceivedTime numAckedECT0 numAckedECT1 MigratedPath cleanupStart largestAcked DeleteBefore ackedPackets getScaledPTO deletedBelow AddBytesRead AddBytesSent addBytesRead isLongHeader aeadOverhead nextSendAEAD rejected0RTT IsRetryToken *ipv4.rawOptrecvMsgsՊsendMsgsՊ MulticastTTL TrafficClass HeaderFields *[512]uint32 tryWriteCopy huffmanBlock *flate.hcode *crc32.Table setAuthStyle RefreshToken EncodeValues RetryWaitMin RetryWaitMax PrepareRetrypatIndexi SVCBResource SVCBResource *sign.Scheme PushAndChain parseComment parseNewline scanDateTime KeepComments *gob.gobType encoding/gob *gob.mapType *gob.Encoder encodeSingle writeMessage IfaCacheinfo RegisterFile RegisterEnum CheckOverlap TypeResolver FileRegistry lazyInitOnce fileRegistry *impl.offset PointerSlice extensionMap isMessageSet oneofsByName mergePointer ExtendedType initToLegacy lazyInitSlow isNonPointer *impl.enumV1 *coding.Bits *coding.Mask *coding.Code *coding.Plan maxBurstSize lastSentTime getBandwidth IsEndOfRound hystartFoundMainjson:"" *socket.Conn CombinedMult IsAtInfinity *token.Token StartMessage WriteLiteral *gf256.Field encoderState *func() error *func(string) fillTLSConfig AcceptableCAs UnwrapSession Renegotiation DecryptTicket EncryptTicket decryptTicket encryptTicket mutualVersion supportsCurve *tls.halfConn trafficSecret *tls.keyShare sessionTicket alpnProtocols pskIdentities originalBytes updateBinders MaxNameLength serverNameAck selectedGroup readFromUntil readHandshake *tls.listener pointToAffine MarshalBinary LoadAndDelete internal/sync loadAndDelete establishKeys cipherSuiteOk *tls.QUICConn *[]*net.IPNet UnmarshalText *func() int32 *func(uint64) *fmt.fmtFlags handleMethods *fmt.Stringer *net.UnixAddr *net.sockaddr IsUnspecified *net.UnixConn SetReadBuffer readFromInet4 readFromInet6 writeMsgInet4 writeMsgInet6 writeDeadline *net.pipeAddr *net.DNSError *net.Listener *net.fileAddr singleRequest *[]net.IPAddr *chan []uint8 canonicalName *net.Resolver *net.addrList goLookupCNAME fallbackDelay FallbackDelay *netip.Prefix *func() int64 *os.LinkError copyFileRange *os.noWriteTo *[]complex128 *interface {} *runtime.Func filetabOffset takeFromFront *runtime.coro decPinCounter getPinnerBits incPinCounter newPinnerBits nextFreeIndex pinnerBitSize *func(uint16) reportZombies setPinnerBits changegstatus maybeRunAsync acquireStatus tryGetObjFast *[508]uintptr checknonempty mayNeedWorker *[512]uintptr scannedStacks *[]*runtime.p *runtime.note *[65516]uint8 varintReserve oldthrowsplit cgoCallersUse waitTraceSkip signalPending hasCgoOnStack preemptShrink parkingOnChan nocgocallback trackingStamp fipsIndicator syncSafePoint gcAssistBytes *[16384]uint8 *[]abi.Method missingMethod inputOverflow *func(uint32) IncNonDefault headerWritten InterfaceType IsDirectIface *[256][]uint8 *strings.span *syscall.Conn *time.Weekday firstZoneUsed UnmarshalJSON *[1]time.zone commandgroups parentsPflags usageTemplate flagErrorFunc SilenceErrors ArgsLenAtDash ContainsGroup FlagErrorFunc HasLocalFlags RemoveCommand ResetCommands UsageTemplate *viper.Finder secretKeyring SecretKeyring allowEmptyEnv AddConfigPath AllowEmptyEnv BindFlagValue MergeInConfig RegisterAlias SetConfigFile SetConfigName SetConfigType WriteConfigAs WriteConfigTo getConfigFile getConfigType marshalWriter registerAlias RegisterCodec *[]zap.Option sweetenFields *zap.errArray *zap.uintptrs *zap.float32s *zap.float64s handleConnect handleRequest socksListener BindInterface **net.UDPAddr NewConnection PushFrontList *url.Userinfo GeoIPFilename verifyAndFill connectedFunc *client.udpIO newStreamChan maxNumStreams ListenUDPFunc *zapcore.Core CapitalString unmarshalText AppendFloat32 AppendFloat64 AppendUintptr AddByteString AddComplex128 OpenNamespace IncCheckReset UnmarshalYAML EncoderConfig appendComplex safeAddString FlushInterval encoding/json *json.encOpts readSlice$ *[]json.field *json.scanner popParseState convertNumber rescanLiteral *json.Decoder tokenValueEnd *json.Encoder SetEscapeHTML *io.nopCloser *io.eofReader *io.onceError replyToWriter headerFragBuf WritePriority WriteRawFrame WriteSettings readMetaFrame HeaderEncoder *http.Handler *http.Request ContentLength *http.pattern *http.segment conflictsWith MultipartForm PostFormValue requiresHTTP1 handlerHeader contentLength closeNotifyCh finalTrailers finishRequest nextProtoOnce listenerGroup trackListener remoteAddrStr advMaxStreams shutdownTimer readIdleTimer RegularFields HasDuplicates checkPriority processGoAway declBodyBytes onReadTimeout *http.htmlSig *http.textSig didEarlyClose bodyReadError GetClientConn *chan<- error writeLoopDone cancelRequest getCtxForDial *http.connLRU CancelRequest customDialTLS newclientconn connPoolOrDef NewClientConn newClientConn requestedGzip reqBodyClosed sentEndStream getConnCalled pendingResets SetDoNotReuse closeForError onIdleTimeout tooIdleLocked addConnLocked getClientConn *http.anyDirs reqDidTimeout needsContinue *http.Flusher *[32768]uint8 checkRedirect CheckRedirect SetXForwarded flushInterval copyToBackend AnyCommonName hostWhitelist CertSelection RenewCertSync AccountKeyPEM emailUsername lookUpAccount newACMEClient activeWorkers AppendRecords DeleteRecords getDNSRecords errorResponse *vultr.Client getDNSEntries *acme.Problem *acme.Account FinalizeOrder UpdateAccount doHTTPRequest *server.udpIO HookedReqAddr UntraceStream TrafficLogger Authenticator authenticated HijackAddress removeElement ContainsOrAdd RewriteDomain *bytes.readOp *bytes.Buffer *bytes.Reader *rsa.CRTValue SessionKeyLen *[]sync.eface *sync.RWMutex crypto/cipher *cipher.Block roundKeysSize blockExpanded *list.Element DefaultReader *atomic.Value *atomic.Int32 *atomic.Int64 *hpke.hkdfKDF LabeledExpand *hpke.context *hpke.uint128 pendingLenLen pendingIsASN1 AddASN1BigInt AddASN1Uint64 addASN1Signed addBase128Int encryptionKey decryptionKey NewPrivateKey newPrivateKey *asn1.encoder encoding/asn1 expNNWindowed ProbablyPrime ToRDNSequence StreetAddress *fs.PathError *reflect.Type *reflect.Kind *reflect.flag InterfaceData OverflowFloat UnsafePointer ConvertibleTo stepsForValue DNSSECAllowed ExtendedRCode Authoritative CNAMEResource SkipAuthority resHeaderType internal/poll *poll.fdMutex *poll.SysFile ZeroReadIsEOF GetsockoptInt ReadFromInet4 ReadFromInet6 SetsockoptInt WriteMsgInet4 WriteMsgInet6 stringOffsets *abi.FuncType NeedKeyUpdate IntRegArgAddr *abi.FuncFlag *atomic.Uint8 *func() uint8 getWithoutKey maxGrowthLeft specifiedName specifiedFlag BoolSliceVarP DurationSlice Float32SliceP Float64SliceP GetIPNetSlice GetInt32Slice GetInt64Slice IPNetSliceVar Int32SliceVar Int64SliceVar PrintDefaults SetAnnotation StringToInt64 UintSliceVarP parseShortArg orderedActual orderedFormal argsLenAtDash errorHandling text/template *regexp.input regexp/syntax *regexp.queue *regexp.entry *[]regexp.job FindAllString LiteralPrefix *dotenv.Codec *slog.Handler *[5]slog.Attr *slog.Leveler *csv.position *[65536]uint8 decodeComplex *[]*flag.Flag *flag.FlagSet ErrorHandling *atomic.nocmp *bufio.Writer *bufio.Reader decodeQuantum *[]unix.Iovec *socks5.Reply gsoReadAccess FrontHeadroom deleteElement inet4Prefixes inet6Prefixes broadcastAddr bindInterface frontHeadroom *tun.LinuxTUN processPacket familyByteMap WriteAddrPort dualStack~ *acl.HostInfo *acl.Protocol *acl.TextRule *v2geo.Domain unknownFields GetTypedValue GetSecondBest sendTimeState SetRemoteAddr *[]*quic.path pathChallenge *quic.rawConn AddResetToken AddWithConnID MeanDeviation BytesReceived *[]qlog.Frame OpenUniStream handlePackets maxPacketSize setCloseError zeroRTTQueues stopAccepting handleNewConn refuseNewConn validateToken getSendStream AddConnRunner GetCryptoData highestOffset initialStream *[]wire.Frame activeStreams controlFrames pathResponses HandleMessage connIDManager tokenStoreKey mtuDiscoverer receivedRetry datagramQueue Get0RTTSealer Get1RTTSealer getDestConnID EncryptHeader encryptPacket getLongHeader DecryptHeader *quic.oobConn lastProbeTime *http3.Stream parsedTrailer writeUnframed flushTrailers writeTrailers **http3.Error encodeHeaders requestWriter *http3.Server serverContext ServeListener ServeQUICConn serveListener net/textproto ReadLineBytes readLineSlice compress/gzip *[]hpack.node maxTableIndex *acmez.Solver *acmez.Waiter Authorization currentSolver *acmez.Client nextChallenge provision userAgent HashAlgorithm IssuerKeyHash *ocsp.request *dns.AMTRELAYTxt dns:"txt" *dns.IPSECKEY ExtendedRcode *dns.Question *dns.SVCBPort *dns.SVCBAlpn *dns.EDNS0_UL SourceNetmask *dns.ServeMux ReadMsgHeader *errors.stack *errors.Frame *oauth2.Token SetAuthHeader DeviceAuthURL *govultr.Meta *[]govultr.OS *govultr.IPv4 *govultr.IPv6 ExpirySeconds GetRepository UpdateUserACL *govultr.Node CreateCluster DeleteCluster GetKubeConfig ListNodePools UpdateCluster *govultr.Plan ListBareMetal CreateFromURL *govultr.User *govultr.VPC2 FirewallGroup ObjectStorage StartupScript DoWithContext SetRetryLimit *<-chan error parentIOPipes rawExtensions SessionTicket *tls.KeyShare AlpnProtocols PskIdentities getPrivatePtr reseedCounter *rand.ChaCha8 BitLenVarTime montgomeryMul defaultReader *drbg.Counter *bisect.dedup padAndPermute *ecdh.curveID *syntax.Error *syntax.Flags leadingRegexp leadingString EnterKeyValue *toml.decoder handleKeyPart unmarshalBool *yaml.keyList *[]*yaml.Node mapping_style problem_value comments_head tokens_parsed block_allowed write_handler output_buffer output_writer *yaml.decoder mappingStruct stringMapType *yaml.encoder BoundaryAfter Decomposition FirstBoundary firstBoundary combineHangul insertOrdered compatibility html/template *template.CSS *template.URL *netlink.Link RxFrameErrors PhaseSegment1 PhaseSegment2 SyncJumpWidth VlanFiltering *netlink.Bond ArpAllTargets AdUserPortKey AdActorSystem *netlink.Vlan *netlink.Veth PeerNamespace *netlink.Addr *netlink.Rule PayloadLength overlapsEndOf *netipx.IPSet ContainsRange OverlapsRange MarshalAppend Deterministic UseCachedSize ProtoInternal IsPlaceholder ReservedNames AppendMutable *bbr.ackPoint bytesInFlight chooseA0Point onAckEventEnd drainToTarget OnPacketAcked TimeUntilSend recoveryState endRecoveryAt slowerStartup updateAckRate *protocol.ECN *utils.Logger SetInitialRTT meanDeviation IsCryptoError RetirePriorTo ParseExtended ParseAckFrame numAckedECNCE failIfMangled ReceivedBytes ResetForRetry SkippedPacket bytesReceived packetHistory lastBlockedAt receiveWindow Get0RTTOpener Get1RTTOpener highestRcvdPN updateAllowed zeroRTTOpener zeroRTTSealer initialOpener initialSealer has1RTTSealer has1RTTOpener handleMessage NewRetryToken *qlog.KeyType *qlog.RawInfo ChosenVersion BytesInFlight SetICMPFilter *flate.Reader *flate.byFreq closeBodyi LeveledLogger HTTPSResource TLSIdentifier PublicKeySize SignatureSize DeriveKeyPair SharedKeySize extractExpand labeledExpand *hpke.kemBase setShortBytes signedRadix16 parseStdTable parseValArray UnmarshalTOML checkKeyValue *gob.wireType *gob.encInstr *gob.gobError *gob.typeInfo *nl.IfInfomsg *nl.IfAddrmsg *[]sync.Mutex NumExtensions RangeMessages numExtensions GoPackagePath *strs.Builder unmarshalFull unmarshalSeed RawDescriptor allExtensions allocMessages allocServices *impl.pointer growBoolSlice unknownOffset GoReflectType OneofWrappers sizecacheType extensionType ExtensionType *impl.mapInfo *coding.Alpha *coding.Level AddCheckBytes *coding.Pixel *common.Pacer isCwndLimited currentMinRTT runtime/debug *debug.Module *socket.iovec *ed448.scheme *descfmt.list *text.encType *text.Encoder*func() string*cmd.tunLogger*cmd.udpLogger*cmd.tcpLoggerConnectRequest**fs.PathError*cmd.tunConfigfillQUICConfigfillServerAddrfillDisableUDPCompareAndSwap*[]*os.dirInfo*cmd.modeError*tls.quicState*tls.QUICEventverifiedChains*[]tls.CurveIDVerifiedChains*tls.ticketKeyGetCertificategetCertificatesetErrorLockedhandshakeMutexcloseNotifyErrclientFinishedserverFinishedclientProtocol*tls.echConfig*tls.echCipherVerifyHostnamepickTLSVersion*func([]uint8)ScalarBaseMultcompareAndSwapMaxPathLenZeroAuthorityKeyIdEmailAddressesPolicyMappings*x509.KeyUsage*x509.CertPool*x509.lazyCertCheckSignature*x509.validityTBSCertificateSignatureValue*[]fs.DirEntry*fmt.wrapErrortruncateString*fmt.FormatterSetWriteBufferlistenDatagram*net.noWriteTo*net.AddrError*func(uintptr)*func() uint16*net.InterfaceMulticastAddrs*net.nssSource*net.temporary*net.dnsConfiggetLookupGroupControlContext*net.sysDialerdoDialTCPProto*[1]net.IPAddrhasWeakPointerStringExpanded*netip.uint128*[]fs.FileInfo*os.unixDirent*os.noReadFrom*runtime.FramefuncnameOffset*runtime._func*runtime.stack*runtime.gobuf*runtime.mspan*runtime.mutexlockRankStructmanualFreeListinlineMarkBitstypePointersOf*func() uint64*runtime.gList*runtime.sudog*runtime.hchan*runtime.timer*runtime.waitqflushScanStats*[2048]uintptr*runtime.wbBufrunSafePointFncleanupsQueuedtraceBufHeaderbecomeSpinningasyncSafePointtinyAllocCountlargeFreeCountsmallFreeCountheapStatsDeltatotalAllocatedgcCyclesForcedScavengeBgTime*func(float64)goodSuffixSkip*syscall.Errno*syscall.Iovec*time.Duration*time.Location*cobra.CommandExecuteContextHasSubCommandsInheritedFlagsMarkFlagCustomNameAndAliasesSetHelpCommandSuggestionsForgetCompletionspersistentFlag*viper.Encoder*viper.DecoderenvKeyReplacertypeByDefValueonConfigChangeBindFlagValuesConfigFileUsedGetSizeInBytesGetStringSliceMergeConfigMapOnConfigChangeUnmarshalExactfindConfigFile*zap.durations*[1]zap.OptioninitHTTPClient*chan net.ConnListenAndServeCheckSupportedapplyToUDPConn*socks5.ServerUpdateIntervalshouldDownloadURL json:"url"*client.Client*client.ConfigMaxIdleTimeoutReceiveMessageCloseWithErrorOpenStreamSync*[]quic.pathIDpathToSwitchToobfsPacketConnreadBufferSize*zapcore.Entry*zapcore.Level*zapcore.Field*func(float32)AppendDurationopenNamespacestryAddRuneSelf*zapcore.Clock*json.isZeroerpushParseStatearrayInterfacevalueInterface*io.ReadCloser*io.ReaderFrom*io.ReadWriter*io.ReadSeeker*io.ByteReader*io.ByteWriter*io.RuneReaderreadCloseError*io.PipeReader*io.PipeWriterdebugFramerBufSetReuseFramesWriteRSTStreamunregisterConn*http.Response*http.SameSitebodyIsWritablecompareMethodsoutgoingLengthbackgroundRead*http.responsedeclareTrailerMaxHeaderBytescloseIdleConnsmaxHeaderBytescountErrorFuncheaderWriteBufForeachSettingcurOpenStreamsprocessHeadersprocessSettingupgradeRequestBreakWithErrorcloseWithErroronWriteTimeoutsentContentLen*http.sniffSig*http.exactSigResponseToHEAD*http.ServeMux*http.muxEntry*http.wantConnconnsPerHostMuDialTLSContextReadBufferSizeremoveIdleConntryPutIdleConndialClientConnrespHeaderRecvencodeTrailersforceCloseConnforgetStreamIDhttp2Transport*http.Hijacker*http.canceler**http.RequestmodifyResponseModifyResponseRootCommonNamemaintainAssetsObtainCertSyncRenewCertAsyncAltTLSALPNPortNewAccountFunclastNextUpdateOverrideDomainTTL json:"ttl"toLibDNSRecordlistAllRecordsCSR json:"csr"LastActiveTimeLogOnlineState*server.ConfigUDPIdleTimeout*server.Server ResponseWriterdirectOutboundskipCNAMEChain*sniff.SniffergetDumpStreamslastActiveTime*crypto.Signer*sha256.Digestcrypto/ed25519doubleJacobian*rsa.PublicKey*cipher.Stream*des.desCipherXORKeyStreamAtcontainer/list*godebug.valuenonDefaultOnce*atomic.noCopy*atomic.Uint32*atomic.Uint64LabeledExtractincrementNonceexporterSecretinContinuationAddASN1BooleanAddASN1UTCTime*asn1.RawValuesetFromScanner*dsa.PublicKey*reflect.ValuemustBeExported*reflect.rtype*reflect.visitAllAdditionalsAllAuthoritiesSkipAdditionalSkipAllAnswersresourceHeaderresHeaderValidincrefAndClose*poll.pollDescSetsockoptByte*go.shape.boolForgetUnshared*abi.ArrayType*[]abi.ImethodHashMightPanic*abi.SliceType*sys.NotInHeapdirectoryIndex*godebugs.Info*pflag.ipValue*[]*pflag.Flag*pflag.FlagSetBytesBase64VarDurationSlicePGetBytesBase64GetStringArrayGetStringToIntIPNetSliceVarPInt32SliceVarPInt64SliceVarPMarkDeprecatedStringArrayVarStringSliceVarStringToInt64PStringToIntVarStringToString*regexp.RegexpmaxBitStateLenprefixComplete*regexp.thread*regexp.inputscanCheckPrefixReplaceAllFunc*afero.LstaternewHandleState*slog.groupptr*slog.timeTime*flag.intValue*flag.boolFlag*buffer.BufferwriteMultilineEncodeToString*unix.Sockaddr*unix._SocklenShared_umem_fd*unix.TIPCAddrDestinationSAP*logger.Logger*[]*buf.Buffer*tun.NativeTunExcludedRangesIncludePackageExcludePackageFileDescriptorlookupOrInsertupdateAgeOnGetLoadWithExpireprocessIPv4TCPprocessIPv4UDPprocessIPv6TCPprocessIPv6UDP*tun.ifreqData*buf.Allocator*[11]sync.PoolReadPacketFromWaitReadPacket*acl.ipMatcher*acl.GeoLoader*v2geo.GeoSiteEnumDescriptorGetCountryCode*[]*v2geo.CIDREntrySlotsUsedgetEntryWraper*utils.QStream*quic.sendConnlastPacketTimercvdNonProbingnonQUICPacketsearlyConnReadydataForWritingflowControllerpopStreamFramereliableOffsetreadPosInFramecancelReadImplcompletedMutexIsAckElicitinglongHdrPacketsshortHdrPacketNextConnectiongetPathManagerhandleAckFrametriggerSendingreceivedPackettokenGenerator*quic.ListenerpathChallengesremovePathImplSequenceNumberhighestRetiredissueNewConnIDPopCryptoFrame*quic.unpackerStartHandshakeorigDestConnIDretrySrcConnIDpacingDeadlineconnStateMutexremoteAddrInfo*[1]qlog.Frame*http3.rawConnrcvdControlStronStreamsEmptydatagramStreamheaderCompletetrailerWritten*http3.ErrCodecreatedLocallyrequestHandlerSetQUICHeadersremoveListenerdoRoundTripOptresolveUDPAddr*rand.Source64mime/multipartCreateFormFilenlDashBoundaryReadMIMEHeaderGot100ContinueGot1xxResponse*[]*hpack.node*hpack.EncoderallowedMaxSize*hpack.DecoderSetEmitEnableddomainMatchers httpClientRawResponderID*ocsp.Response*dns.RR_Header*func() dns.RR*dns.APLPrefixReadPrivateKeypublicKeyECDSAData dns:"any"ValidityPeriodisCompressible*dns.SVCBLocal*[]dns.SVCBKey*dns.EDNS0_ESU*dns.EDNS0_EDE*dns.EDNS0_N3U*dns.EDNS0_DHU*dns.EDNS0_DAU*dns.EDNS0_LLQTsigTimersOnlytsigRequestMACSingleInflight*libdns.Record*oauth2.ConfigauthStyleCache*govultr.LinksRAM json:"ram"Tag json:"tag"URN json:"urn"SSL json:"ssl"CPU json:"cpu"Max json:"max"StartMigrationKVM json:"kvm"*[]govultr.ISOCreateNodePoolDeleteNodePoolUpdateNodePoolRegenerateKeys*[]govultr.VPCISO json:"iso"VPC json:"vpc" systemTimecreatedByStackCombinedOutput*tls.ECHConfigParsePublicKeySetCipherSuite*tls.certCache*ecdsa.curveIDgeneratorTableInverseVarTime*sync.hashFunc*sha512.Digest*bisect.Writer*[]bisect.cond*field.ElementcarryPropagate*syntax.ranges*syntax.InstOp*[]syntax.Inst*syntax.Regexp*syntax.parserparseClassCharparsePerlFlagshandleKeyValueunmarshalArrayunmarshalFloatskipUntilTable*yaml.IsZeroersequence_styletag_directivesstart_implicitproblem_offsetraw_buffer_poslast_anchor_idgeneralMapTypeBoundaryBeforeIsNormalString*norm.formInfo*norm.iterFunc*template.HTML*netlink.EncapRxLengthErrorsRxMissedErrorsTxWindowErrorsClockFrequency*netlink.IPoIB*netlink.Xfrmi*netlink.IptunUdpZeroCsum6TxUdpZeroCsum6RxXmitHashPolicyAdActorSysPrio*netlink.VxlanUDP6ZeroCSumTxUDP6ZeroCSumRx*netlink.Dummy*netlink.Route*netlink.Scope*udpnat.packetgo4.org/netipxAppendPrefixesentirelyBeforeContainsPrefixOverlapsPrefixDiscardUnknownmarshalMessagesizeMessageSet FileDescriptorReservedRangesTypeDescriptor*bbr.BandwidthtotalBytesSenttotalBytesLostTotalBytesLostTotalBytesSentmax_ack_heightlastSentPacketnumStartupRtts*bbr.bbrSenderroundTripCountlastCycleStartexitProbeRttAtrecoveryWindowtoGQUICVersionHasMeasurementSetMaxAckDelayhasMeasurement*monotime.TimeDataLenPresent*wire.AckFrame*wire.AckRangeencodeAckRangeIsAckFrameTypeisValidRFC9000ValidForUpdateInitialMaxDatanumSentTestingnumLostTestingReceivedPacketNumOutstandingSkippedPacketsskippedPacketsnumOutstandinginitialPacketsappDataPacketsshouldQueueACKIsNewlyBlockedSendWindowSizeepochStartTimetokenProtector*qlog.ECNStateClientVersionsServerVersionsTimeReordering*ipv4.dgramOptpayloadHandlerQuaterStreamID*qpack.Decoder*qpack.Encodercompress/flate*[]flate.hcode*[]crc32.Table*query.EncoderRequestLogHook wantsCloseiStandardClient*pki.TLSSchemePrivateKeySize*kem.PublicKeyCiphertextSizelabeledExtract*hpke.shortKEM*unstable.Kind*unstable.Node*unstable.rootNextExpressionparseSimpleKeyscanIntOrFloat*danger.TypeID*tracker.entry*gob.arrayType*gob.sliceType*gob.fieldType*gob.encBufferTextMarshalerT*gob.encHelper*gob.encEnginesendActualTypeSetSendTimeoutFindFileByPathFindEnumByNameAppendFullName*filedesc.File*filedesc.Enum*filedesc.Base*impl.exportergrowInt32SlicegrowInt64SliceunknownPtrKindneedsInitCheckfieldsByNumbermakeFieldTypesmakeStructInfosizeExtensionsinitFromLegacy*impl.EnumInfo*coding.StringnumConnectionsrttSampleCount*socket.ipConn*socket.msghdrboundRecvmmsgFboundSendmmsgFmarshalUnknown*func(net.Addr)*cmd.httpLogger*cmd.httpConfigfillConnFactoryfillEventLoggerfillMasqHandlerfillRequestHook*[0]*os.dirInfo*chan os.Signal*chan struct {}*map[string]int*[]netip.PrefixextMasterSecretwaitingForDraintransportParamsSupportedCurvesSupportedPointsSupportedProtosResumptionStatecloseNotifySentupdateRequested*[]tls.keySharesupportedCurvessupportedPointsticketSupported*func() []uint8encapsulatedKeyinnerTranscriptConnectionStateSetReadDeadlineclientHandshakehandleKeyUpdatemakeClientHelloreadClientHelloreadRecordOrCCSretryReadRecordsendAlertLockedserverHandshakeechRetryConfigspreMasterSecretRetryConfigList*tls.cthWrapperConstantTimeSumcrypto/ellipticnormalizeScalarpointFromAffine*tls.AlertErrorUnmarshalBinarylookupWithValuedoFullHandshakepickCipherSuite*[4]tls.CurveID*go.shape.uint8ExtraExtensions*[128][4]uint64internal/bisect*[5]tls.CurveIDgetSANExtensionhasSANExtension*x509.authKeyId*func() []error*fmt.wrapErrors*func(int) bool*fmt.GoStringerIsGlobalUnicastmatchAddrFamily*<-chan []uint8*chan<- []uint8*net.noReadFrom*net.ParseError*net.PacketConnwriteToAddrPortSetMultipathTCPKeepAliveConfig*net.dialResult*map[int]stringresolveAddrListtestHookDialTCP rUnlockSlowgetLineFromDatabitsClearedFrom*netip.AddrPort*func() uintptrsetReadDeadlinepidfdSendSignal*signal.handler*unsafe.Pointer*[]interface {}*runtime._defer*runtime.pinner*runtime._panic*runtime.sigset*runtime.mcache*runtime.gcBitsmarkBitsForBasemoveInlineMarksprepareForSweep*runtime.timersminWhenModifiedmaybeWakeLockedsetStatusTracedstatusWasTraced*runtime.gcWork*runtime.lfnodevgetrandomStateg0StackAccuraterunningCleanupsvalgrindStackIDlargeAllocCountsmallAllocCountGCDedicatedTimedeferBitsOffsetsleepController*runtime.FramesExportedMethods*strings.Reader*syscall.RtAttr*syscall.Signal*syscall._Gid_t*syscall.Rlimit*syscall.Rusage*syscall.Stat_t*func() float64*time.zoneTrans*chan time.TimelookupFirstZone*func(int, int)*[]*cobra.Group*cobra.tmplFuncversionTemplatecommandCalledAsExecuteContextCMarkFlagDirnamePersistentFlagsSetHelpTemplateVersionTemplateargsMinusFirstXfindSuggestionsinitCompleteCmdremoteProvidersencoderRegistrydecoderRegistrySafeWriteConfiggetRemoteConfigunmarshalReadergo.uber.org/zap*zap.optionFuncMarshalLogArray*zap.complex64s*zap.stacktraceidleCleanupLoop*proxymux.OpErracceptErrorFunc*tun.singLogger*tun.tunHandlerEscapedFragmentGeoSiteFilenameDownloadErrFuncInitializeCacheKeepAlivePeriodBandwidthConfig*client.tcpConnPseudoLocalAddr*client.udpConnGetOrOpenStreamscheduleSendingwriteBufferSizenextHopIntervalAppendComplex64AppendReflected*[]zapcore.CoreencodeReflectedresetReflectBuftryAddRuneError*zapcore.ioCorepropagateCancel*json.MarshalerAvailableBuffer*json.jsonErroraddErrorContextobjectInterface*io.multiReader*io.WriteCloser*io.ByteScannerwriteCloseErrorReadMetaHeadersWriteDataPaddedcheckFrameOrderReadIdleTimeout*http.keyValuessortedKeyValues*[]*http.Cookie*[]http.segmentMultipartReaderexpectsContinuemultipartReader*http.ConnStateSendPingTimeout*http.ProtocolswriteContinueMucloseAfterReplyrequestTooLargeunackedSettingsneedsFrameFlushreadIdleTimeoutcanonicalHeaderhandlePingTimeronReadIdleTimeronSettingsTimeronShutdownTimerprocessPriorityprocessSettingsscheduleHandlerstartFrameWritewriteFrameAsync*http.http2pipecloseDoneLockedcloseNotifierMucloseNotifierCh*http.maskedSig ReadWriteCloser*http.socksAddrmatchingMethodsmatchOrRedirect*http.TransportwaitForContinuedialsInProgressTLSClientConfigMaxConnsPerHostIdleConnTimeoutWriteBufferSizedecConnsPerHostidleConnTimeouttotalHeaderSizeget1xxTraceFuncwantSettingsAckstreamsReservedpendingRequestsaddStreamLockedidleStateLockedaddConnIfNeeded*http.httpRange*http.CookieJar**http.ResponsegetErrorHandlercopyFromBackendDisableStaplingObtainCertAsyncreusePrivateKeyExternalAccountPreferredChains*[2]tls.CurveID*gandi.Provider*vultr.ProviderremoveDNSRecordupdateDNSRecord*acme.Directory*acme.ChallengeIdentifierValue*server.UDPConn readFromUDP~addrExToRequestfromStreamStats*elliptic.Curve*rsa.PSSOptions*rsa.PrivateKey*[]rsa.CRTValue*sync.poolLocal*sync.poolChain*sync.WaitGroupNewCBCDecrypterNewCBCEncrypter*cipher.ctrAble*cipher.gcmAblegenerateSubkeysgcmPlatformData*atomic.align64*atomic.Uintptr*hpke.RecipientHandshakeSecret*sort.Interface*ecdh.PublicKey*ecdh.nistCurve*asn1.BitString*[]asn1.encoderexpNNMontgomery*dsa.Parameters*pkix.ExtensionContextSpecific*fs.ReadDirFile*reflect.MethodFieldByIndexErrFieldByNameFuncOverflowComplexstringNonStringexportedMethods*reflect.abiSeq*[]reflect.Type*nettrace.TraceAuthorityHeaderUnknownResourceresHeaderOffsetresHeaderLength*abi.StructTypecheckInvariantspruneTombstonesgetWithKeySmall*pflag.intValue*pflag.boolFlagBytesBase64VarPCopyToGoFlagSetFloat32SliceVarFloat64SliceVarGetFloat32SliceGetFloat64SliceSetInterspersedShorthandLookupStringArrayVarPStringSliceVarPStringToIntVarPStringToStringPaddedGoFlagSetsMatchEmptyWidth*regexp.machine*[]regexp.entryFindAllSubmatchFindReaderIndexFindStringIndexLstatIfPossible*slog.LogValuer*slog.stringptr*csv.ParseError*fsnotify.EventSquashTagOption*flag.uintValuewriteSinglelineencoding/base64*base64.encoderencoding/binary*unix.IfInfomsg*unix.IfAddrmsg*socks5.RequestWriteVectorised*tun.tcpGROItem*tun.TCPSessionStoreWithExpireNewPacketDirectinterfaceFinderprocessIPv4ICMPprocessIPv6ICMPReadAtLeastFromNewPacketBuffer*acl.allMatcherGetResourceHash*[]*v2geo.GeoIPGetInverseMatch*[]bbr.ackPointSetWindowLengthtotalBytesAckedEnableDatagrams*quic.TransportConnectionIDLenconnIDGeneratorgetControlFramefinishedWritingonHasStreamDataPacketsReceivedencryptionLevelEncryptionLevelPacketNumberLenAcceptUniStreamConnectionStatsReceiveDatagramhandleOnePacketmaybeResetTimersendProbePacketswitchToNewPathreceivedPacketssendRetryPacketNextPathToProbe*quic.newConnIDaddConnectionIDassertNotClosedAddConnectionIDconnIDsToRetirehandshakeStreamAddActiveStreamShouldSendProbe*quic.blockModesentFirstPacketPopPacketNumber*quic.batchConn*quic.basicConn*quic.sendQueue*quic.mtuFinder*http3.fakeConnenqueueDatagram*http3.SettingsenableDatagramsExtendedConnectsendRequestBody*http3.listener*rand.rngSource*frag.Defragger*blake2b.digest*multipart.partCreateFormField*multipart.Part*multipart.FormisFinalBoundarypopulateHeadersWait100ContinuetableSizeUpdate*idna.runeErrorgetAuthzObjects httpPostJWS pollTimeout postAccountsolveChallengesTBSResponseData*[]ocsp.request*dns.ParseErrorAAAA dns:"aaaa"setPublicKeyRSAPublicKeyLength*dns.NSEC3PARAM*dns.OPENPGPKEY*[]dns.QuestionRdata dns:"hex"*dns.EDNS0_NSIDExchangeContextACL json:"acls"*govultr.Client*govultr.Backup*govultr.VNCUrl*[]govultr.IPv4*[]govultr.IPv6DetachMigration*govultr.DomainListReverseIPv6*govultr.ISOReq*[]govultr.NodeGetFirewallRule*govultr.S3Keys*[]govultr.Plan*govultr.Region*govultr.SSHKey*[]govultr.User*govultr.VPCReq*[]govultr.VPC2BareMetalServer*govultr.lbBase*exec.ExitError*[]func() error*exec.ctxResultawaitGoroutines*tfo.dialResult*[]*net.TCPAddrECHRetryConfigs*tls.activeCertSetMasterSecret*[]tls.KeyShareTicketSupportedSrcConnectionID*ecdsa.hmacDRBGBytesCompressedbytesCompressed*bigmod.ModulusDivShortVarTimeExpShortVarTime*sync.equalFunc*bisect.Matcher*syntax.EmptyOpparseNamedClassparseRightParenswapVerticalBar*toml.LocalDate*toml.LocalTimeEnterArrayTablehandleKeyValueshandleTablePartunmarshalStringclearArrayTable*yaml.TypeError*yaml.MarshalerindicatedString*yaml.fieldInfo*yaml.yamlErrorquoted_implicittoken_availablemapping_contextcallUnmarshalercombinesForwardQuickSpanStringdecomposeHangul*netlink.bpfObjSetXmitHeadroomTxAbortedErrorsTxCarrierErrors*netlink.VfInfoTimeSegment1MinTimeSegment1MaxTimeSegment2MinTimeSegment2Max*netlink.Tuntap*netlink.Bridge*netlink.Sittun*netlink.Ip6tnl*netlink.Gretun*netlink.Gretap*netlink.Geneve*netlink.IPVtap*netlink.IPVlanPrimaryReselectAllSlavesActivePacketsPerSlave*netlink.DeviceSuppressIfgroupreadWaitOptions*udpnat.Handler*netipx.IPRangeoverlapsStartOfmarshalSingularsizeMessageSlowLeadingCommentsSourceLocationsExtensionRangesRequiredNumbersContainingOneofLessRecentPointMostRecentPointTotalBytesAckedlastAckedPacketrecentAckPointsHasPacingBudgetmaybeAppLimitedsetHighCwndGainminRttTimestampmaxDatagramSize*brutal.pktInfocanPrintAckRate*utils.LogLevel*utils.RTTStats*wire.PingFrame*wire.FrameTypeparseLongHeaderMaxUniStreamNumisTestingPacketRemovePathProbelostPacketsInfocongestionMutexnumProbesToSendpacketsInFlightgenerateNewSkipGetAlarmTimeoutlargestObservedGetWindowUpdategetWindowUpdatehasWindowUpdatehighestReceived*handshake.conn ConnectionStateheaderDecrypterheaderEncrypterSetLargestAckedhandshakeOpenerhandshakeSealerheaderProtector*qlog.Initiator*qlog.TimerTypeConnectionErrorPacketsInFlightSupportsSchemasSetMulticastTTL*qlog.DataFrame*flate.Resetterencoding/base32lookupAuthStyle*internal.TokenResponseLogHookresponseHandler isH2Upgradei*sign.PublicKeySupportsContext*kem.PrivateKeyGenerateKeyPairAuthDecapsulateAuthEncapsulate*hybrid.cScheme*hybrid.xScheme*hpke.dhKemBaseSetUniformBytesnonAdjacentForm*unicode.config*unstable.RangeparseArrayTableparseExpressionparseWhitespaceCheckExpressioncheckArrayTablesetExplicitFlag*gob.CommonType*gob.structType*[]gob.encInstrencodeInterfacenewEncoderState*gob.GobDecoder*gob.GobEncoder*protowire.TypeRangeExtensionsRegisterMessage*order.mapEntry*filedesc.NamesIsFieldPresenceIsUTF8ValidatedIsJSONCompliantEditionFeatures*filedesc.Field*filedesc.Oneof*filedesc.EnumsunmarshalCountsallocExtensionsresolveMessagesresolveServicesFindEnumByIndex*impl.fieldInfoappendLazyBytesgrowUint32SlicegrowUint64Slice*impl.oneofInfosizecacheOffsetextensionOffsetgetUnknownBytessizePointerSlow*impl.ConverterLoadMessageInfo*impl.messageV1*impl.unwrapperXXX_MessageName*coding.Version*[]coding.PixelackedBytesCountendPacketNumberhybridSlowStartnumAckedPackets*socket.Message*socket.mmsghdr*[]socket.iovec*socket.tcpConn*socket.udpConn*identifier.MIB prepareNext@rsc.io/qr/gf256*ed25519.scheme*blake2s.digest*cmd.configError*func(time.Time)Code json:"code"Type json:"type"*go.shape.string*[]zapcore.Field*[1]netip.Prefix*[1]interface {}*[2]interface {}*[3]interface {}*[4]interface {}*[8]interface {}*[]tls.QUICEventpeerCertificates*tls.CertificateSignatureSchemesPeerCertificates*[]tls.ticketKeyVerifyConnectionSessionTicketKeyCurvePreferencescurvePreferencesexplicitNonceLenchangeCipherSpecsetTrafficSecretresumptionSecret*tls.pskIdentity*[]tls.echCiphersupportedVersionselectedIdentityHandshakeContext*func() net.Addr*func() net.ConnSetWriteDeadlinehandshakeContext*func(int) errorquicStoreSession*tls.finishedMsgcertificateTypesCompareAndDelete*tls.CipherSuite*tls.cipherSuitecompareAndDelete*[]*bisect.dedup*map[uint16]bool*go.shape.*uint8ExcludedIPRangesInhibitAnyPolicy*map[uint64]boolinternal/godebug*[1]tls.keyShareunmarshalOIDText*[]x509.lazyCert*[]asn1.RawValue*x509.privateKey*map[string]boolValue asn1:"set"readFromAddrPortwriteMsgAddrPort*net.TCPListenerSetUnlinkOnClose*net.rawListener*func() *poll.FD*[]net.nssSourcestandardCriteria*chan net.resultinternetAddrList*func(struct {})setWriteDeadline*os.SyscallError*os.ProcessState*[]syscall.Iovec*signal.stopping*runtime.functab*runtime.offAddr*runtime.specialfreeIndexForScanisUserArenaChunkdivideByElemSizemarkBitsForIndexrefillAllocCache*[]atomic.Uint32*runtime.workbuf*runtime.funcvalgcMarkWorkerModescannedStackSize*runtime.libcallisIdleInSynctestactiveStackChans*runtime.mPadded*runtime.funcinlcontrollerFailed*runtime.Cleanup*[]runtime.Frame*func() abi.Kind*go.shape.uint32*strings.Builder*syscall.Cmsghdr*syscall.Timeval*syscall.RawConn*time.ParseErrorHiddenDefaultCmdPersistentPreRunTraverseChildrenGenZshCompletionMarkFlagFilenameMarkFlagRequiredSetFlagErrorFunc*func(io.Reader)SetUsageTemplategenZshCompletion*func() []string*[6]interface {}*viper.FlagValueReadRemoteConfigdecodeStructKeys*[]time.DurationMarshalLogObject*zap.AtomicLevel*zap.stringArray*zap.complex128s*http.cachedConn*[]*http.Request*tun.EventLogger*url.EscapeErrorResolveReference*utils.GeoLoaderdownloadAndCheckCongestionConfigPseudoRemoteAddrnextStreamToOpenqueueMaxStreamIDUpdateSendWindow*obfs.Obfuscator*[5]interface {}*func(complex64)AppendByteStringAppendComplex128*zapcore.sampler*zapcore.counter*zapcore.EncoderAppendTimeLayout*zapcore.nopCore*context.Context*context.todoCtx*context.stopCtx*json.RawMessageliteralInterface*json.mapEncoder*json.ptrEncoder*io.StringWriter*http.http2Frame*http.http2Flagshttp2FrameHeaderlastHeaderStreamdebugReadLoggerfWritePushPromiseWriteSettingsAckMaxReadFrameSizeWriteByteTimeoutTransferEncodingisProtocolSwitchUnencryptedHTTP2*http.connReaderabortPendingReadwants10KeepAlivecanWriteContinueEnableFullDuplexsetupHTTP2_ServemarkNewGoroutinewantWriteFrameChsawClientPrefacesawFirstSettingsclientMaxStreamscurClientStreamscurPushedStreamsmaxPushPromiseIDneedToSendGoAwaywriteHeaderBlocksendWindowUpdategotTrailerHeader*http.bodyLockedregisterOnHitEOF*http.byteReader*http.readResultprobeRequestBody*[]*http.pattern*[]http.muxEntrymutateHeaderFuncconnsPerHostWaitRegisterProtocolqueueForIdleConnawaitFlowControlwriteRequestBodyseenSettingsChancloseForLostPingwriteStreamResetlastChunkOrAlloc*http.FileSystem*http.writerOnly*http.gzipReader*http.fakeLocker*http.closeIdler*http.contextKey*certmagic.CacheGetConfigForCertcacheCertificatequeueRenewalTaskdeleteSiteAssetsgetChallengeInfoloadCertResourcesaveCertResourceaskUserAgreementloadAccountByKey*[]libdns.RecordPropagationDelayName json:"name"Plan json:"plan"Page json:"page"Fqdn json:"fqdn"Data json:"data"fromLibDNSRecord*acme.Subproblem*acme.IdentifierGetAuthorizationNewAuthorization*server.HyStreamsetHookedReqAddr*server.OutboundhandleTCPRequest writeBuffers~Addr json:"addr"Auth json:"auth"dialAndNegotiatedualStackDialTCPinitEvictBuffers*sniff.teeReader*go.shape.uint64*utils.PortRange*utils.PortUniontryGrowByReslice*ecdsa.PublicKey*ed25519.OptionsprecomputeLegacy*rsa.OAEPOptions*sync.dequeueNil*sync.notifyList*gcm.GCMForTLS12*gcm.GCMForTLS13*godebug.setting*godebug.SettingAddASN1BitStringcallContinuationEncapsulationKey*ecdh.PrivateKey*pem.lineBreaker*asn1.setEncoder*asn1.oidEncoder*asn1.Enumerated*asn1.RawContent*[2]asn1.encoder*[]reflect.ValuedivRecursiveSteptrailingZeroBitsTrailingZeroBitscrypto/x509/pkix*reflect.ChanDirmustBeAssignable*reflect.abiStep*reflect.abiDesc*reflect.ptrType*unicode.Range16*unicode.Range32internal/fmtsort*dnsmessage.Type*dnsmessage.NameRecursionDesiredCheckingDisabledAdditionalHeaderSkipAllQuestions*poll.splicePipesplicePipeFieldsSetsockoptIPMreqSetsockoptLinger*unique.cloneSeq*abi.StructFielduncheckedPutSlot*pflag.uintValue*pflag.int8Value*pflag.boolValueGetSpecifiedNameGetSpecifiedFlag*[]*flag.FlagSetDurationSliceVarFloat32SliceVarPFloat64SliceVarPGetDurationSliceGetNormalizeFuncGetStringToInt64SetNormalizeFuncStringToInt64Var*regexp.lazyFlag*regexp.bitStateReplaceAllString*locafero.FinderFile json:"file"Line json:"line"WeaklyTypedInputdecodeMapFromMapcachedDecodeHook*flag.int64ValuecollectFragments*base64.Encoding*unix.SockaddrVM*unix.SockaddrL2Service_name_len*socks5.Datagram*tproxy.ListenerDefaultInterfaceRegisterCallbackIncludeInterfaceExcludeInterfaceInterfaceMonitor*tun.tcpGROTable*[]*netlink.RuleloopCheckTimeoutNewContextPacket*tun.StackRunnerFastOpenNoCookie*map[uint8]uint8*acl.hostMatcher*acl.cidrMatcher*[]*v2geo.Domain*v2geo.GeoIPList*quic.packetInfo*quic.ClientInfo*quic.TokenStorehandshakeTimeoutmaxRetryTokenAgeChangeRemoteAddr*quic.baseServerRemoveResetToken*quic.connRunner*quic.SendStreamcloseForShutdownisNewlyCompletedupdateSendWindowcurrentFrameDonecancelledLocallydequeueNextFramecheckIfCompleted*quic.closeErrorhandleCloseError*chan *quic.ConnacceptEarlyConnshandshakingCounthandle0RTTPackethandlePacketImplShouldSwitchPath*quic.streamsMapgetReceiveStreamhighestProbingIDGetConnIDForPathactiveSrcConnIDsbaseCryptoStreamUnpackLongHeaderGetSessionTicketsendingScheduledreceivedPacketMxGetInitialSealerPeekPacketNumberunpackLongHeader*quic.queueEntrylastProbeWasLostnextPacketNumberwroteFirstPacket*[]wire.AckRangereceivedSettingsReceivedSettingshasActiveStreamsreceiveDatagramshasContentLengthsmallResponseBufsniffContentType*http3.FrameTypeStreamDispatcherconnHandlingDoneNewRawServerConnnewRawServerConn*http3.dataFrame*http3.TransportNewRawClientConndashBoundaryDashTLSHandshakeDoneWroteHeaderField*[256]hpack.node*idna.labelErrorcurrentChallenge pollIntervalChallengeSolvers*ocsp.ParseError*ocsp.tbsRequestRevocationReasonRawResponderNameResponderKeyHash*[1]ocsp.request*[]dns.APLPrefixDigest dns:"hex"PrivateKeyStringpublicKeyED25519ZSData dns:"txt"Option dns:"opt"SetExtendedRcode*dns.SVCBDoHPath*dns.EDNS0_LOCALExchangeWithConnErrorDescription*oauth2.Endpoint*govultr.AccountNext json:"next"Prev json:"prev"Size json:"size"Tags json:"tags"Disk json:"disk"Arch json:"arch"*govultr.VPCInfo*govultr.InvoiceDate json:"date"*govultr.HistoryListInvoiceItemsCost json:"cost"Used json:"used"Root json:"root"DeleteRepositoryListRepositoriesUpdateRepositoryHost json:"host"Port json:"port"User json:"user"Mode json:"mode"Time json:"time"StartMaintenance*govultr.ClusterListAppVariables*govultr.NetworkCity json:"city"*govultr.UserReq*govultr.VPC2Req*govultr.isoBase*govultr.vpcBasewriterDescriptor*func(*exec.Cmd)*[]tls.ECHConfigSetSessionTicket*tls.PskIdentityDestConnectionIDheaderProtection*ecdsa.Signature*rsa.millerRabinparseVerticalBarhandleArrayTableunmarshalIntegersequence_contextkey_line_comment*yaml.structInfo*norm.PropertiescombinesBackwardhasDecompositionPropertiesStringinsertDecomposed*norm.streamSafe*norm.lookupFunc*netlink.LinkXdp*netlink.BareUDPBitRatePreScalerSyncJumpWidthMax*netlink.Macvlan*netlink.MacvtapLinkFailureCountPermHardwareAddrPeerHardwareAddr*format.Stringer*netipx.multiErrRemoveFreePrefixCheckInitializedappendFeatureSetTrailingCommentsDefaultEnumValueIsValidInterface*[2]bbr.ackPointOnPacketNeuteredenterStartupModebytesLostInRoundcongestionWindowrateBasedStartupSetLogTimeFormatHasMissingRangestoExtendedHeaderParseStreamFrameackDelayExponentAckDelayExponentMaxBidiStreamNumPreferredAddressHandleNewlyAckedQueueProbePacketFirstOutstandingpathProbePacketshandshakePacketslargestAckedTimeackedPacketsInfolowest1RTTPacketepochStartOffset*handshake.EventGetInitialOpener*handshake.token*handshake.Token*qlog.DatagramID*qlog.PacketTypeApplicationError*qlog.PacketSent*qlog.MTUUpdatedCongestionWindow*qlog.PacketLostPacketReordering*qlog.KeyUpdated*ipv4.genericOpt*ipv4.PacketConn*flate.byLiteral*base32.Encoding isReplayablei*sign.PrivateKey*[]unstable.Node*unstable.ParserparseBasicStringparseInlineTable*tracker.keyKind*[]tracker.entrycheckInlineTableUpdateArrayTable*[]gob.fieldTypeBinaryMarshalerTencodeGobEncoderfreeEncoderState*gob.emptyStruct*nl.IfaCacheInfo*nl.SocketHandleFindMessageByURLIsProto3Optional*[]filedesc.Enum*filedesc.EnumL2*filedesc.BaseL0*filedesc.EnumL1IsLegacyRequired*filedesc.FieldsunmarshalOptions*filedesc.Oneofs*filedesc.Method*filedesc.FileL1*filedesc.FileL2*impl.weakFieldsgrowFloat32SlicegrowFloat64SliceProtoMessageInfodenseCoderFieldscoderMessageInfo*impl.structInfoappendExtensionscheckInitializedisInitExtensionsmakeCoderMethodsmakeReflectFuncsunmarshalPointer*impl.mapReflectStoreMessageInforsc.io/qr/coding*coding.EncodingbudgetAtLastSent*debug.BuildInfo*[]*debug.Module*socket.mmsgTmps*socket.mmsghdrs*kyber512.scheme*kyber768.schemeallowInvalidUTF8gopkg.in/yaml.v3*cmd.serverLogger*cmd.socks5Logger*cmd.clientConfighopIntervalConfig*cmd.socks5Config*cmd.serverConfigfillAuthenticatorfillTrafficLogger*func() time.Time*chan<- os.Signal*map[string][]int*[1]zapcore.Field*[2]zapcore.Field*[3]zapcore.Field*[4]zapcore.Field*[5]zapcore.Field*[]*cobra.Command*func() hash.Hash*tls.SessionState*[8]tls.QUICEvent*<-chan struct {}SupportedVersionsHandshakeCompletetestingOnlyDidHRRNameToCertificatesessionTicketKeyssupportedVersionsprepareCipherSpec*tls.keyUpdateMsg*tls.echExtensioncompressionMethodquicResumeSessionquicSetReadSecretquicWaitForSignalsendSessionTicketwriteRecordLocked*tls.finishedHash*tls.keyAgreement*tls.echConfigErr*tls.xorNonceAEAD*tls.rawExtension*[0]*bisect.dedup*[]*godebug.valuereadSessionTicketsaveSessionTicketdoResumeHandshakeSendSessionTicketsessionTicketSent*[]pkix.ExtensionRawTBSCertificatePermittedIPRangesPolicyIdentifiers*[1]tls.ticketKey*x509.Certificate*x509.ExtKeyUsageCheckCRLSignature*x509.certificateexpectedPolicySetValues asn1:"set"*[1]asn1.RawValue*errors.joinError*func(error) bool*net.pipeDeadline*net.ListenConfig*net.UnixListener*net.timeoutError*net.HardwareAddr*net.nssCriteriongoLookupHostOrder*func(int) string*netip.addrDetailmarshalBinarySize*os.processHandle*[]unsafe.Pointer*runtime.funcInfo*runtime.pcHeader*runtime.textsect*runtime.initTask*runtime.guintptr*runtime.puintptr*runtime.muintptrallocBitsForIndexrefreshPinnerBitsuserArenaNextFree*[]*runtime.mspan*[]*runtime.sudogupdateMinWhenHeap*[3]atomic.Uint32sparseObjsScannedmaxStackScanDelta*runtime.traceBuf*runtime.dlogPerMprofileTimerValid*runtime.lockRankclearAllpSnapshotgoroutineProfiled*runtime.cpuStatsScavengeTotalTimefloat64HistOrInit*runtime.stringer*runtime.pollDesctargetCPUFraction*func(int64) bool*[2]runtime.Frame*func() *abi.Type*strconv.NumError*strings.replacer*strings.trieNode*iter.Seq[string]*strings.Replacer*syscall.Sockaddr*syscall._Socklen*syscall.NlMsghdr*syscall.Timespec*[]time.zoneTrans*<-chan time.TimeDisableDefaultCmdDisableNoDescFlagValidArgsFunctionPersistentPreRunEPersistentPostRunCompletionOptionscommandsAreSortedcommandsMaxUseLenDisableAutoGenTag*func() io.WriterGenBashCompletionGenFishCompletionHasAvailableFlagsHasInheritedFlagsNonInheritedFlagsgenBashCompletion*cobra.SliceValueconfigPermissionsAddRemoteProviderSafeWriteConfigAsSetEnvKeyReplacerWatchRemoteConfigfindConfigFileOldgetKeyValueConfigwatchRemoteConfig*zap.errArrayElem*zap.sinkRegistry*http.EventLogger*tproxy.TCPTProxy*tproxy.UDPTProxyInet4RouteAddressInet6RouteAddress*client.HyUDPConn*client.TLSConfig*client.udpIOImpl*[]chan struct {}*[]*http.response*udphop.udpPacket*func(complex128)*zapcore.counterssafeAddByteString*zapcore.errArray*context.valueCtx*context.canceler*context.timerCtx*context.emptyCtx*context.stringer*json.SyntaxError*json.Unmarshaler*json.encoderFunc*json.encodeState*json.decodeStatetokenValueAllowedwriteToWithBuffer*io.LimitedReader*http.http2stream*http.http2Server*http.http2FramerAllowIllegalReadsMaxHeaderListSizedebugWriteLoggerfWriteContinuationWriteWindowUpdatemaxHeaderListSizestaysWithinBufferNewWriteScheduler*[]http.keyValues*http.HTTP2Config*http.chunkWriterlazyCloseNotifyMucloseWriteAndWaitReadHeaderTimeoutdisableKeepAlivesListenAndServeTLSreadHeaderTimeout*http.http2inflowmaxClientStreamIDunstartedHandlerswritingFrameAsynchttp2HeadersFramenewResponseWriterstopShutdownTimer*http.errorReader*http.HandlerFunc*http.routingNode*http.serveMux121*http.statusError*http.persistConn*chan<- struct {}mapRoundTripError*http.connOrError*[]*http.wantConn*http.h2TransportDisableKeepAlivesForceAttemptHTTP2abortStreamLockedinitialWindowSizeCanTakeNewRequestReserveNewRequest*http.fileHandler*http.http2sorter*http.closeWriter*http.rwUnwrappermakeHeadersCopier*[]http.httpRangenet/http/httputil*certmagic.Issuer*certmagic.ConfigwhitelistContainsSelectCertificateOCSPCheckIntervalremoveCertificateupdateOCSPStaplesDefaultServerNameClientCredentialsCertObtainTimeoutstorageKeyUserRegmaxConcurrentJobs*[1]libdns.Record*[6]zapcore.Field*[7]zapcore.Field*[8]zapcore.Field*duckdns.ProviderValue json:"data"*godaddy.Provider*[]govultr.DomainResourcejson:"-"Locationjson:"-"*acme.CertificateChainPEMjson:"-"InitiateChallengePollAuthorizationRevokeCertificate*[]acme.Challenge*server.udpIOImpl*server.TLSConfig*outbounds.AddrEx PluggableOutbound*errors.AuthError*errors.DialError*crypto.PublicKey*crypto.Decrypter*ecdsa.PrivateKey*sync.copyChecker*sync.poolDequeuepoolLocalInternal*aes.KeySizeError*cipher.BlockMode*des.KeySizeError*aes.CBCEncrypter*aes.CBCDecrypter*rc4.KeySizeError defaultReaderq5addLengthPrefixed*mlkem.nttElement*sort.StringSlice*ecdh.x25519Curve*asn1.SyntaxError*asn1.byteEncodermodSqrt3Mod4PrimemodSqrt5Mod8Prime*pkix.RDNSequence*reflect.cacheKeystackCallArgsSize*reflectlite.Type*fmtsort.KeyValueinternal/nettrace*dnsmessage.Class*dnsmessage.RCodeSetsockoptIPMreqn*abi.SwissMapType*abi.UncommonTypeinstallTableSplittombstonePossibleinternal/godebugs*pflag.uint8Value*pflag.ipNetValue*pflag.int64Value*pflag.int32Value*pflag.countValueDurationSliceVarPFlagUsagesWrappedGetStringToStringStringToInt64VarPStringToStringVarnormalizeFlagNamenormalizeNameFunc*[]*regexp.threadFindSubmatchIndexReplaceAllLiteralSymlinkIfPossible*func() slog.KindpreformattedAttrsAllowUnsetPointer*flag.stringValue*flag.uint64Value*bufio.ReadWriter*binary.ByteOrder*binary.bigEndian*unix.SockaddrXDP*func() [12]uint8*unix.SockaddrCAN*unix.SockaddrNFCSetServiceNameLen*unix.RawSockaddrBuildAndroidRulesAndroidVPNEnabled*[]tun.tcpGROIteminterfaceCallbacktxChecksumOffloadTXChecksumOffloadmaybeDeleteOldest*[1]*netlink.Rule fallbackDelay~WriterReplaceable*acl.geoipMatcher*[]*v2geo.GeoSite*map[int32]string*map[string]int32*utils.AtomicTime*quic.ClientTokenInitialPacketSize*quic.pathManager*quic.closePacketStatelessResetKeyTokenGeneratorKeystatelessResetterReplaceWithClosed*quic.wrappedConnhandshakeComplete*quic.StreamErrorgetDataForWritingpopNewStreamFrameonStreamCompleted*quic.frameSorterdeleteConsecutivequeuedStopSendingcancelledRemotelyhandleStreamFrameSupportsDatagramsIsPathProbePacketOpenUniStreamSynchandleCryptoFramehandleRetryPackethandleUnpackErrornewFlowControllernextKeepAliveTimequeueControlFrame*func(wire.Frame)supportsDatagramsinvalidTokenQueuehandleInitialImplReadNonQUICPacketHandleStreamFrame*[]quic.newConnID*quic.connRunnersHandleCryptoFramecontrolFrameMutexQueueControlFrameUnpackShortHeaderPackAckOnlyPacketsentPacketHandlerversionNegotiatedkeepAlivePingSentkeepAliveInterval*quic.frameSourcecomposeNextPacketinitialPaddingLenshortHdrConnIDLenunpackShortHeader*[]socket.Message**os.SyscallErrorsignalHasDatagramcontrolStrHandleropenControlStreamwasStreamHijacked*http3.qpackError*http3.gzipReader*http3.clientConnSendRequestHeadersendRequestHeaderOpenRequestStream*http3.ClientConnopenRequestStream*[]http3.listenerdecreaseConnCount*http3.contextKey*multipart.Writer*multipart.ReaderdispositionParams*textproto.ReaderReadContinuedLineTLSHandshakeStart*[256]*hpack.nodeparseFieldIndexedparseFieldLiteralnet/http/internal*httpproxy.Config*httpproxy.config*acmez.authzStateObtainCertificate doHTTPRequestpollAuthorization*ocsp.revokedInfo*ocsp.ocspRequestValue dns:"octet"setPublicKeyECDSA*dns.SVCBKeyValueValue dns:"pairs" Locator32dns:"a"Locator dns:"hex"*func() dns.EDNS0AuthenticatedDataCompressjson:"-"*dns.TsigProvider*dns.SVCBIPv6Hint*dns.SVCBIPv4Hint*dns.EDNS0_EXPIRE*dns.EDNS0_COOKIE*dns.EDNS0_SUBNET*dns.ClientConfig*map[string]uint8*map[uint8]string*errors.withStack*oauth2.Transport*oauth2.AuthStyleDeviceAccessToken*[]govultr.BackupOsID json:"os_id"*govultr.Upgrades*govultr.UserData*govultr.VPC2Info*govultr.DatabaseGetConnectionPoolListServiceAlertsRestoreFromBackup*govultr.InstanceCreateReverseIPv4CreateReverseIPv6DeleteReverseIPv6GetBackupScheduleSetBackupSchedule*govultr.NodePool*govultr.VersionsGetForwardingRuleListFirewallRules*[]govultr.Region*govultr.Snapshot*[]govultr.SSHKey*govultr.VPC2NodeContainerRegistryvultrErrorHandler*govultr.userBase*govultr.vpc2Base*tinydoh.ResolverdialTFOFromSocketMaximumNameLengthactiveCertHandlesSetVerifiedChains*quic.cryptoFrame*nistec.P256Point*nistec.p521Table*nistec.P521Point*nistec.p224Table*nistec.P224Point*nistec.p384Table*nistec.P384PointShiftRightVarTime*hmac.marshalable*syntax.ErrorCode*[]*syntax.Regexp*syntax.charGroupparseUnicodeClass*[]identifier.MIB*toml.DecodeErrortypeMismatchErrorunmarshalDateTime*yaml.Unmarshaler*yaml.yaml_mark_tversion_directive*yaml.yaml_node_t*[]yaml.fieldInfo*transform.ReadertransformComplete*map[uint32]int32*template.element*netlink.BpfEncap*[]netlink.bpfObjTxHeartbeatErrors*netlink.Protinfo*[]netlink.VfInfoMulticastSnooping*netlink.VrfSlave*netlink.BondModeSuppressPrefixlen*[]netipx.IPRange NoUnkeyedLiteralsmarshalMessageSet*protoreflect.MapIsStreamingClientIsStreamingServerappendEnumOptionsappendFileOptionsContainingMessageOnCongestionEventmaxTrackedPacketsbandwidthEstimatebandwidthForPacermaybeUpdateMinRttisAtFullBandwidthexitingQuiescence*bbr.DefaultClock*[]brutal.pktInfo*protocol.Version*wire.CryptoFrame*wire.StreamFramevalidateAckRangesMaximumStreamDataIsStreamFrameType*wire.FrameParserMaxUDPPayloadSize*ackhandler.FrameisPathProbePacketlastTestingPacketfirstPacketNumberdetectLostPacketslossDetectionTimereceiveWindowSizeprevRcvAEADExpiryFirstPacketNumbersetAEADParametersstartKeyDropTimerzeroRTTParametersencodedRemoteAddr*qlog.CryptoFrame*qlog.StreamFrame*qlogwriter.Event*qlogwriter.TraceMulticastLoopbackSetControlMessage*qlog.GoAwayFrame*qlog.HeaderField*qlog.FrameParsedwriteIndexedField requiresHTTP1i*fiat.P224Element*fiat.P256Element*fiat.P384Element*fiat.P521ElementSetCanonicalBytes*unstable.builder*func(gob.typeId)*gob.userTypeInfo*gob.encoderState*[]*gob.encEngine*nl.NetlinkSocketSetReceiveTimeout*errors.wrapError*protowire.Number*pragma.DoNotCopyNumFilesByPackageFindMessageByNameRegisterExtension*[]order.mapEntry*filedesc.fileRaw*filedesc.Builder*filedesc.Message*[]filedesc.Field*filedesc.FieldL1*[]filedesc.Oneof*filedesc.OneofL1*filedesc.Service*filedesc.Methods*filedesc.Edition*filedesc.pathKeyresolveExtensions*filetype.depIdxs*impl.MessageInfonumRequiredFields*impl.listReflectatomicMessageInfo*[][]coding.Pixel*congestion.Clock*congestion.CubicSetNumConnectionstimeToOriginPointBandwidthEstimatemaybeIncreaseCwndStartReceiveRound*congestion.paceradjustedBandwidth*jsontext.context*jsontext.Encoder*socket.syscaller*kyber1024.scheme*encoding.Encoder*encoding.Decoder*map[string]stringfillOutboundConfigfillUDPIdleTimeoutError json:"error"**certmagic.Config*[1]*cobra.Command*tls.QUICEventKind*[]tls.CertificateNegotiatedProtocolGetConfigForClientInsecureSkipVerifyClientSessionCacheticketKeyFromBytes*func(error) error*[]tls.pskIdentitycompressionMethodsquicSetWriteSecretreadHandshakeBytessignatureAlgorithm*tls.atLeastReader*tls.weakCertCacheCompareAndSwapNoWB*[0]*godebug.value*func(uint16) boolprocessServerHellocheckForResumptionprocessClientHelloSignatureAlgorithmPublicKeyAlgorithmUnknownExtKeyUsageExcludedDNSDomainsExcludedURIDomainsIssuerDomainPolicyAppendCertsFromPEMCheckSignatureFromhasNameConstraints*x509.ecPrivateKeyDpasn1:"optional"Dqasn1:"optional"*func(string) boolIsLinkLocalUnicastSetKeepAliveConfigSetKeepAlivePeriod*net.notFoundError*net.canceledError*net.onlyValuesCtxReadMsgUDPAddrPortWriteToUDPAddrPort*net.byRFC6724Info*func(int64) error**os.processHandleblockUntilWaitable*[]runtime.functab*runtime.ptabEntry*runtime.bitvector*runtime.addrRangeremoveGreaterEqual*runtime.mSpanList*runtime.gclinkptr*runtime.spanClassuserArenaChunkFreeinitInlineMarkBitstypePointersOfTypewriteHeapBitsSmall*runtime.pageCache*[]*runtime._defer*runtime.timerWhen*runtime.notInHeapcleanupBlockHeader*runtime.throwType*runtime.mWaitList*runtime.traceTimegcBgMarkWorkerNode*func(int64) int64ScavengeAssistTime*runtime.timeTimer*runtime.untracedG*[1]unsafe.PointercontrollerCooldown*map.group[int]int*runtime._typePair*func(uint8) error*map[string]uint64*func(int) []uint8*[1]time.zoneTransPersistentPostRunEhelpCommandGroupIDFParseErrWhitelistcommandsMaxNameLenDisableFlagParsingDisableSuggestionsCommandPathPaddingHasHelpSubCommandsHasPersistentFlagsInitDefaultHelpCmdIsAvailableCommandSetVersionTemplateValidateFlagGroupscheckCommandGroupsexperimentalFinderGetStringMapStringflattenAndMergeMapmergeWithEnvPrefixproviderPathExists*func(*zap.Logger)*zap.SugaredLogger*zap.nopCloserSink*zap.errorResponseLevel json:"level"newFileSinkFromURL*redirect.sockAddrupdateConnDeadline*client.QUICConfig*client.clientImplnextStreamToAccept*func(quic.pathID)*[0]*http.response*udphop.UDPHopAddr*func(string, int)*zapcore.FieldType*[]zapcore.counter*context.cancelCtx*json.errorContext*json.floatEncoder*json.structFields*json.sliceEncoder*json.arrayEncoderAllowIllegalWrites*http.http2ErrCode*http.http2SettingmaxHeaderStringLenContextWithTimeout*http.headerSorterParseMultipartFormRegisterOnShutdown*chan interface {}*http.http2outflowhttp2PriorityParamprocessResetStreamscheduleFrameWritesendWindowUpdate32*http.incomparableUnencryptedNetConnmatchMethodAndPath*http.routingIndex*http.RoundTripper*http.writeRequest*func(http.Header)shouldRetryRequestcleanFrontCanceledDisableCompressionProxyConnectHeadertlsNextProtoWasNilhasCustomTLSDialerputOrCloseIdleConncontextWithTimeoutdialTLSWithContextdisableCompressioncloseReqBodyLockedgetStartDialLocked*http.dirEntryDirs*http.fileInfoDirs*http.timeoutErrorallocatePromisedID*http.stringWriter*certmagic.Storage*certmagic.KeyInfo*certmagic.KeyType*certmagic.ManagerResponderOverridesRenewCheckIntervalreplaceCertificateRenewalWindowRatioDNS01TXTRecordNameHTTP01ResourcePath issuerKeyjson:"-"promptUserForEmailstorageKeyCAPrefixstorageSafeUserKeychallengeTokensKeyPropagationTimeout*cloudflare.cfZonePrice json:"price"Count json:"count"*gandi.gandiRecord*gandi.gandiDomain*gandi.gandiStatus*gandi.gandiErrorsCause json:"cause"*[]acme.SubproblemValue json:"value"*[]acme.IdentifierAccountKeyRolloverprovisionDirectory*[]utils.PortRange*server.h3sHandler*server.QUICConfigMaxIncomingStreams*server.serverImpl*func(uint64) boolListenAndServeHTTP*outbounds.UDPConnPushFrontExpirableState json:"state"*crypto.SignerOpts*crypto.PrivateKey*ed25519.PublicKey*[]*go.shape.uint8affineFromJacobian*sync.poolChainElt*cipher.cbcDecAble*cipher.cbcEncAble*aes.blockExpandedsealAfterIndicatorAddASN1OctetString*tls13.EarlySecret*asn1.bytesEncoder*asn1.int64Encoder*asn1.multiEncoder*asn1.tagAndLengthprobablyPrimeLucasOrganizationalUnit*reflect.StructTagmustBeExportedSlow*reflect.bitVector*reflect.fieldScan*reflect.layoutKey*[]reflect.abiStep*reflect.sliceType*[]abi.StructField*[]unicode.Range16*[]unicode.Range32*reflectlite.rtype*nettrace.TraceKey*map[string]uint16*dnsmessage.OptionRecursionAvailable*dnsmessage.header*dnsmessage.ParserSkipAllAdditionalsSkipAllAuthoritiesSetsockoptIPv6Mreq*singleflight.call*abi.InterfaceType*[0]unsafe.PointerputSlotSmallFast32putSlotSmallFast64*chacha8rand.State*pflag.uint64Value*pflag.uint32Value*pflag.uint16Value*pflag.stringValue*pflag.ipMaskValuedefaultIsZeroValueStringToStringVarP*regexp.inputBytesFindAllStringIndexFindStringSubmatch*locafero.FileTypeReadlinkIfPossible*func() slog.Level*func() slog.Value*slog.timeLocationDisableUnmarshalerdecodeMapFromSlice*flag.float64Valuego.uber.org/atomic*unix.SockaddrUnix*unix.SockaddrTIPC*unix.SockaddrIUCV*unix.IfaCacheinfoOverrideAndroidVPNUnregisterCallbackIncludeAndroidUser_TXChecksumOffloadLoadOrStoreWithAgeinet4ServerAddressinet6ServerAddress*metadata.Metadata*acl.geositeDomain*acl.domainMatcher*v2geo.GeoSiteList*v2geo.Domain_Type*quic.packetBufferDisablePathManager*quic.pathOutgoingConnectionIDLength*quic.zeroRTTQueue*quic.streamSenderreturnFramesToPoolcurrentFrameIsLastlogCoalescedPacketsendPacketsWithGSOnextZeroRTTCleanupmaybeStopListeningsendStatelessResetoutgoingUniStreamsincomingUniStreamsactiveConnectionIDshouldUpdateConnIDupdateConnectionIDRemoveConnectionID*quic.cryptoStreamconnFlowControllerRemoveActiveStreamgetNextStreamFramePackMTUProbePacketPackPTOProbePacketChangeConnectionIDDiscardInitialKeyslargestRcvdAppDatacurrentMTUEstimateearlyConnReadyChandroppedInitialKeyshandshakeConfirmed*quic.packetPackerGetHandshakeSealer*quic.emptyHandlerpopStreamFrame*http3.requestBody*http3.frameParser*map[uint64]uint64**http3.qpackErrorWriteRequestHeadersendRequestTraileradditionalSettings**quic.StreamErrorAdditionalSettings*http3.goAwayFrame*rand.lockedSourceupcomingHeaderKeysnet/http/httptrace*hpack.HeaderFieldSetMaxStringLength*httpproxy.matcher*httpproxy.ipMatch*[1]pkix.Extension*ocsp.responseData*ocsp.responseASN1*func(dns.RR) boolPrefixes dns:"apl"Endpoint dns:"hex"Target dns:"octet"*dns.SVCBECHConfig*dns.SVCBMandatory*dns.EDNS0_PADDING*map[uint16]stringEmail json:"email"Total json:"total"Links json:"links"Label json:"label"*govultr.Bandwidth*[]govultr.VPCInfo*[]govultr.HistoryUnits json:"units"*[]govultr.InvoiceBytes json:"bytes"Image json:"image"Plans json:"plans"MySQL json:"mysql"Redis json:"redis"AddReadOnlyReplicaGetMigrationStatusPromoteReadReplica*govultr.DomainReqNotes json:"notes"*govultr.ReverseIP*govultr.NeighborsDefaultReverseIPv4*govultr.PublicISONodes json:"nodes"*[]govultr.Cluster*[]govultr.Network*govultr.OSService*govultr.SSHKeyReqonRequestCompletedOnRequestCompletedBlock json:"block"*exec.wrappedError*quicvarint.Reader*quicvarint.Peeker*tls.HPKEKeyConfig*[]*tls.activeCertServerCertificates*[]tls.PskIdentityGroup json:"group"CompressionMethodscachedPrivateHello*bisect.parseError*[1]*syntax.Regexp*[9]identifier.MIB*toml.errorContexthandleKeyValueParttryTextUnmarshalertypeMismatchStringunmarshalLocalDateunmarshalLocalTimego.yaml.in/yaml/v3*yaml.yaml_event_t*yaml.yaml_style_t*yaml.yaml_token_ttag_directives_endsimple_key_allowedsimple_keys_by_tok*yaml.yaml_break_tflow_plain_allowedsimple_key_contextInlineUnmarshalers*runes.Transformer*[]norm.Properties*template.HTMLAttr*netlink.MPLSEncap*netlink.SEG6Encap*[4]netlink.bpfObj*netlink.LinkAttrs*netlink.LinkSlavePropagationSegment*netlink.IPoIBMode*netlink.BondSlave*netlink.Wireguard*[1]netipx.IPRangemarshalMessageSlow*protoreflect.Name*protoreflect.Kind*protoreflect.ListappendFieldOptionsappendOneofOptionsHasOptionalKeyword*protoreflect.Enum*bbr.sendTimeStatemaxAckHeightFilterTotalBytesNeuteredtotalBytesNeuteredconnectionStateMapdetectOvershootingMaybeExitSlowStartSetMaxDatagramSizecycleCurrentOffset*[5]brutal.pktInfo*protocol.StreamID*protocol.KeyPhaseMaybeSplitOffFrame*wire.MaxDataFrameIsApplicationErrorRequestMaxAckDelayParseDatagramFramemarshalVarintParam*ackhandler.packetfirstTestingPacketfirstCapablePacketLowestPacketNumberignorePacketsBelowgetPTOTimeAndSpaceqlogMetricsUpdatedIgnorePacketsBelowHighestMissingUpTobaseFlowControllerDecodePacketNumberGetHandshakeOpener*[]handshake.EventinvalidPacketLimitinvalidPacketCountValidateRemoteAddr*qlog.PacketHeader*qlog.SpuriousLoss*qlog.KeyDiscarded*ipv4.ControlFlagsMulticastInterface*qlog.HeadersFrame*qlog.UnknownFrame*qlog.FrameCreated*qpack.HeaderField*flate.dictDecoder*flate.literalNodeoutgoingLengthiSetResponseHandler*func() kem.Scheme*unicode.BOMPolicyparseLiteralString*func() gob.typeIdsendTypeDescriptor*struct { r1 int }*struct { r2 int }*struct { r3 int }*struct { r4 int }*struct { r5 int }*struct { r6 int }*struct { r7 int }*[0]*gob.encEngine*order.FieldRanger*order.EntryRangerIsDelimitedEncoded*filedesc.Messages*[]filedesc.Method*filedesc.MethodL1optionsUnmarshaler*filedesc.ServicesFindMessageByIndex*impl.mergeOptionsAppendPointerSlice*[]*impl.fieldInfo*impl.extensionMaporderedCoderFieldsreflectMessageInfounmarshalExtension*impl.resolverOnly*impl.mapConverter*impl.messageState*impl.mapEntryType*impl.legacyMerger*impl.MessageStateslowStartThreshold*encoding.Encoding*internal.Encoding*prototext.encoder*text.encoderStatefillBandwidthConfig*chan cmd.modeError*[]certmagic.IssuerenableSessionEventsSupportsCertificate*tls.ClientAuthTypemaxSupportedVersionisHandshakeCompletesecureRenegotiation*func([]uint8) bool*tls.clientHelloMsgobfuscatedTicketAge*[]tls.echExtension*tls.serverHelloMsg*tls.transcriptHash*func(string) errorhandleRenegotiationquicWriteCryptoData*tls.certificateMsg*tls.permanentErrorUnmarshalCompressed*func(interface {})*[]x509.ExtKeyUsagePermittedDNSDomainsPermittedURIDomains*[]*tls.CipherSuite*[1]tls.pskIdentity*x509.HostnameError*func() crypto.Hash*x509.PolicyMappingSubjectDomainPolicy*x509.InvalidReason*x509.publicKeyInfo*x509.pssParameters*[][]pkix.Extension*errors.errorString*func() (int, bool)ReadFromUDPAddrPortWriteMsgUDPAddrPort*net.temporaryError*func(uintptr) bool*func() poll.String*[]net.nssCriterion*go.shape.struct {}*func() fs.FileMode*runtime.plainError*runtime.moduledata*[]runtime.textsect*runtime.modulehash*[13]unsafe.Pointer*runtime.cgoCallersinitOpenCodedDefers*runtime.sysmontickscannedBitsForIndex*[]runtime.guintptr*runtime.workbufhdr*[]*runtime.funcval*runtime.winlibcall*runtime.waitReason*runtime.statDepSet*runtime.metricKind*runtime.traceFrame*runtime.metricData*syscall.WaitStatus*syscall.Credential*time.fileSizeErrorappendFormatRFC3339appendStrictRFC3339DisableDescriptionsGenBashCompletionV2InitDefaultHelpFlaggetHelpTemplateFuncupdateParentsPflagsautomaticEnvAppliedwatchKeyValueConfig*zap.SamplingConfignewFileSinkFromPath**redirect.sockAddrFdControlUnixSocket*socks5.EventLoggerNewPacketConnection*utils.SNIGuardFunc*client.ConnFactoryEnableResetStreamAt*[]*quic.closeError*func(string, bool)*func(string, int8)*func(string, uint)*zapcore.optionFuncaddElementSeparatorcloseOpenNamespaces*zapcore.errorGroup*context.CancelFunc*json.unquotedValue*json.structEncoder*io.ReadWriteCloserHeaderBlockFragmentSetMaxReadFrameSize*func() http.HeaderSetUnencryptedHTTP2startBackgroundReadrequestBodyLimitHit*func() <-chan boolsetupHTTP2_ServeTLStlsHandshakeTimeoutqueuedControlFramescanonHeaderKeysSizeinFrameScheduleLoopnewWriterAndRequestprocessWindowUpdatehasNonemptyTrailers*http.bodyEOFSignalmatchingMethodsPathredirectToPathSlash*http.MaxBytesError*http.wantConnQueue*http.connectMethodTLSHandshakeTimeoutMaxIdleConnsPerHostmaxIdleConnsPerHostcleanupWriteRequestcountReadFrameErrorisDoNotReuseAndIdlebytesFromFirstChunk*http.http2dialCallhttp2clientConnPool*http.ProtocolError*http.serverHandler*http.baseContexter*http.CloseNotifierdefaultErrorHandlergetAllMatchingCertsoptionalMaintenance*[]acme.CertificateHandleHTTPChallengepromptUserAgreement CertificateResource*certmagic.lockMeta*certmagic.namedJobgetDNSPresentMemory*godaddy.PostRecord*acme.Authorization*acme.DirectoryMeta*acme.accountObjectKeyID json:"key_id"GetCertificateChain PrivateKeyjson:"-"fillChallengeFields*server.StreamStats*server.StreamState*server.RequestHook*server.EventLoggerProxyStreamHijackerwriteToAddrPort~*masq.MasqTCPServerListenAndServeHTTPSisClosedBeforeReady*[1]utils.PortRange*errors.ConfigError*errors.ClosedError*ed25519.PrivateKey*[0]*go.shape.uint8*cipher.gcmFallback*cryptobyte.BuilderAddASN1Int64WithTag*mlkem.fieldElement*[]mlkem.nttElement*tls13.MasterSecretResumptionBinderKey*asn1.taggedEncoder*asn1.stringEncoderexpNNMontgomeryEvenFillFromRDNSequence*func(float64) bool*reflect.structType*reflect.layoutType*reflect.ValueError*unicode.RangeTable*[]fmtsort.KeyValue*dnsmessage.section*poll.errNetClosingSetsockoptInet4Addr*singleflight.Group*cgroup.stringErrorputSlotSmallFastPtrputSlotSmallFastStr*pflag.float64Value*pflag.float32ValuespecifiedShorthandsShorthandDeprecatedparseSingleShortArg*regexp.onePassProg*regexp.onePassInst*regexp.inputString*regexp.inputReader*slog.commonHandler*mapstructure.fielddecodeMapFromStructdecodeStructFromMap*flag.durationValue*flag.ErrorHandling*unix.SockaddrInet4*unix.SockaddrInet6*unix.RawSockaddrVM*unix.RawSockaddrL2*unix.SockaddrPPPoE*[][]tun.tcpGROItemWriteIsThreadUnsafe*chan udpnat.packet*metadata.Socksaddr*network.PacketConn*acl.geositeMatcher*quic.packetHandler*[]protocol.Version*[]ackhandler.FrameVerifySourceAddressstatelessResetQueue*quic.connTestHooks*quic.ReceiveStreamretransmissionQueuecancellationFlaggedSetReliableBoundaryenableResetStreamAtonHasConnectionDataqueuedMaxStreamDatacloseForShutdownErrsendStreamCompleteddropEncryptionLevelhandleDatagramFramehandleNewTokenFramelogLongHeaderPacketnextIdleTimeoutTimeresetPacingDeadlinesendConnectionCloseverifySourceAddresshandleNonQUICPacketoutgoingBidiStreamsincomingBidiStreams*quic.connIDManagerStatelessResetTokenChangeInitialConnIDRetireConnIDForPathSetMaxActiveConnIDsHandle0RTTRejectionappendControlFramesPackCoalescedPacketPackConnectionClosePackPathProbePacket*quic.mtuDiscovererSetLargest1RTTAcked*quic.datagramQueueHandleDatagramFramehandshakeDestConnIDpathManagerOutgoingcryptoStreamManagercryptoStreamHandlerreceivedFirstPacketappendPacketPayloadpackConnectionClose*quic.deadlineErrorgetControlFramercvdQPACKEncoderStrrcvdQPACKDecoderStrMaxFieldSectionSizehandleControlStream*http3.headersFrame*http3.QUICListener*[]qlog.HeaderFieldWriteRequestTrailerHandleRequestStreamhandleRequestStream*rand.runtimeSourceFormDataContentType*hpack.incomparableMaxDynamicTableSize*hpack.dynamicTable*httpproxy.allMatch*acmez.retryableErrremainingChallenges*ocsp.ResponseError*ocsp.basicResponse*ocsp.responseBytes*dns.compressionMap GatewayAddrdns:"-"setPublicKeyED25519Digest dns:"base64"*[]dns.SVCBKeyValue*func() dns.SVCBKeySetRcodeFormatError*dns.ResponseWriter*errors.withMessage*errors.fundamentalgolang.org/x/oauth2*oauth2.TokenSourceAppID json:"app_id"*[]govultr.VPC2Info MegaBytes json:"mb" GigaBytes json:"gb" TeraBytes json:"tb"*[]govultr.DatabaseVPCID json:"vpc_id"*govultr.DatabaseDBMaxGB json:"max_gb"MaxMB json:"max_mb"ListAdvancedOptionsListConnectionPoolsStartVersionUpgradeIsoID json:"iso_id"*[]govultr.Instance*govultr.RestoreReqListPrivateNetworks*govultr.ISOService*govultr.ClusterReq*[]govultr.NodePool*govultr.KubeConfigListForwardingRules*govultr.NetworkReq NetworkID json:"id"*govultr.ReservedIP*[]govultr.Snapshot*govultr.VPCService*[]govultr.VPC2Node*govultr.backupBase*govultr.domainBase*govultr.sshKeyBase*func(func() error)dialAndWriteTCPConn*map[string][]uint8ApplicationSettingsSecureRenegotiationgetCachedPrivatePtrTransportParameters*[]quic.cryptoFrame*quic.ProtectionKey*[]nistec.p521Table*[]nistec.p224Table*[]nistec.p384Table*[]fiat.P224ElementSetOverflowingBytesmontgomeryReduction*drbg.DefaultReader*unsafeheader.SliceremoveLeadingRegexpremoveLeadingString*[]toml.DecodeError*toml.LocalDateTimehandleKeyValueInner*yaml.yaml_parser_t*[]yaml.yaml_mark_t*[]yaml.yaml_node_ttag_directives_datastream_end_producedblock_plain_allowed*norm.reorderBuffernLeadingNonStartersBitRatePreScalerMinBitRatePreScalerMaxBitRatePreScalerInc*netlink.TuntapMode*netlink.TuntapFlag*[]net.HardwareAddr*netlink.IPVlanMode*netlink.IPVlanFlag*netlink.BondAdInfoFindExtensionByName*proto.mergeOptions*protoreflect.ValueappendMethodOptionsappendRepeatedFieldappendSingularField*protoreflect.Names*[]protowire.Number*bbr.roundTripCountmaxAckHeightTrackerGetCongestionWindowOnCongestionEventExSetRTTStatsProvidercalculatePacingRateupdateRecoveryStatecurrentRoundTripEndmaxCongestionWindowminCongestionWindowprobeRttRoundPassed*protocol.StreamNum*protocol.ByteCount*utils.ByteInterval*wire.NewTokenFrameReorderingThresholdIsDatagramFrameTypeisAllowedAtEncLevel*map[uint64][]uint8*wire.DatagramFrameSetAckDelayExponentSentPathProbePackethighestPacketNumbergetLossTimeAndSpaceallowWindowIncreasereceivedFinalOffsethandleSessionTicket*qlog.DatagramFrame*qlog.PacketDropped*qlog.ParametersSet*[]jsontext.context*qlog.ReservedFrame*qlog.SettingsFrame*flate.decompressor*internal.AuthStyle*internal.tokenJSONexpectsContinueimultipartReaderigenericSVCBResource*sign.SignatureOpts*func() sign.Scheme*edwards25519.Point*unicode.Endianness*unstable.reference*tracker.KeyTracker*gob.gobEncoderType*errors.prefixErrorRangeFilesByPackageextensionsByMessage*order.messageField*filedesc.Extension*filedesc.EnumValue*[]filedesc.Message*filedesc.MessageL2*filedesc.MessageL1*[]filedesc.Service*filedesc.ServiceL2*filedesc.ServiceL1unmarshalNeedsValue*func(impl.pointer)oneofWrappersByTypemakeKnownFieldsFuncmutableUnknownBytes*impl.ExtensionInfo ExtensionDescriptor*impl.listConverter*impl.enumConverter*impl.boolConverterShouldExitSlowStarttimeScaledBandwidth*debug.BuildSetting*map[string]float64*func(string, error)*cmd.udpTProxyLogger*cmd.tcpTProxyLogger*cmd.clientConfigTLSCAmapstructure:"ca"Upmapstructure:"up"*cmd.tcpTProxyConfig*cmd.udpTProxyConfigfillCongestionConfig*cmd.serverConfigTLS*cmd.serverConfigACL*func(string) string*[1]certmagic.Issuer*[]*x509.Certificate*tls.SignatureScheme*tls.ClientHelloInfo*tls.ConnectionStateExportKeyingMaterialGetClientCertificateSetSessionTicketKeysextendedMasterSecretencryptedClientHelloSymmetricCipherSuitegetClientCertificatenewRecordHeaderErrorreadChangeCipherSpecsetReadTrafficSecretwriteHandshakeRecord*tls.helloRequestMsg*tls.rsaKeyAgreement*tls.prefixNonceAEAD*tls.binaryMarshaler*func([]uint8) errorcrypto/internal/hpkeserverResumedSessionInhibitAnyPolicyZeroInhibitPolicyMapping*[1]x509.ExtKeyUsagefindPotentialParentscheckNameConstraintsIsCAasn1:"optional"*x509.tbsCertificateQinvasn1:"optional"*x509.pkcs1PublicKey*x509.rfc2821Mailbox*map[string][]string*[1][]pkix.Extension*func(string, int32)IsLinkLocalMulticast*net.KeepAliveConfig*net.hostLookupOrderstandardStatusAction*[]net.byRFC6724Info*chan net.dialResult*func(net.Addr) boolgoLookupIPCNAMEOrder*net.mptcpStatusDial*[]*netip.addrDetail*func() interface {}*runtime.errorString*[]runtime.ptabEntry*[]*runtime.initTask*runtime.boundsError*[136]*runtime.mspanheapBitsSmallForAddr*[32]*runtime._defer*[]runtime.timerWhen*[128]*runtime.sudog*[128]*runtime.mspan*runtime.pTraceStategcFractionalMarkTime*runtime.mTraceState*[]*runtime.traceBufneedPerThreadSyscallwaitTraceBlockReasonisWaitingForSuspendG*runtime.gTraceState*func(*runtime.coro)*runtime.metricValue*func(int, int) bool*func(string) func()printControllerReset*func() []abi.Method*[]*strings.trieNode*syscall.SysProcAttr*func(time.Duration)*cobra.flagCompErrorGenZshCompletionFileMarkFlagsOneRequiredgenZshCompletionFilegetUsageTemplateFunchasNameOrAliasPrefixmergePersistentFlagsSetConfigPermissionsdefaultDecoderConfig*zap.errSinkNotFound*proxymux.muxManagercanonicalizeAddrPort*tun.interfaceFinderInterfaceIndexByNameInterfaceNameByIndexUrgent json:"urgent"queueStreamIDBlockedmaybeUnblockOpenSync*func() *quic.Stream*[]protocol.StreamID*[0]*quic.closeError*obfs.obfsPacketConn*zapcore.WriteSyncer*zapcore.EntryCaller*func(string, int16)*func(string, int64)*func(string, uint8)*zapcore.jsonEncoder*zapcore.TimeEncoder*zapcore.NameEncoder*zapcore.systemClock*context.afterFuncer*json.MarshalerErrortryGrowByReslice$*http.http2FrameType*http.http2DataFrame*[]http.http2Setting*http.http2SettingIDstartWriteDataPaddedMaxConcurrentStreams*http.ResponseWriterwantsHttp10KeepAlivesetInfiniteReadLimitcloseNotifyTriggereddisableWriteContinueSetKeepAlivesEnabledcloseListenersLockedinitialReadLimitSize*[]hpack.HeaderField*http.http2PingFrame*http.http2writeData*func(*http.Request)writeDataFromHandlerunreadDataSizeLocked*http.transferWriter*http.maxBytesReader*http.http2Transport*[]*http.persistConn*http.requestAndChannumExpectedResponsescloseConnIfStillIdlecleanFrontNotWaitingCloseIdleConnectionsremoveIdleConnLockedreqBodyContentLengthmaxConcurrentStreamscloseIdleConnections*http.countingWriter*http.http2writePing*http.http2timeTimer*http.http2connError*http.http2httpError*httputil.BufferPool*[]certmagic.Manager*certmagic.ChallengehandshakeMaintenanceDisableHTTPChallengeHTTPChallengeHandlerselectPreferredChainstorageKeyUserPrefixsaveDNSPresentMemory*[]cloudflare.cfZoneStatus json:"status"Paused json:"paused"*cloudflare.Provider*[]gandi.gandiErrorsLocation json:"body"Object json:"object"Errors json:"errors"*namedotcom.ProviderOrders json:"orders"Sigjson:"signature"*func(uint32, error)readFromAddrPort~writeMsgAddrPort~*outbounds.aclEngineStream json:"stream"*errors.ConnectError*[]*ecdsa.PrivateKey*weak.Pointer[uint8]*cipher.cbcDecrypter*cipher.cbcEncrypter*des.tripleDESCipher*gcm.gcmPlatformData*mlkem.encryptionKey*[3]mlkem.nttElement*[9]mlkem.nttElement*mlkem.decryptionKeyExporterMasterSecretmodSqrtTonelliShanks*func() reflect.Type*reflect.StructField*func() reflect.KindmustBeAssignableSlow*reflect.abiStepKind*reflect.methodValueinternal/reflectlite*[]dnsmessage.Option*dnsmessage.Resource*singleflight.Result*abi.IntArgRegBitmapinternal/runtime/sysinternal/chacha8rand*pflag.intSliceValue*pflag.durationValue*pflag.NotExistError*pflag.ErrorHandlingParseErrorsAllowlistParseErrorsWhitelistFindAllSubmatchIndexReplaceAllStringFunc*slog.HandlerOptions*slog.defaultHandlerIgnoreUntaggedFieldsgo.uber.org/multierr*multierr.multiError*binary.littleEndian*unix.SockaddrL2TPIP*unix.SockaddrRFCOMM*unix.RawSockaddrXDP*unix.TIPCSocketAddr*unix.RawSockaddrCAN*unix.RawSockaddrNFC*unix.RawSockaddrAnyBuildAutoRouteRangesDefaultInterfaceName*func() *udpnat.conn*func(uintptr) error*metadata.SerializerInitializeReadWaiter*[]acl.geositeDomain*protocol.UDPMessage*quic.receivedPacketHandshakeIdleTimeoutMaxDatagramFrameSizeGenerateConnectionID*[]*wire.StreamFramenumOutstandingFramescanBufferStreamFrame*quic.unpackedPacketIsPathMTUProbePacketSetCongestionControlidleTimeoutStartTimelogShortHeaderPacket*quic.rejectedPacketcleanupZeroRTTQueues*func(monotime.Time)activeSequenceNumberSetHandshakeComplete*quic.connIDToRetireRemoveRetiredConnIDs*quic.clientHelloCutGetPostHandshakeData*[]*wire.CryptoFramePackApplicationClosenotifyReceivedPacketundecryptablePackets*quic.sealingManager*quic.ackFrameSourcemaybeGetCryptoPacket*quic.packetUnpacker OOBCapablePacketConn*quic.remoteAddrInfo*[1]ackhandler.Frame*http3.tracingReader*http3.streamClearercheckIfCompletedcloseForShutdownupdateSendWindow*http3.settingsFrame*http3.RequestStream*http3.requestWriter*http3.RawServerConngenerateAltSvcHeadersetupListenerForConn*[1]protocol.Version*textproto.dotReaderGotFirstResponseByte*hpack.DecodingError*hpack.pairNameValueparseHeaderFieldReprchunkHeaderAvailable*httpproxy.cidrMatch*[]httpproxy.matcher*[]*acmez.authzState*ocsp.ResponseStatus*ocsp.singleResponsegithub.com/miekg/dnsAddress dns:"uint48"getTimeoutForRequest*govultr.ListOptions*govultr.ApplicationVendor json:"vendor"Region json:"region"Family json:"family"Amount json:"amount"*govultr.InvoiceItemPublic json:"public"*govultr.PGExtensionMemory json:"memory"Period json:"period"CreateConnectionPoolDeleteConnectionPoolGetBackupInformationUpdateConnectionPoolSubnet json:"subnet"Action json:"action"Source json:"source"*[]govultr.ReverseIPAttachPrivateNetworkDetachPrivateNetwork*[]govultr.PublicISO*govultr.NodePoolReqLabels json:"labels"*govultr.HealthCheck*govultr.GenericInfoCreateForwardingRuleDeleteForwardingRuleDeploy json:"deploy"*govultr.PlanService*govultr.SnapshotReqScript json:"script"*govultr.UserService*govultr.VPC2Service*govultr.accountBaseBackup json:"backup"Domain json:"domain"*govultr.networkBasecachedLookExtensions*chan exec.ctxResult*chan tfo.dialResult*[]*nistec.P521Point*[]*nistec.P224Point*[]*nistec.P384PointmaybeSubtractModulus*unsafeheader.StringparsePerlClassEscapeunmarshalerInterfacehandleArrayTableParthandleRootExpressionunmarshalInlineTable*yaml.yaml_comment_t*[]yaml.yaml_token_ttag_directives_start*yaml.yaml_emitter_t*[]yaml.yaml_event_t*map[*yaml.Node]bool*yaml.resolveMapItemnTrailingNonStartersNextBoundaryInString*[32]norm.Properties*netlink.Destination*netlink.MacvlanModeAdActorOperPortState*netlink.GenericLink*netlink.NexthopInfo*common.WithUpstreamprefixFrom128AndBits*protoreflect.MapKey*protoreflect.SyntaxappendMessageOptionsappendServiceOptionsappendSourceCodeInfo*[2]protowire.Number*bbr.extraAckedEvent*bbr.recentAckPointsEndOfAppLimitedPhaseonPacketAcknowledgedendOfAppLimitedPhaseupdateGainCyclePhasenumLossEventsInRoundcongestionWindowGainbandwidthAtLastRoundisAppLimitedRecovery*brutal.BrutalSenderToTLSEncryptionLevel*protocol.PacketType*protocol.StreamType*utils.defaultLogger*qerr.TransportError*wire.ExtendedHeaderParseLessCommonFramesupportsAckFrequencyreadPreferredAddress*func() protocol.ECN*ackhandler.ecnState*ackhandler.SendModepeerAddressValidateddetectLostPathProbesdetectSpuriousLossesgetCongestionControlgetPacketNumberSpace*ackhandler.intervalhasNewMissingPacketsmaxReceiveWindowSize*handshake.EventKindnextRcvTrafficSecretgetNextTrafficSecretRetrySrcConnectionID*qlog.PacketReceived*qlog.PacketBuffered*qlog.MetricsUpdatedInitialMaxStreamsUni*qlogwriter.Recorder*ipv4.ControlMessageSetMulticastLoopback*ipv4.payloadHandler*ipv6.ControlMessage*qlog.MaxPushIDFrame*qlog.DatagramParsed*objx.MSIConvertablemime/quotedprintable*flate.InternalError*[]flate.literalNode*crc32.slicing8Table*internal.ContextKey*dnsmessage.SVCParam*eddilithium3.scheme*edwards25519.ScalarSetBytesWithClamping*unicode.utf8Decoder*tracker.SeenTracker*map[string][2]int32*map[gob.typeId]bool*pragma.DoNotCompare*protoregistry.FilesFindDescriptorByName*protoregistry.Types*filedesc.Extensions*filedesc.stringName*filedesc.EnumValues*[]protoreflect.Name*filedesc.EnumRangesunmarshalSeedOptions*impl.ExtensionField*impl.marshalOptions*impl.validationInfo*impl.validationType*impl.coderFieldInfoinitOneofFieldCodersmarshalAppendPointer EnumValueDescriptors*impl.legacyEnumType*impl.int32Converter*impl.int64Converter*impl.bytesConverter*impl.errInvalidUTF8OnApplicationLimitedmaybeQlogStateChangelastSentPacketNumber*eddilithium2.scheme*func(string, string)*cmd.clientConfigObfs*cmd.clientConfigQUIC*cmd.serverConfigObfs*cmd.serverConfigACME*cmd.serverConfigQUIC*cmd.serverConfigAuth*utils.Atomic[string]EABKIDjson:"eab_kid"*[]*sync.poolChainElt*map[x509.sum224]bool*map.group[string]int*map[string]struct {}*cmd.clientModeRunnerVerifyPeerCertificateautoSessionTicketKeyssupportedCipherSuitesclientFinishedIsFirstmarshalWithoutBinders*tls.echClientContext*tls.echServerContext*tls.handshakeMessageclientSessionCacheKeyconnectionStateLockedprocessECHClientHelloquicHandshakeCompletequicRejectedEarlyDatasetWriteTrafficSecrethasSignatureAlgorithm*tls.constantTimeHash*[0]*x509.Certificate*map[tls.alert]string*func() *hpke.hkdfKDF*[]x509.PolicyMappingBasicConstraintsValidIssuingCertificateURLCRLDistributionPointsRequireExplicitPolicy*[12]*tls.CipherSuite*[13]*tls.CipherSuite*x509.potentialParentAddCertWithConstraint*x509.pkcs1PrivateKey*x509.policyGraphNode*x509.pkcs10Attribute*[1]*x509.Certificate*hex.InvalidByteError*map.group[int]string*func() time.Duration*netip.parseAddrError*[0]*netip.addrDetail*func(netip.Addr) int*func(*os.file) error*func(*os.File) error*[]runtime.modulehash*runtime.ancestorInfo*runtime.gsignalStackallocCountBeforeCacheupdateMinWhenModified*runtime.limiterEvent*runtime.cleanupBlockgcMarkWorkerStartTime*runtime.mLockProfile*[2]*runtime.traceBuf*runtime.pcvalueCache*runtime.heldLockInfo*runtime.metricReaderaccumulateGCPauseTime*runtime.piController*strings.stringWriter*strings.stringFinder*strings.byteReplacer*syscall.SockaddrUnix*syscall.SysProcIDMap*cobra.PositionalArgsDisableFlagsInUseLineGenBashCompletionFileGenFishCompletionFileGetFlagCompletionFuncSetHelpCommandGroupIDValidateRequiredFlags*viper.StringReplacer*func(fsnotify.Event)SetTypeByDefaultValue*viper.discardHandler*forwarding.TCPTunnel*forwarding.UDPTunnel*proxymux.subListener*proxymux.muxListener*redirect.TCPRedirect*list.List[func(int)]*url.InvalidHostError*utils.UpdateResponse*client.HandshakeInfo*[]utils.ByteIntervalmaybeSendBlockedFrame*zapcore.CheckedEntry*zapcore.ArrayEncoder*func(string, uint16)*func(string, uint32)*func(string, uint64)*zapcore.LevelEncoder*zapcore.LevelEnabler*zapcore.errArrayElem*context.afterFuncCtx*map[reflect.Type]intdisallowUnknownFields*json.condAddrEncoderDisallowUnknownFieldstokenPrepareForDecode*io.nopCloserWriterTo*http.http2serverConn*func(uint32) []uint8*http.http2frameCachestartGracefulShutdownhandleReadErrorLockedsendExpectationFailedshouldReuseConnectionneedToSendSettingsAckpeerMaxHeaderListSizewriteFrameFromHandler*http.http2pipeBuffercloseWithErrorAndCodeprocessTrailerHeaders*chan http.readResult*http.redirectHandler*http.routingIndexKeyshouldRedirectRLocked*http.http2writeQueue*http.http2ClientConnmaxHeaderResponseSizeResponseHeaderTimeoutExpectContinueTimeoutGetProxyConnectHeaderalternateRoundTripperuseRegisteredProtocolexpectContinueTimeoutabortRequestBodyWriteencodeAndWriteHeadersframeScratchBufferLenrstStreamPingsBlockedresponseHeaderTimeout*http.http2dataBuffer*http.http2gzipReader*http.cancelTimerBody*http.initALPNRequest*http.socksAuthMethod*[5]http.http2SettinghandleUpgradeResponse*certmagic.ACMEIssuer*certmagic.OCSPConfigDNS01KeyAuthorization*certmagic.acmeClientstorageKeyUsersPrefix*certmagic.ErrNoRetrychallengeTokensPrefix*certmagic.httpSolver*certmagic.solverInfo*certmagic.PreChecker*certmagic.ocspUpdate*certmagic.jobManager*[]certmagic.namedJob*[]godaddy.PostRecordMACKeyjson:"mac_key"*acme.cachedDirectory*firewall.closerFuncs*server.TrafficLogger*func(uint32, string)*server.AuthenticatorIgnoreClientBandwidth*auth.httpAuthRequest*outbounds.cachedConn*outbounds.dialResult*errors.ProtocolError*crypto.MessageSigner*crypto.DecrypterOpts*boring.PublicKeyECDH*[0]*ecdsa.PrivateKey*elliptic.unmarshaler*elliptic.CurveParams*cipher.aesCtrWrapper*[]mlkem.fieldElement*asn1.StructuralError*asn1.fieldParameters*reflect.makeFuncImpl*reflect.makeFuncCtxt*dnsmessage.AResource*func() go.shape.boolinternal/singleflightCompareAndSwapRelease*atomic.UnsafePointerinternal/runtime/maps*maps.groupsReference*pflag.NormalizedName*[]regexp.onePassInstFindAllStringSubmatchgithub.com/spf13/cast*cast.float64ProviderUnmarshalMapstructure*mapstructure.Decoder*func([]uint8) uint16*func([]uint8) uint32*func([]uint8) uint64golang.org/x/sys/unix*unix.SockaddrNetlink*unix.RawSockaddrUnix*unix.SockaddrL2TPIP6*unix.TIPCServiceName*unix.RawSockaddrTIPC*unix.RawSockaddrIUCV*unix.SockaddrNFCLLCP*func(net.Conn) error*ranges.Range[uint32]DefaultInterfaceIndex*buf.defaultAllocator*network.PacketWriter*acl.CompilationErrorMaxIncomingUniStreamsConnectionIDGeneratorreadingNonQUICPacketssupportsResetStreamAthandleStreamFrameImpl*quic.ConnectionState*quic.coalescedPackethandleHandshakeEvents*func() monotime.TimesendPacketsWithoutGSOmaybeSendInvalidTokensendConnectionRefusedmaxIncomingUniStreamsHandleMaxStreamsFrame*quic.connIDGeneratorSetHandshakeConfirmedreceivedPacketHandlerhandshakeCompleteChanmaybeGetAppDataPacket*quic.headerDecryptor*[]*quic.packetBuffer*quic.uniStreamSenderonStreamCompletedImpl*chan quic.queueEntry*quic.closedLocalConn*[]protocol.ByteCount*quic.errServerClosed**qerr.TransportError*http3.datagramStreamhandleStreamFrameEnableExtendedConnectbytesRemainingInFrameviolatedContentLength*http3.responseWriter*http3.hijackableBodyrequestMaxHeaderBytes*multipart.partReader*multipart.FileHeader*multipart.writerOnly*textproto.MIMEHeader*[1]httpproxy.matcher*acmez.challengeTypeslistOfferedChallengesenabledChallengeTypesgolang.org/x/net/idna TypeBitMap dns:"nsec"Mbdns:"cdomain-name"Mddns:"cdomain-name"Mfdns:"cdomain-name"Mgdns:"cdomain-name"Mrdns:"cdomain-name"Mxdns:"cdomain-name"Nsdns:"cdomain-name"Ptrdns:"domain-name"Txtdns:"domain-name" Certificate dns:"hex" FingerPrint dns:"hex"*func(*dns.Msg) errorgithub.com/pkg/errors*oauth2.RetrieveErrorMainIPjson:"main_ip"SizeGBjson:"size_gb"*govultr.BlockStorage*govultr.DatabaseUser*[]govultr.DatabaseDB*govultr.DatabasePlanListAvailableVersionsUpdateAdvancedOptions*govultr.DomainRecordIPTypejson:"ip_type"*govultr.FirewallRule*govultr.ReinstallReq*govultr.LoadBalancer*[]govultr.ReservedIPSSHKeyjson:"ssh_key"*govultr.databaseBase*govultr.instanceBase*govultr.snapshotBase*exec.goroutineStatusSetServerCertificatesLabeljson:"identity"*map[uint]sign.Scheme*[56]nistec.p224Table*[96]nistec.p384Table*[96]fiat.P224Element*sha3.spongeDirectioninternal/unsafeheader*yaml.yaml_encoding_t*yaml.yaml_document_tstream_start_producedsingle_quoted_allowedskipContinuationBytesFirstBoundaryInString*netlink.BondLacpRate*netlink.BondAdSelect*netlink.VlanProtocol*netlink.RuleUIDRange*netipx.stacktraceErrFindExtensionByNumber*proto.MarshalOptions*protoreflect.MessageappendDescriptorProtoExtensionRangeOptionsSetFilterWindowLengthaggregationEpochBytes*bbr.bandwidthSamplerRemoveObsoletePacketsoverestimateAvoidance*bbr.bbrRecoveryStatehasNoAppLimitedSamplelastAckPrintTimestamp*protocol.Perspective*protocol.KeyPhaseBit*func(utils.LogLevel)ResetForPathMigration*qerr.StreamErrorCodenumEncodableAckRanges*wire.MaxStreamsFrameAckElicitingThreshold*congestion.ByteCountHasOutstandingPackets*[]*ackhandler.packetsetLossDetectionTimer*ackhandler.ccAdapterreceivedPacketTrackerUpdateHighestReceivedmaybeAdjustWindowSizenumRcvdWithCurrentKeynumSentWithCurrentKeynextSendTrafficSecrethandshakeCompleteTime*qlog.CongestionState*qlog.PTOCountUpdatedInitialMaxStreamsBidi*qlog.ECNStateUpdated*qlog.ALPNInformationgolang.org/x/net/ipv4SetMulticastInterfacegolang.org/x/net/ipv6*qlog.CancelPushFrame*qlog.DatagramCreated*qpack.indexAndValues*flate.huffmanDecoder*flate.huffmanEncoderassignEncodingAndSize*retryablehttp.Client*retryablehttp.LoggerIPv4MappedIPv6Enabled*func() kem.PublicKeyEncapsulationSeedSize*unicode.utf16Decoder*unstable.ParserError*unstable.Unmarshaler*protoiface.MessageV1checkGenProtoConflict*[]order.messageField*[]filedesc.Extension*filedesc.ExtensionL2*[]filedesc.EnumValue*filedesc.EnumValueL1*filedesc.OneofFields*filedesc.FieldRanges*filedesc.FileImportsresolveEnumDependency*filedesc.ExtensionL1*impl.valueCoderFuncs*impl.unmarshalOutputoneofWrappersByNumbermakeUnknownFieldsFunc*impl.aberrantMessage*impl.uint32Converter*impl.uint64Converter*impl.stringConverter*impl.legacyMarshaler*congestion.BandwidthOnConnectionMigrationSumjson:",omitempty"*[]debug.BuildSettingKeyjson:",omitempty"*cmd.tcpRedirectLogger*func(net.Addr, error)URLmapstructure:"url"UDPmapstructure:"udp"SNImapstructure:"sni"*cmd.tcpRedirectConfigMTUmapstructure:"mtu"TLSmapstructure:"tls"TUNmapstructure:"tun"Keymapstructure:"key"Dirmapstructure:"dir"DNSmapstructure:"dns"TCPmapstructure:"tcp"*cmd.serverConfigSniffACLmapstructure:"acl"Successjson:"success"*[0]*sync.poolChainElt*[][]*x509.Certificate*[]tls.SignatureSchemeSessionTicketsDisabledBuildNameToCertificate*func([]uint8) []uint8*tls.RecordHeaderError*func(time.Time) errorhandleNewSessionTicketmaxPayloadSizeForWriteprocessCertsFromClientquicReadHandshakeBytescertificateAuthoritiesdiscardHandshakeBuffer*tls.ecdheKeyAgreement*tls.ECHRejectionErrorUnverifiedCertificates*tls.endOfEarlyDataMsg*map.group[uint16]boolSetTransportParameters*go.shape.interface {}ExcludedEmailAddresses*map.group[uint64]bool*x509.SystemRootsError*x509.basicConstraints*map[string][]x509.OID*map.group[string]bool*func() (uint8, error)*net.mptcpStatusListen*func(string) []string*map[string]net.byName*func(dnsmessage.Type)*os.fileWithoutWriteTohandleTransientAcquirehandleTransientRelease*func(go.shape.*uint8)*runtime.PanicNilError*runtime.mSpanStateBoxisFreeOrNewlyAllocatedisUnusedUserArenaChunkspecialFindSplicePointwriteUserArenaHeapBits*runtime.stackfreelist*[256]runtime.guintptr*[123]*runtime.funcval*runtime.statAggregate*[]*runtime.moduledata*syscall.SockaddrInet4*syscall.SockaddrInet6github.com/spf13/cobraBashCompletionFunctionGenZshCompletionNoDescHasAvailableLocalFlagsInitDefaultVersionFlag*func(...interface {})getVersionTemplateFuncgithub.com/spf13/viper*viper.EncoderRegistry*viper.DecoderRegistryexperimentalBindStruct*func(...string) errorHookjson:"-" yaml:"-"*forwarding.atomicTimegetAndClearAcceptError*tproxy.TCPEventLogger*tproxy.UDPEventLoggerMaxStreamReceiveWindow*client.udpConnFactory*[]*wire.DatagramFrame*[]quic.receivedPacket*[]protocol.UDPMessage*zapcore.writerWrapper*zapcore.ObjectEncoder*func(string, []uint8)*func(string, float32)*func(string, float64)*func(string, uintptr)*[4096]zapcore.counter*zapcore.SamplerOption*zapcore.EncoderConfig*zapcore.CallerEncoder*context.backgroundCtx*map[reflect.Type]bool*http.http2chunkWriter*http.http2writeFramer*http.http2FrameHeadercomparePathsAndMethodsclosedRequestBodyEarly*http.http2bodyReadMsg*http.http2streamState*http.http2GoAwayFrame*http.http2StreamErrorprocessFrameFromReader*http.http2closeWaiter*http.readTrackingBody*http.bufioFlushWriter*http.connectMethodKey*http.transportRequest*http.responseAndErrorreadLoopPeekFailLocked*chan http.connOrErrorOnProxyConnectResponseMaxResponseHeaderBytesprepareTransportCancelstartDialConnForLockedpeerMaxHeaderTableSizeextendedConnectAlloweddecrStreamReservations*http.http2missingBody*http.http2GoAwayError*http.http2addConnCall*http.http2requestBody*http.http2writeGoAway*http.connectionStater*http.requestTooLarger*httputil.ProxyRequest*httputil.ReverseProxy*certmagic.FileStorage*certmagic.Certificate PrivateKeyPEMjson:"-"getCertDuringHandshakegetNameFromClientHelloloadManagedCertificatemostRecentAccountEmailstorageKeyIssuerPrefix*certmagic.DNS01SolverdeleteDNSPresentMemoryIDjson:"id,omitempty"Accountjson:"account"*cloudflare.cfResponseMessagejson:"message"*[1]godaddy.PostRecord*namedotcom.nameClient*namedotcom.nameDotComPayloadjson:"payload"*func(server.HyStream)*server.udpEventLogger*server.defaultUDPConn*auth.httpAuthResponse*outbounds.ResolveInfo*outbounds.dohResolverStreamsjson:"streams"crypto/internal/boring*boring.PrivateKeyECDH*func() *sha512.Digest*rsa.PrecomputedValues*godebug.runtimeStderr*cryptobyte.BuildErrorAddASN1GeneralizedTimeAddUint8LengthPrefixed*func() *sha256.Digest*tls13.HandshakeSecretResumptionMasterSecret*asn1.bitStringEncoder*asn1.ObjectIdentifier*func(complex128) bool*dnsmessage.NSResource*dnsmessage.MXResource*poll.splicePipeFieldsgithub.com/spf13/pflagGetSpecifiedShortnames*map[uint8]*pflag.Flag*regexp.onePassMachine*locafero.searchResultgithub.com/spf13/afero*cast.float64EProvider*map[interface {}]bool*mapstructure.Metadata*map[string]*flag.Flag*func() *buffer.Buffergo.uber.org/zap/buffer*func([]uint8, uint16)*func([]uint8, uint32)*func([]uint8, uint64)*unix.RawSockaddrInet4*unix.RawSockaddrInet6*unix.RawSockaddrPPPoX*unix.TIPCServiceRange*unix.SockaddrCANJ1939*map.group[uint8]uint8*acl.geositeDomainTypenumberOfPresentEntriesNumberOfPresentEntrieslastAckedPacketAckTime*quic.connCapabilitiesGetStatelessResetToken*quic.packetHandlerMap*chan quic.closePacketqueuedResetStreamFramehandleStopSendingFramemaybeGetRetransmission*quic.frameSorterEntryhandleResetStreamFramereceiveStreamCompleted*quic.longHeaderPackethandleLongHeaderPacketmaybeSendAckOnlyPacketconnectionRefusedQueuemaxIncomingBidiStreamsHandleResetStreamFrameHandleStopSendingFramepacketsSinceLastChangepacketsPerConnectionIDaddStatelessResetTokenSetStatelessResetToken*[]quic.connIDToRetirequeueConnIDForRetiring*quic.baseCryptoStream*[]quic.clientHelloCutlastPacketReceivedTimenumNonAckElicitingAcksappendLongHeaderPacketlongHeaderPacketLengthpackPTOProbePacket1RTTunpackLongHeaderPacket*[8]*quic.packetBufferMaxDatagramPayloadSize*quic.closedRemoteConn*[3]protocol.ByteCount*quic.headerParseErrorremainingContentLengthmaxResponseHeaderBytes*http3.cancelingReader*http3.errConnUnusableReadContinuedLineBytesreadContinuedLineSlice*httptrace.ClientTrace*httptrace.GotConnInfo*httptrace.DNSDoneInfoSetMaxDynamicTableSize*httpproxy.domainMatchgithub.com/mholt/acmezprovisionDirectory*[]ocsp.singleResponse*func() *dns.RR_Header PublicKey dns:"base64"Fqdndns:"domain-name"Ptrdns:"cdomain-name"Mboxdns:"domain-name" Signature dns:"base64"Hostdns:"domain-name"*dns.SVCBNoDefaultAlpn*oauth2.tokenRefresherBalancejson:"balance"*[]govultr.Application*govultr.BackupService*govultr.AttachVPC2ReqOSjson:"os,omitempty"IPjson:"ip,omitempty"*[]govultr.InvoiceItemProductjson:"product"Allowedjson:"allowed"Countryjson:"country"Airportjson:"airport"Billingjson:"billing"Storagejson:"storage"Premiumjson:"premium"*[]govultr.PGExtension*govultr.DatabaseUsage*govultr.DBListOptionsPGjson:"pg,omitempty"*govultr.DatabaseAlertListMaintenanceUpdates*govultr.DomainService*govultr.FirewallGroupReversejson:"reverse"*[]govultr.NodePoolReqVersionjson:"version"DeleteNodePoolInstance*govultr.ObjectStorage*govultr.BareMetalPlan*govultr.RegionServiceOptionsjson:"options"*govultr.ReservedIPReq*govultr.SSHKeyService*govultr.StartupScript*govultr.bareMetalBaseNetworkjson:"network"*<-chan exec.ctxResult*chan<- exec.ctxResult*quicvarint.byteReader*tls.ECHConfigContentsInsecureSkipTimeVerify*tls.PubClientHelloMsg*[132]nistec.p521Table**unstable.ParserError*map[reflect.Value]intunmarshalLocalDateTime*[]yaml.yaml_comment_t*yaml.yaml_node_type_t*yaml.yaml_node_item_t*yaml.yaml_node_pair_t*map[string]*yaml.Node*transform.Transformer*transform.NopResetter*exceptions.multiError*exceptions.causeError*exceptions.MultiError*netlink.LinkOperStateAdPartnerOperPortState*netlink.RouteProtocol*netlink.RulePortRange*interface { Reset() }marshalMessageSetField*protoreflect.FullNameappendEnumValueOptions*protoreflect.EnumTypeupdateRoundTripCounterlastSampleIsAppLimited*protocol.PacketNumber*protocol.ConnectionID*utils.ConnectionStats*qerr.ApplicationError*qerr.IdleTimeoutError*wire.ResetStreamFrame*wire.DataBlockedFrame*wire.StopSendingFrame*wire.PreferredAddressDisableActiveMigration*ackhandler.ecnHandler*ackhandler.ecnTrackerOnLossDetectionTimeout*ackhandler.lostPacket*ackhandler.alarmTimerisAmplificationLimited*[]ackhandler.intervalIsPotentiallyDuplicate*handshake.CryptoSetup*handshake.cryptoSetup*handshake.cipherSuite*qlog.KeyUpdateTrigger*qlog.PacketDropReason*qlog.PacketLossReason*qlog.PathEndpointInfo*qlog.ConnectionClosed*qlog.PreferredAddress*qlog.LossTimerUpdated*qlog.PushPromiseFrame ErrorCode json:"error"*retryablehttp.Backoff*retryablehttp.Request*[]dnsmessage.SVCParam*pki.CertificateScheme*unicode.utf16Encoding*nl.NetlinkRequestData*pragma.DoNotImplementNumExtensionsByMessage*filedesc.defaultValue*[][2]protowire.Number*filedesc.FieldNumbers*filetype.fileRegistry*impl.unmarshalOptions*impl.atomicNilMessage*impl.coderMessageInfo*impl.messageConverter*impl.listPtrConverter*impl.float32Converter*impl.float64ConverterPathjson:",omitempty"Depsjson:",omitempty"*socket.mmsghdrsPacker*func(net.Addr, string)*cmd.tcpForwardingEntry*cmd.udpForwardingEntry*atomic.Pointer[string]*map.group[string][]int*func() context.Context*tls.ClientSessionCache*tls.ClientSessionStatequicTransportParametersselectedIdentityPresentverifyServerCertificatewriteChangeCipherRecord*tls.serverHelloDoneMsg*func([]uint8, []uint8)internal/runtime/atomic*func(tls.CurveID) boolRawSubjectPublicKeyInfoPermittedEmailAddresses*[1]tls.SignatureScheme*[3]tls.SignatureScheme*[4]tls.SignatureScheme*[7]tls.SignatureScheme*x509.distributionPoint*func(fmt.State, int32)*func(*net.netFD) error*netip.parsePrefixError*os.fileWithoutReadFrom*runtime.lockRankStructtypePointersOfUnchecked*runtime.synctestBubbletraceSchedResourceState*runtime.localSpanQueue*runtime.traceBufHeader*[][2]*runtime.traceBuf*[]runtime.heldLockInfo*[]runtime.ancestorInfo*runtime.heapStatsDelta*runtime.scavengerState*map[uint32][]*abi.Type*syscall.NetlinkMessage*[]syscall.SysProcIDMapGenBashCompletionFileV2GenPowerShellCompletionGlobalNormalizationFuncHasAvailableSubCommandsLocalNonPersistentFlagsgenPowerShellCompletionAddSecureRemoteProviderGetStringMapStringSliceisPathShadowedInAutoEnvisPathShadowedInDeepMapisPathShadowedInFlatMap*map[string]viper.Codec*viper.ConfigParseError*func(*zapcore.sampler)*sockopts.SocketOptions HasUpdate json:"update"getCertificateWithCacheDisablePathMTUDiscovery*client.BandwidthConfig*obfs.obfsPacketConnUDP*chan *udphop.udpPacketgo.uber.org/zap/zapcore*zapcore.CheckWriteHook*zapcore.ArrayMarshaler*func() zapcore.Encoder*zapcore.consoleEncoderaddSeparatorIfNecessary*json.reflectWithString*map[string]*json.field*http.http2writeContext*http.http2HeadersFrame*http.http2incomparablenoteBodyReadFromHandlerwrite100ContinueHeadersshouldSendContentLength*chan http.writeRequestconnectMethodForRequesthttp2transportTestHooks*http.http2clientStreamcanTakeNewRequestLocked*http.http2UnknownFrame*func() (uint32, error)*http.http2writePingAck*http.onceCloseListener*http.persistConnWriter*http.http2noBodyReader*[]http.socksAuthMethod*certmagic.KeyGenerator*certmagic.CacheOptions*certmagic.ConfigGetterAllMatchingCertificatesmakeCertificateWithOCSPCertificatePEMjson:"-"CacheManagedCertificategetCertificateFromCachegetTLSALPNChallengeCertmanagedCertNeedsRenewalrenewDynamicCertificatestorageHasCertResourcesDisableTLSALPNChallenge*cloudflare.cfDNSRecordPerPagejson:"per_page"github.com/libdns/gandigithub.com/libdns/vultr*[]govultr.DomainRecordDeactivateAuthorization*firewall.commandRunner*server.BandwidthConfig*server.udpSessionEntry*server.defaultOutbound*auth.HTTPAuthenticator*outbounds.httpOutbound*outbounds.resolveError*outbounds.udpConnState*outbounds.fastOpenConn*outbounds.lookupResultReqAddrjson:"req_addr"*func() go.shape.*uint8*sync.poolLocalInternalAddASN1ObjectIdentifierAddUint16LengthPrefixedAddUint24LengthPrefixedAddUint32LengthPrefixed*func() reflect.ChanDir*func(int) reflect.Type*map[reflect.visit]bool*reflectlite.ValueError*dnsmessage.nestedError*func() dnsmessage.Type*dnsmessage.SOAResource*dnsmessage.PTRResource*dnsmessage.TXTResource*dnsmessage.SRVResource*dnsmessage.OPTResourceinternal/runtime/cgroup*pflag.stringSliceValue*pflag.stringArrayValueMarkShorthandDeprecated*func(int) (int32, int)FindReaderSubmatchIndexFindStringSubmatchIndexReplaceAllLiteralString*unix.SockaddrLinklayer*unix.RawSockaddrL2TPIP*unix.RawSockaddrRFCOMMDialOriginalDestination*[]ranges.Range[uint32]*[]*netlink.NexthopInfo*acl.InvalidSyntaxError*v2geo.Domain_Attribute*map.group[int32]string*map.group[string]int32lastAckedPacketSentTimecloseWithTransportErrorHandlePathResponseFrame*quic.StatelessResetKey*quic.statelessResetteronHasStreamControlFrame*quic.shortHeaderPacketIsOnlyShortHeaderPackethandleHandshakeCompletehandlePathResponseFramehandleShortHeaderPacketqlogTransportParametersversionNegotiationQueuemaybeSendStatelessResetAddFromPreferredAddressinitialClientDestConnID*[2]quic.clientHelloCut*quic.streamFrameGetter*func() handshake.EventappendShortHeaderPacketshortHeaderPacketLengthunpackShortHeaderPacket*[]*quic.remoteAddrInfo**quic.headerParseError**qerr.ApplicationErrorenableResetStreamAt*func() *http3.Settings**http3.errConnUnusable*[]*protocol.UDPMessage*[1]protocol.UDPMessage*encoding.TextMarshalerisBoundaryDelimiterLineparseContentDisposition*httptrace.DNSStartInfo*func(string, []string)*hpack.headerFieldTable*internal.chunkedWriter*internal.chunkedReader*acmez.challengeHistorylistRemainingChallengesfillChallengeFieldsrememberFailedChallengepresentForNextChallengeNamedns:"cdomain-name" TimeSigned dns:"uint48"Mboxdns:"cdomain-name"*dns.tsigSecretProvider*map[string]dns.Handler*map[dns.SVCBKey]string*map[string]dns.SVCBKey*map.group[string]uint8*map.group[uint8]stringExchangeWithConnContext*govultr.AccountServiceTagurl:"tag,omitempty"ImageIDjson:"image_id"*govultr.BillingServiceEndDatejson:"end_date"MountIDjson:"mount_id"*[]govultr.BlockStorageBaseURLjson:"base_url"StartUpjson:"start_up"CreateDockerCredentialsPlanRAMjson:"plan_ram"*govultr.DatabaseBackup*[]govultr.DatabasePlan*govultr.MaxConnections*[]govultr.DatabaseUser*[]govultr.FirewallRule*govultr.BackupSchedule*govultr.PrivateNetworkRecycleNodePoolInstance*govultr.StickySessions*govultr.ForwardingRule*govultr.LBFirewallRule*[]govultr.LoadBalancer*govultr.NetworkService*govultr.SnapshotURLReqIPBlockjson:"ip_block"*govultr.reservedIPBase*exec.prefixSuffixSaverPeerApplicationSettingsQuicTransportParametersisPersonalizationStringTrailingZeroBitsVarTime*map[*syntax.Regexp]int*[]unstable.ParserError*func(*yaml.Node) error*yaml.yaml_event_type_t*yaml.yaml_error_type_t*yaml.yaml_token_type_t*yaml.yaml_simple_key_t*yaml.yaml_alias_data_tcompact_sequence_indentcallObsoleteUnmarshaler*runes.replaceIllFormedgolang.org/x/text/runes*map.group[uint32]int32*netlink.SEG6LocalEncap*netlink.LinkStatistics*netlink.BondSlaveState*netlink.vxlanPortRangeLeadingDetachedComments*protoreflect.RawFieldsNumAckAggregationEpochsnumAckAggregationEpochsOnRetransmissionTimeoutcalculateRecoveryWindowenterProbeBandwidthModemaybeExitStartupOrDraininitialCongestionWindow*wire.PathResponseFrame*wire.AckFrequencyFrame*wire.ImmediateAckFrameMarshalForSessionTicketInitialMaxStreamDataUniRetrySourceConnectionIDActiveConnectionIDLimit*ackhandler.StreamFrameincludedInBytesInFlightGetLossDetectionTimeoutremoveFromBytesInFlight*ackhandler.ccAdapterExlargestObservedRcvdTimestartNewAutoTuningEpochEnsureMinimumWindowSizeshouldQueueWindowUpdate*handshake.xorNonceAEADfirstRcvdWithCurrentKeyfirstSentWithCurrentKeyshouldInitiateKeyUpdategetDataForSessionTicket*qlog.StartedConnection*func(qlogwriter.Event)JoinSourceSpecificGroupparseIndexedHeaderFieldparseLiteralHeaderField*quotedprintable.Reader*internal.RetrieveError*dnsmessage.SVCParamKey*map[string]sign.Scheme*unicode.utf8bomDecoder*map[*gob.typeInfo]bool*map[string]token.Token*[]*impl.coderFieldInfo*impl.pointerCoderFuncscheckInitializedPointermakeExtensionFieldsFunc*impl.legacyUnmarshalerlastMaxCongestionWindow*congestion.cubicSenderlargestSentPacketNumberValuejson:",omitempty"*cmd.adaptiveConnFactoryModemapstructure:"mode"Addrmapstructure:"addr"Namemapstructure:"name"Typemapstructure:"type"HTTPmapstructure:"http"Downmapstructure:"down"IPv4mapstructure:"ipv4"IPv6mapstructure:"ipv6"Authmapstructure:"auth"Obfsmapstructure:"obfs"QUICmapstructure:"quic"Lazymapstructure:"lazy"Certmapstructure:"cert"*cmd.serverConfigACMETLS*cmd.serverConfigACMEDNS*map.group[string]stringFilemapstructure:"file"ACMEmapstructure:"acme"*utils.Atomic[time.Time]*map[string]func() error*tls.QUICEncryptionLevel*func() ([]uint8, error)PreferServerCipherSuitesEncryptedClientHelloKeys*tls.keySharePrivateKeys*tls.certificateMsgTLS13hashForClientCertificate*tls.newSessionTicketMsgprocessClientKeyExchangeprocessServerKeyExchange*func([]uint8) hash.Hash*[]asn1.ObjectIdentifierInhibitPolicyMappingZero*[12]tls.SignatureScheme*x509.SignatureAlgorithm*x509.PublicKeyAlgorithmIdasn1:"optional,tag:0"*x509.certificateRequest*[]*x509.policyGraphNode*x509.CertificateRequestRawTBSCertificateRequest*func(interface {}) bool*net.UnknownNetworkError*func() <-chan struct {}*func(netip.Addr) string*func(*os.processHandle)*runtime.boundsErrorCodesetUserArenaChunkToFault*[]runtime.stackfreelist*runtime.persistentAlloc*[2][2]*runtime.traceBuf*runtime.pcvalueCacheEnt*map[string]interface {}*strings.genericReplacer*func(func(string) bool)*syscall.SockaddrNetlink*syscall.RawSockaddrUnix*map.group[string]uint64*cobra.CompletionOptionscompletionCommandGroupIDInitDefaultCompletionCmdfindConfigFileWithFinder*forwarding.sessionEntry*redirect.TCPEventLoggerInet4RouteExcludeAddressInet6RouteExcludeAddress*list.Element[func(int)]*map[string]*v2geo.GeoIP*client.CongestionConfig*func(protocol.StreamID)*udphop.udpHopPacketConn*udphop.InvalidPortError*zapcore.ObjectMarshaler*func(string, complex64)*func(string, time.Time)*[][4096]zapcore.counter*zapcore.DurationEncoder*func(time.Time, string)*context.CancelCauseFunc*json.UnmarshalTypeError*func() (float64, error)*func() json.encoderFunc*http.http2PriorityParam*func() <-chan time.TimeMaxUploadBufferPerStreamonceSetNextProtoDefaults*http.http2goroutineLock*http.http2PriorityFrame*http.http2SettingsFrame*http.unsupportedTEError*[]*http.http2ClientConn*http.http2writeSettingsIsHTTP2NoCachedConnError*http.erringRoundTripper*http.http2serverMessage*[]*multipart.FileHeader*http.ResponseController*[2]http.socksAuthMethod*func(hpack.HeaderField)*[]certmagic.CertificateRenewManagedCertificatesunsyncedCacheCertificatereloadManagedCertificatenewACMEClientWithAccountstorageKeyUserPrivateKey*certmagic.tlsALPNSolver*certmagic.solverWrapper*certmagic.soaCacheEntry*map[string]acmez.SolverTTLjson:"ttl,omitempty"Currencyjson:"currency"*cloudflare.cfResultInfoNewNoncejson:"newNonce"NewOrderjson:"newOrder"Finalizejson:"finalize"*func(bool, string) bool*server.CongestionConfig**server.udpSessionEntry*outbounds.socks5UDPConn*outbounds.OutboundEntry*func() crypto.PublicKeyClientEarlyTrafficSecretprobablyPrimeMillerRabinCriticalasn1:"optional"*func(reflect.Type) bool*func() reflectlite.Type*dnsmessage.ResourceBody*map.group[string]uint16*dnsmessage.AAAAResource*pflag.InvalidValueError*template.missingValType*[]locafero.searchResultFunctionjson:"function"*mapstructure.ParseError*func(int, string) error*unix.RawSockaddrNetlink*unix.RawSockaddrL2TPIP6*unix.RawSockaddrNFCLLCP*socks5.NegotiationReply*control.InterfaceFinder*network.ReadWaitOptions*func(acl.HostInfo) bool*acl.matchResultCacheKey*func() ([]uint8, []int)*[]protocol.ConnectionIDapplyTransportParameterscheckTransportParametershandleHandshakeConfirmedhandleHandshakeDoneFramehandlePathChallengeFrameHandleMaxStreamDataFrame*quic.framesToRetransmitstreamsWithControlFrames*quic.errTransportClosed*[0]*quic.remoteAddrInfo*map.group[uint64]uint64*textproto.ProtocolError*hpack.InvalidIndexErrorcountAvailableChallengesinitiateCurrentChallengegolang.org/x/crypto/ocsp Certificate dns:"base64"Targetdns:"domain-name"*func() dns.SVCBKeyValueRmaildns:"cdomain-name"Emaildns:"cdomain-name"Map822dns:"domain-name"*dns.EDNS0_TCP_KEEPALIVE*map.group[uint16]stringgithub.com/libdns/libdns*oauth2.reuseTokenSourcePasswordCredentialsToken*govultr.BareMetalCreateTagjson:"tag,omitempty"*govultr.BareMetalServerFeaturesjson:"features"*govultr.BareMetalUpdateUserNamejson:"username"Passwordjson:"password"Metadatajson:"metadata"Businessjson:"business"*govultr.DatabaseServiceDatabasejson:"database"Usernamejson:"username"*govultr.DatabaseUserACL*govultr.DatabaseForkReq*govultr.DatabaseBackupsJitjson:"jit,omitempty"*govultr.AvailableOption*[]govultr.DatabaseAlert*govultr.DomainRecordReq*[]govultr.FirewallGroup*govultr.FirewallRuleReqProtocoljson:"protocol"*govultr.InstanceServiceHostnamejson:"hostname"Dowjson:"dow,omitempty"Domjson:"dom,omitempty"FileNamejson:"filename"Endpointjson:"endpoint"Versionsjson:"versions"*govultr.LoadBalancerReqSSLjson:"ssl,omitempty"VPCjson:"vpc,omitempty"Requiredjson:"required"Locationjson:"location"*[]govultr.ObjectStorage*[]govultr.BareMetalPlan*govultr.SnapshotService*[]govultr.StartupScriptInstancejson:"instance"Snapshotjson:"snapshot"montgomeryRepresentation*toml.StrictMissingError*[]yaml.yaml_node_item_t*[]yaml.yaml_node_pair_tgetPossiblyUnhashableKeysetPossiblyUnhashableKeylog/slog/internal/buffer*netlink.MPLSDestination*netlink.BondArpValidate*netlink.BondFailOverMac*[]nl.NetlinkRequestData*protoreflect.EnumNumber*protoreflect.Descriptor*protoreflect.FileImport*protoreflect.SourcePath*protoreflect.EnumRanges*func() protowire.Number*bbr.maxAckHeightTrackerResetMaxAckHeightTrackermaybeEnterOrExitProbeRttprobeRttCongestionWindow*qerr.TransportErrorCode*wire.MaxStreamDataFrame*wire.PathChallengeFrame*wire.HandshakeDoneFrame*congestion.PacketNumber*ackhandler.FrameHandler*func(bool) protocol.ECNHasOutstandingPathProbes*[]protocol.PacketNumber*[]ackhandler.lostPacketIncrementHighestReceived*handshake.updatableAEADOriginalDestConnectionID*qlog.VersionInformationLeaveSourceSpecificGroup*qpack.invalidIndexErrorgithub.com/quic-go/qpackgithub.com/stretchr/objx*flate.CorruptInputError*internal.AuthStyleCache*internal.expirationTimewantsHttp10KeepAlivei*retryablehttp.LenReader*dnsmessage.SVCBResourceUnmarshalBinaryPublicKeygolang.org/x/crypto/hkdf*unicode.utf8bomEncodingRangeExtensionsByMessageresolveMessageDependency*impl.reflectMessageInfo*func(impl.pointer) bool*impl.extensionFieldInfo*impl.lazyExtensionValue*congestion.DefaultClockCongestionWindowAfterAcklargestAckedPacketNumberlargestSentAtLastCutback*internal.SimpleEncoding*func(net.Addr, net.Addr)*[]cmd.tcpForwardingEntry*[]cmd.udpForwardingEntry*cmd.serverConfigACMEHTTP*cmd.serverConfigAuthHTTP*cmd.serverConfigResolverfillIgnoreClientBandwidth*map[string]zapcore.Level*tls.RenegotiationSupportunmarshalHandshakeMessage*func() (net.Conn, error)*tls.certificateVerifyMsg*tls.certificateStatusMsg*tls.clientKeyExchangeMsg*tls.serverKeyExchangeMsggenerateClientKeyExchangegenerateServerKeyExchange*func() *nistec.P256Point*func() *nistec.P384Point*func() *nistec.P521Point*tls.clientHandshakeState*tls.serverHandshakeStateRequireExplicitPolicyZero*func() *nistec.P224Point*x509.authorityInfoAccessMGFasn1:"explicit,tag:1"*[]x509.distributionPointIsInterfaceLocalMulticast*func() (time.Time, bool)*func(go.shape.struct {})*[]*runtime.PanicNilError*[4]runtime.stackfreelist*runtime.gcMarkWorkerMode*runtime.traceBlockReason*[10]runtime.heldLockInfo*runtime.gcStatsAggregate*map[int32]unsafe.Pointer*map[unsafe.Pointer]int32*func() *abi.UncommonType*syscall.RawSockaddrInet4*syscall.RawSockaddrInet6*syscall.NetlinkRouteAttr*func(time.Duration) bool*cobra.ShellCompDirective*cobra.FParseErrWhitelistDefaultShellCompDirectivecommandsMaxCommandPathLenAllChildCommandsHaveGroupMarkFlagsRequiredTogetherMarkPersistentFlagDirnamesearchMapWithPathPrefixes*func(zapcore.Level) bool*proxymux.connWithOneByte LatestVersion json:"lver"*client.udpSessionManager*func(protocol.ByteCount)*func() protocol.StreamID*udphop.HopIntervalConfig*zapcore.multiWriteSyncer*func(interface {}) error*func(string, complex128)*zapcore.CheckWriteAction*zapcore.SamplingDecision*zapcore.ReflectedEncoder*zapcore.MapObjectEncoder*map[zapcore.Level]string*func(bool, error, error)*context.withoutCancelCtx*func(func()) func() bool*func(reflect.Value) bool*[]json.reflectWithString*http.http2WriteScheduler*func() *http.http2FramerMaxDecoderHeaderTableSizeMaxEncoderHeaderTableSizeMaxReceiveBufferPerStream*map[*http.conn]struct {}*http.http2bufferedWriter*http.http2responseWriter*http.http2RSTStreamFramenewWriterAndRequestNoBodypromoteUndeclaredTrailers*http.readWriteCloserBody*http.finishAsyncByteRead*map[string]http.muxEntry*http.http2writeQueuePool*http.http2ClientConnPool*chan http.requestAndChancurrentRequestCountLocked*http.http2clientConnPool*http.nothingWrittenError*certmagic.OnDemandConfiggetCertFromAnyCertManagerloadCertResourceAnyIssuermoveCompromisedPrivateKeyobtainOnDemandCertificate*[]cloudflare.cfDNSRecordLegacyIDjson:"legacy_id"github.com/libdns/duckdnsgithub.com/libdns/godaddy*namedotcom.errorResponse*acme.loggableSubproblemsSetExternalAccountBinding*firewall.osCommandRunner*server.udpSessionManager*outbounds.socks5Outbound*outbounds.noAddressError*outbounds.directOutbound*outbounds.systemResolver*outbounds.udpConnAdapter*outbounds.fastOpenDialerEarlyExporterMasterSecret*pkix.AlgorithmIdentifier*func(int) reflect.Method*dnsmessage.CNAMEResource*chan singleflight.Result*maps.unhashableTypeErrorgetWithoutKeySmallFastStr*pflag.ValueRequiredError*pflag.InvalidSyntaxError*[1]locafero.searchResult*mapstructure.DecodeError*mapstructure.Unmarshaler*base64.CorruptInputError*network.VectorisedWriter*quic.pathManagerOutgoing*chan quic.receivedPacket*[]*quic.longHeaderPacket*[]ackhandler.StreamFramehandleTransportParameterssendPackedCoalescedPacket*chan quic.rejectedPacketdisableVersionNegotiationmaybeHandleStatelessResetHandleTransportParametersactiveStatelessResetTokenremoveStatelessResetToken*quic.connRunnerCallbacks*quic.cryptoStreamManager*quic.initialCryptoStream*quic.retransmissionQueue*func(monotime.Time) bool*quic.cryptoStreamHandler*quic.packetNumberManagermaybeGetShortHeaderPacket*quic.mtuFinderAckHandler*func(quic.packetHandler)*http3.countingByteReaderHandleBidirectionalStream*encoding.BinaryMarshaler*encoding.TextUnmarshaler*acmez.failedChallengeMapenqueueUnfailedChallengesObtainCertificateUsingCSRTargetdns:"cdomain-name"Mapx400dns:"domain-name"*map[uint16]func() dns.RRCPUCountjson:"cpu_count"UnitTypejson:"unit_type"SiteCodejson:"site_code"RootUserjson:"root_user"PublicIPjson:"public_ip"PlanDiskjson:"plan_disk"*govultr.DatabaseCPUUsage*govultr.SupportedEngines*govultr.FirewallGroupReq*[]govultr.PrivateNetworkMinNodesjson:"min_nodes"MaxNodesjson:"max_nodes"*govultr.ClusterReqUpdate*[]govultr.ForwardingRule*[]govultr.LBFirewallRuleV4Subnetjson:"v4_subnet"CPUModeljson:"cpu_model"*govultr.PlanAvailability*govultr.StartupScriptReqACLjson:"acls,omitempty"*govultr.OSServiceHandler*govultr.blockStorageBase*govultr.domainRecordBase*govultr.firewallRuleBase*map.group[string][]uint8PQSignatureSchemesEnabled*func([]uint8) *hmac.HMAC*map[*syntax.Regexp]int64*yaml.obsoleteUnmarshaler*yaml.yaml_scalar_style_t*yaml.yaml_parser_state_t*yaml.yaml_read_handler_t*[]yaml.yaml_simple_key_t*[]yaml.yaml_alias_data_t*exceptions.HasInnerError*func(netlink.Encap) bool*netlink.LinkStatistics32*netlink.LinkStatistics64*map[int]*nl.SocketHandle*protoreflect.Cardinality*func() protoreflect.Name*func(protoreflect.Value)*protoreflect.FileImportsappendEnumDescriptorProtoappendFileDescriptorProtoappendUninterpretedOption*protoreflect.FieldRanges*func() protoreflect.Kind*protoreflect.MessageTypeaggregationEpochStartTimecalculateCongestionWindowgetTargetCongestionWindowrescalePacketSizedWindows*protocol.EncryptionLevel*protocol.PacketNumberLen*func(bool) time.Duration*qerr.StatelessResetError*wire.StreamsBlockedFrame*map.group[uint64][]uint8*wire.TransportParametersInitialSourceConnectionIDFirstOutstandingPathProbecheckFlowControlViolation*handshake.TokenGenerator*handshake.tokenProtector*qlog.LossTimerUpdateType*base32.CorruptInputErrorErrorURIjson:"error_uri"*retryablehttp.CheckRetry*retryablehttp.ReaderFunc*retryablehttp.hookLogger*dnsmessage.HTTPSResource*netx.IPStackCapabilitiesUnmarshalBinaryPrivateKey*func(kem.PublicKey) bool*func() *encoding.Decoder*func() *encoding.EncoderparseIntOrFloatOrDateTimeparseMultilineBasicString*errors.SizeMismatchError*pragma.NoUnkeyedLiterals*filedesc.EditionFeatures*filedesc.SourceLocations*map[filedesc.pathKey]int*filedesc.PlaceholderFile*filedesc.PlaceholderEnum*filedesc.resolverByIndex*filetype.resolverByIndex*func(int32, int32) int32*func() *impl.MessageInfo*impl.aberrantMessageType*impl.messageIfaceWrapper*func(coding.Version) intVersionjson:",omitempty"Replacejson:",omitempty"*prototext.MarshalOptions*map.group[string]float64*cmd.masqHandlerLogWrapper*cmd.clientConfigTransport*cmd.clientConfigBandwidthRealmmapstructure:"realm"Routemapstructure:"route"Emailmapstructure:"email"*cmd.serverConfigBandwidthHTTPSmapstructure:"https"GeoIPmapstructure:"geoip"Proxymapstructure:"proxy"Sniffmapstructure:"sniff"*func(string, string) bool*map.group[string][]stringNegotiatedProtocolIsMutualhandlePostHandshakeMessagequicGetTransportParametersquicSetTransportParameters*tls.certificateRequestMsg RawAttributes asn1:"tag:0"Hashasn1:"explicit,tag:0"*func(string) (int, error)*func(string) net.sockaddr*net.tcpConnWithoutWriteTo*func(func(uintptr)) error*map[string]map[string]int*map[abi.TypeOff]*abi.Type*[0]*runtime.PanicNilError*[]runtime.pcvalueCacheEnt*runtime.sysStatsAggregate*runtime.cpuStatsAggregate*runtime.sliceInterfacePtr*strings.appendSliceWriter*syscall.SockaddrLinklayerGidMappingsEnableSetgroups*cobra.commandSorterByNameSuggestionsMinimumDistanceGenZshCompletionFileNoDescHasAvailableInheritedFlagsMarkFlagsMutuallyExclusiveMarkPersistentFlagFilenameMarkPersistentFlagRequiredRegisterFlagCompletionFuncSetGlobalNormalizationFuncWatchRemoteConfigOnChannel*func(string) slog.Handler*forwarding.TCPEventLogger*forwarding.UDPEventLogger*sockopts.UnsupportedError*func(int) (string, error)*map[string]*v2geo.GeoSiteInitialStreamReceiveWindowMaxConnectionReceiveWindow*chan *protocol.UDPMessagegithub.com/apernet/quic-go*func(quic.receivedPacket)*func(chan struct {}) bool*obfs.SalamanderObfuscator*zapcore.lockedWriteSyncer*zapcore.sliceArrayEncoder*zapcore.appendTimeEncoder*json.UnsupportedTypeErrormaybeServeUnencryptedHTTP2*http.http2readFrameResult*http.http2writeResHeaderscloseAllStreamsOnConnClose*func([]uint8, int) string*http.expectContinueReader*http.globalOptionsHandlerStrictMaxConcurrentStreams*http.http2ConnectionError*http.http2handlerPanicRST*http.http2goAwayFlowError*http.checkConnErrorWriter*http.http2stickyErrWriter*http.requestBodyReadError*map[http.ConnState]string*map[string][]*http.Cookie*httputil.maxLatencyWriter*certmagic.ChainPreferenceSANsjson:"sans,omitempty"*certmagic.renewQueueEntry*map[string]chan struct {}*certmagic.ACMEDNSProviderSizejson:"size,omitempty"Namejson:"name,omitempty"Portjson:"port,omitempty"Typejson:"type,omitempty"Datajson:"data,omitempty"Metajson:"meta,omitempty" Frequencyjson:"frequency"Hostjson:"host,omitempty"Fqdnjson:"fqdn,omitempty"Userjson:"user,omitempty" KeyChangejson:"keyChange" Protectedjson:"protected"*server.udpEventLoggerImpl*auth.CommandAuthenticatoraltSvcHijackResponseWriter*[]acl.matchResultCacheKey*chan outbounds.dialResult*func(weak.Pointer[uint8])*mlkem.DecapsulationKey768 Parametersasn1:"optional"*dnsmessage.ResourceHeader*func(int) regexp.lazyFlag*func(*regexp.Regexp) boolFindAllStringSubmatchIndex*[][]locafero.searchResult*func(interface {}) string*unix.RawSockaddrLinklayer*socks5.NegotiationRequest*func([]*buf.Buffer) error*map[netip.AddrPort]uint16*[]*v2geo.Domain_Attribute*func() *v2geo.Domain_Type*func() protocol.ByteCount*func(*quic.ReceiveStream)handleResetStreamFrameImplappendOneShortHeaderPackethandleConnectionCloseFrame*func(monotime.Time) errorrestoreTransportParameters*[]*wire.PathResponseFramequeuedTooManyControlFramesAddStreamWithControlFramesQueuedTooManyControlFrames*quic.OOBCapablePacketConn*quic.sendStreamAckHandler**qerr.StatelessResetError*[1]*quic.longHeaderPacket*http3.stateTrackingStreamhandleResetStreamFramehandleStopSendingFramehandleUnidirectionalStreamHandleUnidirectionalStreamGoodasn1:"tag:0,optional"Hostnamedns:"domain-name"MACdns:"size-hex:MACSize"NextNamedns:"domain-name"Keydns:"size-hex:KeySize"Planjson:"plan,omitempty"V6MainIPjson:"v6_main_ip" Bandwidthjson:"bandwidth"*[]govultr.BareMetalServerLivejson:"live,omitempty"*govultr.ContainerRegistry Continentjson:"continent"*govultr.DatabaseCreateReqModejson:"mode,omitempty"Datejson:"date,omitempty"Timejson:"time,omitempty"*govultr.DatabaseMigration*govultr.DatabaseDiskUsage*[]govultr.AvailableOption Availablejson:"available"*govultr.DBPlanListOptions Locationsjson:"locations" Timestampjson:"timestamp"*govultr.DatabaseUpdateReq*govultr.InstanceCreateReqHourjson:"hour,omitempty" Neighborsjson:"neighbors"*govultr.BackupScheduleReq*govultr.InstanceUpdateReq*govultr.KubernetesService*govultr.NodePoolReqUpdate*govultr.ClusterUpgradeReqDeleteClusterWithResourcesPathjson:"path,omitempty"RuleIDjson:"id,omitempty"IPV4json:"ipv4,omitempty"IPV6json:"ipv6,omitempty"*govultr.ReservedIPService*govultr.ISOServiceHandler*govultr.KubernetesHandler*govultr.VPCServiceHandler*govultr.firewallGroupBase*govultr.objectStorageBase*govultr.startupScriptBase*chan exec.goroutineStatusInsecureServerNameToVerifygithub.com/subosito/gotenvhandleArrayTableCollection*yaml.yaml_emitter_state_t*yaml.yaml_mapping_style_t*yaml.yaml_tag_directive_t*yaml.yaml_write_handler_t*map.group[*yaml.Node]bool*map[string]yaml.fieldInfo*func() *netlink.LinkAttrs*netlink.BondArpAllTargets*netlink.LinkNotFoundErrorNeedAdditionalReadDeadline**errors.SizeMismatchError*func(protoreflect.MapKey)*func() protoreflect.Value*protoreflect.ProtoMessageappendFieldDescriptorProtoappendOneofDescriptorProto*func() protoreflect.Names*[]protoreflect.EnumNumber*protoreflect.FieldNumbersshouldExitStartupDueToLossroundsWithoutBandwidthGain*func(string) utils.Logger*qerr.ApplicationErrorCode*wire.NewConnectionIDFrame*wire.ConnectionCloseFrame*wire.transportParameterIDUnmarshalFromSessionTicket*congestion.LostPacketInfolastAckElicitingPacketTime*handshake.headerProtector*handshake.ConnectionStatehandleDataFromSessionStatemarshalDataForSessionStateExcludeSourceSpecificGroupIncludeSourceSpecificGroup*func(*flate.decompressor)*func() (io.Reader, error)*func(kem.PrivateKey) bool*edwards25519.incomparable*map.group[string][2]int32*go.shape.map[string]int32*map.group[gob.typeId]bool*protoregistry.typesByName*map[protoreflect.Name]int*impl.placeholderExtension*impl.legacyMessageWrapperlastTargetCongestionWindowlastCutbackExitedSlowstartinitialMaxCongestionWindowSettingsjson:",omitempty"golang.org/x/text/encoding**sockopts.UnsupportedError*cmd.clientConfigCongestion*cmd.serverConfigCongestion*cmd.serverConfigMasquerade*atomic.Pointer[os.dirInfo]*cmd.clientModeRunnerResult*map.group[x509.sum224]bool*map.group[string]struct {}*func(string, func() error)SignedCertificateTimestamps*tls.CertificateRequestInfoDynamicRecordSizingDisabledGetEncryptedClientHelloKeys*func([]uint8) (int, error)*func() tls.ConnectionState*tls.encryptedExtensionsMsg*map.group[tls.alert]stringUnhandledCriticalExtensionsPermittedDNSDomainsCritical*x509.UnknownAuthorityError*x509.tbsCertificateRequest*x509.distributionPointName*[]x509.authorityInfoAccess*func() (int32, int, error)*net.tcpConnWithoutReadFrom*map[string][]net.nssSource*<-chan singleflight.Result*map[*abi.Type]interface {}*func(string, string) error*runtime.sizeClassScanStats*runtime.cleanupBlockHeader*[8]runtime.pcvalueCacheEnt*runtime.errorAddressString*runtime.gcBgMarkWorkerNode*runtime.heapStatsAggregate*runtime.stringInterfacePtr*runtime.uint16InterfacePtr*runtime.uint32InterfacePtr*runtime.uint64InterfacePtr*runtime.TypeAssertionError*strings.byteStringReplacer*syscall.RawSockaddrNetlink*func(string, int, int) int*func(*cobra.Command) errorGenPowerShellCompletionFileHasAvailablePersistentFlagsSetCompletionCommandGroupIDgenPowerShellCompletionFile*map[string]map[string]bool*map[string]viper.FlagValuesearchSliceWithPathPrefixes*viper.DefaultCodecRegistry*map[uint32]*client.udpConn*func([]uint8, []uint8) int*json.UnsupportedValueError*json.InvalidUnmarshalError*map[interface {}]struct {}*map.group[reflect.Type]int*http.http2frameWriteResult*chan http.http2bodyReadMsg*http.http2unstartedHandlerinitialStreamSendWindowSizeinitialStreamRecvWindowSize*http.http2MetaHeadersFrame*http.http2startPushRequestpossiblyConflictingPatterns*chan http.responseAndError*http.http2PushPromiseFrame*http.http2writePushPromise*http.http2writeSettingsAck*http.http2flushFrameWriter*http.http2connectionStater*func() http.ResponseWriter*map[http.http2Flags]string*http.socksUsernamePassword*go.shape.[]go.shape.string*func(*http.Response) errorcheckIfCertShouldBeObtained*certmagic.dnsPresentMemory*certmagic.retryStateCtxKey*certmagic.updateQueueEntry CreatedOnjson:"created_on"github.com/mholt/acmez/acme*auth.PasswordAuthenticator*auth.UserPassAuthenticator*outbounds.speedtestHandler*outbounds.standardResolver*func(qerr.StreamErrorCode) InitialAtjson:"initial_at"*rsa.PKCS1v15DecryptOptionscrypto/internal/fips140/aes*tls13.ExporterMasterSecret*asn1.invalidUnmarshalError*pkix.AttributeTypeAndValue*reflect.structTypeUncommon*dnsmessage.UnknownResource*map[dnsmessage.Type]string*poll.DeadlineExceededError*chan<- singleflight.Result*func(string) (uint, error)*pflag.ParseErrorsAllowlist*func(string) (int8, error)*mapstructure.DecoderConfiggithub.com/apernet/sing-tun*func([][]uint8, int) error*map[uint16]*tun.TCPSession*tun.systemUDPPacketWriter6*tun.systemUDPPacketWriter4*quic.ConnectionIDGeneratorIsActiveStatelessResetTokenonHasStreamControlFrameImpl*quic.DatagramTooLargeError*quic.errCloseForRecreating*quic.pathManagerAckHandlercheckContentLengthViolationgolang.org/x/crypto/blake2b*encoding.BinaryUnmarshaler*httptrace.WroteRequestInfoSetMaxDynamicTableSizeLimitparseDynamicTableSizeUpdate GatewayHostdns:"ipsechost" Exchangerdns:"domain-name" Algorithmdns:"domain-name" ExpiresInjson:"expires_in"github.com/vultr/govultr/v3*govultr.ApplicationServiceLabelurl:"label,omitempty" ShortNamejson:"short_name"OsIDjson:"os_id,omitempty" NetmaskV4json:"netmask_v4" GatewayV4json:"gateway_v4" V6Networkjson:"v6_network" IPAddressjson:"ip_address" StartDatejson:"start_date" UnitPricejson:"unit_price"*govultr.BlockStorageAttach*govultr.BlockStorageCreate BlockTypejson:"block_type"*govultr.BlockStorageDetach*govultr.BlockStorageUpdate DateCreatedjson:"added_at" PullCountjson:"pull_count" PlanVCPUsjson:"plan_vcpus" CurrentGBjson:"current_gb" CurrentMBjson:"current_mb"Nodesurl:"nodes,omitempty" VCPUCountjson:"vcpu_count"*govultr.DatabaseUserACLReq RuleCountjson:"rule_count" NetworkIDjson:"network_id" NodePoolsjson:"node_pools"*govultr.MarketplaceService DiskCountjson:"disk_count"*govultr.PlanServiceHandler*govultr.UserServiceHandler*govultr.VPC2ServiceHandler BareMetaljson:"bare_metal"**govultr.ContainerRegistry*map.group[uint]sign.Schemecrypto/internal/fips140/rsa*yaml.yaml_sequence_style_t*[]yaml.yaml_parser_state_tgolang.org/x/text/transformgithub.com/sagernet/netlink*netlink.BondSlaveMiiStatus*netlink.BondXmitHashPolicy*func() protoreflect.SyntaxappendExtensionRangeOptionsappendMethodDescriptorProto*[2]protoreflect.EnumNumber*func(int) protowire.Number*protoreflect.ExtensionType*func() protoreflect.MapKeyEnableOverestimateAvoidance*func(congestion.ByteCount)checkIfFullBandwidthReached*qerr.HandshakeTimeoutError*congestion.AckedPacketInfodetectAndRemoveAckedPacketshasOutstandingCryptoPackets*handshake.LongHeaderOpener*handshake.LongHeaderSealer*handshake.longHeaderOpener*handshake.longHeaderSealer*func() qlogwriter.Recorder TokenTypejson:"token_type"*retryablehttp.ErrorHandler*retryablehttp.PrepareRetryVarTimeDoubleScalarBaseMultparseMultilineLiteralString*func(*unstable.Node) errorGenerateLegacyUnmarshalJSON*map[string]*filedesc.Field*map[filedesc.pathKey][]int*impl.messageReflectWrapper*impl.placeholderEnumValues*func(protoiface.MessageV1)originPointCongestionWindow*congestion.HybridSlowStart*congestion.SendAlgorithmEx GoVersionjson:",omitempty"golang.org/x/crypto/blake2s*func(string, string, error)Directmapstructure:"direct"SOCKS5mapstructure:"socks5"Listenmapstructure:"listen"Remotemapstructure:"remote"Strictmapstructure:"strict"Servermapstructure:"server"Configmapstructure:"config"*cmd.serverConfigResolverTCP*cmd.serverConfigResolverUDP*cmd.serverConfigResolverTLSEnablemapstructure:"enable"Inlinemapstructure:"inline"Secretmapstructure:"secret"Stringmapstructure:"string"*func(string, time.Duration)*func(context.Context) errorSupportedSignatureAlgorithms*map[string]*tls.Certificate*tls.EncryptedClientHelloKeysupportedSignatureAlgorithmssecureRenegotiationSupported*func(go.shape.interface {})*x509.InsecureAlgorithmErrorReasonasn1:"optional,tag:1"*func(crypto.PublicKey) bool*map.group[string][]x509.OID*map.group[string]net.byName*func(context.Context, bool)*go.shape.*internal/abi.Type*func(int) ([]string, error)*func() (fs.FileInfo, error)*runtime.savedOpenDeferState*func([]uint8, int, int) intSetDefaultShellCompDirectiveIsAdditionalHelpTopicCommand*viper.defaultRemoteProviderwatchKeyValueConfigOnChannel*func([]uint8, string) error*utils.localCertificateCache**quic.DatagramTooLargeError*func(*wire.MaxStreamsFrame)*func() []utils.ByteInterval*[]*quic.pathManagerOutgoing*map.group[reflect.Type]bool*http.http2OpenStreamOptions*http.http2FrameWriteRequest*func(*http.http2serverConn)PermitProhibitedCipherSuitesMaxUploadBufferPerConnection*map[*net.Listener]struct {}DisableGeneralOptionsHandlershouldConfigureHTTP2ForServe*http.http2WindowUpdateFramecopyTrailersToHandlerRequestshouldSendChunkedRequestBody*func(*http.http2ClientConn)*map[[8]uint8]chan struct {}awaitOpenSlotForStreamLockeddecrStreamReservationsLocked*http.http2writeWindowUpdate*http.http2pseudoHeaderError*http.http2ContinuationFrame*http.http2noCachedConnError*certmagic.IssuedCertificateCacheUnmanagedTLSCertificate*certmagic.distributedSolvergithub.com/libdns/cloudflareProtojson:"proto,omitempty"Flagsjson:"flags,omitempty"Usagejson:"usage,omitempty"github.com/libdns/namedotcom*namedotcom.nameDotComRecordTokenjson:"token,omitempty"Titlejson:"title,omitempty" NewAccountjson:"newAccount" RevokeCertjson:"revokeCert"Errorjson:"error,omitempty" Identifierjson:"identifier" Challengesjson:"challenges"*outbounds.PluggableOutbound*outbounds.aclRejectOutbound*chan outbounds.lookupResult Connectionjson:"connection"crypto/internal/fips140cache*func([]uint8) cipher.Streamcrypto/internal/fips140/drbgClientHandshakeTrafficSecretServerHandshakeTrafficSecretcrypto/internal/fips140/ecdh*map[*reflect.structType]int*func(reflectlite.Type) bool*map[dnsmessage.Class]string*map[dnsmessage.RCode]string*func(poll.splicePipeFields)*func(string) (int64, error)*func(string) (int32, error)*map.group[uint8]*pflag.Flag*func(string) (int16, error)*func(string) (uint8, error)*map.group[interface {}]boolgithub.com/fsnotify/fsnotify*mapstructure.DecodeHookFunc*map[reflect.Value]struct {}*map.group[string]*flag.Flaggithub.com/txthinking/socks5github.com/apernet/go-tproxy*tun.DefaultInterfaceMonitor*func() protoreflect.Message*func(protocol.ConnectionID)*quic.sendStreamFrameHandlerHandleStreamDataBlockedFramemaybeGetAppDataPacketFor0RTT**quic.errCloseForRecreating*http3.roundTripperWithCount*multipart.stickyErrorReader*func(httptrace.GotConnInfo)*func(httptrace.DNSDoneInfo)vendor/golang.org/x/net/idnaHitdns:"size-hex:HitLength" NextDomaindns:"domain-name" SignerNamedns:"domain-name"packBufferWithCompressionMapLabeljson:"label,omitempty"Plansjson:"plans,omitempty"*govultr.BlockStorageService*[]govultr.ContainerRegistry Enterprisejson:"enterprise"*govultr.FerretDBCredentials*govultr.DatabaseDBCreateReq*govultr.DatabaseCredentials Percentagejson:"percentage"*govultr.DatabaseMemoryUsageUnitsjson:"units,omitempty"*govultr.DatabaseConnectionsMySQLjson:"mysql,omitempty"Emailjson:"email,omitempty"*govultr.DomainRecordService*govultr.FireWallRuleServiceNotesjson:"notes,omitempty"*govultr.LoadBalancerServiceChainjson:"chain,omitempty"Nodesjson:"nodes,omitempty"*govultr.ReservedIPUpdateReq*govultr.VPC2AttachDetachReq*govultr.LoadBalancerHandlerSecureRenegotiationSupported*ecdsa.personalizationStringcrypto/internal/fips140/hmaccrypto/internal/fips140/sha3*map[string]syntax.charGroup*map.group[reflect.Value]int*[]yaml.yaml_tag_directive_t*[]yaml.yaml_emitter_state_t*map.group[string]*yaml.Node*map[string]template.element*map[reflect.Type]gob.typeId*netlink.BondPrimaryReselect*map[netlink.BondMode]string*protoreflect.EnumDescriptor*protoreflect.FileDescriptor*func(pragma.DoNotImplement)*protoreflect.SourceLocationappendServiceDescriptorProto*func(int) protoreflect.Name*func(protowire.Number) bool*func() congestion.ByteCount*[]congestion.LostPacketInfocongestionWindowGainConstantcwndToCalculateMinPacingRate*func() protocol.KeyPhaseBit*wire.StreamDataBlockedFrame*[]wire.transportParameterID*congestion.RTTStatsProvider*func(protocol.PacketNumber)queueFramesForRetransmission*handshake.ShortHeaderOpener*handshake.ShortHeaderSealer*handshake.TokenProtectorKey*qlog.ConnectionCloseTrigger*qlog.VersionNegotiationSent*qlog.CongestionStateUpdatedgolang.org/x/net/http2/hpackgolang.org/x/oauth2/internal*internal.LazyAuthStyleCache*retryablehttp.LeveledLoggerEncapsulateDeterministically*map[reflect.Type]*gob.encOp*filedesc.PlaceholderMessageestimatedTCPcongestionWindow*func() congestion.Bandwidth*cmd.serverConfigOutboundHTTP*cmd.clientConfigTransportUDP*cmd.clientConfigQUICSockopts*cmd.serverConfigTrafficStats*tls.newSessionTicketMsgTLS13*func() *elliptic.CurveParams*x509.CertificateInvalidError*x509.pkcs1AdditionalRSAPrime*[]pkix.AttributeTypeAndValue*interface { Is(error) bool }*interface { Unwrap() error }*func(string) (string, error)*func(string, int, int) error*struct { F uintptr; X0 int }*[]runtime.sizeClassScanStats*[][8]runtime.pcvalueCacheEnt*struct { key int; elem int }*map.group[uint32][]*abi.Type*strings.singleStringReplacer*syscall.RawSockaddrLinklayer*syscall.SocketControlMessage*map.group[string]viper.Codec*viper.UnsupportedConfigError*func(context.Context, error)*interface { Timeout() bool }*utils.LocalCertificateLoader*[0]*quic.pathManagerOutgoing*map.group[string]*json.field*func() http.http2FrameHeaderMaxReceiveBufferPerConnection*map[uint32]*http.http2stream*[]http.http2unstartedHandlerstartGracefulShutdownInternal*map[string]*http.routingNode*http.http2transportTestHooks*http.http2erringRoundTripper*http.unencryptedHTTP2Request*map[http.http2ErrCode]string*map[http.http2SettingID]bool*map[string]http.RoundTripper*func(*httputil.ProxyRequest)*map[string]*certmagic.Config*[]certmagic.dnsPresentMemory*map[string]certmagic.KeyInfo*map[string]certmagic.Storage ModifiedOnjson:"modified_on"*map[string]cloudflare.cfZone TotalCountjson:"total_count"*map[string]gandi.gandiDomain DomainHrefjson:"domain_href"*func([]uint8, *string) error*outbounds.DirectOutboundMode*func(crypto.PrivateKey) boolcrypto/internal/fips140/ecdsa*func(*ecdsa.PrivateKey) boolcrypto/internal/fips140/mlkemcrypto/internal/fips140/tls13*map[*reflect.structType]bool*map.group[reflect.visit]bool*[]chan<- singleflight.Result*func() (interface {}, error)*func(string) (uint16, error)*func(string) (uint32, error)*func(string) (uint64, error)*func(uintptr, []uint8) error*mapstructure.strconvNumError*func() protoreflect.EnumTypeisDomain_Attribute_TypedValueAllowConnectionWindowIncrease*func() quic.connCapabilities*func(*wire.StopSendingFrame)isRemoteCancellationEffectivehandlePathResponseFrameClienthandlePathResponseFrameServer*func() protocol.ConnectionIDundecryptablePacketsToProcess*quic.StreamLimitReachedError*map[string]map[string]string*func(httptrace.DNSStartInfo)SetAllowedMaxDynamicTableSizeRevokedasn1:"tag:1,optional"Unknownasn1:"tag:2,optional" ThisUpdateasn1:"generalized" ProducedAtasn1:"generalized" Replacementdns:"domain-name"*map.group[string]dns.Handler*map.group[dns.SVCBKey]string*map.group[string]dns.SVCBKeyCursorurl:"cursor,omitempty"Regionurl:"region,omitempty" DeployNamejson:"deploy_name"VPCIDjson:"vpc_id,omitempty"AppIDjson:"app_id,omitempty" MacAddressjson:"mac_address" InstanceIDjson:"instance_id"*govultr.ContainerRegistryReq DataCenterjson:"data_center"*govultr.DockerCredentialsOpt VanityNamejson:"vanity_name" TrustedIPsjson:"trusted_ips"Engineurl:"engine,omitempty"*govultr.FirewallGroupService SubnetSizejson:"subnet_size"ISOIDjson:"iso_id,omitempty" InternalIPjson:"internal_ip" AutoScalerjson:"auto_scaler" KubeConfigjson:"kube_config"*govultr.ObjectStorageService S3Hostnamejson:"s3_hostname"*govultr.ObjectStorageCluster CPUThreadsjson:"cpu_threads"*govultr.ReservedIPConvertReq*govultr.StartupScriptService APIEnabledjson:"api_enabled" MACAddressjson:"mac_address" NodeStatusjson:"node_status"*govultr.BackupServiceHandler*govultr.DomainServiceHandler*govultr.RegionServiceHandler*govultr.SSHKeyServiceHandler ReservedIPjson:"reserved_ip"*quicvarint.varintLengthError*tls.HPKESymmetricCipherSuite*map.group[*syntax.Regexp]int*map[netlink.IPoIBMode]string*map[string]netlink.IPoIBModesyscallVectorisedWriterFields*func(protoreflect.Name) bool*func() protoreflect.FullName*protoreflect.FieldDescriptor*protoreflect.EnumDescriptors*protoreflect.SourceLocationsappendSourceCodeInfo_Location*protoreflect.OneofDescriptor*func(protoreflect.RawFields)*func(int) protoreflect.Value*[]congestion.AckedPacketInfoexpireAckAggregationInStartup*protocol.StatelessResetToken*qerr.VersionNegotiationError*func() protocol.PacketNumber*wire.RetireConnectionIDFramereadNumericTransportParameterInitialMaxStreamDataBidiLocal*congestion.CongestionControl*ackhandler.SentPacketHandler*ackhandler.sentPacketHandler*ackhandler.packetNumberSpace*ackhandler.sentPacketHistory*ackhandler.lostPacketTracker*handshake.aesHeaderProtector*retryablehttp.RequestLogHook*func() asn1.ObjectIdentifier*map.group[string]sign.Scheme*go.shape.map[string][2]int32*map.group[*gob.typeInfo]bool*map[reflect.Type]gob.gobType*map.group[string]token.Token*[][2]protoreflect.EnumNumber*impl.extensionTypeDescriptor*func(net.Addr, string, error)*cmd.serverConfigOutboundEntryTimeoutmapstructure:"timeout"Addressmapstructure:"address"AltPortmapstructure:"altPort"Domainsmapstructure:"domains"Commandmapstructure:"command"*cmd.serverConfigResolverHTTPSGeoSitemapstructure:"geosite"Contentmapstructure:"content"Headersmapstructure:"headers" EABHMACKeyjson:"eab_hmac_key"*map.group[string]func() error*[]tls.EncryptedClientHelloKeyEncryptedClientHelloConfigList*func(*big.Int, *big.Int) bool*func(uint16) tls.keyAgreement*map[interface {}]interface {}*x509.ConstraintViolationErrorUniqueIdasn1:"optional,tag:1"FullNameasn1:"optional,tag:0"*[2][8]runtime.pcvalueCacheEnt*runtime.synctestDeadlockError*map.group[string]interface {}*map[string]runtime.metricData*struct { F uintptr; X0 bool }*func(string, ...string) error*func(string, ...interface {})enforceFlagGroupsForCompletion*viper.ConfigFileNotFoundError*map.group[string]*v2geo.GeoIPInitialConnectionReceiveWindow*zapcore.PrimitiveArrayEncoder*map[zapcore.Level]color.Color*context.deadlineExceededError*http.http2responseWriterState*http.http2serverInternalState*func() (io.ReadCloser, error)onceSetNextProtoDefaults_Serve*[]http.http2FrameWriteRequest*map[http.connectMethodKey]int*func(*http.http2clientStream)*http.tlsHandshakeTimeoutError*func(*url.URL) []*http.Cookie*httputil.switchProtocolCopier*certmagic.CertificateSelector*certmagic.CertificateResourcedistributedHTTPChallengeSolver*certmagic.decodedCertResource*map.group[string]acmez.SolverWeightjson:"weight,omitempty"Targetjson:"target,omitempty"Sourcejson:"source,omitempty"Lockedjson:"locked,omitempty" Permissionsjson:"permissions"Resultjson:"result,omitempty"Errorsjson:"errors,omitempty" Descriptionjson:"description"Answerjson:"answer,omitempty"Serverjson:"server,omitempty"Statusjson:"status,omitempty"Detailjson:"detail,omitempty" Identifiersjson:"identifiers" Certificatejson:"certificate"*trafficlogger.dumpStreamEntrycrypto/internal/fips140/sha256ClientApplicationTrafficSecretServerApplicationTrafficSecret*pkix.AttributeTypeAndValueSET*[1]pkix.AttributeTypeAndValue*func(int) reflect.StructField*map[dnsmessage.section]string*map[string]*singleflight.call*[1]chan<- singleflight.Result*func(string) (float64, error)*func(string) (float32, error)*func(*regexp.Regexp, int) int*ranges.Range[go.shape.uint32]*func(qerr.TransportErrorCode)*func(*quic.Conn, uint64) bool*func([]uint8, net.Addr) error*quic.streamControlFrameGetterpopNewStreamFrameWithoutBufferhandleUnpackedLongHeaderPackethandleVersionNegotiationPackettryQueueingUndecryptablePacket**qerr.VersionNegotiationError*func(protocol.ByteCount) boolrejectWithHeaderFieldsTooLargego.uber.org/zap/internal/color GatewayHostdns:"amtrelayhost"Saltdns:"size-hex:SaltLength" PreviousNamedns:"domain-name"*func() (*oauth2.Token, error)Expiryjson:"expiry,omitempty"*govultr.AccountServiceHandlerMainIPurl:"main_ip,omitempty"Regionjson:"region,omitempty" DateModifiedjson:"updated_at"*govultr.ContainerRegistryUser*govultr.ContainerRegistryRepo*govultr.ContainerRegistryPlanPublicjson:"public,omitempty"*govultr.DatabaseAddReplicaReqDBNamejson:"dbname,omitempty"*govultr.DatabaseUserCreateReqMethodjson:"method,omitempty" Credentialsjson:"credentials"*govultr.DatabaseListAlertsReq*govultr.DatabaseUserUpdateReqDomainjson:"domain,omitempty"MD5Sumjson:"md5sum,omitempty"Labelsjson:"labels,omitempty"Scriptjson:"script,omitempty"*govultr.BillingServiceHandler*govultr.NetworkServiceHandlerRecordjson:"record,omitempty"crypto/internal/fips140/nisteccrypto/internal/fips140/bigmodcrypto/internal/fips140/sha512handleArrayTableCollectionLast*yaml.yaml_version_directive_t*transform.SpanningTransformer*map[string]netlink.TuntapMode*bufio.SyscallVectorisedWriter*protoreflect.MethodDescriptorappendEnumValueDescriptorProto*func(int) [2]protowire.Number*protoreflect.FieldDescriptors*protoreflect.OneofDescriptors*func() protoreflect.RawFields*func(protoreflect.Value) bool*func(int, protoreflect.Value)*map[int32]impl.ExtensionFieldIsOverestimateAvoidanceEnabledInitialMaxStreamDataBidiRemotecheckSequentialPacketNumberUsepeerCompletedAddressValidation*map[string]internal.AuthStyle*retryablehttp.ResponseLogHookgolang.org/x/crypto/cryptobytegithub.com/sagernet/netlink/nl*[]protoreflect.FileDescriptor*[]protoreflect.SourceLocation*filedesc.PlaceholderEnumValue*func(net.Addr, string, uint64)*func(net.Addr, string, string)*cmd.serverConfigOutboundDirect*cmd.serverConfigOutboundSOCKS5*cmd.clientConfigObfsSalamander*func() (*client.Config, error)*cmd.serverConfigObfsSalamander*cmd.serverConfigMasqueradeFile*[]*utils.localCertificateCache*map.group[string]zapcore.Level*tls.certificateRequestMsgTLS13*atomic.Pointer[runtime._defer]*func(tls.SignatureScheme) bool*func([]uint8) ([]uint8, error) CRLIssuerasn1:"optional,tag:2"*[]x509.pkcs1AdditionalRSAPrime*map[*x509.policyGraphNode]bool*[][]pkix.AttributeTypeAndValue*interface { Unwrap() []error }*func(io.Writer) (int64, error)*func(io.Reader) (int64, error)*func(func(uintptr) bool) error*map[net.hostLookupOrder]string*map[netip.addrDetail]struct {}*[68]runtime.sizeClassScanStats*runtime.metricFloat64Histogram*func(uintptr) (uintptr, int64)*map.group[int32]unsafe.Pointer*[]struct { key int; elem int }*map.group[unsafe.Pointer]int32*func(*cobra.Command, []string)GenPowerShellCompletionWithDesc*[]*viper.defaultRemoteProvider*func() map[string]interface {}searchIndexableWithPathPrefixes*func([]slog.Attr) slog.HandlerLeveljson:"level" yaml:"level"*func() (net.PacketConn, error)*func(*list.Element[func(int)])*interface { Temporary() bool }*func(string) (net.Conn, error)*client.reconnectableClientImpl*map.group[zapcore.Level]string*map[context.canceler]struct {}*func(*json.scanner, uint8) int*func(net.Conn, http.ConnState)*map.group[*http.conn]struct {}*chan http.http2readFrameResultprocessSettingInitialWindowSize*map.group[string]http.muxEntry*http.http2noDialH2RoundTripper*http.http2noDialClientConnPool*map[string]*http.http2dialCall*http.http2unencryptedTransport*http.http2headerFieldNameError*map[http.http2SettingID]string*func(*url.URL, []*http.Cookie)*struct { F uintptr; X0 error }*certmagic.StandardKeyGeneratormakeCertificateFromDiskWithOCSPmanagedCertInStorageExpiresSoon*map[string]certmagic.ChallengeKeyTagjson:"key_tag,omitempty"ZoneIDjson:"zone_id,omitempty" ActivatedOnjson:"activated_on" PlanPendingjson:"plan_pending" NameServersjson:"name_servers"*outbounds.errHTTPRequestFailed*func(*ed25519.PrivateKey) boolcrypto/internal/fips140/ed25519crypto/internal/fips140/aes/gcm*func([]uint8) cipher.BlockMode*map[string]*unicode.RangeTable*pflag.notExistErrorMessageType*func(netip.Addr) (string, int)*func() protoreflect.EnumNumbertotalBytesSentAtLastAckedPacket*func(string) *quic.ClientTokenhandleUnpackedShortHeaderPacketregisterPackedShortHeaderPacketenqueueVersionNegotiationPacket*quic.receiveStreamFrameHandler*map[quic.pathID]quic.newConnID*func([]uint8, *uint8, []uint8)*map[hpack.pairNameValue]uint64*internal.FlushAfterChunkWriter*func([]uint8, *dns.TSIG) error*map.group[uint16]func() dns.RR AccessTokenjson:"access_token" DateCreatedjson:"date_created"*govultr.BareMetalServerServiceSizeGBjson:"size_gb,omitempty"*govultr.ContainerRegistryPlans*govultr.DatabaseConnectionPool MonthlyCostjson:"monthly_cost" MessageTypejson:"message_type"DNSSecjson:"dns_sec,omitempty" PowerStatusjson:"power_status" DateUpdatedjson:"date_updated"IPTypejson:"ip_type,omitempty"*govultr.MarketplaceAppVariable*[]govultr.ObjectStorageClusterSSHKeyjson:"ssh_key,omitempty"APIKeyjson:"api_key,omitempty"*govultr.DatabaseServiceHandler*govultr.InstanceServiceHandler*govultr.SnapshotServiceHandler*[]tls.HPKESymmetricCipherSuite*map.group[*syntax.Regexp]int64github.com/pelletier/go-toml/v2*map[string]yaml.resolveMapItem*func(*norm.reorderBuffer) bool*func(netlink.Destination) bool*map.group[int]*nl.SocketHandlegithub.com/sagernet/sing/common*func(protoreflect.MapKey) bool*protoreflect.MessageDescriptor*func() protoreflect.Descriptor*protoreflect.ServiceDescriptor*protoreflect.MethodDescriptors*func() protoreflect.EnumRangeslastSentPacketNumberBeforeEpochOriginalDestinationConnectionID*congestion.CongestionControlEx*flowcontrol.baseFlowControllergithub.com/apernet/quic-go/qloggithub.com/davecgh/go-spew/spew*func(io.Reader, []uint8) errorgolang.org/x/net/dns/dnsmessagegithub.com/cloudflare/circl/pkigithub.com/cloudflare/circl/kem*map[reflect.Kind]gob.encHelper*map[reflect.Type]*gob.typeInfo*[]protoreflect.FieldDescriptor*map[protowire.Number]struct {}*map.group[filedesc.pathKey]int*func(protoreflect.Value) errorCongestionWindowAfterPacketLoss *func(net.Addr, net.Addr, error)BindIPv4mapstructure:"bindIPv4"BindIPv6mapstructure:"bindIPv6"FastOpenmapstructure:"fastOpen"Usernamemapstructure:"username"Passwordmapstructure:"password"Insecuremapstructure:"insecure"Sockoptsmapstructure:"sockopts"SNIGuardmapstructure:"sniGuard"ClientCAmapstructure:"clientCA"UserPassmapstructure:"userpass"TCPPortsmapstructure:"tcpPorts"UDPPortsmapstructure:"udpPorts" *[]cmd.serverConfigOutboundEntry *cmd.serverConfigMasqueradeProxyResolvermapstructure:"resolver" *[0]*utils.localCertificateCache *chan cmd.clientModeRunnerResult *struct { key string; elem int } *struct { F uintptr; X0 string } *func(tls.ConnectionState) error *func([]uint8, []uint8) tls.aead supportedSignatureAlgorithmsCert *map[uint16]func() *hpke.hkdfKDF *func([]*x509.Certificate) error *x509.UnhandledCriticalExtension SaltLengthasn1:"explicit,tag:2" *[]pkix.AttributeTypeAndValueSET *struct { F uintptr; X0 *error } *func() (syscall.RawConn, error) *func(interface {}) interface {} *struct { key int; elem string } *map.group[string]map[string]int *func(int64, int) (int64, error) *func(string, fs.FileMode) error *map.group[abi.TypeOff]*abi.Type *runtime.traceSchedResourceState *[8]struct { key int; elem int } *map[runtime._typePair]struct {} *func(zapcore.Core) zapcore.Core *struct { F uintptr; X0 uint32 } *map.group[string]*v2geo.GeoSite *func() ([]uint8, string, error) *func(*wire.StreamsBlockedFrame) *func() http.http2WriteScheduler *chan http.http2frameWriteResult *http.http2transportResponseBody *func(string) (http.File, error) *http.http2headerFieldValueError *http.http2headersOrContinuation *struct { io.Reader; io.Closer } *map.group[http.ConnState]string *map.group[string][]*http.Cookie github.com/caddyserver/certmagic CacheUnmanagedCertificatePEMFile storageHasCertResourcesAnyIssuerCreatedjson:"created,omitempty"Updatedjson:"updated,omitempty" *[]certmagic.decodedCertResource *certmagic.RingBufferRateLimiter *map.group[string]chan struct {} *map[string]certmagic.ocspUpdateServicejson:"service,omitempty"Contentjson:"content,omitempty"Proxiedjson:"proxied,omitempty"Messagejson:"message,omitempty"Detailsjson:"details,omitempty"Tokenjson:"api_token,omitempty"Websitejson:"website,omitempty"Expiresjson:"expires,omitempty"Contactjson:"contact,omitempty" *map[string]acme.cachedDirectory *masq.altSvcHijackResponseWriter *outbounds.directOutboundUDPConn *trafficlogger.trafficStatsEntry *[]trafficlogger.dumpStreamEntry *func([]int) reflect.StructField *struct { F uintptr; X0 []int8 } *nettrace.LookupIPAltResolverKey *func([]uint8, int) (int, error) *chacha8rand.errUnmarshalChaCha8 *mapstructure.DecodeHookFuncKind *mapstructure.DecodeHookFuncType *socks5.UserPassNegotiationReply *map.group[netip.AddrPort]uint16 *func() ([]uint8, func(), error) *v2geo.Domain_Attribute_IntValue *func(string, *quic.ClientToken) EnableStreamResetPartialDelivery *func(net.Addr, quic.packetInfo) DisableVersionNegotiationPackets popNewOrRetransmittedStreamFrame *chan quic.errCloseForRecreating github.com/apernet/quic-go/http3 *httptrace.clientEventContextKeyPerPageurl:"per_page,omitempty"Netmaskjson:"netmask,omitempty"Gatewayjson:"gateway,omitempty"Reversejson:"reverse,omitempty"Networkjson:"network,omitempty" *govultr.ContainerRegistryRegion Subscriptionjson:"subscription" *[]govultr.ContainerRegistryRepo *govultr.DatabaseAdvancedOptionsVersionjson:"version,omitempty"Backupsjson:"backups,omitempty"Enabledjson:"enabled,omitempty"SSLInfojson:"has_ssl,omitempty" S3AccessKeyjson:"s3_access_key" S3SecretKeyjson:"s3_secret_key" SupportedSignatureAlgorithmsCert *map.group[string]yaml.fieldInfo *map[netlink.BondAdSelect]string *map[netlink.BondLacpRate]string *map[netlink.VlanProtocol]string *map[string]netlink.BondAdSelect *map[string]netlink.BondLacpRate *map[string]netlink.VlanProtocol google.golang.org/protobuf/proto *func() protoreflect.Cardinality *func() protoreflect.FileImports *protoreflect.MessageDescriptors *protoreflect.ServiceDescriptors *func() protoreflect.FieldRanges *func() protoreflect.MessageType *func(int) protoreflect.EnumType *bbr.connectionStateOnSentPacket AckAggregationBandwidthThreshold ackAggregationBandwidthThreshold totalBytesAckedAfterLastAckEvent *func(congestion.ByteCount) bool *handshake.chachaHeaderProtector *handshake.quicVersionContextKey *qlog.VersionNegotiationReceived golang.org/x/net/internal/socket *map[string]qpack.indexAndValues *func() *internal.AuthStyleCache *func(string, *url.Values) error github.com/database64128/netx-go *func() netx.IPStackCapabilities github.com/cloudflare/circl/sign AuthEncapsulateDeterministically github.com/cloudflare/circl/hpke *protoregistry.packageDescriptor *map.group[protoreflect.Name]int!*cmd.serverConfigMasqueradeString!*map[string]zapcore.EncoderConfig!testingOnlyPeerSignatureAlgorithm!initLegacySessionTicketKeyRLocked!*tls.CertificateVerificationError!*struct { key uint16; elem bool }!*struct { key uint64; elem bool }!*struct { F uintptr; X0 []uint8 }!*func(*x509.policyGraphNode) bool!*map[string]*x509.policyGraphNode!*struct { key string; elem bool }!*map.group[string][]net.nssSource!*map.group[*abi.Type]interface {}!*func(int) ([]fs.DirEntry, error)!*func(int) ([]fs.FileInfo, error)!*runtime.gcBgMarkWorkerNodePadded!MarkZshCompPositionalArgumentFile!*map.group[string]map[string]bool!*func(afero.Fs) ([]string, error)!*map.group[string]viper.FlagValue!*func(zapcore.ArrayEncoder) error!*func(*url.URL) (zap.Sink, error)!*map[string]*proxymux.muxListener!*func() (client.HyUDPConn, error)!*map.group[uint32]*client.udpConn!*func(string, interface {}) error!*func(time.Duration) *time.Ticker!*map.group[interface {}]struct {}!*func(json.field, json.field) int!*http.http2synctestGroupInterface!*chan http.http2FrameWriteRequest!*http.unencryptedNetConnInTLSConn!*map[uint32]*http.http2writeQueue!*interface { CloseWrite() error }!*interface { FlushError() error }!*map.group[http.http2Flags]string!*map[string]certmagic.Certificate!CacheUnmanagedCertificatePEMBytes!*map[string]*certmagic.solverInfo IsSubscribedjson:"is_subscribed" CanSubscribejson:"can_subscribe"!*outbounds.errSOCKS5RequestFailed!*trafficlogger.TrafficStatsServer!*struct { F uintptr; X0 *uint64 }!*func(reflect.Value) interface {}!*struct { F uintptr; X0 []int16 }!*struct { F uintptr; X0 []int32 }!*struct { F uintptr; X0 []int64 }!*map.group[dnsmessage.Type]string!github.com/sagikazarmark/locafero!*func(string) (afero.File, error)!*mapstructure.DecodeHookFuncValue!*func(*flag.Flag, *flag.Flag) int!*map[tun.flowKey][]tun.tcpGROItem!setSearchDomainForSystemdResolved!*map.group[uint16]*tun.TCPSession!*struct { key uint8; elem uint8 }!*v2geo.Domain_Attribute_BoolValue!maybeSendVersionNegotiationPacket!*map[uint64]protocol.ConnectionID!*func() handshake.ConnectionState!*func(tls.ConnectionState, error)!*func(httptrace.WroteRequestInfo)RevocationTimeasn1:"generalized" OtherDatadns:"size-hex:OtherLen"ImageIDjson:"image_id,omitempty"!*govultr.ContainerRegistryService!*govultr.ContainerRegistryStorage MonthlyPricejson:"monthly_price" PlanReplicasjson:"plan_replicas" LatestBackupjson:"latest_backup"!*[]govultr.DatabaseConnectionPool!*govultr.DatabaseBackupRestoreReq DateModifiedjson:"date_modified" ServerStatusjson:"server_status" NodeQuantityjson:"node_quantity"!*[]govultr.MarketplaceAppVariableGPUTypejson:"gpu_type,omitempty" PrefixLengthjson:"prefix_length"!*govultr.ReservedIPServiceHandler FirewallRulejson:"firewall_rule" LoadBalancerjson:"load_balancer"!*struct { in string; out string }!*ecdsa.plainPersonalizationString!*func([]uint8, bool) (int, error)!*bufio.NetVectorisedWriterWrapper!*func() protoreflect.ProtoMessage!appendFieldOptions_EditionDefault!appendFieldOptions_FeatureSupport!*protoreflect.EnumValueDescriptor!*func() protoreflect.FieldNumbers!enableAckAggregationDuringStartup!*ackhandler.packetNumberGenerator!*func(ackhandler.lostPacket) bool!*ackhandler.ReceivedPacketHandler!*ackhandler.receivedPacketTracker!*ackhandler.receivedPacketHistory!*flowcontrol.StreamFlowController!*flowcontrol.streamFlowController RefreshTokenjson:"refresh_token"!*func(map[gob.typeId]bool) string!*protoregistry.extensionsByNumber!*interface { EnforceUTF8() bool }!*map.group[string]*filedesc.Field!*map.group[filedesc.pathKey][]intN{6h?U 1 j.6hg0r6hg dmH6hA`~ez 96h~N6hɦw_)6h 6h_6hg6h8Jc6h_h6hA K6hGr6h@ISi$6hv 'F6hi'6h8`v^6h8WQ6hx6h9B1{,6h_PG6hh d6h+9 (e/6hjZD6h96h`KK6h`@R~y6h`_l/~6h+6h Z,6h5` 26hn6h2M96hM,R6hk,@̃͝6h,(6hU )`g{O6hw 3)X6hA93kS6hB_!6h `9ك6h&h@6hz)Z.6hK8jM6h  6hB n6hB 4P6h!A6hB#6h-k9|6h@PW6h-JL66hB .6h}˦06h`n6hܖJn6hm+6hC 36hQ*6hC`ª_NH6h`a@u6hwa 5 36h@i6hal<6h^U76h@n{S6hFb +޹6h;l]6h`$8 6hPa6h" a6hؗ+,6hAG'6h9DB^6h,M6hZѭ6hYD.u6hUڟ 6hCc@1Xt6h"6htm^]6h76h<6hR'~6h; "w 6hyD`5f6h ĵ6hU,@X6h6sX6h r[6h WP6hy -f*%6hB6hqc êRg6h< z6h nse6hԘ6Cd6h-<x*ld6hc-Ʈ6hc;l6h .gdFe6hwoo6h Cq6hD`Q6hm63D6h F6hn؟6h/.6$6h< / y6he _x;6h/n 6h;$6hӤ';6hi0RZ6h^6hmw6h $6hyEly6h)'6hЬ6h\`;6h@pZrJ6h@躿6hjNP6h16hH|)6h#@J 6h1 <6h1cw6hH=!6h1@u6hH++6h1x6hHgE6hb@#6h##ip6hbM.6h;r.6hB@86hb]r6hb)6h*#S6h?o@;p6hݞH6haoecy6hIF$m6hTf6h*Wc6h/Q6h@6h I6hx~6hd L]6h??K6hڟ&o16h:26hyFS6hF6hd3A6ho ۟16h= 4* 6hF?86h:'eWh N4H6h 26hG`ս6h` t;6hyTj6hӷ6h| 4q6h`pwWh  5ȈR6hޚ`D`6h S6h;rr6h!nԩ6h@q6h>9:6h5(6h5#Wi6hX*\I6h`(s R6hke@% Ҡ6h 6u6h(6h :x 6heT6hX`*W6h8å :s6hxj tn6h@v06h+`A6hrE6h`u6h7%$6h@ 6h6hk6hl;젃6h\8#Q6h/ť A16h\M`6hm6hqQ6hr6hT!j6hgWgv6h 9q6h Dl;6hC'U6h6 :)6hQ<1A6hfƠWO6hz =ܱ6hl@Ci6h=q߃A6h+D\6h:f ʥOf6h_q@k 6hpqW! 6hq٫6hq` E6h?Hr6h9 ;?ʶ 6h}<6h 06hʥ7f6hq;0Lo6hQf`*IY6h:g6h r`46ht6h< F6hl6hf@y 6hps6h26hII 6h/s6hYI`hY6hr-56hy 7&6h$6h)q6h`OKZ6h  ΥҲ6hrH6h@s 9*6hp6hAХ sg6hs0)d6ht@qKAn6ht䂻6h׊`t̯96hq6hg =;6h/ ԥdWة6h+#-6hJ06h&46h Y,6h9 @kW6hiqa6h{`믋'6hZ_c6hh 6h tҫj6hb ub6h>mP6hAu{Ym6h!@Ц٥6hiK`*`6hM 6h66h׬B?"56hbhϫ9ґ6h@|b6h~6hd6h`v6h T6h@&F.}6hY` װc6h'ګ6hhO6hKucO6hW6hp@^ 6h`r"6h@ve6hF"6hAy8 6hsBW46h0K6h9u`>[6hVRj6hi,s76h"s3U6h1`xD6h@!6hK C6h;to6hY ۥy!q6h -p6hu6hי6h)Lvhu6h9L@yF6h6h16h`V6hIL`w\6huwc`6hR6hYL x7C6hiLlf6hux/6hyL mL!6hL`og6h@Ѧh{ 6h0Qh6hy-6hm sWL6hx#6h D`76hj +Z6hiN@V_6h`ݟX 6hB$m6hj#q6hN}c6hGAO6h+{ɠ6hD_6h  6hHU6ht @J6h6hEx166h`yV6hҦkv6hm&௤A*6h@|nl6h&LPG6hyO N/^6hkP/6hyࢡ?6hO@A~CR6h<J6hEH=B6hW`6h ь6h6h |׋6h<$&6ho 46hXॡY6hl"6hy|V6h@f6hE}i6h K6hGT6h/Bv[6h6h`}6h2}406hk iC6hS'6hZ`RL6h%m06hHG W6ha0w$6hm H6Vc6hm#D&6hQEE6h6@]6hK iI6hmP6hj6hn06hH'P6h} z݄6h{26hאI$[6h IT6h  J C6hJEeM6h1 K_6hE{6hu`aD6hG6h' G6h൤Q6hz`0"6hJ9n+6h`ȪIgu>6hF6h 2!M6h=g/6hdo`28O6hզK6h(-6ho 6h{L2у6h( ' 6hWM/(6h0c6h _:6hC0vv46hB`6hD{'6h6dj-6hTNT6hQਡ,a6h=)¤ p6hmv̭M6hh6 6h@uG6h%Bk6h{3" 6h{`Z\'6hiOF6hH 4r;6hR%@6hQĤ־<6h{ 5o>6h36h!4f 6h4ݟ16hHƤrQD6hH $,6h!|ǤbG6h@w"6h)6h*@K6h,(?6h>B*rE6hyR PJ06hpɪ36h T6hϴWl6hN@w,6h? n6h| S6hRȤW5&6hɤՅ&6hbBJ6h`ɤ 6h]ɤc-?6h|Vt6hwT6hw?66h|xǡ6h*@Ŭ6fc6hn6hId6h U<<6h=ʤ^/6hQʤ*"6hT" HM6hJpU;k6h3p6hI ZuY6hR?M)6h j>6h(O6h~" ml6h ѩ6h`̤k6h 6o YU6he`606hS} V_6h"6hDŽ6h ͤ6h[6h QG76hJ`H36h@ v<76h@q6h0?6h6h~WG-\6h =1 6hͤvm6hX$r%6h,@0Έ6h;h o 7lh S 6h 66hVc6h `P6hPVǺ6hiVmd%6hqzՓ6h7 ^6hGW 6hP! 6hJմ6h@ݤr&6ha436h/n6h@צI6hIWݤE6hޤx6hYW .6h.:$6ha5k6hr ;86h3%@M`6h-f96h<஡E6hu`b6hM a6hc0Y?gh6h6xa6hWtD6h@Y6hOr`:S6h]%$} k6hncE6h@4e6h`{G6h)X 6h i6hצj6h%06h){6h?_ 96hn6hs v6h9o6hsM:C66hq,c66hA8`6hł <yyp6h =2ڀ6hON6h{N~^6h`yb6h1ŧ6hYAN6h-`6hQ(@ئ,856hV6hM@U6hN`{)06h. 6hqt46hO`J^6he Ʉh6ht7*6h '6hѩV6h0>1?A6hmO@$X'|6hu>CW6hOM,6hC 6h)B6hh1H6hg6h* GWa6hE /6h9[ {6hౡx6h!@6hvI]6he[W6h ]-6h`;ɮ6h f6h u6h Jc 56h!6h^*ޟʺ6hfP6hP`T6h``6hP4z6h_4*[6h* i(I6h^6h}Q36h h!6hCE}6hVa*6h:Lƀ@U6h4@[6hC6h+ $!6hX ҳB6hCt"-U2n6h6h@٦(6hr߫6hϛW6h @g6h?26h`@dl6h o {6h1Xw`6hD0@6h[ a6h6eDU6h6ob6hW Y~6hY 6hs%6h|U6h f꬝6h &6hYRa(6h:Y6h# 1)6h# p†6hx`Ϊ+$6h$6h:$,Β6hQ h6h@Mp 6ht6hMf%6ha'>6h6hQ6hD;@6hN4E6hܟ@6h /j6h~Mr=H6ha@@Gg6h q2:q6ha Zr|6hs@e6h%`u6htz6hƬ@M6haL+6h]: (! 6hR [6hjsd6h īv6h g3~6h6h@ 6hb ٓ6h7 j06h# soa6h6h, 701.6h+ `#6hsUe6hb @z6h"% tA6hg PƲ6h^~F6h _c6h= ǡC6hk;@ڦw 6h hƚ6hFy`)L6hMڦ0?6h@!e`^6h`,t6h;|6h0n6htyϪA6hG6hG +r*6h A\~-6hAG@6hE*.P 6hU!6hY `6h^_l#6hy"N6hR-Qf6h t"d6h h7$D6h|-@ۦ6h`"dz6hu e&6h} uB(h6h %6hSbv6h-*m.6h(`X 6hN6uJq6h@Y_6h-"R6h; #5D6h#Qzg6h @+D6h #c E6h;`ҩs6hS@X6h@$*6hhMt6h  `*v6h¼ v|+6h`RH^c6hS+%tts6hy`]6h%E>6h#t`T6hۦlq6h-vd6h@,K6hN@6h a(_O6h`gTE6hN w`6hGӦ6hST6h6mNs6hі6h'@96hs$Ѥ6h iV6h 6h0O =6h.ऩ#"r6hWi-S6h<% w6h@ܦS6hiTx6hrD\6h s6hoܦ6h@న6h'wm@6hOO@ݦ6haə6h -߳6hTݦG6hd j[6h6-6h9.@ަEEg6hI x@96h `.6hT ]6h=<`%n;,6hvj$V\6h6/)6h/#5 6h ߟ{6hT0E16hc.1Z6h`1.Ÿ6h1Ix6hy 2&6hx.2Վy6h2t6h#@36h3e{6hy4K_?h6h`476h|4'6hU 5L=6h?56h?5(D6hz@66h.6py6h[7|J6h`76h7m6h 8F6h賂6h,z` 6hE !Ea6hY `%Op6h^ya6hm k Bu6hP :wL6h-J6h8j(G^6hŲ6h1f6hz7@ɜ#6hi>y6hܖTc6h}ަ$Y{6h@}@6hFb zR56hk 56h 0O>6h<6h_@|8m6h* +6hE  cvk6h< h 6hI_=`Ğ6h=aT6hF#6h/*@6hi_෡6h' i~6hz;6h.8L6h/j*@6hU'6hV_y6hL8@6hO76h I6hD%6h5  Yd6hY`@6h Dm6hlc6hz6h^"6hω2YrJ6h`H%6h;t!6h7V@̕6h n '6hr(6h@zEv6hZB;6h&,t86hz9޵6h?d 6h?6h @[D6h L/26h9L6h  Ҫ`6hk|^6h oʊ6h੩6hןFE6h.{6h@9}6h{ XK6hp0`6h;?6h9 @46hyVv6h }귯6hV;(\6h7a^6h_d6h96ha 6h ž6h@žǤ6h:žeH6h>o6h /j6hW@ߦ76h)aߦK6hh>a6h:@6h3`ѓJ6h8ot6h >Ui6h d6h ."6hl1ÞBb6h)W@Þ P6h1ÞIZ6h1Þe6h1q.6h ߡ6he n'6hWມ 6hڶ@66hIb26h6h\06h9ĞT6h 6hP@5r}6h&|ު46h^Qk_6h3v` L6h}Q6h=`ex6hSh6hS5ui6h>%6h`~VY:6h@6h~$d6h=~a6huvө6hv⡪6hdd6hQ@`6hY>Xκ6hS2@6h2NY6hXs`6hvөC6h`8wy6he@"q6h?eU6hQ}U:6h tf6h'O6h @k6h;ڪ6ho8N6h 6h c@Ğ6hĞ>'6h;`) 76hʼn 77\6h- 6_6h}2ĞNTh6h1X{/6hOŞ6h|@Ş16hC6hT vü<6hŞ 6hOYŞ06hZƞy6hy3@ƞrc6huR d6h?;[6hw fgBh6hB,6h q6h@:p%6h S6hYȞ6hNS6hߘi 6hS<Ì6h5;6h }d6hZ;6hRW6hPc> -6hX @U֦6h"<6hg&6h( XN6h()B6h?36h@O6h 96h,>ꈮ6h GB6h9@`G6hW@@Ȟ |6hPȞ>р6hqȞFԥ6heɞ6hA@ɞD6h >ɞGe6hɞܜ6hʞsO6hǣ@ʞb56hߣʞc6hbʞn6hR˞I6hmy6h4E&&S6h JEI6h[։ |6h"`7q6h5 {6h@˞*(6h` T6h 6h^*Vv6hx46hP !p"6h˞b6h{˞Qf6h%\`Ӂؒ6hU>kdJ6h!`16h#d6h{a6h}\ B6h̞96h&I6h a`^6hG5@̞˨ 6h\`JɊ6huM8j=6hIf 6hTJK6hHB'6hfZ6hཡkUȍ6h@" 6h)6h)y6h gtx6h$`.h6h A`]6hyJsh6h_`#Mx*6h"̞66h@ DDY 6hϤ`_l6hfk+D6h5J’6h/@%6t6h &_6hL`J6hf%=;6h}fscW6hQ46h`LV16h(06hfб76hfhS6h g 7<6hHg`VV6h6h Q6h5͞6h@͞6h&66h&u}6hҀ 0E6hIg͞X6hYg A˂6h_@6hg(u6hR`%6hK6h? E6G6hg L+p6hgP&6hǑB,B6hؑE6h?P 6h6`LOj6h?Ei{6h 6h*o26h͞46hL6h@6h@+ɬ(6h6+6hl6h¡76hE`BW#E6h6x-26hG6hs,$I6h"i66hƻ,#?^6h3 B 6h`'U6hA6h6-'6h6@D6k6hA x6h7@.1r6h*7 Ml:6h2[5B#6hΞA:6h.n;6hD u?V6hys6h@[`6h/;6hYh`Ms6h/\S6hz~ 6h`/[|/6ha^ {2]6hw^@Ξxh6hc{6h}DӐ;x6h `?6hN/ 6hץ  r6hE 6h^Ӫy>6h¼@(\RL>6h6h`¡Hxx6h¡H6hm á_ (6háKs6hœá b6h֓@ġA6h@mƇ6h J6hv66ĥΞ6hġMzʚ6h+Y`6h%{@ت6h7 ޷p6hA D6h;86C6h9iO6h86ho78F6h Z-6hf 6hZƍ6h1#6hΞ^76hA@O36hY`š 6hϞS*y6h`š6h@ϞcU6hš X 6hωH|6hUG[6h7V ɩS6ha6hϞ^ٲ6hϞ 6hОA36h&@О06hzО|]6h?d9~6h9[6h ОEI6hsipHV6h9ў\F_6h `ԪPfy6hky9D6h"6hɩ6hן@ў6hў66h@:6h{ ^I뢪6hp0cuJ6h; Pi6h9 ў.6hyV`Y6h 6hV:g6hAҞh6h  PinSHA256mapstructure:"pinSHA256" ClientKeymapstructure:"clientKey" FirewallMarkmapstructure:"fwmark" Transportmapstructure:"transport" Bandwidthmapstructure:"bandwidth" TCPTProxymapstructure:"tcpTProxy" UDPTProxymapstructure:"udpTProxy" SpeedTestmapstructure:"speedTest" Outboundsmapstructure:"outbounds""*atomic.Pointer[sync.poolChainElt]"*struct { key string; elem []int }"*[]struct { key string; elem int }"*func(time.Duration, uint64, bool)"*struct { F uintptr; X0 net.Conn }]ԇ6h{!t6h)B B4~ oOi6h \qƣTơ ZXz 1$ڻ6hL Ghښ NBɠ w Pz``i6h`ԞF3"E tl{ǡ WW `ȡ  ɡ 6hEQ06h/m6h R_:bש xdDj Z6hHD06h^  hZ .M} Ӎ#`} R9 ׄ *հ)נ >۵sk ϡ"*func() (*x509.Certificate, error)"*map.group[string]*tls.Certificate"*struct { F uintptr; R *tls.Conn }  4 .:~ $ o5 L2s `ԡ B# FV : ej6h}` >Ej` Ͽ N {06h` 1‰ཪ t%I| ? Ta: ০ wJ[` ,\9@ HH@ (6s| ա {4ա  &9֡ Tj`ס z{i ء ;$ء*36h2I-6hP+p6hW 06hl؞R]6h~6hB@W,-6h( `   @fmV6hV ~V }6h દI4M6hW mG  દ}v6h ւ q 5  h  8:o m ^Y# Ľb 6hౝ56h F"6h-  I`  ١[:6h{ RelativeNameasn1:"optional,tag:1" (&56h˜ w옢˜ P k.i@6h@l _4I`ݡ <'Oo@ ]oĮ  dBɤ &ܷpi :d 5 %P=|ɤ ?@ :=*x ޡ bޡ  ٪nߡ HzQ` QbQ )vX`w-6h/vA*6h k/Dw6h B06hi"*[]struct { key int; elem string } 2^n W(k 3v̦ V.@ `^(` T'<0 $ͦ yĚ ~%Ϥ k3qC46hiG`Н pŚ mb,`ƣ :IO> j eKgЩѝ ߩ> 6 RC ҝ y, onUM@  l!6h =g6h ԝ Yu_ \6h`՝ (+W lOˊ@ /$j ә/1l:U6h ^  Ny uhz5@ V @'206h ٝ /y6h ڝ \Va6h ڝW16h ߞ ?Ѡ(d6h`۝>6h. ~   ʥ wOʥ }; HF"*func(*cobra.Command, error) error"MarkZshCompPositionalArgumentWords 9RqԚ rsg  22 y xpє@ ^t4_k  fQ  ֲ%d0@`"*func(zapcore.ObjectEncoder) error q% c6h5`*Կ6h* ЉB*` t̂@ Z U,sr ]  &G٭ "tyX 6hJٚ#16hs  i Qz@ s^ISU R^i`+6h& >@6h `>%6hY b P+h.9 B6hh. u6h 0 5P%  r  룾H_@ ?Hx`  f | @7@ jfkA z>  ^g0"Q6h>6h0Z ?T-6hA> 6hD KL6h Ԯ sErs M(6hr /c56h֪ kw=)K   F(zO"*atomic.Pointer[net/http.response] Rxr<Layoutjson:"layout" yaml:"layout" Ot@Ц  v_ ত Ę"z1h6h ` ì}6 oKK1Ō@ H\ۚO F  K&"@! .J w\{ t` D~ o76h f[ƍ6h3*JGT6hx` ??XA6h u+B Z\_#"*func(http.http2FrameWriteRequest)"*map.group[*net.Listener]struct {}"*struct { io.Reader; io.WriterTo }"*map.group[[8]uint8]chan struct {}"*map[string]*http.http2addConnCall"*http.transportReadFromServerError"*struct { F uintptr; X0 []string } O;0B D-'  %` S8vԣ T\Ivޥ Z @ Z d! t.' !TE A M?C ƣ6ht? I{? ̣`'@ 撝v ̱L  ߋgٍ UL. 42#Y`n *({ >6DϬ R @ 0hħ ˆ  yP '  47@ ZD   M bu( mH@ ,&HpP! DQx! ߇"qW6h`Ÿ6h& 94 {Z@# (($ _"`$ H' % 8C Z(@& LP' |p' ;(( ]se(@) ᬶL iw\ Hm6h`Q 6hxw @tY 6hO٭ꈒ6hy  !s.~ "*func() (crypto.PrivateKey, error)  VF  3 0| 5 q]  0`' ZR&T)5 bw 6 if^(`7 @} 8 ESF |D 8 9 sR`: 1) ; ); n< ,}`= 5"n Altitudejson:"altitude,omitempty"Priorityjson:"priority,omitempty"Protocoljson:"protocol,omitempty"Selectorjson:"selector,omitempty"Messagesjson:"messages,omitempty" 6h@ 9NЫHR6h9@N +,FO6hFN D9@ > A T 4N*A ߩMG nUP-'6hP ha3X9n`    _ F^ذ`)Instancejson:"instance,omitempty"NewAuthzjson:"newAuthz,omitempty"NotAfterjson:"notAfter,omitempty"Locationjson:"location,omitempty"Wildcardjson:"wildcard,omitempty" $m Ch൤ v% "b"6h`T LoB n9 "*func(string, uint64, uint64) bool NOC 6hu ȧ"github.com/hashicorp/golang-lru/v2 /x +6hLE x.PAKU6ht A CBF)6hj J66 gxCwz A  גXF.916hx`LMXD6hHG{6hC |`LiK6h2˩d576hLa_`k6h)B!<656hV5@C ;G(6h=6h!@ Jw4Xi Y ao+B)ye6hr6hD26h  LastActiveAtjson:"last_active_at" 0#K06hHI _}6hZ +D|6h"*func() (*ecdsa.PrivateKey, error) h 5Ht96hӿ 6h {s6hE SN6h~ 6h<8q6h `Dv6hD  i ]b::6hQQ[j?t&6h-=Ÿ6h=ۈ26h E tBmyT6hx(\ƃ6ha = uf3{   )`"*chacha20poly1305.chacha20poly1305 67o ϥd!ݟ\MT6h@p6hY6h(@N<6hCĮ e|@ Xݓ3b "*pkix.RelativeDistinguishedNameSET"*map.group[*reflect.structType]int"*map[unsafe.Pointer]unsafe.Pointer e [  >M$B}@Ŭ uH"*J %qK [@L .&]M =+|   #ǻtX`P Hd"`̤H$6h E"*func([]interface {}, bool, error)"*map.group[dnsmessage.Class]string"*map.group[dnsmessage.RCode]string } Q \cKQ ,UR YD:`Sޚn6ha6?^6hySl>_6hkR[6hb?gP6h .H`@ ; T (n]Sͤ p@W @8T RАT {[qҤ E+ Ӥ }% &*e. ( Vĕ<Ԥ 5q@kR6h/E/6h h6h\`Y 9C `Y r?U YL V Z `WBM6h. "*map.group[reflect.Value]struct {} I3o Z I$h X 'B.+ H&`Z)6hd/ o [>A4d/nڤ"*socks5.UserPassNegotiationRequest [uyV i!36hr@F "@F Y# /B)R~[ w<$@p cibЫU  \  ~k``]6hh @ n q k: ^16h%{ lƩ6hО C.F 6V6h^G 6h!  6h `G6h6hD^G?6h{@P.6h@ b^]6h'M Hè6h\ _ q cy6f``   F L?Qt iu@ƞE6h80 DN=D|gb6hǷ6hzvIL6h6hu{&ȼ6h_@"6h OYx@"*func(*quic.Conn) http3.clientConn Ů n EYn$'/6hCn6h~3 m )` 6h+@ 56h! d G hl{& o ϢD 7 B-˸,sW6h@5  [I f24f {th] t"*func(string, string, net.IP) bool y;Q`  QQ ާ m< ݟm@@S6h t ENN@u"*struct { key string; elem uint8 }"*struct { key uint8; elem string } q/ o+ l ] @٦ HT lF?\`< Y7v _Nv7v  7w jZ@x Py &u*y >zHostnamejson:"hostname,omitempty""*govultr.ContainerRegistryMetadata MaxStorageMBjson:"max_storage_mb""*[]govultr.ContainerRegistryRegionVersionsjson:"versions,omitempty"Databasejson:"database,omitempty"Usernamejson:"username,omitempty"Passwordjson:"password,omitempty" RedisACLKeysjson:"redis_acl_keys""*govultr.DatabaseMigrationStartReq"*govultr.DatabaseVersionUpgradeReq MaxRuleCountjson:"max_rule_count"SSHKeysjson:"sshkey_id,omitempty" V4SubnetMaskjson:"v4_subnet_mask""*govultr.RequestCompletionCallback"*govultr.ApplicationServiceHandler"*govultr.MarketplaceServiceHandler  I  e W | p -5 o pYU  |le =}o ,, Y z)Y =& q( !_e f tK`Ϊ N!: FF0 SO@ uל ,s *N  wg z%:x` _ Ϫ b0 T r E` _I,Ϫ ݄i=- A [_ >3JaS 3)^ ?S u F W҆u y-`X  P*@Y ,h ^1" v sۼ` ` jb, g` +Dt w   >›t i \sWOyऩ CRD$. P!w  - it 8- =>y^`. AZ/ TxzN./#6hD&Z J "github.com/database64128/tfo-go/v2 LKiC06h"PreferSkipResumptionOnNilExtensionDatajson:"key_exchange,omitempty" r`#< Wu5@0 yDz } 2.B = "3 u  >дy "\uP`~   K: y   [ &@ o#j z& 8vv  |Ŕ5/ a6hs@ #[U`: 6c_/`ߟ X$DqU; qt/ߟ U< ī/ߟ j/L ){Ly_i"*map.group[string]syntax.charGroup _ | ,I<< p98@@ H%W U`qE UX]uΞ a j110n M6hwi ѓP@ QMy a"*map[reflect.Type]*yaml.structInfo wW8 + -= V@ A MV Ҫ *2| \& ?  'j0 n $KE# o O Ѝqi@ 0੩ K= okwxV㮲P6h*i / 2 Tv S)T W` }, } u4d"*struct { key uint32; elem int32 } "*map.group[string]template.element 7`"*map.group[reflect.Type]gob.typeId n  "*map.group[netlink.BondMode]string Aܫ  >  Z؋1Ơ ;Dt Tx  tD` ֣ر )Kyt R)C:  혱$| ` t> Bb/ Ot 7EB` It H& I ~YCH E ` e˝u +ڕ u& x</` l ? KHMu S K B"*interface { IsMessageSet() bool } j6hl XNr6hĦ"*protoreflect.ExtensionDescriptors"*func(int) protoreflect.FileImport"appendUninterpretedOption_NamePart"*func(protoreflect.FileDescriptor)"*func(protoreflect.EnumDescriptor)"*protoreflect.EnumValueDescriptors"*func() protoreflect.ExtensionType fiEĞ x/nh2L v\ߺ6he !z?@"SetMaxAckHeightTrackerWindowLength"limitMaxAckHeightTrackerBySendRate"*func(congestion.RTTStatsProvider) D7R| &> ;@Z v"*protocol.ArbitraryLenConnectionID b?@Ǟ `CHb"*ackhandler.packetWithPacketNumber B $ kE ~) IC Ş z7' +f"7"*func() (bool, protocol.ByteCount) V :4 "writeLiteralFieldWithNameReference |5U3uD6h^ M!gQ[ r^24 &h]@nd^u6h@l :@JW6h_]6h#{ ` jg\! 0K)f! U̓9f     Z <@"*retryablehttp.ResponseHandlerFunc"*map[dnsmessage.SVCParamKey]string Df@ I $  ܅_ढ < Lo8` |: t+6hv @ go@ৢFy#6h@  c@"golang.org/x/text/encoding/unicode ^ w >g: A rbyvnS6heTb6hG d6h<+"*map.group[reflect.Type]*gob.encOp Ay 1~:( ~ 56h=(y=6hQ96he6hy@,6h'+/6hbF6h P2xǛ d Z2Th@ g-U" $k!h -V1 D?"*func(protoreflect.EnumType) error"*protoregistry.extensionsByMessage t0\< `Tf% N2 ` r%@ 9 ఢ ,#li D#@@+Bk6h#̜ +6h̜ wTZ\`,  HwH `  ]C # ?eKT`Q  Wo - Mൢ ` 9fk` \dxk .D uq ย  B #|- s` a_S L$i $04@V n໢  h16 G-- \i, ` (7  Չ &fX V@  s+. (| sϺ oP V:b¢"*map[protowire.Number]interface {}"*map[reflect.Type]protowire.Number"*map[protowire.Number]reflect.Type jTS`â {uF+% Ģ CcĢ 3=s@ԛ @՛ իW-Q Ţ % `Ƣ Mx Ǣ pQ"+Ǣ ѱbȢ W߽``ɢ چ ʢ C @  Iny؜ (ٛ  ;6 @7 \P8 7 NJi-=9   ɩ N >MV`Ԫ w; Q/z=&O t0 g# 9Oў "iDi@: Cz0ɩ @(K=Ϟ bVȺx6h* q ~w= H NTϢ k\'Т -,@Ѣ us44dҢ 2jҢ#*struct { key string; elem string }#*[8]struct { key string; elem int }#EncryptedClientHelloRejectionVerify#*func([]uint8) (*big.Int, *big.Int)#*[]struct { key uint16; elem bool }#*func([]uint8) (cipher.AEAD, error)#*[]struct { key uint64; elem bool }#*struct { F uintptr; X0 *tls.Conn }#*map[string][]*x509.policyGraphNode#*[]struct { key string; elem bool }#*[]map[string]*x509.policyGraphNode#*[8]struct { key int; elem string }#*weak.Pointer[net/netip.addrDetail]#*unique.entry[net/netip.addrDetail]#*func(*abi.Type, interface {}) bool#*func(fs.DirEntry, fs.DirEntry) int#*func(interface {}, uintptr, int64)#*struct { key string; elem uint64 }#GenPowerShellCompletionFileWithDesc#*map[protocol.StreamID]*quic.Stream#*map[quic.pathID]*quic.pathOutgoing#*func(zapcore.ArrayMarshaler) error#*func([]zapcore.Field) zapcore.Core#*func(http.http2writeContext) error#*func(net.Listener) context.Context#*map.group[uint32]*http.http2stream#*map.group[string]*http.routingNode#*http.http2roundRobinWriteScheduler#*map[uint32]*http.http2clientStream#*map[string][]*http.http2ClientConn#*map[*http.http2ClientConn][]string#*http.http2clientConnPoolIdleCloser#*map.group[http.http2ErrCode]string#*map.group[http.http2SettingID]bool#*map[string][]*multipart.FileHeader#*map.group[string]http.RoundTripper#*struct { F uintptr; X0 time.Time }#*func(context.Context, string) bool#*map.group[string]*certmagic.Config#*map.group[string]certmagic.KeyInfo#*map.group[string]certmagic.StorageZoneNamejson:"zone_name,omitempty"#*map.group[string]cloudflare.cfZoneAPITokenjson:"api_token,omitempty"RRSetTTLjson:"rrset_ttl,omitempty"#*map.group[string]gandi.gandiDomain#*func([]uint8) (int, string, error)#*func([]uint8, string) (int, error)#*map[uint32]*server.udpSessionEntry#*outbounds.invalidOutboundModeError#*outbounds.PluggableOutboundAdapter#*map.group[*reflect.structType]bool#*struct { F uintptr; X0 *abi.Type }#*struct { key string; elem uint16 }#github.com/go-viper/mapstructure/v2#*udpnat.Service[net/netip.AddrPort]#*func(netip.AddrPort, *udpnat.conn)#github.com/sagernet/sing/common/buf#*[]struct { key uint8; elem uint8 }#*func() protoreflect.EnumDescriptor#*func(*quic.packetBuffer, net.Addr)#*func(protocol.StatelessResetToken)#*struct { Remote bool; Local bool }#*func(congestion.CongestionControl)#*quic.pathManagerOutgoingAckHandler#*struct { F uintptr; R *quic.Conn }#*struct { key uint64; elem uint64 }#*map.group[string]map[string]string#vendor/golang.org/x/net/http2/hpackRendezvousServersdns:"domain-name"#*func(dns.ResponseWriter, *dns.Msg)#*struct { key uint16; elem string }UserDatajson:"user_data,omitempty" IncomingBytesjson:"incoming_bytes" OutgoingBytesjson:"outgoing_bytes" ArtifactCountjson:"artifact_count"#*govultr.ContainerRegistryPlanTypes#*govultr.ContainerRegistryUpdateReqMinValuejson:"min_value,omitempty"MaxValuejson:"max_value,omitempty" InstanceCountjson:"instance_count"ScriptIDjson:"script_id,omitempty"BackupIDjson:"backup_id,omitempty"MinNodesjson:"min_nodes,omitempty"MaxNodesjson:"max_nodes,omitempty" ClusterSubnetjson:"cluster_subnet" ServiceSubnetjson:"service_subnet" FirewallRulesjson:"firewall_rules"#*govultr.BlockStorageServiceHandler#*govultr.FireWallRuleServiceHandler FirewallGroupjson:"firewall_group" ObjectStoragejson:"object_storage" StartupScriptjson:"startup_script"#*map[danger.TypeID]map[string][]int#*map[netlink.BondArpValidate]string#*map[netlink.BondFailOverMac]string#*map.group[netlink.IPoIBMode]string#*map[string]netlink.BondArpValidate#*map[string]netlink.BondFailOverMac#*map.group[string]netlink.IPoIBMode#*func(protoreflect.FieldDescriptor)#*func() protoreflect.FileDescriptor#appendDescriptorProto_ReservedRange#*func(protoreflect.EnumNumber) bool#*func(protoreflect.OneofDescriptor)#*func(int) protoreflect.MessageType#SetAckAggregationBandwidthThreshold#reduceExtraAckedOnBandwidthIncrease#bytesLostWhileDetectingOvershooting#*func(time.Duration, time.Duration)#crypto/internal/fips140/nistec/fiat#*map.group[reflect.Type]gob.gobType#*[]func() protoreflect.ProtoMessage#*map[protoreflect.Kind]reflect.Type#*func(*coding.Bits, coding.Version)#golang.org/x/text/encoding/internal BindDevicemapstructure:"bindDevice"$*unique.Handle[net/netip.addrDetail] Salamandermapstructure:"salamander" BBRProfilemapstructure:"bbrProfile" DisableUDPmapstructure:"disableUDP" Congestionmapstructure:"congestion" ListenHostmapstructure:"listenHost" XForwardedmapstructure:"xForwarded" StatusCodemapstructure:"statusCode" ListenHTTPmapstructure:"listenHTTP" ForceHTTPSmapstructure:"forceHTTPS" Masquerademapstructure:"masquerade"$*[]struct { key string; elem []int }$*struct { F uintptr; R *net.Dialer }$*map.group[interface {}]interface {}$*[8]struct { key uint16; elem bool }$*[8]struct { key uint64; elem bool }$*struct { F uintptr; R crypto.Hash }$*[8]struct { key string; elem bool }$*[1]map[string]*x509.policyGraphNode$*interface { As(interface {}) bool }$*func(int) (syscall.Sockaddr, error)$*runtime.goroutineProfileStateHolder$*map.group[string]runtime.metricData$*func(io.Writer, interface {}) error$*struct { name string; called bool }$*func(string) (viper.Encoder, error)$*func(string) (viper.Decoder, error)$*map[string]*forwarding.sessionEntry$*func(zapcore.ObjectMarshaler) error$*map.group[zapcore.Level]color.Color$*map[*http.http2serverConn]struct {}$*map[*http.persistConn]*list.Element$*map.group[http.connectMethodKey]int$*struct { F uintptr; X0 chan error }$*func(context.Context, string) error$*map[string]*certmagic.soaCacheEntry Algorithmjson:"algorithm,omitempty" Proxiablejson:"proxiable,omitempty" NotBeforejson:"notBefore,omitempty"Authorizationsjson:"authorizations" Validatedjson:"validated,omitempty" HookedReqAddrjson:"hooked_req_addr"$*func() (*ed25519.PrivateKey, error)$*func(int, int) (cipher.AEAD, error)$*func(string) (reflect.Method, bool)$*map.group[dnsmessage.section]string$*map.group[string]*singleflight.call$*func([]string, slog.Attr) slog.Attr$*mapstructure.UnconvertibleTypeError$*struct { F uintptr; R buffer.Pool }$*[8]struct { key uint8; elem uint8 }$*v2geo.isDomain_Attribute_TypedValue$*[]struct { key int32; elem string }$*[]struct { key string; elem int32 }$*func() (quic.receivedPacket, error)$*func(protocol.EncryptionLevel) bool$*[]quic.receivedPacketWithDatagramID$*struct { F uintptr; X0 *quic.Conn }$*func(int, map[string]struct {}) int$*[]struct { key string; elem uint8 }$*[]struct { key uint8; elem string } SSHKeyIDsjson:"sshkey_id,omitempty" V6NetworkSizejson:"v6_network_size" Enumeralsjson:"enumerals,omitempty" NumberOfNodesjson:"number_of_nodes" NSPrimaryjson:"nsprimary,omitempty" SHA512Sumjson:"sha512sum,omitempty" Instancesjson:"instances,omitempty"GPUVRAMjson:"gpu_vram_gb,omitempty" Continentjson:"continent,omitempty"$*govultr.DomainRecordsServiceHandler$*govultr.FireWallGroupServiceHandler$*govultr.ObjectStorageServiceHandler$*govultr.StartupScriptServiceHandler$*struct { key string; elem []uint8 }$*[]struct { key uint32; elem int32 }$*map.group[string]netlink.TuntapMode$*bufio.syscallVectorisedWriterFields$*struct { pragma.NoUnkeyedLiterals }$*func() protoreflect.EnumDescriptors$*func(protoreflect.MethodDescriptor)$appendDescriptorProto_ExtensionRange$*func() protoreflect.SourceLocations$*func(int) protoreflect.ProtoMessage$*func() protoreflect.OneofDescriptor$*func() protoreflect.FieldDescriptor$*map[int32]protoreflect.ProtoMessage$*map.group[int32]impl.ExtensionField$*struct { key uint64; elem []uint8 }$*[]ackhandler.packetWithPacketNumber$*qlog.PacketHeaderVersionNegotiation$*map.group[string]internal.AuthStyle$golang.org/x/crypto/chacha20poly1305$crypto/internal/fips140/edwards25519$*func(impl.pointer) protowire.Number$github.com/cloudflare/circl/ecc/p384$*struct { key string; elem float64 }%*[]struct { key string; elem string }%*[8]struct { key string; elem []int }%*struct { key string; elem []string }%*sync.node[interface {},interface {}]%*struct { F uintptr; X0 *sync.Mutex } MaxPathLenasn1:"optional,default:-1"SubjectUniqueIdasn1:"optional,tag:2"%*map.group[*x509.policyGraphNode]bool%*func([]uint8) (int, net.Addr, error)%*func([]uint8, net.Addr) (int, error)%*map.group[net.hostLookupOrder]string%*struct { F uintptr; X0 *time.Timer }%*[]*unique.node[net/netip.addrDetail]%*map.group[netip.addrDetail]struct {}%*map[chan<- os.Signal]*signal.handler%*func(io.Writer, string) (int, error)%*[]struct { key string; elem uint64 }%*func(*cobra.Command, []string) error%*map[pflag.NormalizedName]*pflag.FlagInitialjson:"initial" yaml:"initial"%*struct { F uintptr; R net.Listener }%*func() (*protocol.UDPMessage, error)%*func(protocol.StreamID) *quic.Stream%*struct { F uintptr; R client.udpIO }%*func(func(interface {}) error) errorTimeKeyjson:"timeKey" yaml:"timeKey"NameKeyjson:"nameKey" yaml:"nameKey"NewReflectedEncoderjson:"-" yaml:"-"%*map.group[context.canceler]struct {}%*struct { ptr interface {}; len int }%*map.group[string]*http.http2dialCall%*http.http2duplicatePseudoHeaderError%*map.group[http.http2SettingID]string%*func(string) (*http.Response, error)%*struct { F uintptr; R http.Handler }%*struct { F uintptr; R *atomic.Bool }%*map.group[string]certmagic.Challenge AutoAddedjson:"auto_added,omitempty" CreatedOnjson:"created_on,omitempty" RRSetHrefjson:"rrset_href,omitempty" RRSetNamejson:"rrset_name,omitempty" RRSetTypejson:"rrset_type,omitempty"%*struct { CSR string "json:\"csr\"" }%*func(string) (server.UDPConn, error)%*trafficlogger.trafficStatsServerImpl%vendor/golang.org/x/crypto/cryptobyte%*map.group[string]*unicode.RangeTable%*[]struct { key string; elem uint16 }%github.com/sagernet/sing/common/cache%*struct { F uintptr; X0 *tun.System }%*struct { F uintptr; X0 *[9]uintptr }%*[8]struct { key int32; elem string }%*[8]struct { key string; elem int32 }%*map.group[quic.pathID]quic.newConnID%*[]struct { key uint64; elem uint64 }%*map.group[hpack.pairNameValue]uint64Reasonasn1:"explicit,tag:0,optional"%*[8]struct { key string; elem uint8 }%*[]struct { key uint16; elem string }%*[8]struct { key uint8; elem string } TokenTypejson:"token_type,omitempty"PendingChargesjson:"pending_charges" IPAddressjson:"ip_address,omitempty" BlockTypejson:"block_type,omitempty" PrivateIPjson:"private_ip,omitempty"DatabaseEnginejson:"database_engine"MaintenanceDOWjson:"maintenance_dow" AltValuesjson:"alt_values,omitempty" EnableVPCjson:"enable_vpc,omitempty" AttachVPCjson:"attach_vpc,omitempty" DetachVPCjson:"detach_vpc,omitempty"DDOSProtectionjson:"ddos_protection"AvailablePlansjson:"available_plans"CompressedSizejson:"compressed_size"%github.com/apernet/quic-go/quicvarint%github.com/refraction-networking/utls%*struct { key *yaml.Node; elem bool }%*map.group[string]yaml.resolveMapItem%*[8]struct { key uint32; elem int32 }%*map[netlink.BondArpAllTargets]string%*map[string]netlink.BondArpAllTargets%github.com/sagernet/sing/common/bufio%*map[protoreflect.Kind]protowire.Type%*func(protoreflect.ServiceDescriptor)%*func(int) [2]protoreflect.EnumNumber%*func() protoreflect.FieldDescriptors%*func() protoreflect.OneofDescriptors%*func(protoreflect.MessageDescriptor)%*protoreflect.ExtensionTypeDescriptor%SetLimitMaxAckHeightTrackerBySendRate%github.com/apernet/quic-go/congestion%*func() (bool, protocol.PacketNumber)%*flowcontrol.ConnectionFlowController%*flowcontrol.connectionFlowController%github.com/apernet/quic-go/qlogwriter%github.com/apernet/quic-go/http3/qlog%writeLiteralFieldWithoutNameReference%vendor/golang.org/x/text/unicode/norm%github.com/hashicorp/go-retryablehttp%*func([]uint8) (kem.PublicKey, error)%parseOptionalWhitespaceCommentNewline%*struct { key string; elem [2]int32 }%*struct { key gob.typeId; elem bool }%*map.group[reflect.Kind]gob.encHelper%*map.group[reflect.Type]*gob.typeInfo%*func(protoreflect.MessageType) error%*interface { GoPackagePath() string }%*map[protowire.Number]*filedesc.Field%*map.group[protowire.Number]struct {}%*map[protoreflect.Name]*filedesc.Enum%*map[protowire.Number]*impl.fieldInfo&github.com/apernet/hysteria/app/v2/cmd&*func(net.Addr, string, string, error)&*func(net.Addr, string, uint32, error) HopIntervalmapstructure:"hopInterval" IPv4Excludemapstructure:"ipv4Exclude" IPv6Excludemapstructure:"ipv6Exclude" TCPRedirectmapstructure:"tcpRedirect"&*[8]struct { key string; elem string } DisableHTTPmapstructure:"disableHTTP" AltHTTPPortmapstructure:"altHTTPPort" RewriteHostmapstructure:"rewriteHost" ListenHTTPSmapstructure:"listenHTTPS"&*struct { key x509.sum224; elem bool }&*struct { key string; elem struct {} }Uc3Ady3S3ZP3in@i3s3¾@b3@D{` 2h.=K 2hK{ گ 2h+i 2hj@pg> 2h"j`Ԟ|[ 2hվ@pdt3mզ&*func(string, *tls.ClientSessionState)&*tls.handshakeMessageWithOriginalBytes&*func(interface {}, interface {}) bool&*weak.Pointer[crypto/x509.Certificate]&*sync.entry[interface {},interface {}]&*atomic.Pointer[internal/bisect.dedup]&*func(unsafe.Pointer, uintptr) uintptr&*struct { key tls.alert; elem string }&*map.group[uint16]func() *hpke.hkdfKDFpL 2h`Ԟm3`r)!3@ _32kJ3 R36n5J3H Wv3C.5L3@XlM3ZB@6{h3<Ax3`:{/3ݞ#lF3מlN3b N#'3-W2Q3u3Exc3;Xwu3ilB*3mN3gM3@3`3@?jj3N&3򣢷3@&*struct { F uintptr; R *net.Resolver }`6}3 p< 2hm] 2h@ 2hmFٌ 2h@ %3`k3)EeW)3V3dX~39E 2h m 2hȀ@UY 2h<ثFH 2h 5:3c@`H 2hm513&*unique.canonMap[net/netip.addrDetail]&*unique.indirect[net/netip.addrDetail]&*[0]*unique.node[net/netip.addrDetail]&*[]*unique.entry[net/netip.addrDetail]ʠ3 `ԞD:!o3۞-8Q3(``\&*go.shape.interface { Error() string }3 _fi3Xt)3a=ݞ"3n\3%  4X3I2$k3&*func(*runtime.g, unsafe.Pointer) bool&*map.group[runtime._typePair]struct {}O}3-e>3xrٸ~33FT3?T3IHYhU3XߖV 2h48 2hL3 U83q?!!36X3tEF3`&*[8]struct { key string; elem uint64 }3qӇq 2hq@r/ 2h@A3?@`!Q3q 3ωh3lW3֜3 gཨ9#3k ^&*struct { F uintptr; X0 *[]io.Closer }cf3W3ݫr&*struct { F uintptr; X0 *http.Server }F9P 2hIJ &github.com/sagernet/sing/common/x/listqO83%l&*map[protocol.StreamID]go.shape.*uint8rŹ 2h 7b>3+0$)=3~$9e;3ژ43@ƞ3UA Uw3@H`3M3I0.'34 2hݚ-@3@vʎ3Q3K 353M@w]3@&&*struct { key reflect.Type; elem int }&*struct { F uintptr; X0 reflect.Type }E3,Zv3Kf&*func(uint32, http.http2PriorityParam)&*func(*http.Request) (*url.URL, error)&*func(int, textproto.MIMEHeader) error&*http.http2bufferedWriterTimeoutWriter&*struct { F uintptr; X0 bytes.Reader }!>3#E`H}3A͛3:`n\73~@ѦV30໮,=f3`)+ 3 .As 2h;ķ3W`41 2hNmߥ^ 2he`nB 2h ~p 2h*`/ 2h5ݞks3+D٭.pk 2hjB'* 31(ɱt 2h nr1 2hN`Ԟhh 2hF 2h#%|K 2h@3% . 2h :3?Z 33 m3F&*func(context.Context, []string) error&*map.group[string]certmagic.ocspUpdate&*func() (certmagic.Certificate, error)DomainKeysHrefjson:"domain_keys_href" DomainNamejson:"domainName,omitempty" Identifierjson:"identifier,omitempty"&*map.group[string]acme.cachedDirectory4 k3g@ސ?3j`VD 2hO 2h49f 2h4`<3VǞn`A31&*weak.Pointer[crypto/ecdsa.PrivateKey] t3`]8U3?F95 3-^D"3I3^@ЦN3a _ EB"`T3ϒ`5&*func([]reflect.Value) []reflect.Value0M35AJE3=I@Ŭn 3iI5Q=3E ѩ&vendor/golang.org/x/net/dns/dnsmessage&*[8]struct { key string; elem uint16 }i#3a6gAjm3b@h T3xpo5 2hOml 2h:Lsb3,TS3p X3yH]3 @M3 9&*struct { F uintptr; R *flag.FlagSet }fx%3 s-dV3&github.com/sagernet/sing/common/logger&github.com/sagernet/sing/common/ranges&github.com/sagernet/sing/common/udpnat-53L υT3ULǫ 2h %IbŴ3su=3.ۘQ% 2h@ 2hڭԮ3 N/3J7P3f973J [m= 2h;u>e 2hA3\Q3&*[8]struct { key uint64; elem uint64 }`3@E 45)38 fPh31K `39 J6~3Ŕ&vendor/golang.org/x/net/http/httpproxy&*map[crypto.Hash]asn1.ObjectIdentifier&*[8]struct { key uint16; elem string }P3I\ av{3`*yv^3+`<Ii3!7 :3@٦&*govultr.ContainerRegistryStorageCount&*govultr.ContainerRegistrySubscription Encryptionjson:"encryption,omitempty"ObjectStoreClusterIDjson:"cluster_id"&*govultr.BareMetalServerServiceHandler 2h>7:0 2hϞ@3.`~/[3d3I' 63S@x3 ө3w~d3%5*3w#>3@*3@XY3%< 3Tv5H34`e7-3@=]3v(3xө}M3A3FŢ73_`uz3G @iW3 /3n l3 `V3 N3S`U3f3ө"cmY3~zY,G3ku3LOj3xk23_e X[p3|=^3@g3̪a Y3| @ h{3Q X1i3/l#3' a4H38&SetReduceExtraAckedOnBandwidthIncrease&startNewAggregationEpochAfterFullRoundppv<3>ǞH31(Ǟt3 ;&*protocol.DefaultConnectionIDGeneratorZ3I?D?,3Q}ƞ&*[]struct { key uint64; elem []uint8 }*3RŞ3?ŞfN3Y&*func(protocol.ByteCount) (bool, bool)&*flowcontrol.connectionFlowControllerI 63`a3S)&*map.group[string]qpack.indexAndValuesv3ʫ3@4&github.com/google/go-querystring/queryݡT30Ӝ3 s- 3h@8d3'T&*func([]uint8) (sign.PublicKey, error)35&*func([]uint8) (kem.PrivateKey, error):c3v%Lc3f&github.com/cloudflare/circl/kem/hybrid&*fiat.p224MontgomeryDomainFieldElement&*fiat.p256MontgomeryDomainFieldElement&*fiat.p384MontgomeryDomainFieldElement&*fiat.p521MontgomeryDomainFieldElement)䱓3 3`Z3 *O3? &*map[protoreflect.Name]*filedesc.Field&*map[protoreflect.Name]*filedesc.Oneof&*func() *map[int32]impl.ExtensionField&*func(impl.pointer) protoreflect.Value&*map[protoreflect.Name]*impl.oneofInfo&*func(impl.pointer) *impl.extensionMap&*map[reflect.Type]*impl.coderFieldInfoȢ3T7r<3h`j3  k m3**$3AΞ&github.com/cloudflare/circl/sign/ed448&*[]struct { key string; elem float64 }'*func(net.Addr, string, uint32, string)'*func(net.Addr) (net.PacketConn, error)'*map.group[string]zapcore.EncoderConfig'*[]struct { key string; elem []string }'*struct { F uintptr; X0 client.Client }'*atomic.Pointer[internal/godebug.value]'*func(string, string) (net.Conn, error)DistributionPointasn1:"optional,tag:0"'*iter.Seq[*crypto/x509.policyGraphNode]'*func(func(*x509.policyGraphNode) bool)'*map.group[string]*x509.policyGraphNode'*struct { key string; elem []x509.OID }'*struct { key string; elem net.byName }'*[0]*unique.entry[net/netip.addrDetail]'*unique.uniqueMap[net/netip.addrDetail]'*func(context.Context, slog.Level) bool'*map.group[string]*proxymux.muxListener'*struct { F uintptr; X0 io.ReadCloser }'*map[protocol.StreamID]*quic.SendStream'*interface { SetReadBuffer(int) error }'*struct { key reflect.Type; elem bool }'*func() (*hpack.Encoder, *bytes.Buffer)'*map.group[uint32]*http.http2writeQueue'*http.http2write100ContinueHeadersFrame'*struct { F uintptr; X0 io.ReadSeeker }'*map.group[string]certmagic.Certificate IssuerDatajson:"issuer_data,omitempty"'*map.group[string]*certmagic.solverInfo LatDegreesjson:"lat_degrees,omitempty" LatMinutesjson:"lat_minutes,omitempty" LatSecondsjson:"lat_seconds,omitempty" DigestTypejson:"digest_type,omitempty" ModifiedOnjson:"modified_on,omitempty"DevelopmentModejson:"development_mode"OriginalDnshostjson:"original_dnshost" ErrorChainjson:"error_chain,omitempty" ResultInfojson:"result_info,omitempty"'*map[string]outbounds.PluggableOutbound'*struct { F uintptr; R *atomic.Uint64 }'*func([]uint8) (*ecdh.PublicKey, error)'*struct { key uint8; elem *pflag.Flag }'*struct { key interface {}; elem bool }'*struct { key string; elem *flag.Flag }'*map.group[tun.flowKey][]tun.tcpGROItem'github.com/sagernet/sing/common/control'github.com/sagernet/sing/common/network TypedValueprotobuf_oneof:"typed_value"'*func(bbr.Bandwidth, bbr.Bandwidth) int'*func(context.Context) ([]uint8, error)'*map.group[uint64]protocol.ConnectionID'*struct { F uintptr; R *http3.rawConn }'*struct { F uintptr; X0 *bytes.Buffer }Responseasn1:"explicit,tag:0,optional" NextDomaindns:"size-base32:HashLength" Descriptionurl:"description,omitempty" SnapshotIDjson:"snapshot_id,omitempty" EnableIPv6json:"enable_ipv6,omitempty" AttachVPC2json:"attach_vpc2,omitempty" DetachVPC2json:"detach_vpc2,omitempty" EnableVPC2json:"enable_vpc2,omitempty"DefaultPasswordjson:"default_password"'*govultr.ContainerRegistryRepoUpdateReq PublicHostjson:"public_host,omitempty"MaintenanceTimejson:"maintenance_time" TrustedIPsjson:"trusted_ips,omitempty" TableCountjson:"table_count,omitempty"HAControlPlanesjson:"ha_controlplanes" AutoScalerjson:"auto_scaler,omitempty" CookieNamejson:"cookie_name,omitempty" PrivateKeyjson:"private_key,omitempty" InstanceIDjson:"instance_id,omitempty" APIEnabledjson:"api_enabled,omitempty"'*[8]struct { key string; elem []uint8 }'*struct { key reflect.Value; elem int }'*[]struct { key *yaml.Node; elem bool }'*struct { key string; elem *yaml.Node }'*map[netlink.BondPrimaryReselect]string'*map[string]netlink.BondPrimaryReselect'*func(int) protoreflect.FieldDescriptor'appendExtensionRangeOptions_Declaration'*func() protoreflect.MessageDescriptors'*func() protoreflect.ServiceDescriptors'*func(protoreflect.EnumValueDescriptor)'*func(int) protoreflect.OneofDescriptor'*struct { F uintptr; R *bbr.bbrSender }'*[8]struct { key uint64; elem []uint8 }'*func(protocol.ByteCount) monotime.Time'ackElicitingPacketsReceivedSinceLastAck'*func(monotime.Time) protocol.ByteCount'*func([]uint8) (sign.PrivateKey, error)'*[]struct { key string; elem [2]int32 }'*[]struct { key gob.typeId; elem bool }'*atomic.Pointer[encoding/gob.encEngine]'*struct { F uintptr; X0 *gob.typeInfo }'*map[protoreflect.FullName]interface {}'*func(protoreflect.ExtensionType) error'*map[protoreflect.Name]*filedesc.Method'*func(impl.pointer, protoreflect.Value)'*func(protoreflect.Value) reflect.Value'*func(reflect.Value) protoreflect.Value'*interface { XXX_MessageName() string }'*congestion.SendAlgorithmWithDebugInfos'*[8]struct { key string; elem float64 } TrafficStatsmapstructure:"trafficStats"(*[]struct { key x509.sum224; elem bool }(*map[server.HyStream]*server.StreamStats(*[]struct { key string; elem struct {} }(*[8]struct { key string; elem []string }(*[]*sync.node[interface {},interface {}](*[]struct { key tls.alert; elem string } PublicKeyasn1:"optional,explicit,tag:1"(*struct { F uintptr; X0 chan struct {} }(*go.shape.struct { unique.isEntry bool }(*struct { key uint32; elem []*abi.Type }(*struct { key string; elem viper.Codec }Samplingjson:"sampling" yaml:"sampling"Encodingjson:"encoding" yaml:"encoding"(*func() (map[string]*v2geo.GeoIP, error)(*func(protocol.StreamID) go.shape.*uint8(*interface { SetWriteBuffer(int) error }LevelKeyjson:"levelKey" yaml:"levelKey"(*struct { key string; elem *json.field }(*[]struct { key reflect.Type; elem int }(*struct { F uintptr; R json.mapEncoder }(*struct { F uintptr; R json.ptrEncoder }(*map.group[string]*http.http2addConnCall(*struct { F uintptr; X0 strings.Reader }(*map[string][]certmagic.dnsPresentMemory Subproblemsjson:"subproblems,omitempty"(*masq.altSvcHijackResponseWriterHijacker(*func([]uint8) (*ecdh.PrivateKey, error)(*struct { key reflect.visit; elem bool }(*map.group[unsafe.Pointer]unsafe.Pointer(*func() ([]locafero.searchResult, error)(*func(string) (fs.FileInfo, bool, error)(github.com/sagernet/sing/common/metadata(firstAckElicitingPacketAfterIdleSentTime(*struct { F uintptr; R quic.connRunner }(*struct { F uintptr; R *quic.Transport }(*struct { F uintptr; X0 *error; X1 int }(*map[string]*http3.roundTripperWithCount(*struct { F uintptr; X0 *http3.rawConn }(*struct { key string; elem dns.Handler }(*struct { key dns.SVCBKey; elem string }(*struct { key string; elem dns.SVCBKey }LastPaymentDatejson:"last_payment_date"(*govultr.DatabaseConnectionPoolCreateReq(*govultr.DatabaseConnectionPoolUpdateReqFirewallGroupIDjson:"firewall_group_id" Certificatejson:"certificate,omitempty" Descriptionjson:"description,omitempty"(*govultr.ContainerRegistryServiceHandler(*struct { F uintptr; R *govultr.Client }(*[]struct { key uint; elem sign.Scheme }(*ecdsa.blockAlignedPersonalizationString(*struct { key *syntax.Regexp; elem int }(*[8]struct { key *yaml.Node; elem bool }(*map.group[reflect.Type]*yaml.structInfo(*func(int) protoreflect.MethodDescriptor(*func() protoreflect.EnumValueDescriptor(*func(protoreflect.FieldDescriptor) bool(github.com/apernet/quic-go/internal/qerr(github.com/apernet/quic-go/internal/wire(*func(monotime.Time, protocol.ByteCount)(*func(protocol.ByteCount, monotime.Time)(*func(monotime.Time) ackhandler.SendMode(*ackhandler.appDataReceivedPacketTracker(*map.group[dnsmessage.SVCParamKey]string(*struct { key string; elem sign.Scheme }(github.com/pelletier/go-toml/v2/unstable(*[8]struct { key string; elem [2]int32 }(*[8]struct { key gob.typeId; elem bool }(*struct { key *gob.typeInfo; elem bool }(*func(protoreflect.FileDescriptor) error(*struct { key string; elem token.Token }(google.golang.org/protobuf/internal/strs(*map[string]protoreflect.FieldDescriptor(*map[protoreflect.Name]*filedesc.Message(*map[protoreflect.Name]*filedesc.Service(google.golang.org/protobuf/internal/impl(*map.group[protowire.Number]interface {}(*map.group[reflect.Type]protowire.Number(*map.group[protowire.Number]reflect.Type(*struct { F uintptr; X0 impl.Converter }(github.com/cloudflare/circl/sign/ed25519)*func(http.ResponseWriter, *http.Request))*[8]struct { key x509.sum224; elem bool })*struct { key string; elem func() error })*[8]struct { key string; elem struct {} })*sync.indirect[interface {},interface {}])*[]*sync.entry[interface {},interface {}])*[0]*sync.node[interface {},interface {}])*[8]struct { key tls.alert; elem string })*map.group[string][]*x509.policyGraphNode)*[]struct { key string; elem []x509.OID })*[]struct { key string; elem net.byName })*[]*unique.indirect[net/netip.addrDetail])*func(func(*abi.Type, interface {}) bool))*func(string, time.Time, time.Time) error)*struct { key string; elem interface {} })*func(context.Context, slog.Record) error)*struct { F uintptr; X0 []zapcore.Field })*func(func(int)) *list.Element[func(int)])*struct { key string; elem *v2geo.GeoIP })*func(protocol.StreamID) *quic.SendStream)*map.group[protocol.StreamID]*quic.Stream)*quic.incomingStreamsMap[go.shape.*uint8])*quic.outgoingStreamsMap[go.shape.*uint8])*map.group[quic.pathID]*quic.pathOutgoing)*func(io.Writer) zapcore.ReflectedEncoder)*[]struct { key reflect.Type; elem bool })*[8]struct { key reflect.Type; elem int })*http.entry[string,*net/http.routingNode])*map[http.routingIndexKey][]*http.pattern)*map.group[uint32]*http.http2clientStream)*map.group[string][]*http.http2ClientConn)*map.group[*http.http2ClientConn][]string)*func(http.keyValues, http.keyValues) int)*interface { IsHTTP2NoCachedConnError() })*map.group[string][]*multipart.FileHeader)*struct { F uintptr; R *http.connReader })*struct { key string; elem acmez.Solver })*struct { F uintptr; X0 context.Context } LongDegreesjson:"long_degrees,omitempty" LongMinutesjson:"long_minutes,omitempty" LongSecondsjson:"long_seconds,omitempty" RRSetValuesjson:"rrset_values,omitempty" BearerTokenjson:"bearer_token,omitempty")*map.group[uint32]*server.udpSessionEntry)*outbounds.errSOCKS5UnsupportedAuthMethod)*struct { F uintptr; R *godebug.Setting })*func(string) (reflect.StructField, bool))*[]struct { key uint8; elem *pflag.Flag })*[]struct { key interface {}; elem bool })*[]struct { key string; elem *flag.Flag })*func([][]uint8, int, []int) (int, error))*func([]socket.Message, int) (int, error))*struct { F uintptr; X0 *quic.Transport })*struct { F uintptr; X0 *int; X1 *error } NetworkSizejson:"network_size,omitempty"SupportedEnginesjson:"supported_engines" DateCreatedjson:"date_created,omitempty")*func(context.Context, string, int) errorAllowedBandwidthjson:"allowed_bandwidth" BackendPortjson:"backend_port,omitempty" HealthCheckjson:"health_check,omitempty" SSLRedirectjson:"ssl_redirect,omitempty" GenericInfojson:"generic_info,omitempty")*[8]struct { key uint; elem sign.Scheme })*map[unicode.Endianness][9]identifier.MIB)*map.group[danger.TypeID]map[string][]int)*[]struct { key reflect.Value; elem int })*[]struct { key string; elem *yaml.Node })*struct { F uintptr; X0 *int; X1 string })*map.group[netlink.BondArpValidate]string)*map.group[netlink.BondFailOverMac]string)*map.group[string]netlink.BondArpValidate)*map.group[string]netlink.BondFailOverMac)*func() protoreflect.ExtensionDescriptors)*func(int) protoreflect.MessageDescriptor)*func(int) protoreflect.ServiceDescriptor)*func() protoreflect.EnumValueDescriptors)SetStartNewAggregationEpochAfterFullRound)*func(congestion.ByteCount) monotime.Time)github.com/apernet/quic-go/internal/utils)*ackhandler.skippingPacketNumberGenerator)*func(*jsontext.Encoder, time.Time) error)*struct { A spew.t0; spew.t0; a spew.t0 }ErrorDescriptionjson:"error_description")*map[string][]protoreflect.FileDescriptor)google.golang.org/protobuf/internal/order)*map.group[protoreflect.Kind]reflect.Type)*map[protowire.Number]reflect.StructField)*struct { F uintptr; X0 impl.structInfo })*struct { F uintptr; X0 *filedesc.Field } BindInterfacemapstructure:"bindInterface" TCPForwardingmapstructure:"tcpForwarding" UDPForwardingmapstructure:"udpForwarding" RewriteDomainmapstructure:"rewriteDomain"**struct { key string; elem zapcore.Level }**struct { F uintptr; R *cmd.clientConfig }**struct { F uintptr; R *certmagic.Config }y/{3٭U3_4N3e8cHm*3nna3Wn^3nЄ3g`|\QPUơ  o3W9ID l ){ښ l jɠ f l !`arsY l `B ǡ```dx4 `ȡ``R= ɡ9@W{ɡ ``jʡ``\fH`ˡ`XU(e ̡`XULx)̡ `X=tl͡`R3c,xG: - ` I - @% - $$qPשIwkTt .pHH_XשllNq\ą!ש 3$ - H` =M``4ש\(dGשl6 1h z1R(m9`}`nߕx(ݞ KKhݞ Vi,"l( Tlm -  Ѻpԅݞ t؅ݞ x0ˠ@@ی|Εݞ'| ϡ` j3-@`.}8 l | - **func([]uint8, []uint8, bool) interface {}**[0]*sync.entry[interface {},interface {}]**func(unsafe.Pointer, unsafe.Pointer) bool**struct { F uintptr; X0 func() hash.Hash }FJ3=-`rHr}3`;s 4a(3 ``iY@$`ԡ]y3{ w3 gc - g Z^L37Ur3cK - } { / s Jh3}|_ / ~H3g@ 934d3~@ 3' ٓ 3%;3z3ܧxpN l ]b $3W@n\":3զb l Xཪ@ĵ]V l  ?@@/Xt ০, l P`ɀ` l 5@@Wge l a@I3#i^3h $gѨ3u`\W` աdTGա u{ ֡@@@Wjx`ס!$k ءŤ lءڮ / ~f / ~^ l  @P l j@@𚥓X~ દ@00( (/c {q 0/ 44K .,c 44B6 .  `q{ h    - @  -  @/ m``E (١@* . H/ +@~x+ -  $@ 0) Ѕ ³ Y $@ȯ*O(`0` }@<;} h ;@z ³ G\| - { P/ R / r $@= - l#q -  $@ f1X X/ Am#@$? - {@@ `/  $@7f}$C AdditionalPrimesasn1:"optional,omitempty"**[8]struct { key string; elem []x509.OID }**struct { sync.Once; v *x509.Certificate }nj39|:$3K.1@<ݲj`ݡz3c@``nD ޡ >®ޡ`#)xߡ`Xt`($׿$A L] - #BlWV / /B 1hc  ó Y<  kq@$6 P }+1X` e h @(0l  / G l - 6$ / S~' `/ _,ƶ / `ܚ3ݞz3Zy3G`-3@@x7|3T~3m@Di 00 ˣDw}Y3o<@83֨o@**[8]struct { key string; elem net.byName }Jɳ3/.3 ׭;O#3|<3 @d6=3}ݞݞN3AKP<3g 3i9?@}8P3w`\``\ u `(k``&ZgVT@@TH'3 =n3I@y7pY 0 Pд(wnǥC$E`=-r3@!ADq3.`r**[0]*unique.indirect[net/netip.addrDetail]P~% l )d , l !@D`@@/EX`4 l mC l ૦ ?V l :% I{ l wD @@X ``  l k஦ ``F( x;|k bj3@dx@b}3 x`^v l u h l q \ l  `kY l o `@@Ä) Xj ద l `I @1 4ņF - u H1 ۥ`g3Wdʠ>3nd `*3.TH3}VW}  H@l 1 5  - #@@@xLX<``**struct { key int32; elem unsafe.Pointer }**[]struct { key uint32; elem []*abi.Type }**struct { key unsafe.Pointer; elem int32 }@@C})  1ri l ã44 G .@@ B H4 =C 0 - ^@J @4= 0P / Lj )l 1x'>Ě@Pt 1 =>C q1] - Ϥ]=  g  H4 WjDkzH h4  B p4 iG~6M h/ 8K 4߈Ś@{ @4  p# 4 Jަ  Te jen  ѝJt @4  6@:u / W ҝP* 4  pb 4 iU 3]@P 4 @  H4 Dys[3kΠ@Ϡ@7 4  @ s X/  $ 0 M 1h@@]  #@5 @/ @!@E! - /L&3E? p) 4 qp7 / ~ 3+M  w@@@~ȭ @!@'D~ }"`\ORBy@"a]"(ct|L@#x'/|{y@#@<.;#0< (/ 0^3\= @4 #i - @X@҈($Ι,4˩$Ip 4 @$ ҟ$ O p4 $ ActG 4 A  / @# / % ]tMl Jz$3lfA 5 @lB؂  l@ `1 - C@Gs `/ @`^ 5 @` , - @87s X4 [@3 - f@ 5 3@`t $('[4 - F@A3%@ƴI`ʥ& d 9;&Ly\3q@@@3ks3Z\$wG3X@@X(``m|w@(``|Tw @(00h t4ݞ**[]struct { key string; elem viper.Codec }!;)3_L3k@)@z;0r3@z8y)ߗ **struct { F uintptr; R *zap.sinkRegistry }lt3)&3z ? =3ϫ``' `+``rGpw +3`U()J *O C37~@Ц@Ц**map.group[string]*forwarding.sessionEntry``T+``Ӧ ^`,T@3l 8x h M@*}3D`rI$3Ƌ **func() (map[string]*v2geo.GeoSite, error)``ߋ@ -``p`-FLk3}aė3, b*github.com/apernet/hysteria/core/v2/client**func([]uint8, *protocol.UDPMessage) error**quic.incomingStreamEntry[go.shape.*uint8]f_3p$3 7@@QqR0`-|R~ p `/} ?3;`|/* /ܓu3 ``  /43O``C``0{39yEL l A>`1h l D1 ,3@|ǩ w  3e4i3}I``ww3```4x` l <5*github.com/apernet/hysteria/extras/v2/obfs((}tݞ**struct { key zapcore.Level; elem string }R3 '3yh3h\^$3he33B 3ߋtw3 ?Q32@Ц ত5M3^q 3 UY3e@K3ُ@`̣AT+ hO`6`\j=`@ 6`\l`m 6^l3E **[]struct { key string; elem *json.field }**[8]struct { key reflect.Type; elem bool }**struct { F uintptr; R json.arrayEncoder }**struct { F uintptr; R json.floatEncoder }**struct { F uintptr; R json.sliceEncoder }3`\y|` 7.V03` ``!i{ 7`\`` 8`\@`I `8**func(uint32, http.http2OpenStreamOptions)**map.group[*http.http2serverConn]struct {}**struct { key *http.conn; elem struct {} }**struct { key string; elem http.muxEntry }**map.group[*http.persistConn]*list.Element**map[*http.Request]context.CancelCauseFunc**func(string, *tls.Conn) http.RoundTripper**struct { F uintptr; R *http.http2stream }**struct { F uintptr; R *http.persistConn }**struct { F uintptr; R *httpproxy.config }**struct { F uintptr; X0 *http.connReader }W=31\3, Ru( (0  3iV^3Un Hq3W so|@^3j{`n@< ; @;O:63@`)3Yv``GR_a @@<.!|3 m .vg3|`r@<T2a&<@<{<@@0E7=``x7@@>-$Ԏa >$͙?@@r:?@81ξ44w @@@6P @@@XA@@$eX`g @A䬎 5Į`E3fp[3S5ਡ| @4 vLLp 8/ @<g< / {@% (; Hݟa"f_ 0; Hݟa **func(io.Reader) (*ecdh.PrivateKey, error)P@@b=aV\]ɤ*vendor/golang.org/x/crypto/cryptobyte/asn1**[]struct { key reflect.visit; elem bool }**struct { F uintptr; X0 []unsafe.Pointer }x3+@ŬL3]@uQ3!3̲@@ŬkT3(>bb8C3G@-F+3*"{>3O ݞTn43@@O@<;:Jc@<3K+K dft/H@L`d@@MX`Md``fp`P`ẹ36 ѩ`XJp? Qfu P< `\Z`z+Qf`\h`+Rg`\shY`X`S@g``^Y Ti'?!3Iݞ|" 1h?^`@hi4 l ǶFM+ l @@**[8]struct { key uint8; elem *pflag.Flag }@@nvTj'd3C@8`3_xh h G@och  F@**func() ([][]locafero.searchResult, error)[p3c@k3kU$Ԥ@kxx?p.@)**[8]struct { key interface {}; elem bool }**map[go.shape.string]go.shape.interface {}!;3ݞ`\l` Ul@@cU VmS3A`w `W@mN! P4 .mx}B, X n**[8]struct { key string; elem *flag.Flag }``N] `ZnC((nT13ǔA3ߔU3Rg3qm! 3q!a3q?[ p> ?k 3r  (3ob ؓ[py"7̏0\@q@@:k`]q@܏/; ^@r! 3ͫǫj@i܏^u૑ 1hUqwp` ԅHqbiW F Z3kL Z``v;3ק]3`\0` ax`X@a@x**func([]uint8, uint16, protocol.ECN) error**func(protocol.StreamID, *quic.SendStream)**func(context.Context) (*quic.Conn, error)**quic.retransmissionQueueInitialAckHandler**quic.retransmissionQueueAppDataAckHandler**func(protocol.Version) protocol.ByteCount**struct { F uintptr; X0 *quic.streamsMap }**struct { F uintptr; R *wire.StreamFrame }**struct { F uintptr; X0 *quic.baseServer } 3,q@:Q3@:3ۄn@'u3ns83hE7®>ֵ b~ `c 7x3@3 ď dؚ3bnP3'Oa\ d 43r3'9j! 2rf`Y&4D f7 g `2 - `d3 l @h _lJ i`o`3mL 3l}ŞU3=A>33Ή Ş -x -܅`P - /@ƞ=$^' l 7D g3h(@ƞ 1h Y O`~+x(YZd`١3_@ƞ**struct { F uintptr; R *http3.ClientConn }**struct { F uintptr; X0 *http3.Transport }``$}P n@v3`0%l Jn``S  o@X`3Ԯ37 h P}n ? _L<]4) h> O```x;siP3 4a3ڸYL /I@QDΰf'wds tz (v` xKc:\xK||@u`$@ 4 F@ LLQ@**func(*dns.zlexer, string) *dns.ParseError**func([]uint8, *dns.TSIG) ([]uint8, error)**[]struct { key string; elem dns.Handler }**[]struct { key dns.SVCBKey; elem string }**[]struct { key string; elem dns.SVCBKey }**struct { key uint16; elem func() dns.RR }R 3% 3Ix`]r3"`~e݀v `\j:` v``XM7w`XQ@x@@@~y `\,v `Ly``\l`Qz@X3`StartupScriptIDjson:"script_id,omitempty" Applicationsjson:"applications,omitempty"**govultr.ContainerRegistryRegionDataCenterRedisACLChannelsjson:"redis_acl_channels"RedisACLCommandsjson:"redis_acl_commands"te@$ |``Vk@$}`k{3{ƫk A+v`~`۝3n3W@}``,  53f`(l pA_`ߟ 9/>Q A 9 *b xA0zߟ8a/ A ǿaUV AHzߟ ` rL A zL``F A ӿ@2XE A 2 4 *crypto/internal/fips140/edwards25519/field**[]struct { key *syntax.Regexp; elem int }**struct { key *syntax.Regexp; elem int64 }LE 1h @@<E4R&@`X@aW|h.шK / ! Ξ@ \  **[8]struct { key reflect.Value; elem int }@@X@@x.¯ B**struct { handle []uint8; suffix []uint8 }**[8]struct { key string; elem *yaml.Node }3 +@<X)ଡ଼@8:ʹ ܒ ``ezx0````WeB +tஜ@ mx& 6 @`XSE .``\ S`. *github.com/sagernet/sing/common/exceptions**struct { key int; elem *nl.SocketHandle }3u@ߦt)3YߦrM - 5x0,& H ``\;` `\?2<`u``\̍ `c``\3<` ౜`\yF*` `\u#`0/``\/_` ``\Z+(H` ಜ`\ɔl` > `\غ ``@@^?``XK ೜`XÝ `X)``X8G``X'y ജ`X' `XC0 ``XOy>``X&d ൜`Xw ((OH  /Іy B a@f34j`f3 k**func(string) protoreflect.FieldDescriptor ]3 QC{3v au3 a8SV3  a8S;3CkI3vw@k3C`Vӧ3Y@`WZ+3xCdWٴ3}@d3+Cө#3@ө'3 5XTE3  XUQ3 T@Xs3ȷ@3>@C!  'Ğ3 @`Q3Ğ&3Cө13 Ğөxbi34@ө‚3,C`el3HT@`e3@@&M  XLผ&3d@SFL3>L U3Lkj93bLk3OC%/f3Cx@6#Y3'@Lp3k8 ,3фk:3pT8ݞeUH3e8 3Tݞ8]` 3dk8X3 koE3R@83e@8;[3/ĞTd43@+31@**map.group[int32]protoreflect.ProtoMessage``qm ֏{T4e@ t` - j`@yg?f3MǞZB3Ǟxl :  v?c)33@pϣ3u@`3@`@`.$x`**func(protocol.PacketNumber, protocol.ECN)3p3,[Şo3@  >X3py3O@ƞ3y@ƞmd3Fy~U31 Ş!ֳ3x@ƞӊ'3d3y@ƞ3@ƞ:3  L@3΃NC /@ΰY|ds@ؤ h/ G@| D @<L 7 #{@D r~ 00 +@7u3u ڬ.ǒ / V  `X Of3`\mG`z+ œ`\=`+ढ@œ`\3iz`œ`\kH``œ`\t_`X Üp 4 gৢÜ**[]struct { key string; elem sign.Scheme }"v@ĜV^3v%y@36>K3*t#$uĜ- 3$"z.3ù  **[]struct { key *gob.typeInfo; elem bool }@ Ɯy=3` l ǛȜ@<,Ȝ@@ڲVv@ɜ``_x0@ɜ``Vxvɜٔwd@ɜ*google.golang.org/protobuf/internal/errors*google.golang.org/protobuf/internal/pragma .3%+*b ʜ u `˜U3${3/zwQ 3S``Gn @˜``Ĝ?o ఢ˜**[]struct { key string; elem token.Token }`XB˜**map[protoreflect.Name]*filedesc.EnumValue**struct { key filedesc.pathKey; elem int }**map[protoreflect.Name]*filedesc.Extension``[` @͜@@t `͜`XEy@0 Μ``b! ൢϜ``@^#@Ϝ@@_ M`ϜT М2 ย@М``P М``؈* `ќ@J v ќ``ک9໢Ҝ``^>p @Ҝ``6K `Ӝ``zL Ӝ Y^̏s@Ԝ``J] Ԝ`0 $} Ԝ $J#՜``Y¢@՜**func(impl.pointer) protoreflect.RawFields**map[protowire.Number]*impl.coderFieldInfo**map[protoreflect.Name]reflect.StructField**struct { F uintptr; R *impl.MessageInfo } 3x8)O3Ir$3hr8p;3zr8@@踬`â՜e3rL``ĉh Ģ ֜``gĢ`֜#3Lor XW5%3Pr X3 @8-|S30ir@@@X; Ţ לG"m8 `Ƣ`ל;\IX` Ǣל`\I`@Ǣל``h\xȢ ؜bZK3z8 K3z 8``T]x `ɢ`؜eOd@ ʢ؜13\@w8|3~5**struct { F uintptr; R *socket.syscaller }(P D D6Wv3 7@8;kܒϢݜ``#x0Т ޜ``u,B@Ѣ`ޜPXtҢޜt$N{Ңޜ+*[]struct { key string; elem func() error }+*struct { F uintptr; X0 *cmd.serverConfig }+*struct { F uintptr; X0 string; X1 string }+*struct { F uintptr; X0 *x509.Certificate }+*struct { key string; elem map[string]int }+*struct { F uintptr; X0 *net.pipeDeadline }+*sync.node[*internal/abi.Type,interface {}]+*[]*go.shape.struct { unique.isEntry bool }+*map.group[chan<- os.Signal]*signal.handler+*struct { key abi.TypeOff; elem *abi.Type }+*[]struct { key string; elem interface {} }+*[8]struct { key uint32; elem []*abi.Type }+*map.group[pflag.NormalizedName]*pflag.Flag+*[8]struct { key string; elem viper.Codec }+*[]struct { key string; elem *v2geo.GeoIP }+*struct { key string; elem *v2geo.GeoSite }+*func(string, zapcore.ArrayMarshaler) error+*func(zapcore.Entry, []zapcore.Field) error CallerKey!json:"callerKey" yaml:"callerKey"+*struct { F uintptr; X0 *context.timerCtx }+*[8]struct { key string; elem *json.field }+*struct { F uintptr; R json.structEncoder }+*func() (http.http2FrameWriteRequest, bool)+*http.mapping[string,*net/http.routingNode]+*[]http.entry[string,*net/http.routingNode]+*struct { key http.ConnState; elem string }+*struct { key string; elem []*http.Cookie }+*func(*http.Request, []*http.Request) error+*struct { F uintptr; X0 *http.http2Server }+*struct { F uintptr; X0 *http.http2Framer }+*struct { F uintptr; X0 *http.persistConn }+*struct { key string; elem chan struct {} }+*[]struct { key string; elem acmez.Solver } LatDirectionjson:"lat_direction,omitempty" MatchingTypejson:"matching_type,omitempty"OriginalRegistrarjson:"original_registrar"+*struct { Status string "json:\"status\"" }+*func(server.HyStream, *server.StreamStats)+*struct { F uintptr; R *server.h3sHandler }+github.com/hashicorp/golang-lru/v2/internal+*struct { F uintptr; X0 *error; X1 string }+github.com/apernet/hysteria/extras/v2/sniff+github.com/apernet/hysteria/extras/v2/utils+vendor/golang.org/x/crypto/chacha20poly1305+*[8]struct { key reflect.visit; elem bool }+*struct { key netip.AddrPort; elem uint16 }+*bbr.entry[go.shape.uint64,go.shape.uint64]+*func(go.shape.uint64, go.shape.uint64) int+*func() (handshake.LongHeaderSealer, error)+*struct { F uintptr; X0 *error; X1 *error }+*func(io.Reader, *http3.headersFrame) error Certificatesasn1:"explicit,tag:0,optional" PublicKey!dns:"size-base64:PublicKeyLength"+*[8]struct { key string; elem dns.Handler }+*[8]struct { key dns.SVCBKey; elem string }+*[8]struct { key string; elem dns.SVCBKey } RefreshTokenjson:"refresh_token,omitempty" ReservedIPv4json:"reserved_ipv4,omitempty" AppVariablesjson:"app_variables,omitempty"+*govultr.ContainerRegistryDockerCredentials ReadReplicasjson:"read_replicas,omitempty" LatestBackupjson:"latest_backup,omitempty" OldestBackupjson:"oldest_backup,omitempty" ResourceTypejson:"resource_type,omitempty" NodeQuantityjson:"node_quantity,omitempty" FrontendPortjson:"frontend_port,omitempty"+*[8]struct { key *syntax.Regexp; elem int }+*struct { key string; elem yaml.fieldInfo }+*map.group[netlink.BondArpAllTargets]string+*map.group[string]netlink.BondArpAllTargets+*map.group[protoreflect.Kind]protowire.Type+appendEnumDescriptorProto_EnumReservedRange+*func(int) protoreflect.EnumValueDescriptor+*ackhandler.sequentialPacketNumberGenerator+*func() (handshake.LongHeaderOpener, error)+parseLiteralHeaderFieldWithoutNameReference+*[8]struct { key string; elem sign.Scheme }+*[8]struct { key *gob.typeInfo; elem bool }+*[8]struct { key string; elem token.Token }+*struct { F uintptr; X0 *[]order.mapEntry }+*struct { key protoreflect.Name; elem int }+*map.group[protowire.Number]*filedesc.Field+*map.group[protoreflect.Name]*filedesc.Enum+*map.group[protowire.Number]*impl.fieldInfo+*func(impl.pointer, protoreflect.RawFields)+*struct { F uintptr; X0 *impl.MessageInfo }+google.golang.org/protobuf/internal/descfmtMinHopIntervalmapstructure:"minHopInterval"MaxHopIntervalmapstructure:"maxHopInterval"MaxIdleTimeoutmapstructure:"maxIdleTimeout"DisableTLSALPNmapstructure:"disableTLSALPN"AltTLSALPNPortmapstructure:"altTLSALPNPort"UDPIdleTimeoutmapstructure:"udpIdleTimeout",*map[string]*trafficlogger.trafficStatsEntry,*[8]struct { key string; elem func() error },*[]struct { key string; elem zapcore.Level },*struct { F uintptr; X0 chan cmd.modeError },*struct { F uintptr; X0 **certmagic.Config },*func(string, []uint8, int) ([]uint8, error),*func(func(interface {}, interface {}) bool),*sync.HashTrieMap[interface {},interface {}],*[]*sync.indirect[interface {},interface {}] NamedCurveOIDasn1:"optional,explicit,tag:0",*func(string, string, syscall.RawConn) error,*struct { key string; elem []net.nssSource },*sync.entry[*internal/abi.Type,interface {}],*struct { key *abi.Type; elem interface {} },*[0]*go.shape.struct { unique.isEntry bool },*struct { len int; buf [128]*runtime.mspan },*[]struct { key int32; elem unsafe.Pointer },*[8]struct { key string; elem interface {} },*[]struct { key unsafe.Pointer; elem int32 },*struct { key string; elem map[string]bool },*struct { key string; elem viper.FlagValue },*map[string]func(*url.URL) (zap.Sink, error),*[8]struct { key string; elem *v2geo.GeoIP },*struct { key uint32; elem *client.udpConn },*func(protocol.StreamID) *quic.ReceiveStream,*map.group[protocol.StreamID]go.shape.*uint8,*func(string, zapcore.ObjectMarshaler) error,*[]struct { key zapcore.Level; elem string },*struct { F uintptr; X0 *context.cancelCtx },*struct { key interface {}; elem struct {} },*func(*http.Server, *tls.Conn, http.Handler),*func() (net.Conn, *bufio.ReadWriter, error),*[]struct { key *http.conn; elem struct {} },*[]struct { key string; elem http.muxEntry },*func(*http.Request) (*http.Response, error),*interface { UnencryptedNetConn() net.Conn },*struct { key http.http2Flags; elem string },*func(context.Context, string, string) error,*func(context.Context, []string, bool) error,*func(context.Context, acme.Challenge) error,*map[string]*certmagic.RingBufferRateLimiter,*[8]struct { key string; elem acmez.Solver }DomainRecordsHrefjson:"domain_records_href" CAAIdentitiesjson:"caaIdentities,omitempty",github.com/hashicorp/golang-lru/v2/simplelru,*func(weak.Pointer[crypto/ecdsa.PrivateKey]),*struct { key dnsmessage.Type; elem string },*struct { key uint16; elem *tun.TCPSession },*func(*buf.Buffer, metadata.Socksaddr) error,*func() (handshake.ShortHeaderSealer, error),*quic.retransmissionQueueHandshakeAckHandler,*struct { F uintptr; R *quic.connIDManager } RequestorNameasn1:"explicit,tag:1,optional",*map.group[crypto.Hash]asn1.ObjectIdentifier,*[]struct { key uint16; elem func() dns.RR }LastPaymentAmountjson:"last_payment_amount" RedisACLKeysjson:"redis_acl_keys,omitempty" IPXEChainURLjson:"ipxe_chain_url,omitempty",*[]struct { key *syntax.Regexp; elem int64 },*map.group[netlink.BondXmitHashPolicy]string,*[]struct { key int; elem *nl.SocketHandle },*map.group[string]netlink.BondXmitHashPolicy,*func() protoreflect.ExtensionTypeDescriptor,github.com/apernet/quic-go/internal/protocol,github.com/apernet/quic-go/internal/monotime,*func() (handshake.ShortHeaderOpener, error),google.golang.org/protobuf/internal/filedesc,*map.group[protoreflect.Name]*filedesc.Field,*struct { key string; elem *filedesc.Field },*map.group[protoreflect.Name]*filedesc.Oneof,*[]struct { key filedesc.pathKey; elem int },*struct { key filedesc.pathKey; elem []int },google.golang.org/protobuf/internal/filetype,*map.group[protoreflect.Name]*impl.oneofInfo,*map.group[reflect.Type]*impl.coderFieldInfo-*[8]struct { key string; elem zapcore.Level }-*struct { F uintptr; X0 *masq.MasqTCPServer }-*struct { key string; elem *tls.Certificate }-*func([][]uint8, [][]*x509.Certificate) error-*func(string) (*tls.ClientSessionState, bool)-*[0]*sync.indirect[interface {},interface {}]-*[]struct { key string; elem map[string]int }-*func() go.shape.interface { Error() string }-*[]struct { key abi.TypeOff; elem *abi.Type }-*[8]struct { key int32; elem unsafe.Pointer }-*[8]struct { key unsafe.Pointer; elem int32 }-*struct { F uintptr; R runtime.metricReader }-*struct { F uintptr; X0 *bool; X1 io.Writer }-*struct { F uintptr; X0 io.Writer; X1 *bool }-*func([]uint8, map[string]interface {}) error-*struct { F uintptr; X0 zapcore.WriteSyncer }-*[]struct { key string; elem *v2geo.GeoSite }-*map.group[protocol.StreamID]*quic.SendStream-*func(utils.ByteInterval) *utils.ByteInterval-*func(*zapcore.CheckedEntry, []zapcore.Field)-*[8]struct { key zapcore.Level; elem string }-*struct { F uintptr; R json.condAddrEncoder }-*struct { key *net.Listener; elem struct {} }-*[8]struct { key *http.conn; elem struct {} }-*[8]struct { key string; elem http.muxEntry }-*map[http.connectMethodKey]http.wantConnQueue-*struct { key [8]uint8; elem chan struct {} }-*[]struct { key http.ConnState; elem string }-*[]struct { key string; elem []*http.Cookie }-*func(context.Context, string, []uint8) error-*[]struct { key string; elem chan struct {} } LongDirectionjson:"long_direction,omitempty" PrecisionHorzjson:"precision_horz,omitempty" PrecisionVertjson:"precision_vert,omitempty"AutomaticSnapshotsjson:"automatic_snapshots"-*map.group[string]outbounds.PluggableOutbound-*struct { key *reflect.structType; elem int }-*struct { F uintptr; X0 *reflect.structType }-*func(fmtsort.KeyValue, fmtsort.KeyValue) int-*struct { key dnsmessage.Class; elem string }-*struct { key dnsmessage.RCode; elem string }-github.com/spf13/viper/internal/encoding/json-github.com/spf13/viper/internal/encoding/toml-github.com/spf13/viper/internal/encoding/yaml-*struct { key reflect.Value; elem struct {} }-*[]struct { key netip.AddrPort; elem uint16 }-*[]bbr.entry[go.shape.uint64,go.shape.uint64]-*func(*quic.ClientInfo) (*quic.Config, error)-*map[protocol.ConnectionID]quic.packetHandler-*map[protocol.ConnectionID]*quic.zeroRTTQueue-*map[protocol.ByteCount]quic.frameSorterEntry-*func(*wire.StreamFrame, monotime.Time) error-*map[quic.connRunner]quic.connRunnerCallbacks-*map[protocol.StreamID]quic.streamFrameGetter-*struct { F uintptr; R *http3.RawServerConn }-*[8]struct { key uint16; elem func() dns.RR } PersistentPxejson:"persistent_pxe,omitempty"-*govultr.ContainerRegistrySubscriptionBilling AccessControljson:"access_control,omitempty" BGWRITERDelayjson:"bgwriter_delay,omitempty" CheckIntervaljson:"check_interval,omitempty" ProxyProtocoljson:"proxy_protocol,omitempty" FirewallRulesjson:"firewall_rules,omitempty"-*[8]struct { key *syntax.Regexp; elem int64 }-*struct { key string; elem syntax.charGroup }-*[]struct { key string; elem yaml.fieldInfo }-*struct { key string; elem template.element }-*struct { key reflect.Type; elem gob.typeId }-*struct { key netlink.BondMode; elem string }-*map.group[netlink.BondPrimaryReselect]string-*[8]struct { key int; elem *nl.SocketHandle }-*map.group[string]netlink.BondPrimaryReselect-*func(protoreflect.MapKey) protoreflect.Value-bytesLostMultiplierWhileDetectingOvershooting-github.com/apernet/quic-go/internal/handshake-github.com/cloudflare/circl/sign/eddilithium3-*struct { key reflect.Type; elem *gob.encOp }-google.golang.org/protobuf/runtime/protoiface-google.golang.org/protobuf/encoding/protowire-*map.group[protoreflect.FullName]interface {}-*[]struct { key protoreflect.Name; elem int }-*map.group[protoreflect.Name]*filedesc.Method-*[8]struct { key filedesc.pathKey; elem int }-google.golang.org/protobuf/encoding/prototext-github.com/cloudflare/circl/sign/eddilithium2hyh !\ٿNh @ЁKh 9DP)[2h ,@PCh PcRr³ _ ~y³ ~ A³ 5= ~2pH4%³ #@yvj³ 1³ 1ל& ³ Hh 1@ h HC")f 1:p H4h b@<h ##\ h b>ó ; wó B@}r ó bҦló bH`O³ *#Fզ:h?o@1;³ ?]Fkh y]F;ݜ} h ]Fw³ ]Fj) 5]FK2h @]F><pr]Fۂ ³ ]F3ˉ h ]F? ]F^_[ h g@KD h _q@KQ³ =ê h @dA.h Mi?$ E@ ish ijh l@i1p p}vh G@@8h @³ ( $M h c  y ³ !hHKh ,*fq(³ ϴ@*Z'h N5nޘh IFE)³ "@H?fp+~''`³ @h @e/h Y_h  ZZ³ , Xq³ !l-:³  T_  G h  6 ³ 1*h 6 Ύ9pE[³ H   !#Ch !h } "/ó ;#"{* ó P# #(; qJ#Tҝ³ Z;h p"h  &VN pq"'fh J@# h k'p@\wf7p\wQ4p\wSi pǣ\ws pߣ@\wݕpb\wpR\w}zh b] h }w3!Ph {@}wǾ6³  Ih G5@<@h E g @G³ "wn^³ 5$ՎY³ $ѣȇ:hIg!³ h ǓCv³ w^L" ̂@0w ³ nC h À> h ]ih [Q³ ?:³ ;³ &@;Uh z׻³ @1 h 9bh ןA/h @_h 9 [³ A@KeepAlivePeriodmapstructure:"keepAlivePeriod".*map.group[server.HyStream]*server.StreamStats`v3?gn73UnҚ3`gn#s3]+a!q3 ynnl\3!kn k)3V l ԞpP^wH3@`.*func(*big.Int, *big.Int) (*big.Int, *big.Int)L3݄2h3r  9v3r$ b`ql3 '3! Z]3$t @Hc*3{˦Y3@:Wq3VĮĮO 3sĮĮ;=38ݞݞ~ދ3@pm*3@@3v`³ l^խ3h 53@@Єo3@.*[]struct { key string; elem []net.nssSource }.*[8]struct { key string; elem map[string]int }C3@83i<3iz9Dz300@.*[]*sync.node[*internal/abi.Type,interface {}].*[]struct { key *abi.Type; elem interface {} }3  ݞl3@ 35@q3.@x3Tk3C3} Ed3i}3/ww@.*[8]struct { key abi.TypeOff; elem *abi.Type }9x(ޞd`3Tݞi 3$`͠@+Jc3/?@@5/3jC h %^xL35@.*[]struct { key string; elem map[string]bool } X3GH3MѰf3XݞK3$'=33_X.*[]struct { key string; elem viper.FlagValue }ǔ3@=]i3l ^'3ܗ3 ^A3`k3_m`r43p`r9.*func(zapcore.Entry, zapcore.SamplingDecision) Thereafter#json:"thereafter" yaml:"thereafter".*struct { F uintptr; X0 zapcore.LevelEnabler }{3*o^3h3ګ@&! 3/.*struct { F uintptr; R *proxymux.muxListener }#3#@.*[8]struct { key string; elem *v2geo.GeoSite }.*[]struct { key uint32; elem *client.udpConn }.github.com/apernet/quic-go/internal/utils/treeH3gl ?4+3~Z3%ݚ@2"3x 7Bx 3s @B\a3&78y3|@ MessageKey#json:"messageKey" yaml:"messageKey" LineEnding#json:"lineEnding" yaml:"lineEnding"I3\zȶU3@r R3ݞ:ھ3ʴ ` G-D3z`;C|3.*[]struct { key interface {}; elem struct {} }rT3lन@ܳ\L3@!@!@'3@.*struct { key uint32; elem *http.http2stream }.*struct { key string; elem *http.routingNode }.*map[http.connectMethodKey][]*http.persistConn.*[8]struct { key http.ConnState; elem string }.*struct { key http.http2ErrCode; elem string }.*[]struct { key http.http2Flags; elem string }.*struct { key http.http2SettingID; elem bool }.*[8]struct { key string; elem []*http.Cookie }.*struct { key string; elem http.RoundTripper }.*struct { F uintptr; X0 *http.transferWriter }.*struct { F uintptr; R *http.http2ClientConn }.*struct { F uintptr; R *http.http2serverConn }Jq3@` ?3O '}x3&`r `r3} d*z3@t?3٭ RF31٭o\n34 ݥ32@ g~3GҦ3K@3[ j3K|٭ ,!3")٭.*struct { key string; elem *certmagic.Config }.*map.group[string][]certmagic.dnsPresentMemory.*[8]struct { key string; elem chan struct {} }.*struct { key string; elem certmagic.KeyInfo }.*struct { key string; elem certmagic.Storage }33`r#93]`r7ꂾ39`r'3`r ".*struct { key string; elem gandi.gandiDomain }TermsOfServicejson:"termsOfService,omitempty".*func(net.Addr, string, uint64) (bool, string)W3G(!`3 13A.*func([]uint8) (int, *outbounds.AddrEx, error).*func([]uint8, *outbounds.AddrEx) (int, error)43 t3o fC3.6Aaᒉ3g ##@ͦ+ [^L3,8337q fC3,~3\37qH.*struct { key *reflect.structType; elem bool }83"3~`f!3v@Og3_`̤`̤@ӕ3f.*[]struct { key dnsmessage.Type; elem string }9 ³ ySg^c3փ36|36@CYj3_^Yf3^363@t3"I3AIP3YY3`IyH*36mM3^@@.3*@@@.*func(func() ([]locafero.searchResult, error))63!<F33IG3g++@Vl3/@.*func() (unsafe.Pointer, unix._Socklen, error)eQ+3@.*[8]struct { key netip.AddrPort; elem uint16 }.*[]struct { key uint16; elem *tun.TCPSession }x8`3px@D+3C  @43S ;ͅ3 iu.*func(*buf.Buffer) (metadata.Socksaddr, error)uc<3 iu4\|3r@Ğ@Ğ@oN3)q@V@3Ԟ@? 3@.*func(qerr.ApplicationErrorCode, string) error.*func([]uint8, protocol.EncryptionLevel) error DL3973^Ԯn`w93_nw!3*3`7v*`3)7:3؝`@`T3Z"%5c3ž hz!3ƞ–m3'`rԮ3r`r?D3 @ƞV3 @ƞ@ƞX -3  a-3  Şƞf@?3qB-3r@.*func(*quic.ReceiveStream, *http3.frameParser).*map.group[string]*http3.roundTripperWithCount%3V13`rT134]`rԮ`r.*struct { key string; elem map[string]string }+3@S@3,7@ wt3UrAttachedToInstancejson:"attached_to_instance" MySQLSQLModes json:"mysql_sql_modes,omitempty"RedisACLCategoriesjson:"redis_acl_categories" LogLinePrefix json:"log_line_prefix,omitempty" MaxStackDepth json:"max_stack_depth,omitempty" MaxWalSenders json:"max_wal_senders,omitempty" TempFileLimit json:"temp_file_limit,omitempty" TrackIOTiming json:"track_io_timing,omitempty"Recommendationjson:"recommendation,omitempty"StickySessionsjson:"sticky_session,omitempty"e3݄@o\3r `@ J3r$` C3!f4@#3{ަ.*[8]struct { key string; elem yaml.fieldInfo }.*struct { key netlink.IPoIBMode; elem string }.*struct { key string; elem netlink.IPoIBMode }.*struct { pragma.NoUnkeyedLiterals; Size int }.*struct { F uintptr; X0 protoreflect.Message }V3r ~hL3* 3Xad3C .*func(protoreflect.MapKey, protoreflect.Value)(3u a8͎>3: k8>B3x_ ǞǞǞ.*struct { F uintptr; X0 *brutal.BrutalSender }=%34 @Ǟ@Ǟ@.github.com/apernet/quic-go/internal/ackhandler.*func(protocol.EncryptionLevel, monotime.Time)y3( Ş@ƞ@ƞ.*func(protocol.ByteCount, monotime.Time) error@ٞ3(c@ƞV3 @ƞb\3!g ŞƞŞX3/!@ۨcj3:@sg,3w3;|8R& 3*0@%Sa3\0@% $*39yY[3e@%.*func([]uint8) (kem.PublicKey, kem.PrivateKey).*func(kem.PublicKey) ([]uint8, []uint8, error).*func() (kem.PublicKey, kem.PrivateKey, error)٦3%뚷3%iN3fzQY3i %.*struct { key reflect.Type; elem gob.gobType }953U ~5l0m3h%Nl[3 ~ޔ3".*[8]struct { key protoreflect.Name; elem int }.*[]struct { key string; elem *filedesc.Field }.*map.group[string]protoreflect.FieldDescriptor.*map.group[protoreflect.Name]*filedesc.Message.*map.group[protoreflect.Name]*filedesc.Service.*map[filedesc.Edition]filedesc.EditionFeatures.*[]struct { key filedesc.pathKey; elem []int }}e3@@@=X3{#r@՛3rr@՛.github.com/apernet/quic-go/internal/congestion.github.com/apernet/quic-go/qlogwriter/jsontext.github.com/cloudflare/circl/kem/kyber/kyber512.github.com/cloudflare/circl/kem/kyber/kyber768.golang.org/x/text/encoding/internal/identifier/*[]struct { key string; elem *tls.Certificate }/*struct { key interface {}; elem interface {} }/*go.shape.struct { internal/sync.isEntry bool }/*[8]struct { key string; elem []net.nssSource }/*func(net.byRFC6724Info, net.byRFC6724Info) int/*sync.indirect[*internal/abi.Type,interface {}]/*[]*sync.entry[*internal/abi.Type,interface {}]/*[0]*sync.node[*internal/abi.Type,interface {}]/*[8]struct { key *abi.Type; elem interface {} }/*struct { key string; elem runtime.metricData }/*[8]struct { key string; elem map[string]bool }/*[8]struct { key string; elem viper.FlagValue }/*func(map[string]interface {}) ([]uint8, error)/*struct { F uintptr; X0 *proxymux.muxListener }/github.com/apernet/hysteria/app/v2/internal/tun/github.com/apernet/hysteria/app/v2/internal/url/*[8]struct { key uint32; elem *client.udpConn }/*struct { key zapcore.Level; elem color.Color }/*struct { F uintptr; X0 *context.afterFuncCtx }/*[8]struct { key interface {}; elem struct {} }/*[]struct { key *net.Listener; elem struct {} }/*map.group[http.routingIndexKey][]*http.pattern/*struct { key http.connectMethodKey; elem int }/*[]struct { key [8]uint8; elem chan struct {} }/*[8]struct { key http.http2Flags; elem string }/*struct { F uintptr; X0 *http.http2ClientConn }/*struct { F uintptr; X0 *http.http2serverConn }/*func(context.Context, string) ([]uint8, error)/*struct { F uintptr; X0 *certmagic.ACMEIssuer }/*struct { F uintptr; X0 *certmagic.jobManager }/*struct { key string; elem *cloudflare.cfZone }OverrideDomain json:"override_domain,omitempty"/github.com/apernet/hysteria/extras/v2/outbounds/*[]struct { key *reflect.structType; elem int }/*[]struct { key dnsmessage.Class; elem string }/*[]struct { key dnsmessage.RCode; elem string }/*[8]struct { key dnsmessage.Type; elem string }/*struct { key dnsmessage.section; elem string }/*struct { key string; elem *singleflight.call }/github.com/spf13/viper/internal/encoding/dotenv/*[]struct { key reflect.Value; elem struct {} }/*[8]struct { key uint16; elem *tun.TCPSession }/*func(*quic.packetBuffer, uint16, protocol.ECN)SingleExtensionsasn1:"explicit,tag:1,optional"DatabaseEngine json:"database_engine,omitempty"MaintenanceDOW json:"maintenance_dow,omitempty"TrackFunctions json:"track_functions,omitempty"MaxConnections json:"max_connections,omitempty"DDOSProtection json:"ddos_protection,omitempty"EnableFirewall json:"enable_firewall,omitempty"UpgradeVersion json:"upgrade_version,omitempty"PrivateNetwork json:"private_network,omitempty"StickySessions json:"sticky_sessions,omitempty"/*[]struct { key string; elem syntax.charGroup }/*map.group[unicode.Endianness][9]identifier.MIB/*func([]uint8, []uint8, bool) (int, int, error)/*[]struct { key string; elem template.element }/*[]struct { key reflect.Type; elem gob.typeId }/*[]struct { key netlink.BondMode; elem string }/*struct { key string; elem netlink.TuntapMode }/google.golang.org/protobuf/reflect/protoreflect/*struct { key int32; elem impl.ExtensionField }/github.com/apernet/quic-go/internal/flowcontrol/*func([]uint8, []uint8) *handshake.xorNonceAEAD/*struct { key string; elem internal.AuthStyle }/*struct { laddr unix.SockaddrInet6; value int }/*func(kem.PrivateKey, []uint8) ([]uint8, error)/github.com/pelletier/go-toml/v2/internal/danger/*func() (map[string]int32, map[string][2]int32)/*[]struct { key reflect.Type; elem *gob.encOp }/*map.group[string][]protoreflect.FileDescriptor/*func(string) (protoreflect.MessageType, error)/*struct { F uintptr; X0 *[]order.messageField }/*[8]struct { key string; elem *filedesc.Field }/*[8]struct { key filedesc.pathKey; elem []int }/*func(impl.pointer, *impl.coderFieldInfo) error/*map.group[protowire.Number]reflect.StructField/github.com/cloudflare/circl/kem/kyber/kyber10240*struct { F uintptr; R *sockopts.SocketOptions }0*[8]struct { key string; elem *tls.Certificate }0*func(*tls.ClientHelloInfo) (*tls.Config, error)Version(asn1:"optional,explicit,default:0,tag:0"0*struct { key *x509.policyGraphNode; elem bool }0*struct { key net.hostLookupOrder; elem string }0*[0]*sync.entry[*internal/abi.Type,interface {}]0*struct { key netip.addrDetail; elem struct {} }0github.com/apernet/hysteria/app/v2/internal/http0*func(client.Client, *client.HandshakeInfo, int)0*func(quic.pathID) (protocol.ConnectionID, bool) EncodeTime%json:"timeEncoder" yaml:"timeEncoder" EncodeName%json:"nameEncoder" yaml:"nameEncoder"0*struct { key context.canceler; elem struct {} }0*func(context.Context, net.Conn) context.Context0*[8]struct { key *net.Listener; elem struct {} }0*[]struct { key uint32; elem *http.http2stream }0*[]struct { key string; elem *http.routingNode }0*map.group[*http.Request]context.CancelCauseFunc0*[8]struct { key [8]uint8; elem chan struct {} }0*struct { key string; elem *http.http2dialCall }0*[]struct { key http.http2ErrCode; elem string }0*[]struct { key http.http2SettingID; elem bool }0*struct { key http.http2SettingID; elem string }0*[]struct { key string; elem http.RoundTripper }0*struct { F uintptr; R *http.http2clientStream }0*func(http.ResponseWriter, *http.Request, error)0*[]struct { key string; elem *certmagic.Config }0*struct { key string; elem certmagic.Challenge }0*[]struct { key string; elem certmagic.KeyInfo }0*[]struct { key string; elem certmagic.Storage }OriginalNameServersjson:"original_name_servers"0*[]struct { key string; elem gandi.gandiDomain }0*struct { F uintptr; X0 firewall.commandRunner }0*func(server.HyStream, *string) ([]uint8, error)0*[]struct { key *reflect.structType; elem bool }0*[8]struct { key *reflect.structType; elem int }0*struct { key string; elem *unicode.RangeTable }0*[8]struct { key dnsmessage.Class; elem string }0*[8]struct { key dnsmessage.RCode; elem string }0github.com/sagikazarmark/locafero/internal/queue0*map.group[go.shape.string]go.shape.interface {}0*[8]struct { key reflect.Value; elem struct {} }0*struct { key quic.pathID; elem quic.newConnID }0*[]struct { key string; elem map[string]string }0*struct { F uintptr; X0 *httptrace.ClientTrace }0*struct { key hpack.pairNameValue; elem uint64 }Version(asn1:"optional,default:0,explicit,tag:0"Version(asn1:"explicit,tag:0,default:0,optional"WALWriterDelay!json:"wal_writer_delay,omitempty"0*struct { F uintptr; X0 *os.File; X1 *exec.Cmd }0*struct { F uintptr; X0 io.Writer; X1 *os.File }ObfuscatedTicketAgejson:"obfuscated_ticket_age"0*[8]struct { key string; elem syntax.charGroup }0*struct { key string; elem yaml.resolveMapItem }0*[8]struct { key string; elem template.element }0*[8]struct { key reflect.Type; elem gob.typeId }0*[8]struct { key netlink.BondMode; elem string }0*[]struct { key netlink.IPoIBMode; elem string }0*[]struct { key string; elem netlink.IPoIBMode }0*func(protoreflect.EnumNumber) protoreflect.Enum0maxCongestionWindowWithNetworkParametersAdjusted0*func([]uint8) (sign.PublicKey, sign.PrivateKey)0*func() (sign.PublicKey, sign.PrivateKey, error)0github.com/pelletier/go-toml/v2/internal/tracker0*struct { key reflect.Kind; elem gob.encHelper }0*[8]struct { key reflect.Type; elem *gob.encOp }0*struct { key reflect.Type; elem *gob.typeInfo }0*[]struct { key reflect.Type; elem gob.gobType }0google.golang.org/protobuf/reflect/protoregistry0*map[protowire.Number]protoreflect.ExtensionType0*map.group[protoreflect.Name]*filedesc.EnumValue0*map[protoreflect.EnumNumber]*filedesc.EnumValue0*struct { key protowire.Number; elem struct {} }0*map.group[protoreflect.Name]*filedesc.Extension0*map.group[protowire.Number]*impl.coderFieldInfo0*map.group[protoreflect.Name]reflect.StructField0*map[reflect.Type]protoreflect.MessageDescriptor0*struct { F uintptr; R *congestion.cubicSender }1github.com/apernet/hysteria/app/v2/internal/utils1*struct { F uintptr; X0 *sockopts.SocketOptions }1*struct { F uintptr; X0 func(string); X1 string }1*struct { F uintptr; X0 string; X1 http.Handler }1*func([]uint8, []uint8, []uint8, []uint8) []uint81*[]struct { key interface {}; elem interface {} }1*struct { key uint16; elem func() *hpke.hkdfKDF }1*struct { F uintptr; X0 func(int) error; X1 int }1*func(string, int, fs.FileMode) (*os.File, error)1*struct { key runtime._typePair; elem struct {} }1*[]struct { key string; elem runtime.metricData }1*func() (unsafe.Pointer, syscall._Socklen, error)1*struct { Level *zapcore.Level "json:\"level\"" } Development%json:"development" yaml:"development" OutputPaths%json:"outputPaths" yaml:"outputPaths"1*struct { F uintptr; X0 net.Conn; X1 chan error } FunctionKey%json:"functionKey" yaml:"functionKey"1*[]struct { key zapcore.Level; elem color.Color }1*struct { F uintptr; X0 func() json.encoderFunc }1*[8]struct { key uint32; elem *http.http2stream }1*[8]struct { key string; elem *http.routingNode }1*[]struct { key http.connectMethodKey; elem int }1*[8]struct { key http.http2ErrCode; elem string }1*[8]struct { key http.http2SettingID; elem bool }1*[8]struct { key string; elem http.RoundTripper }1*func(*http.Server, net.Conn, http.Handler, bool)1*func(string, string, net.Conn) http.RoundTripper1*struct { F uintptr; R *http.ResponseController }1*[8]struct { key string; elem *certmagic.Config }1*[8]struct { key string; elem certmagic.KeyInfo }1*[8]struct { key string; elem certmagic.Storage }1*struct { key string; elem certmagic.ocspUpdate }1*[]struct { key string; elem *cloudflare.cfZone }1*[8]struct { key string; elem gandi.gandiDomain }1*struct { key string; elem acme.cachedDirectory }1*struct { F uintptr; X0 *server.udpSessionEntry }1*[8]struct { key *reflect.structType; elem bool }1*[]struct { key dnsmessage.section; elem string }1*[]struct { key string; elem *singleflight.call }1*func([]uint8, protocol.Version) ([]uint8, error)1*map[protocol.StreamID]*http3.stateTrackingStream1github.com/apernet/hysteria/core/v2/internal/frag1*[8]struct { key string; elem map[string]string }ActivationEmail!json:"activation_email,omitempty"MaintenanceTime!json:"maintenance_time,omitempty"DeadlockTimeout!json:"deadlock_timeout,omitempty"DefaultPassword!json:"default_password,omitempty"HAControlPlanes!json:"ha_controlplanes,omitempty"ResponseTimeout!json:"response_timeout,omitempty"BackendProtocol!json:"backend_protocol,omitempty"ForwardingRules!json:"forwarding_rules,omitempty"1*struct { key netlink.BondAdSelect; elem string }1*struct { key netlink.BondLacpRate; elem string }1*[8]struct { key netlink.IPoIBMode; elem string }1*struct { key netlink.VlanProtocol; elem string }1*struct { key string; elem netlink.BondAdSelect }1*struct { key string; elem netlink.BondLacpRate }1*[8]struct { key string; elem netlink.IPoIBMode }1*[]struct { key string; elem netlink.TuntapMode }1*struct { key string; elem netlink.VlanProtocol }1*struct { pragma.NoUnkeyedLiterals; Flags uint8 }1*struct { pragma.NoUnkeyedLiterals; Buf []uint8 }1*[]struct { key int32; elem impl.ExtensionField }1*struct { key string; elem qpack.indexAndValues }1*[]struct { key string; elem internal.AuthStyle }1*[]struct { laddr unix.SockaddrInet6; value int }1*[8]struct { key reflect.Type; elem gob.gobType }1google.golang.org/protobuf/internal/encoding/text oَe pBi+]F ufG Kb 3K HQ@ ħi6hB`Ԟ &a>@* Fjbɤ Y t T @6hUp=F6hsp-6h!mp hPL5 `x oC*` " Dz@Lu ux/U ͼ ǓClientCertificate mapstructure:"clientCertificate"GeoUpdateInterval mapstructure:"geoUpdateInterval"2github.com/apernet/hysteria/core/v2/internal/utils2*map.group[string]*trafficlogger.trafficStatsEntry2*struct { key string; elem zapcore.EncoderConfig }4(c 3en:4 B3nR3q  |ӥF3| @@73A;2*func(context.Context, *quic.Conn) context.Context2*[]struct { key hpack.pairNameValue; elem uint64 }`3o3X7ClusterTimeZone"json:"cluster_time_zone,omitempty"2*func(context.Context, string, *govultr.Soa) errorFirewallGroupID"json:"firewall_group_id,omitempty"䑹3j `r@P NP~3J `rRv]'3% `rWH`3h `rWi`3 `rXDŽ3ڥ `r\ z3H^`r@g3, `rhu3~`r@E<3a`rjgY3`r k53= `ro 6 3m `roIl30 `r@pM>3 `rrВQ3`r@yg3 `rz~~q3@`rzT#3{ `r@|2*struct { F uintptr; X0 *error; X1 unix.Sockaddr }%23 T ƫBðh3`T ƫB2*[]struct { key string; elem yaml.resolveMapItem }y'3Ǘ@2*[8]struct { key string; elem netlink.TuntapMode }C3Tj ~L2*[8]struct { key int32; elem impl.ExtensionField };3MǞ@+S3!SǞǞǞk<3@ƞ@b%i=3u Ş@ƞ@ƞC3@ƞ2*[8]struct { key string; elem internal.AuthStyle }2*struct { F uintptr; X0 retryablehttp.ReaderFunc }2*[2]struct { laddr unix.SockaddrInet6; value int }H3x )3!><3%. 3!v%2*[]struct { key reflect.Kind; elem gob.encHelper }2*[]struct { key reflect.Type; elem *gob.typeInfo }2*func(string) (protoreflect.FileDescriptor, error)2*map[protowire.Number]protoreflect.FieldDescriptor2*[]struct { key protowire.Number; elem struct {} }zW38@ z@Y[3ov 888럿3h} r@՛ z@U3,` rr@՛3*[]struct { key uint16; elem func() *hpke.hkdfKDF }3*[0]*go.shape.struct { internal/sync.isEntry bool } Extensions(asn1:"omitempty,optional,explicit,tag:3"3*[8]struct { key *x509.policyGraphNode; elem bool }3*[8]struct { key net.hostLookupOrder; elem string }3*atomic.Pointer[unique.entry[net/netip.addrDetail]]3*[0]*sync.indirect[*internal/abi.Type,interface {}]3*[8]struct { key netip.addrDetail; elem struct {} }3*func(*runtime.statAggregate, *runtime.metricValue)3*[]struct { key runtime._typePair; elem struct {} }3*struct { F uintptr; X0 *http.Server; X1 net.Conn }3*struct { F uintptr; X0 *client.udpSessionManager } EncodeLevel'json:"levelEncoder" yaml:"levelEncoder"3*[8]struct { key context.canceler; elem struct {} }3*map.group[http.connectMethodKey]http.wantConnQueue3*[8]struct { key string; elem *http.http2dialCall }3*struct { key string; elem *http.http2addConnCall }3*map[http.http2FrameType]map[http.http2Flags]string3*[8]struct { key http.http2SettingID; elem string }3*struct { F uintptr; X0 chan struct {}; X1 func() }3*struct { F uintptr; R *httputil.maxLatencyWriter }3*[8]struct { key string; elem certmagic.Challenge }3*[]struct { key string; elem certmagic.ocspUpdate }3*struct { F uintptr; X0 chan struct {}; X1 string }3*[]struct { key string; elem acme.cachedDirectory }3*struct { F uintptr; X0 *server.udpSessionManager }3*func(*outbounds.AddrEx) (outbounds.UDPConn, error)3github.com/apernet/hysteria/extras/v2/outbounds/acl3*struct { F uintptr; X0 chan outbounds.dialResult }3github.com/apernet/hysteria/extras/v2/trafficlogger3*struct { key unsafe.Pointer; elem unsafe.Pointer }3*[8]struct { key string; elem *unicode.RangeTable }3*func(string, int, fs.FileMode) (afero.File, error)3*func(bbr.extraAckedEvent, bbr.extraAckedEvent) int3*map.group[protocol.ConnectionID]quic.packetHandler3*map.group[protocol.ConnectionID]*quic.zeroRTTQueue3*func(monotime.Time) (ackhandler.Frame, bool, bool)3*map.group[protocol.ByteCount]quic.frameSorterEntry3*[8]struct { key quic.pathID; elem quic.newConnID }3*map.group[quic.connRunner]quic.connRunnerCallbacks3*map.group[protocol.StreamID]quic.streamFrameGetter3*func(quic.clientHelloCut, quic.clientHelloCut) int3*[8]struct { key hpack.pairNameValue; elem uint64 }IgnoredDatabases"json:"ignored_databases,omitempty"HealthyThreshold"json:"healthy_threshold,omitempty"FrontendProtocol"json:"frontend_protocol,omitempty"3*struct { key reflect.Type; elem *yaml.structInfo }3*[8]struct { key string; elem yaml.resolveMapItem }3*[]struct { key netlink.BondAdSelect; elem string }3*[]struct { key netlink.BondLacpRate; elem string }3*[]struct { key netlink.VlanProtocol; elem string }3*[]struct { key string; elem netlink.BondAdSelect }3*[]struct { key string; elem netlink.BondLacpRate }3*[]struct { key string; elem netlink.VlanProtocol }3*func(protoreflect.MapKey, protoreflect.Value) bool3*[]struct { key string; elem qpack.indexAndValues }3*struct { key dnsmessage.SVCParamKey; elem string }3*func([]uint8, kem.PrivateKey, kem.PublicKey) error3*[8]struct { key reflect.Kind; elem gob.encHelper }3*[8]struct { key reflect.Type; elem *gob.typeInfo }3*map[protoreflect.Name]protoreflect.FieldDescriptor3*[8]struct { key protowire.Number; elem struct {} }3*struct { key protowire.Number; elem interface {} }3*struct { key reflect.Type; elem protowire.Number }3*struct { key protowire.Number; elem reflect.Type }3*interface { ProtoMessageInfo() *impl.MessageInfo }MaxIncomingStreams!mapstructure:"maxIncomingStreams"4*[]struct { key string; elem zapcore.EncoderConfig }4*[8]struct { key uint16; elem func() *hpke.hkdfKDF }4*[]struct { key string; elem *x509.policyGraphNode }4*struct { key string; elem []*x509.policyGraphNode }4*[]atomic.Pointer[unique.node[net/netip.addrDetail]]4*[8]struct { key runtime._typePair; elem struct {} }4github.com/apernet/hysteria/app/v2/internal/proxymux4*[]struct { key string; elem *proxymux.muxListener }4github.com/apernet/hysteria/app/v2/internal/redirect4github.com/apernet/hysteria/app/v2/internal/sockopts4*struct { F uintptr; X0 *error; X1 func(int) error }4*struct { key protocol.StreamID; elem *quic.Stream }4github.com/apernet/quic-go/internal/utils/ringbuffer4*struct { key quic.pathID; elem *quic.pathOutgoing }4*[]struct { key uint32; elem *http.http2writeQueue }4*func(string, string, *tls.Config) (net.Conn, error)4*map.group[http.connectMethodKey][]*http.persistConn4*struct { key uint32; elem *http.http2clientStream }4*struct { key string; elem []*http.http2ClientConn }4*struct { key *http.http2ClientConn; elem []string }4*struct { key string; elem []*multipart.FileHeader }4*struct { F uintptr; R *http.socksUsernamePassword }4*[]struct { key string; elem certmagic.Certificate }4*[]struct { key string; elem *certmagic.solverInfo }4*[8]struct { key string; elem certmagic.ocspUpdate }4*[8]struct { key string; elem acme.cachedDirectory }4github.com/apernet/hysteria/app/v2/internal/firewall4*struct { key uint32; elem *server.udpSessionEntry }4*func(func(string) bool) (reflect.StructField, bool)4*[]struct { key tun.flowKey; elem []tun.tcpGROItem }4*bbr.WindowedFilter[go.shape.uint64,go.shape.uint64]4*map[protocol.StatelessResetToken]quic.packetHandler4*[]struct { key uint64; elem protocol.ConnectionID }4*map[protocol.StreamID]quic.streamControlFrameGetter4*struct { F uintptr; X0 *error; X1 *sync.WaitGroup }4*func(context.Context) (*http3.RequestStream, error)DatabaseEngineVersionjson:"database_engine_version"WALSenderTImeout#json:"wal_sender_timeout,omitempty"RedisACLChannels#json:"redis_acl_channels,omitempty"RedisACLCommands#json:"redis_acl_commands,omitempty"4*func(context.Context, string, string, string) error4*struct { key danger.TypeID; elem map[string][]int }4*[8]struct { key netlink.BondAdSelect; elem string }4*struct { key netlink.BondArpValidate; elem string }4*struct { key netlink.BondFailOverMac; elem string }4*[8]struct { key netlink.BondLacpRate; elem string }4*[8]struct { key netlink.VlanProtocol; elem string }4*[8]struct { key string; elem netlink.BondAdSelect }4*struct { key string; elem netlink.BondArpValidate }4*struct { key string; elem netlink.BondFailOverMac }4*[8]struct { key string; elem netlink.BondLacpRate }4*[8]struct { key string; elem netlink.VlanProtocol }4*func(protoreflect.Name) protoreflect.EnumDescriptor4*func(protowire.Number) protoreflect.FieldDescriptor4*func(protocol.ByteCount, bool, monotime.Time) error4*[8]struct { key string; elem qpack.indexAndValues }4*edwards25519.fiatScalarMontgomeryDomainFieldElement4*map.group[filedesc.Edition]filedesc.EditionFeatures4*struct { key protoreflect.Kind; elem reflect.Type }5*[8]struct { key string; elem zapcore.EncoderConfig }5*func(*tls.ClientHelloInfo) (*tls.Certificate, error)5*struct { F uintptr; X0 *tls13.ExporterMasterSecret } TrailerField(asn1:"optional,explicit,tag:3,default:1"5*[8]struct { key string; elem *x509.policyGraphNode }5*func(<-chan singleflight.Result, context.CancelFunc)5*func(zapcore.EncoderConfig) (zapcore.Encoder, error)5*struct { key string; elem *forwarding.sessionEntry }5*[8]struct { key string; elem *proxymux.muxListener }5*struct { F uintptr; X0 *socks5.Server; X1 net.Conn }5*struct { F uintptr; X0 *context.timerCtx; X1 error }5*struct { key *http.http2serverConn; elem struct {} }5*[8]struct { key uint32; elem *http.http2writeQueue }5*struct { key *http.persistConn; elem *list.Element }5*map[string]func(string, *tls.Conn) http.RoundTripper5*[]struct { key string; elem *http.http2addConnCall }5*[8]struct { key string; elem certmagic.Certificate }5*struct { key string; elem *certmagic.soaCacheEntry }5*[8]struct { key string; elem *certmagic.solverInfo }5*[]struct { key unsafe.Pointer; elem unsafe.Pointer }5*[8]struct { key tun.flowKey; elem []tun.tcpGROItem }5github.com/apernet/hysteria/core/v2/internal/protocol5*func(protocol.ConnectionID, quic.packetHandler) bool5*[8]struct { key uint64; elem protocol.ConnectionID }5*func(protocol.EncryptionLevel) protocol.PacketNumber5*interface { SyscallConn() (syscall.RawConn, error) } NextUpdate*asn1:"generalized,explicit,tag:0,optional"AutovacuumNaptime#json:"autovacuum_naptime,omitempty"PGPartmanBGWRole$json:"pg_partman_bgw.role,omitempty"5*[]struct { key reflect.Type; elem *yaml.structInfo }5*func(protoreflect.Name) protoreflect.FieldDescriptor5*func(protoreflect.Name) protoreflect.OneofDescriptor5*struct { key int32; elem protoreflect.ProtoMessage }5*[]struct { key dnsmessage.SVCParamKey; elem string }5*[]struct { key protowire.Number; elem interface {} }5*[]struct { key reflect.Type; elem protowire.Number }5*[]struct { key protowire.Number; elem reflect.Type }5*struct { F uintptr; X0 func() congestion.Bandwidth }hS3@KFdControlUnixSocket"mapstructure:"fdControlUnixSocket"6*struct { F uintptr; R *utils.LocalCertificateLoader }6*struct { F uintptr; X0 chan error; X1 server.Server }^!N3ш@B֢73H43 ĮĮĮĮB3`r 6*[]struct { key string; elem []*x509.policyGraphNode }wj3@l (p,`QS(B0r(iV-`Ĕ(B0V-^N~3 `r8h A3, `r6*[16]atomic.Pointer[unique.node[net/netip.addrDetail]]6*atomic.Pointer[unique.indirect[net/netip.addrDetail]]u35@ `6*struct { key chan<- os.Signal; elem *signal.handler }3.%`6*struct { key pflag.NormalizedName; elem *pflag.Flag }v3c  */3[ @Ŭ@Ŭݞݞ6github.com/apernet/hysteria/app/v2/internal/forwardingS (Fl0~e (Dp F6*[]struct { key protocol.StreamID; elem *quic.Stream }6*atomic.Pointer[github.com/apernet/quic-go.closeError]6*[]struct { key quic.pathID; elem *quic.pathOutgoing }6github.com/apernet/hysteria/extras/v2/transport/udphopg(n\Uo|(~ДD EncodeCaller)json:"callerEncoder" yaml:"callerEncoder"6*[]struct { key uint32; elem *http.http2clientStream }6*[]struct { key string; elem []*http.http2ClientConn }6*[]struct { key *http.http2ClientConn; elem []string }6*[8]struct { key string; elem *http.http2addConnCall }6*[]struct { key string; elem []*multipart.FileHeader }6*struct { F uintptr; X0 chan bool; X1 chan struct {} };3^{ *l30 `ro٭ h3 `ro .O\@(ΐP'^\(:z(vЗ ]6}(56*func(context.Context, string, bool) ([]string, error)~ 3`r%W3t `rۭ1-;3 `rIIOnlyReturnExisting#json:"onlyReturnExisting,omitempty"6*func(string, []uint8) (server.UDPConn, string, error)6*[]struct { key uint32; elem *server.udpSessionEntry }tn3pn̢3P -K3 33 ק :_b}3 n3֮ `23'tKLS3g6*ecdh.Curve[*crypto/internal/fips140/nistec.P256Point]6*ecdh.Curve[*crypto/internal/fips140/nistec.P384Point]6*ecdh.Curve[*crypto/internal/fips140/nistec.P521Point]6*[8]struct { key unsafe.Pointer; elem unsafe.Pointer }3u@43p@ <6*struct { F uintptr; X0 *tun.System; X1 net.Listener }ᇼ 3Q @@z>`3О r 6*func([]protocol.ConnectionID, []uint8, time.Duration)6*struct { F uintptr; X0 quic.packetHandler; X1 error }r35@ƞ  $!3z@ƞ@/3/{@ƞ@/r3 Şss(a@LogErrorVerbosity$json:"log_error_verbosity,omitempty"DisablePublicIPv4$json:"disable_public_ipv4,omitempty"6*func(context.Context, string) (*http.Response, error)6*func(context.Context, string, *govultr.UserReq) error<3 `rR Y3`rRS Jq3 `rS \tH3H^ `r@S h3> `rS N03 `rT =pF3 `r@T W8W3^ `r b3 `r@  3 `rV oS3`r@WW oR3i `rW /]3`rXZ U34e `rZ P̗3`rQ :3"m`r^] q3 `r] D3 `r`  }3e `ra .a3p `rb 9a3 `r @3 `r DS3t `rfg ~||3 `rg J_3ʄ `r@g 3l3p{ `rgL3`rhh aМ3 `rh 3` `r !23m`rj@j h0\/3j `r@j N 3+ `rj "413,_ `rk ȉ3 `r@k tM3b `r@ w3b `rl 72>30f `r@l bP3j `rm@m ]43V `r@m ɣ3| `r@no O3`rBbE3r `ro 83-c `r@o z3`rrr 61IK3"k `rr  3KP`r :3/} `rss ®[3 `rs t3 `rt &53A `r@t 3`rw@w .3si`rw@w ;|3zc `r@w 3N`r@xx y3g`rxx 3 `rx 13pu `r@yy +3 `ry qu3`rz@z ڨ3` `r@z zE3| `rz{ Li%3ˌ `r{ L3qk `r{{ 8.3 `r{  I3ͦ `r|| +3 `r| 6*[]struct { key danger.TypeID; elem map[string][]int }6*[8]struct { key reflect.Type; elem *yaml.structInfo }6*struct { key netlink.BondArpAllTargets; elem string }6*[]struct { key netlink.BondArpValidate; elem string }6*[]struct { key netlink.BondFailOverMac; elem string }6*struct { key string; elem netlink.BondArpAllTargets }6*[]struct { key string; elem netlink.BondArpValidate }6*[]struct { key string; elem netlink.BondFailOverMac }6*struct { key protoreflect.Kind; elem protowire.Type }w0(Ķ0E}(pj! 6*func(protoreflect.Name) protoreflect.MethodDescriptor6*func(protoreflect.FieldDescriptor) protoreflect.ValueŴ)3GǞǞǞ7_3 gBm3f | 3|S@ƞŞ@ƞ6*[8]struct { key dnsmessage.SVCParamKey; elem string }g)3 @%b@l53%6*map.group[protowire.Number]protoreflect.ExtensionTypeY-(z0@}HO(=pZ6*map.group[protoreflect.EnumNumber]*filedesc.EnumValue6*struct { key protowire.Number; elem *filedesc.Field }6*struct { key protoreflect.Name; elem *filedesc.Enum }]n3y @@ΜҜ`e3N@@ΜҜ`6*[]struct { key protoreflect.Kind; elem reflect.Type }6*struct { key protowire.Number; elem *impl.fieldInfo }6*[8]struct { key protowire.Number; elem interface {} }6*[8]struct { key reflect.Type; elem protowire.Number }6*[8]struct { key protowire.Number; elem reflect.Type }6*map.group[reflect.Type]protoreflect.MessageDescriptor6*struct { F uintptr; X0 protoreflect.FieldDescriptor }/ (wPj (z6*struct { F uintptr; X0 *error; X1 prototext.encoder }7*struct { F uintptr; X0 *utils.LocalCertificateLoader }7*func(*big.Int, *big.Int, []uint8) (*big.Int, *big.Int)7*sync.node[go.shape.interface {},go.shape.interface {}]7*struct { F uintptr; X0 *tls.Conn; X1 context.Context }7*[8]struct { key string; elem []*x509.policyGraphNode }7*func([]uint8, []uint8, *net.UDPAddr) (int, int, error)7*interface { Network() poll.String; PollFD() *poll.FD } DisableCaller)json:"disableCaller" yaml:"disableCaller" EncoderConfig)json:"encoderConfig" yaml:"encoderConfig" InitialFields)json:"initialFields" yaml:"initialFields"7*[]struct { key string; elem *forwarding.sessionEntry }7*[8]struct { key protocol.StreamID; elem *quic.Stream }7*struct { key protocol.StreamID; elem go.shape.*uint8 }7*[8]struct { key quic.pathID; elem *quic.pathOutgoing } StacktraceKey)json:"stacktraceKey" yaml:"stacktraceKey"7*[]struct { key *http.http2serverConn; elem struct {} }7*map[string]func(*http.Server, *tls.Conn, http.Handler)7*[]struct { key *http.persistConn; elem *list.Element }7*[8]struct { key uint32; elem *http.http2clientStream }7*[8]struct { key string; elem []*http.http2ClientConn }7*[8]struct { key *http.http2ClientConn; elem []string }7*[8]struct { key string; elem []*multipart.FileHeader }7*struct { F uintptr; R *http.http2serverInternalState }7*struct { F uintptr; X0 func(io.Reader); X1 io.Reader }7*[]struct { key string; elem *certmagic.soaCacheEntry }7*[8]struct { key uint32; elem *server.udpSessionEntry }7*struct { F uintptr; X0 *server.h3sHandler; X1 string }7*ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point]7*ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point]7*ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point]7*ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point]7*func([]uint8, map[string]uint16, int) ([]uint8, error)7*func(protocol.StatelessResetToken, quic.packetHandler)7*func(protocol.ConnectionID) (quic.packetHandler, bool)7*func(protocol.StreamID, quic.streamControlFrameGetter)7*map.group[protocol.StreamID]*http3.stateTrackingStream7*struct { key crypto.Hash; elem asn1.ObjectIdentifier }MySQLSlowQueryLog%json:"mysql_slow_query_log,omitempty"UnhealthyThreshold$json:"unhealthy_threshold,omitempty"BalancingAlgorithm$json:"balancing_algorithm,omitempty"7github.com/apernet/hysteria/extras/v2/outbounds/tinydoh7*[8]struct { key danger.TypeID; elem map[string][]int }7*struct { references int; anchor int; serialized bool }7*[8]struct { key netlink.BondArpValidate; elem string }7*[8]struct { key netlink.BondFailOverMac; elem string }7*struct { key netlink.BondXmitHashPolicy; elem string }7*[8]struct { key string; elem netlink.BondArpValidate }7*[8]struct { key string; elem netlink.BondFailOverMac }7*struct { key string; elem netlink.BondXmitHashPolicy }7*struct { F uintptr; X0 *int; X1 proto.MarshalOptions }7*func(protoreflect.Name) protoreflect.MessageDescriptor7*func(protoreflect.Name) protoreflect.ServiceDescriptor7*func(protoreflect.FieldDescriptor, protoreflect.Value)7*[]struct { key int32; elem protoreflect.ProtoMessage }7*func(kem.PublicKey, []uint8) ([]uint8, []uint8, error)7*struct { key protoreflect.Name; elem *filedesc.Field }7*struct { key protoreflect.Name; elem *filedesc.Oneof }7*[8]struct { key protoreflect.Kind; elem reflect.Type }7*func(protoreflect.Value, int, impl.marshalOptions) int7*struct { key protoreflect.Name; elem *impl.oneofInfo }7*struct { key reflect.Type; elem *impl.coderFieldInfo }8*struct { F uintptr; X0 *url.URL; X1 *cmd.serverConfig }8*func(context.Context, string, string) (net.Conn, error)8*sync.entry[go.shape.interface {},go.shape.interface {}]8*atomic.Pointer[go.shape.struct { unique.isEntry bool }]8*[]struct { key chan<- os.Signal; elem *signal.handler }8*[]struct { key pflag.NormalizedName; elem *pflag.Flag }8*[8]struct { key string; elem *forwarding.sessionEntry }8*struct { F uintptr; X0 **redirect.sockAddr; X1 *error }8*struct { F uintptr; X0 *tproxy.TCPTProxy; X1 net.Conn }8*struct { key protocol.StreamID; elem *quic.SendStream }8*[8]struct { key *http.http2serverConn; elem struct {} }8*[8]struct { key *http.persistConn; elem *list.Element }8*struct { F uintptr; X0 *http.conn; X1 context.Context }8*[8]struct { key string; elem *certmagic.soaCacheEntry }8*struct { key string; elem outbounds.PluggableOutbound }8*map.group[reflect.Kind]func(reflect.Value) interface {}8*struct { F uintptr; X0 *error; X1 func(uintptr) error }8*struct { F uintptr; X0 quic.connRunner; X1 *quic.Conn }BGWRITERFlushAFter%json:"bgwriter_flush_after,omitempty"MaxParallelWorkers%json:"max_parallel_workers,omitempty"MaxWorkerProcesses%json:"max_worker_processes,omitempty"RedisACLCategories%json:"redis_acl_categories,omitempty"8*func(context.Context, string, *govultr.ReverseIP) error8*func(context.Context, string, *govultr.SSHKeyReq) error8*[]struct { key netlink.BondArpAllTargets; elem string }8*struct { key netlink.BondPrimaryReselect; elem string }8*[]struct { key string; elem netlink.BondArpAllTargets }8*struct { key string; elem netlink.BondPrimaryReselect }8*[]struct { key protoreflect.Kind; elem protowire.Type }8*[8]struct { key int32; elem protoreflect.ProtoMessage }8*struct { key protoreflect.FullName; elem interface {} }8*[]struct { key protowire.Number; elem *filedesc.Field }8*map.group[protowire.Number]protoreflect.FieldDescriptor8*[]struct { key protoreflect.Name; elem *filedesc.Enum }8*struct { key protoreflect.Name; elem *filedesc.Method }8*[]struct { key protowire.Number; elem *impl.fieldInfo }8*func(impl.pointer) (impl.pointer, *impl.coderFieldInfo)8*struct { F uintptr; X0 reflect.Type; X1 *impl.mapInfo }9*struct { key server.HyStream; elem *server.StreamStats }9*[8]struct { key chan<- os.Signal; elem *signal.handler }9*[8]struct { key pflag.NormalizedName; elem *pflag.Flag }9*struct { F uintptr; X0 func(zapcore.Core) zapcore.Core }9*struct { F uintptr; X0 *proxymux.muxManager; X1 string }9*func(context.Context, net.Conn, metadata.Metadata) error9*[]struct { key protocol.StreamID; elem go.shape.*uint8 }9*func(json.reflectWithString, json.reflectWithString) int9*map.group[http.http2FrameType]map[http.http2Flags]string9*struct { F uintptr; X0 *http.http2stream; X1 time.Time }9*func(context.Context, string) (certmagic.KeyInfo, error)9*struct { key string; elem []certmagic.dnsPresentMemory }9*func(http3.FrameType, *quic.Stream, error) (bool, error)9*func(*ecdh.PrivateKey, *ecdh.PublicKey) ([]uint8, error)9*func(reflect.Value, reflect.Value) (interface {}, error)9*struct { F uintptr; X0 mapstructure.DecodeHookFuncKind }9*struct { F uintptr; X0 mapstructure.DecodeHookFuncType }9github.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo9*func(protocol.StreamID) flowcontrol.StreamFlowController9*struct { key string; elem *http3.roundTripperWithCount }9*struct { F uintptr; X0 *quic.Conn; X1 http3.clientConn }9*struct { F uintptr; X0 *http3.rawConn; X1 *quic.Stream }9*struct { F uintptr; X0 reflect.Value; X1 reflect.Value }9*[]struct { key crypto.Hash; elem asn1.ObjectIdentifier }FerretDBCredentials%json:"ferretdb_credentials,omitempty"MySQLLongQueryTime&json:"mysql_long_query_time,omitempty"MaxFilesPerProcess&json:"max_files_per_process,omitempty"9github.com/apernet/hysteria/extras/v2/sniff/internal/quic9*[8]struct { key netlink.BondArpAllTargets; elem string }9*[]struct { key netlink.BondXmitHashPolicy; elem string }9*[8]struct { key string; elem netlink.BondArpAllTargets }9*[]struct { key string; elem netlink.BondXmitHashPolicy }9*[8]struct { key protoreflect.Kind; elem protowire.Type }9*func(func(protoreflect.MapKey, protoreflect.Value) bool)9*func(protoreflect.Name) protoreflect.EnumValueDescriptor9*[]struct { key protoreflect.Name; elem *filedesc.Field }9*[8]struct { key protowire.Number; elem *filedesc.Field }9*map.group[protoreflect.Name]protoreflect.FieldDescriptor9*struct { key string; elem protoreflect.FieldDescriptor }9*[]struct { key protoreflect.Name; elem *filedesc.Oneof }9*[8]struct { key protoreflect.Name; elem *filedesc.Enum }9*struct { key protoreflect.Name; elem *filedesc.Message }9*struct { key protoreflect.Name; elem *filedesc.Service }9*[8]struct { key protowire.Number; elem *impl.fieldInfo }9*[]struct { key protoreflect.Name; elem *impl.oneofInfo }9*[]struct { key reflect.Type; elem *impl.coderFieldInfo }8:- UP[@4 @ ]FHd o@]FF/ f Kw%  5`5AI3h`  ?` p^31B@` ޅ$3K @`` N=3? F` p`3GB ` L  i  i7h1 4@`hH?\l J@ p (/, qǀh> ?/q ǰ- ӵ< t ^*I ~Il3@}"٭ << 81tF `:जc<<81tF ;`c<<:81t@G <ड़c(- uR= c{<- 9@ ' ^*@ @ϵV/ @7 |np4 }\753 a ``3f@B  P3)@B ٭Ox3B oVZ3$B   b*+- f 9y=- f@0(/ gHtU5 Hg  ˦Q- f @ _  Y] 8gE{)l ʜ8gIgnoreClientBandwidth$mapstructure:"ignoreClientBandwidth":*func([]uint8, []uint8, []uint8, []uint8) ([]uint8, error)ƭ3X3  \z!3  f3O S͔"3+  U)3ht ĮĮĮĮĮĮv9D3 i@@ 3 `rii`{:*[]atomic.Pointer[go.shape.struct { unique.isEntry bool }]" 9h5`*m:*[]struct { key protocol.StreamID; elem *quic.SendStream }:*[8]struct { key protocol.StreamID; elem go.shape.*uint8 }SkipLineEnding+json:"skipLineEnding" yaml:"skipLineEnding"I>Tp 6$5:*struct { key http.routingIndexKey; elem []*http.pattern }Y1A3 `r :*struct { F uintptr; X0 *certmagic.RingBufferRateLimiter }TermsOfServiceAgreed%json:"termsOfServiceAgreed,omitempty"Nh;pyPCRp}F:*struct { F uintptr; X0 func(...string) error; X1 string }:*[]struct { key string; elem outbounds.PluggableOutbound }ƍ|3jUӏ6Ao3= YӏB i7HI @[P[:*go.shape.[]github.com/sagikazarmark/locafero.searchResult:*struct { F uintptr; X0 mapstructure.DecodeHookFuncValue }@3%{ rͫǫZ3!s`GI:*map.group[protocol.StatelessResetToken]quic.packetHandler:*map.group[protocol.StreamID]quic.streamControlFrameGetter:*func(*wire.Header, []uint8) (*quic.unpackedPacket, error):*atomic.Pointer[github.com/apernet/quic-go.remoteAddrInfo]:*struct { F uintptr; R *ackhandler.ReceivedPacketHandler }:*struct { F uintptr; X0 *quic.Transport; X1 quic.rawConn }:*struct { F uintptr; X0 func(wire.Frame); X1 *[3]uintptr }h3@ƞʪt](3@ƞʪKy3â@ƞ@/|3@ƞʪSj3'7`~ʪȪ3i `r 7Ԯ:*[8]struct { key crypto.Hash; elem asn1.ObjectIdentifier }:*func([]uint8, int, dns.compressionMap, bool) (int, error)D3@!@RedisEvictionPolicy&json:"redis_eviction_policy,omitempty"BGWRITERLRUMaxPages&json:"bgwriter_lru_maxpages,omitempty"MaxReplicationSlots&json:"max_replication_slots,omitempty"!U3`rP@Q  3`rPQ -ʺ3p`rP@Q o38`rUS Wb53`rPQ m<3x`rPQ hw3`rP@Q I3)`r[` =]s3@`r@[ !v3`rPQ ][q3,`r@\Z J3`r]] Z3(`r@^^ }3`r^_ ~ 3%`r@__ |3`r`] r 3$`r^ 3qt `r_ 83*| `r_ sŽT3`r@bQ 3`rb $r3i`r@Q =3`r@cQ 3g`r@d 7"3m`rQ w3!`rd] >3)`rea  83L`r@e %3C3J`re] 3`rP@QQ  6E3T`rgh d7I3| `rh n&_3K"`rP@Q >p63`r@ii b~3e `r@i U3f `rT "3&`rPQ ɿt3`rk@j \g3`rl@j [lS3`rPQ ǵP3`rPQ o3`rnn  3 `rn "K3`rPQ +z3 `r@q@q 3M`rq B632N`r@q s3' `rPQ -3H`rPQ  3Pr@՛ z3 ĮĮĮĮ;*[]struct { key server.HyStream; elem *server.StreamStats };*[]*sync.entry[go.shape.interface {},go.shape.interface {}];*sync.indirect[go.shape.interface {},go.shape.interface {}];*func([]uint8, []uint8) (int, int, int, *net.IPAddr, error);*[8]struct { key protocol.StreamID; elem *quic.SendStream };*struct { Layout string "json:\"layout\" yaml:\"layout\"" };*func(*http.Request, string) (*http.http2ClientConn, error);*struct { key *http.Request; elem context.CancelCauseFunc };*map.group[string]func(string, *tls.Conn) http.RoundTripper;*[]struct { key string; elem []certmagic.dnsPresentMemory };*struct { F uintptr; X0 firewall.commandRunner; X1 string };*struct { F uintptr; X0 *server.serverImpl; X1 *quic.Conn };*[8]struct { key string; elem outbounds.PluggableOutbound };*go.shape.struct { Key reflect.Value; Value reflect.Value };*struct { key go.shape.string; elem go.shape.interface {} };*[]func(reflect.Value, reflect.Value) (interface {}, error);github.com/apernet/hysteria/core/v2/internal/congestion/bbr;*func(monotime.Time) (ackhandler.Frame, protocol.ByteCount);*[]struct { key string; elem *http3.roundTripperWithCount }MaintenanceScheduled&json:"maintenance_scheduled,omitempty";*[8]struct { key netlink.BondPrimaryReselect; elem string };*[8]struct { key string; elem netlink.BondPrimaryReselect };*[8]struct { key protoreflect.FullName; elem interface {} };*map[protoreflect.FullName]protoregistry.extensionsByNumber;*struct { key protoreflect.Name; elem *filedesc.EnumValue };*[]struct { key string; elem protoreflect.FieldDescriptor };*[]struct { key protoreflect.Name; elem *filedesc.Message };*[8]struct { key protoreflect.Name; elem *filedesc.Method };*[]struct { key protoreflect.Name; elem *filedesc.Service };*struct { key protoreflect.Name; elem *filedesc.Extension };*struct { key protowire.Number; elem *impl.coderFieldInfo };*struct { key protoreflect.Name; elem reflect.StructField };*struct { F uintptr; X0 protowire.Number; X1 reflect.Type };*struct { F uintptr; X0 reflect.Type; X1 protowire.Number }MaxStreamReceiveWindow%mapstructure:"maxStreamReceiveWindow"<*[8]struct { key server.HyStream; elem *server.StreamStats }<*func(*tls.CertificateRequestInfo) (*tls.Certificate, error)<*[0]*sync.entry[go.shape.interface {},go.shape.interface {}]<*func([]uint8, []uint8) (int, int, int, *net.UDPAddr, error)<*func(context.Context, string, string) ([]net.IPAddr, error)<*[16]atomic.Pointer[go.shape.struct { unique.isEntry bool }]<*struct { F uintptr; X0 *forwarding.TCPTunnel; X1 net.Conn }<*struct { F uintptr; X0 *proxymux.muxListener; X1 net.Conn }<*quic.incomingStreamsMap[*github.com/apernet/quic-go.Stream]<*quic.outgoingStreamsMap[*github.com/apernet/quic-go.Stream]EncodeDuration-json:"durationEncoder" yaml:"durationEncoder"<*[]struct { key http.routingIndexKey; elem []*http.pattern }<*struct { F uintptr; X0 *http.Transport; X1 *http.wantConn }<*[8]struct { key string; elem []certmagic.dnsPresentMemory }<*struct { F uintptr; X0 func(...string) error; X1 []string }<*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }<*[]go.shape.[]github.com/sagikazarmark/locafero.searchResultIp9protobuf:"bytes,1,opt,name=ip,proto3" json:"ip,omitempty"<*func(monotime.Time, protocol.ByteCount, protocol.ByteCount)<*struct { F uintptr; X0 *quic.packetHandlerMap; X1 []uint8 }<*[8]struct { key string; elem *http3.roundTripperWithCount }<*func(context.Context, string, *govultr.AttachVPC2Req) errorAutovacuumMaxWorkers'json:"autovacuum_max_workers,omitempty"TrackCommitTimestamp'json:"track_commit_timestamp,omitempty"EnablePrivateNetwork'json:"enable_private_network,omitempty"AttachPrivateNetwork'json:"attach_private_network,omitempty"NextScheduleTimeUTC(json:"next_scheduled_time_utc,omitempty"DetachPrivateNetwork'json:"detach_private_network,omitempty"<*[]struct { key unicode.Endianness; elem [9]identifier.MIB }<*func(protoreflect.FieldDescriptor, protoreflect.Value) bool<*func(sign.PrivateKey, []uint8, *sign.SignatureOpts) []uint8<*struct { F uintptr; X0 *gob.userTypeInfo; X1 reflect.Type }<*[]struct { key string; elem []protoreflect.FileDescriptor }<*[8]struct { key string; elem protoreflect.FieldDescriptor }<*[8]struct { key protoreflect.Name; elem *filedesc.Message }<*[8]struct { key protoreflect.Name; elem *filedesc.Service }<*[]struct { key protowire.Number; elem reflect.StructField }=*struct { key string; elem *trafficlogger.trafficStatsEntry }=*struct { F uintptr; X0 *cmd.clientConfig; X1 client.Client }=*func(context.Context, string, string, syscall.RawConn) error=*sync.node[go.shape.*internal/abi.Type,go.shape.interface {}]=*struct { key string; elem func(*url.URL) (zap.Sink, error) }=*struct { F uintptr; X0 *zap.SamplingConfig; X1 *zap.Config }=*quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream]=*func(zapcore.Entry, []zapcore.Field) (*buffer.Buffer, error)=*map.group[string]func(*http.Server, *tls.Conn, http.Handler)=*[8]struct { key http.routingIndexKey; elem []*http.pattern }=*[]struct { key *http.Request; elem context.CancelCauseFunc }=*func(context.Context, *url.URL, string) (http.Header, error)=*struct { F uintptr; X0 http.http2closeWaiter; X1 chan bool }=*func(context.Context, string, map[string]interface {}) error=*struct { key string; elem *certmagic.RingBufferRateLimiter }=*func(io.Reader, []uint8, crypto.SignerOpts) ([]uint8, error)=*[]struct { key go.shape.string; elem go.shape.interface {} }PGPartmanBGWInterval(json:"pg_partman_bgw.interval,omitempty"=*struct { F uintptr; X0 *exec.Cmd; X1 chan<- exec.ctxResult }=*struct { F uintptr; X0 func(func() error); X1 func() error }=*[8]struct { key unicode.Endianness; elem [9]identifier.MIB }=*func(protoreflect.FullName) (protoreflect.Descriptor, error)=*[8]struct { key string; elem []protoreflect.FileDescriptor }=*[]struct { key protoreflect.Name; elem *filedesc.EnumValue }=*[]struct { key protoreflect.Name; elem *filedesc.Extension }=*[]struct { key protowire.Number; elem *impl.coderFieldInfo }=*[8]struct { key protowire.Number; elem reflect.StructField }=*[]struct { key protoreflect.Name; elem reflect.StructField }=*struct { F uintptr; X0 impl.offset; X1 reflect.StructField }B+l *^!=%fvl A!=Zէl ? "=wl {8 `"=揅l 8@ "=Zߝl A "=Sl B #=3El i `#=+ul =#=Kh  -ܘ-, ³ --'h ³ 9 -l-P'Skh b --'q/l ç $Yl : %KLl W `%` ³ l ` @-&wh .` P` %`$-<h ! P-`%P$ 6³ c` ` A=Z2/l  &~ l̇h ߤ ~-!08r]h <` ~-#pN `  LZh A@ -(/h  -|Sh ` W04t21UV3QfW4Dxl 7g*.piD ` KKl @ `+g}p ` x|h<'h{pg ` }h(hES`3|3kl  `,L_³  N XL LDy6?3i!౭ 7h E !@83Pl `-!!_³ B` i-Glz@F,{³  i6} ³ B i-$GAnh v i-GPbEvh @ i-XG8Am&6 h o` i` 4H@t@Jжp i8H0?cJp2` i` Hw@6rp  i` HPx@R:pi` i` Hy@εp5n i` Hy@{dp P` ""{pg` P` 0""-3a3iDl n 1G7h 2  -KRAl U@ 1 Rzl 4 1@{-Yx(* : 2:DĀx( :`2:MBx(do :2:1a l {o@ 2Il ' 3cl Q `3\h  ` "d"}Mh @ '` "l"h  ` (HxWl H`4Epsh  K` $%%Vl o  4zǤPl Q 5Rl {`5cCl Z 5,`n' h  FE-v"1h * FE-u\`zel `6c4l e6)% l x 6+Z(K³ a  -@ 8C,l o@!`7/JG^l Q 7l {!7p" Ƴ` R Oޢl  `8EJl #8.x 2` =&%0:h  &HVekh _ p-I)I}x(Q7)9F_U @ ` Pg`o>^@p( : ` ww˚h gQ: -wxwg: ³ A ; Q-|,yjl W %<QL$ ³ 9@ -ID?t ³ @A -JB h b`B -K|CrϦ3I_l@tL3l@@cp) I 8.- 0/³ _I 8.- 0/5³ ?@J 8.-ՀŎ³ K -@;L;ǣh `K -B&_@h RK -3; &$³ Y@M 9-*HA³ N &-l!ecD ³ W1N &-d0ec ³ LO &-l2etc[ڐL³ 'O &-\3eDcDh P &-&e$cE38h Q &-'e(c})ph `Q &-`*e0 cGq1h =Q &-,)e,cMh  R &-+e4 c.;)h ,'R &-,e8 cBh {R &--e< c0‹8h {@S &-0/e@ c턫h {S &-%e c³ 9bT &-"eXc`Uh ߠ U &-$e|d@/vYp `W kG|ihUN³ 9YX =-GN<3N) d3@Y =iP[~4³ :}Y =- FN\2N0h Z =Ia`{ l k(`E_l  EH,l E-`l `& F%kWl @( `F%l4ql ) F%t6³ ZZ  -7p~\ \w-PHP+_l _ G ӿl ` H s2l [ a `H Sl Wa H [3h `c ` *func([]uint8, tls.ConnectionState) (*tls.SessionState, error)>*func(tls.ConnectionState, *tls.SessionState) ([]uint8, error)>*elliptic.nistCurve[*crypto/internal/fips140/nistec.P256Point]>*elliptic.nistCurve[*crypto/internal/fips140/nistec.P384Point]>*elliptic.nistCurve[*crypto/internal/fips140/nistec.P521Point]>*atomic.Pointer[internal/sync.node[interface {},interface {}]]>*struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }e3{5y-ԡth \'5tb lա³h v|5?Wݞݞ@֡ ³AT5 ס$³(Y5|ס$³HE5 ?ء$³@d5e?@١$³YGx(^W^/5hڡ(³h >*elliptic.nistCurve[*crypto/internal/fips140/nistec.P224Point]f:5Oi@ݡ³H۷5@ޡth X5, @ߡt *sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}]fX5 ݞ³h *56j``Ԟ@ mHl  \^!(&\F@x0k|5v ³HL75 ³Hi5@@³HZ]5@@`³Hv5~`Ԟ (³h j^5"ݞto}5Xt]W5M!`³RCq5@@ ³HQh#5t]|#:5j@ ³He5th cq5Yth cD05p`tFn@5r tt:5` th u |5 th >*struct { F uintptr; X0 net.Conn; X1 net.Conn; X2 chan error }h~5ͣ@th M'¿5M `th , 5a:th 5? `th 0`5_ԥ³H~3Y `.@a5f>(³_[5r `>@(³5mO(³h 5 (³h ~N5 >(³A 5,I@(³h  y 5(³h U*5?Y ?:³Nk5 ? ³h >*struct { F uintptr; X0 context.Context; X1 context.canceler }>*struct { F uintptr; X0 context.canceler; X1 context.Context },pi5l@v`Ԟ` |h 5ݞ`Ԟ@ ³h -5T th CGO5o@Ŭ |h y]5i@Ŭ@|h g83 8^౭ >*struct { key http.connectMethodKey; elem http.wantConnQueue }>*[8]struct { key *http.Request; elem context.CancelCauseFunc }>*struct { F uintptr; X0 *http.http2serverConn; X1 chan error }٤5b໮`Ԟ³H"+5`th 0591`Ԟ`³H)CX51`Ԟ ³H` rƞ5 tRyh5 ħ³H <5 @H(5 `8#Y~f5Ϭ ³H^5٭³HB/!5Z @ $P5`th _<5 ³H'7b5 2`@9h &55B tY35m`!th Ӽ5Z( "³Fp5: "th N5 .#³h B,+5:F@y`$³h `45- %³h *queue.Eager[[]github.com/sagikazarmark/locafero.searchResult]>*[8]struct { key go.shape.string; elem go.shape.interface {} }5Oݞ@V ³h w5Y5 W³HH58ԞWWtHr55o7 `ԞX>  ]5+Zth [p5W@p@\>4([aF5#ͫ]@ 25` 4]$³H'5]ͫ^@ >*5d`Gt@_X ] m5*`³75@a³h 5@@bth >*struct { key protocol.ConnectionID; elem quic.packetHandler }>*struct { key protocol.ConnectionID; elem *quic.zeroRTTQueue }>*struct { key protocol.ByteCount; elem quic.frameSorterEntry }>*struct { key quic.connRunner; elem quic.connRunnerCallbacks }>*struct { key protocol.StreamID; elem quic.streamFrameGetter }Q,557c? 6K5~ c?C`3> n@F5d7<d?ZG5@ƞ@e(³Bi!5q <`f(³85צ = g|sO5\7g(³ ϋB5 h(³,J5*`i(³R3yŞƞDcP+30 @ƞ@/Ҁ95t;n(³h '5@o(³5`3pth 5KQ`sth 5r`t@ +D5pLu³|5 `vtFm58`< w$³h YQg5Q`<wth c5xth iQ5L`y$³Hoa6c5 z$³h (05z³h PGAvailableExtensions(json:"pg_available_extensions,omitempty"DatabaseEngineVersion(json:"database_engine_version,omitempty"BGWRITERLRUMultiplier(json:"bgwriter_lru_multiplier,omitempty">*func(context.Context, string) (string, *http.Response, error)>*func(context.Context, string, string) (*http.Response, error)>*func(context.Context, string, *govultr.LoadBalancerReq) errorg5{|t3`rPQ [3M`rPQ (3`r@PQ rn3`rPQ ",3N`r\@[ Y3M`rcQ g--3x`rbb sG*3Q`re^ (C3g`rf_ 3`r@f_ =G3S`rPQQ Z53`rPQ ]Zx3`rPQ u3ؤ`rPQ ?3`rP@Q [i3I`rPQ U[H3.&`rpn Gf3U `rP@Q h3 `rPQ &J3 `rPQ ^3`rP@Q P5y-@~th 5.~t~X5qz³h A-5ս@³H5`³h  5< t5͞A³S5ٌ5u͞R³Hpp5 @`> >*struct { F uintptr; X0 *yaml.decoder; X1 *yaml.Node; X2 int }.5V +@³H6{5s2tH()5@Ŭ|h +5 +th jأ5mu@t4|5F@³HC$5=?th aG`5=@Ŭ |h 5B@³h W5] A³h .5`A³h  5 B³h K5 B@³h 7~5= A³h >5$wA³h ;?u5R`B³h bI5Pž@$³h V5- C³h Z5@k³H5OBth +5 A@th BW5 `Ath 7V5. Bth ܕ5qBth 5MwA@th k5 S`Bth ڟ5Pžth `55d`@th v{w:5 C@th  -(P1 {eDMU5 ~͞@³X25@³h iž5e`@`³ >github.com/apernet/hysteria/core/v2/internal/congestion/brutal)-p53 (³`5 ࡢt[5r !c5_f@̞`th NL5%6$³h 5C6@$³h ?M5H@$³h U5[$³h t5]̞³h ]}54t.f 5-]`ܝ`t>*struct { F uintptr; X0 *gob.encOp; X1 int; X2 gob.encHelper }=-G5C] ³Hj5fɛઢ³HUռN5"x5 L³Hot45GA@ŬǛ`|h 5Cx@Ŭɛ |h c5T@Ŭ@ୢ|>*func(protoreflect.FullName) (protoreflect.MessageType, error)4F]5z~ݞto5ʜtq51L³h 6N5W ~@th 65 th >*[8]struct { key protoreflect.Name; elem *filedesc.EnumValue }>*[8]struct { key protoreflect.Name; elem *filedesc.Extension }aM5iCth &952гH5C@th d15hhC` @th PA5;*` th O.5L` ³Hhߴ5vCkt*5qk@t\E(5hLk³h 5hC`th 5xL`Ԟ³HBvo5C@@th 1@\5Cth )5XzC^th F$H5ŇC`Dྡྷth 7^~U5i.@4z+5$jC#`th 0n5 Ξ ³h q/5X*.4($l5Y~@Ŭâ³h >*func(protoreflect.ExtensionTypeDescriptor) protoreflect.Value>*[8]struct { key protowire.Number; elem *impl.coderFieldInfo }>*[8]struct { key protoreflect.Name; elem reflect.StructField }>*struct { F uintptr; X0 func(); X1 *protoreflect.MessageType }H5L@ԛâ³Hs-5iCԛĢth >5dLݞ@Ţ³h k31-r͞@՛`/ 5xoL@՛Ƣ³HX65LƢ³8T35oCǢt<;5@ŬL@Ȣ|h -5L@Ŭɢ³h YG5Xi@Ŭ@՛ɢ|h 53@Ŭ`ʢ|>github.com/apernet/hysteria/core/v2/internal/congestion/common*Yn5sH ТtH(eu$5@ŬТ|h o<5 7Ѣth 5mu:`Ңt 5P8 Ӣt?*[]struct { key string; elem *trafficlogger.trafficStatsEntry }?*atomic.Pointer[internal/sync.entry[interface {},interface {}]]?*atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }]?*[]struct { key string; elem func(*url.URL) (zap.Sink, error) }?*atomic.Pointer[github.com/apernet/quic-go.pathManagerOutgoing]?*struct { key http.connectMethodKey; elem []*http.persistConn }?*[]struct { key string; elem *certmagic.RingBufferRateLimiter }?*struct { F uintptr; X0 *certmagic.tlsALPNSolver; X1 net.Conn }?*struct { F uintptr; X0 *server.h3sHandler; X1 *utils.QStream }?*[]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }Key;protobuf:"bytes,1,opt,name=key,proto3" json:"key,omitempty"?*func([]uint8, []uint8, protocol.PacketNumber, []uint8) []uint8?*func(context.Context, string, *govultr.FirewallGroupReq) error?*func(context.Context, string, *govultr.ClusterReqUpdate) error?*func(context.Context, string, *govultr.StartupScriptReq) error?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point]?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point]?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point]?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point]?*func(protoreflect.EnumNumber) protoreflect.EnumValueDescriptor?*func(wire.transportParameterID, wire.transportParameterID) int?*struct { key filedesc.Edition; elem filedesc.EditionFeatures }InitConnectionReceiveWindow$mapstructure:"initConnReceiveWindow"@*[8]struct { key string; elem *trafficlogger.trafficStatsEntry }@*[]atomic.Pointer[internal/sync.node[interface {},interface {}]]@*struct { f func(); once sync.Once; valid bool; p interface {} }@*[8]struct { key string; elem func(*url.URL) (zap.Sink, error) }@*map[string]func(zapcore.EncoderConfig) (zapcore.Encoder, error)ErrorOutputPaths/json:"errorOutputPaths" yaml:"errorOutputPaths"@*struct { F uintptr; X0 *redirect.TCPRedirect; X1 *net.TCPConn }@*quic.outgoingStreamsMap[*github.com/apernet/quic-go.SendStream]@*map[protocol.StreamID]quic.incomingStreamEntry[go.shape.*uint8]ConsoleSeparator/json:"consoleSeparator" yaml:"consoleSeparator"@*[]struct { key http.connectMethodKey; elem http.wantConnQueue }@*[8]struct { key string; elem *certmagic.RingBufferRateLimiter }@*struct { F uintptr; X0 *certmagic.ACMEIssuer; X1 http.Handler }@*struct { ID string "json:\"id\""; Name string "json:\"name\"" }ExternalAccountRequired(json:"externalAccountRequired,omitempty"@*func(io.Reader, []uint8, crypto.DecrypterOpts) ([]uint8, error)@*[0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }@*struct { F uintptr; X0 func() go.shape.*uint8; X1 *[3]uintptr }@*struct { F uintptr; X0 func() go.shape.*uint8; X1 *[4]uintptr }@*[]struct { key protocol.ConnectionID; elem quic.packetHandler }@*[]struct { key protocol.ConnectionID; elem *quic.zeroRTTQueue }@*[]struct { key protocol.ByteCount; elem quic.frameSorterEntry }@*[]struct { key quic.connRunner; elem quic.connRunnerCallbacks }@*[]struct { key protocol.StreamID; elem quic.streamFrameGetter }@*struct { F uintptr; X0 *quic.baseServer; X1 *quic.wrappedConn }@*func(context.Context) (*govultr.Account, *http.Response, error)PGStateStatementsTrack)json:"pg_stat_statements.track,omitempty"@*func(context.Context, string) ([]string, *http.Response, error)@*func(context.Context, string, *govultr.ClusterUpgradeReq) error@*func(protoreflect.FullName) (protoreflect.ExtensionType, error)@*func(protoreflect.OneofDescriptor) protoreflect.FieldDescriptor@*func(*big.Int, *big.Int, []uint8, []uint8) (*big.Int, *big.Int)A*struct { Code int "json:\"code\""; Type string "json:\"type\"" }A*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }A*[]atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }]A*[]*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}]A*sync.indirect[go.shape.*internal/abi.Type,go.shape.interface {}]A*ringbuffer.RingBuffer[github.com/apernet/quic-go.receivedPacket]A*func(zapcore.Entry, *zapcore.CheckedEntry) *zapcore.CheckedEntryA*[]struct { key http.connectMethodKey; elem []*http.persistConn }A*[8]struct { key http.connectMethodKey; elem http.wantConnQueue }A*func(context.Context, *quic.ClientInfo) (context.Context, error)A*[8]struct { key protocol.ConnectionID; elem quic.packetHandler }A*[8]struct { key protocol.ConnectionID; elem *quic.zeroRTTQueue }A*[8]struct { key protocol.ByteCount; elem quic.frameSorterEntry }A*[8]struct { key quic.connRunner; elem quic.connRunnerCallbacks }A*[8]struct { key protocol.StreamID; elem quic.streamFrameGetter }A*func(context.Context, string, *govultr.BlockStorageAttach) errorA*func(context.Context, string, *govultr.BlockStorageDetach) errorA*func(context.Context, string, *govultr.BlockStorageUpdate) errorMySQLRequirePrimaryKey*json:"mysql_require_primary_key,omitempty"AutovacuumFreezeMaxAge*json:"autovacuum_freeze_max_age,omitempty"MaxLocksPerTransaction*json:"max_locks_per_transaction,omitempty"MaxStandbyArchiveDelay*json:"max_standby_archive_delay,omitempty"TrackActivityQuerySize*json:"track_activity_query_size,omitempty"A*func(context.Context) (*govultr.Versions, *http.Response, error)A*func(sign.PublicKey, []uint8, []uint8, *sign.SignatureOpts) boolA*func() (go.shape.map[string]int32, go.shape.map[string][2]int32)A*struct { key protowire.Number; elem protoreflect.ExtensionType }A*map.group[protoreflect.FullName]protoregistry.extensionsByNumberA*struct { key protoreflect.EnumNumber; elem *filedesc.EnumValue }A*[]struct { key filedesc.Edition; elem filedesc.EditionFeatures }A*struct { key reflect.Type; elem protoreflect.MessageDescriptor }V4A 6h}=!}@PPP밎 6hy~= 6hA =cZҭ 6h#-ܘ-ܘ-xW 6h#---y 6h ,,d 6h ~' ~'sbm 6h9 $-l-l-q$ 6h9 9kY5 6hb`$---w 6hFjH5 6hO` ̚-̚-bwLE 6h'` ((gF 6h`` [([(ޭ 6h%@X8'8'$ 6hl`%` @-@-8EGc 6h.%P` %%: 6h_W@mP` h%h%dK 6h0@̦P` %%p 6h!%P-`%`%펁 6hP` <%<%xe 6hyB P` ܶ%ܶ%DV 6h[|mP` %% 6h@PiD( 6hc &` AA3 6h/` H H Sõ 6h E`n~G`H"H"BC 0 6h nn~`!!5` 6h ~` l l H+ 6hƠ~-x!x! "@ ~-x!|I I 6hߤ&~-!!1D 6h<&~-d-| 6hiE̦~9 6h#~<*34 6h ~` , 6h@ͦB}` 4X4X 6hd B}` SS}KM 6h2m"  6h7b em"33(7, 6hoG`dd(}J 6h9Fo`00aS 6h]F2. 6hro`]F# C2_ 6h1`']F; 6hͦ]F= h @]FĩE 6h(]F-l+ l+ (Zi 6h{]Fery 6h]F$0 6h]FJ ߳0! 6h 7]FJ  6h ;]F3s. 6h?ĥ]Fp[M 6he]FJg( 6hW@Φ]F` b 6hΦ]F fUh 6h q8]F 6heUK00o¾ 6heƥKuz^ 6h;Kwi 6h) <K``! 6hc@mK````  6h#f K``44} 6h' ɥK``:O 6h?:K`` 6hyH K85  6hN`)`   ?] 6h=` RR7 6hA)-EF 6h)-F 6h?W` 11W^ 6h *W04t2t2A 6hw >WY/r 6hiD*` KKx 6hX@Ϧ` KK C 6h;s*s &+dNdNL 6hؠ*sLs NN 9 2@ *sLs NWM/: 6h `٠*sLs MM ^  *sLs Ml>M 6h ڠ*sLs MM C뇥 *sLs M=Md 6hڠ*sLs MM I4 *sLs M4=Mj/ 6h۠*sLs MM (S@ *sLs M 6hyNତi&EEs 6ho`zi& H H: 6h$zi& H H[ 6h¡ YiXRHRHB 6hi` PFPF{ 6hYi@!THTHA+ 6h@iX(E(EH 6hYiXQHQHPj 6h@ZiXtSHtSH 6h`i!}@&H&H7 6hji!}@\?E\?E{ 6h7 {i!}@POHPOH3 6h(@Ҧi` ?H?Hm 6hSi` "D"D,^ 6h i-GG 6ho.i` 4H4Ht6X 6hŧi` L*HL*H 6hEi78S@8S@s~G 6h%@iNHT>HN 6hE@Ӧi` HH 6hi/i` HH;i 6h5n/i` HHS 6hi@!L)HL)H^?w 6h[i` =H=HCB 6hy \i;H;HĤ 6hNi-CC 6hi!|E|EU|z 6h 0P` ""J( 6hg`0P` 0"0" 6hn\WWP 6h `vvn 6hZ Hl}} 6h[ l$~ 6hqI~~{ 6htЫ73U_n 6hӦ3` ZZe 6h Ls CwCw >ۢ8` Ls Cw=w[e 6h`* 6h'vv? 6h2  1 -. 6h `K LL}\ 6hP d@d@- 6hc L!ǃǃȜJ 6hL!LЃLЃ 6hL!҃҃6 6h@-ÅÅk 6h\@`   6hO@]@` @@= 6ho]@` dd$ 6hG@Ԧ@` yyK 6h@` yyл[ 6h@H 6h @զ`  N N1I 6h^`  N NG 6h`^` T NT N;< 6h6o^` NNy 6h{o2 L_پ 6h'2~ # 6h ྤYQmr 6hYQ DoDo &?` YQ DoVS1 6hc@# ghI 6h`3` ""sqL 6ho _.)_$$"9 6h3'` ""[h 6h3` ((óc 6h?L)x 6h9L)Q 6h`4K` $%$%XJ 6ho4z@!\\ڰ 6h`ƤHn `Q 6hp_*` $T$TSb 6h*` J 6hm@`*` TTd 6h`-4h4h Z B-4hG 6h5FE-vv7X 6hSIFEk汝7 6h*5FE-uu~4 6h|@OFEkDs 6h) ʤFE;^0 6hFE ڬ 6hi"ˤFE` \\\\TO 6h̤I`  ">v 6h̤H?` `> 6ha6-@ @ Kb 6h o<_o 6h"7Ƴ` RR 6hpФp!3 6h 8EJ` ,,C 6h4`mo 6h28=&\wv 6h8&SA 6hh է PHPHA 6h_ 9p-II3D) ݞk 6h9` PP^. 6hq Sq`IIY 6hq`XIXI 6h٤q`xIxI% 6hK/q`II/ 6hv$ 0q`0I0I>h 6h-r[q`ؚIؚI 6h$ \q`̎I̎I# 6h \q`II 6hTq`LILI 6hK0q`IIƹi 6hUq`  6h@W eXeX_* 6h@W@W 6hʪX:q 6hs ;7#J 6hJ` $Y$Y 6h+!` )T)T 6hOBcX4\4\ 6h CcZZ> 6hPccp;[[c 6h)cp;ZZ7 6h cXZZ 6hc-0[0[A< 6hbcp;ZZ@W 6hI`cp; [ [/| 6h8 cG!xq 6hLe; _ _` 6hS :?`@Hr 6hfv`I[X<<3 6h}v@I[d d 6h@I[<<u 6h8I[X|<|< 6hvaI[@!H<H< ^= 6hk ;3` <<./ 6hP3X<<W 6hP`a` >>&=A 6h;` >><\ 6h*`HL&]H?H?p0e 6h%QaHL&]??P 6hئHL&]x?x?e 6hO ܧHL&]??8 6h hHLaD 6h> ݧg (HV 6h(;` ww߱ 6h* b` PwPwώ 6hgQ <-wwL 6h)\Q"X 6hA `<Q-||4 6h@Q- 6hSQ` xxԠ5 6h%QumiY 6hi]`'+_ 6hwxd+` >f1 6h n+!:xx85`f 6ho X+!:} 6h`%"^88] 6h &" UC 6h+". 6h," $#{ 6hfP8 ` NN|E 6h@0 vh 6h9< -IIy 6h = -JJf" 6h9ƫ 9 6h y ^ܿ 6hb`= -KK%{ 6h  oF 6hB v܌2 6hV  `֙ 6hJ/d: p]p] ^ 6hD*H  -6{@D *H GSZ 6hՃ`E*H  >4DՃE *H  6h@ *H G3 6hYz*Ht hFhF} 6h`ߟc`ATT3] 6hߟc`A??@ 6hߟc`Ak 6h4*` ;&<< 6hyQ ~&d[[W 6h :0m` ||q_ 6h2|@ 5 S 6h) >8.- 0 0: 6h=8`8.` //l 6h_`>8.- 0 0Www 6h?>8.-L 6h; ` (;(;I% 6h > -@;@;W^ 6h ? -gk 6hR`? -;3@  @"t 6hO&j! 22 6h Ҫ&X22jl 6hY?9-W 6h&-cc6 6h @&-l!el!eD- 6h= ž&-tctcwl% 6hW1`@&-d0ed0e{j 6h`=&K~ 6hL@&-l2el2e1w 6h'@&-\3e\3e/ 6h9Y D=-GNGN] 6hd3`D=i 6h:}D=- FN FN| 6h D=Ia M= 6hId@%bzN 6hZF -@?@/[ 6h~`G\w-PPؖ 6hd\w6? 6h>\w@8`u= 6h@\w@88 6h/\w@8 6h`d\w@87ib_ 6hJ\w@8e 6h'\w@8c 6hG @8a& 6hG @8# 6hnF @8!8 6h9`F @8: 6h[ H @8=챻 6hW`H @8 6h5F @8[N 6h5 @8 < 6hM G @8EQ 6hd @8 6hH`  6hLkGhhD-? 6hG ǓUdHldHl6p> 6hm۔tt ߊ m @۔tܪt  6h#MkG;t;tEQ 6hL, 6h@T4 t4 t"ln 6hAMd-(#8 6h NdA3i 6hdo,>P 6hƩd6TCuTCu 6h`0r@H/Q/Q̄ 6h }pA-eq 6hA@7Պ  2 6hнrՊ2 ,нq 7Պ2tcS+ 6h `O-}_}_/w 6hO-l› 6hRO-T3 @k 6h e^-n B*func(*tls.ClientHelloInfo) ([]tls.EncryptedClientHelloKey, error)B*func(*big.Int, *big.Int, *big.Int, *big.Int) (*big.Int, *big.Int)B*atomic.Pointer[internal/sync.indirect[interface {},interface {}]]B*[16]atomic.Pointer[internal/sync.node[interface {},interface {}]] 0 6h` jn B*[0]*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}]U 6h jn B*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *poll.FD }B*struct { F uintptr; X0 *net.TCPConn; X1 net.Conn; X2 chan error }B*struct { F uintptr; X0 net.Conn; X1 *net.TCPConn; X2 chan error }B*tree.Node[github.com/apernet/quic-go/internal/utils.ByteInterval]B*[8]struct { key http.connectMethodKey; elem []*http.persistConn }B*go.shape.struct { net/http.key string; net/http.values []string } 6hrx Ko&I 6hy^˩g~}> 6hhBo&ddx 6hH<jn j 6hKH@jn Code=protobuf:"bytes,4,opt,name=code,proto3" json:"code,omitempty"Cidr=protobuf:"bytes,2,rep,name=cidr,proto3" json:"cidr,omitempty"Code=protobuf:"bytes,5,opt,name=code,proto3" json:"code,omitempty"+" 3&``~@ƞ`~@ƞB*struct { key protocol.StreamID; elem *http3.stateTrackingStream }B*struct { F uintptr; X0 http3.clientConn; X1 *quic.ReceiveStream }DefaultToastCompression*json:"default_toast_compression,omitempty"MaxPreparedTransactions*json:"max_prepared_transactions,omitempty"B*func(context.Context, string, *govultr.VPC2AttachDetachReq) errorB*struct { F uintptr; X0 chan exec.goroutineStatus; X1 chan error }B*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }B*func(func(protoreflect.FieldDescriptor, protoreflect.Value) bool)c;3&ŞDB*[8]struct { key filedesc.Edition; elem filedesc.EditionFeatures }B*func(impl.pointer, *impl.coderFieldInfo, impl.marshalOptions) int3\8L͞8`/C*struct { F uintptr; X0 *masq.MasqTCPServer; X1 string; X2 string }C*struct { F uintptr; X0 client.Client; X1 bool; X2 chan struct {} }C*[16]atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }]C*struct { F uintptr; X0 func(dnsmessage.Type); X1 dnsmessage.Type }DisableStacktrace1json:"disableStacktrace" yaml:"disableStacktrace"C*func(context.Context, network.PacketConn, metadata.Metadata) errorC*quic.incomingStreamsMap[*github.com/apernet/quic-go.ReceiveStream]C*tree.Btree[github.com/apernet/quic-go/internal/utils.ByteInterval]C*struct { key reflect.Kind; elem func(reflect.Value) interface {} }C*func(protocol.EncryptionLevel, monotime.Time, bool) *wire.AckFrameLogMinDurationStatement+json:"log_min_duration_statement,omitempty"C*struct { F uintptr; X0 *gob.encOp; X1 *gob.encOp; X2 int; X3 int }C*[]struct { key protowire.Number; elem protoreflect.ExtensionType }C*[]struct { key protoreflect.EnumNumber; elem *filedesc.EnumValue }C*struct { key protowire.Number; elem protoreflect.FieldDescriptor }C*[]struct { key reflect.Type; elem protoreflect.MessageDescriptor }D*atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]]D*[]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }D*struct { F uintptr; X0 *forwarding.UDPTunnel; X1 <-chan struct {} }D*quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream]D*struct { key http.http2FrameType; elem map[http.http2Flags]string }D*struct { F uintptr; X0 *http.http2clientStream; X1 chan struct {} }D*func(context.Context, bool, protocol.ConnectionID) qlogwriter.TraceD*func([]uint8, net.Addr, []uint8, uint16, protocol.ECN) (int, error)D*[]struct { key protocol.StreamID; elem *http3.stateTrackingStream }D*func(context.Context, string) (*govultr.Soa, *http.Response, error)D*func(context.Context, string) (*govultr.Iso, *http.Response, error)D*func(context.Context, string) (*govultr.ISO, *http.Response, error)D*func(context.Context, string) (*govultr.VPC, *http.Response, error)D*func([]ackhandler.packetWithPacketNumber, int64, int64, int64) boolD*func(protocol.PacketNumber, protocol.ByteCount, protocol.ByteCount)D*[8]struct { key protowire.Number; elem protoreflect.ExtensionType }D*[8]struct { key protoreflect.EnumNumber; elem *filedesc.EnumValue }D*struct { key protoreflect.Name; elem protoreflect.FieldDescriptor }D*[8]struct { key reflect.Type; elem protoreflect.MessageDescriptor }E*utils.Atomic[github.com/apernet/hysteria/core/v2/server.StreamState]E*atomic.Pointer[internal/sync.entry[*internal/abi.Type,interface {}]]E*[0]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }E*func(reflect.Type, reflect.Type, interface {}) (interface {}, error)E*struct { F uintptr; X0 *udphop.udpHopPacketConn; X1 net.PacketConn }E*func(context.Context, string, string, *tls.Config) (net.Conn, error)E*func(context.Context, *url.URL, *http.Request, *http.Response) errorE*struct { F uintptr; X0 func(...string) error; X1 string; X2 string }E*fips140cache.Cache[uint8,crypto/internal/fips140/ed25519.PrivateKey]E*go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer }E*[]struct { key reflect.Kind; elem func(reflect.Value) interface {} }Value?protobuf:"bytes,2,opt,name=value,proto3" json:"value,omitempty"Entry?protobuf:"bytes,1,rep,name=entry,proto3" json:"entry,omitempty"E*struct { key protocol.StatelessResetToken; elem quic.packetHandler }E*struct { key protocol.StreamID; elem quic.streamControlFrameGetter }E*[8]struct { key protocol.StreamID; elem *http3.stateTrackingStream }E*struct { F uintptr; X0 *http3.stateTrackingStream; X1 *quic.Stream }LogAutovacuumMinDuration,json:"log_autovacuum_min_duration,omitempty"MaxStandbyStreamingDelay,json:"max_standby_streaming_delay,omitempty"E*func(context.Context, string) (*govultr.User, *http.Response, error)E*func(context.Context, string) (*govultr.VPC2, *http.Response, error)E*struct { value []uint8; length int; style yaml.yaml_scalar_style_t }E*struct { F uintptr; X0 proto.mergeOptions; X1 protoreflect.Message }E*[]struct { key protowire.Number; elem protoreflect.FieldDescriptor }&I(@@!3$@`(ԘPʗ@P 3,1(Dee 0`9](mee`93u(e`e-?(yE~~~ qa(@~ ~ F1.(@ F5(1` yA3e ]FJY(]F]F-B(TKK``[$Y(K`Ka@q/(WWig* '(  Mm(f@K@+(II6``(y(@L\/(YI6,(/@L g(y*s`*s &+A 3;s *s &+MM #(L LHq(Bs(׬@Ls (@N x.( &+7Y31 r &+0L0L>(`6(hSM(ѧ(W@ `/(p 8`@(sBKK)ao(0K@K-5@(9u@!!N -(V!!`DZ(K!`!6ǵm(@!%( X(9L`[(y7(1@G`}`g(@G!-^(iLQf(yL`*$%(L@9`@-U(C#i i!}@(iNii&q i(iࠡijDp(@i@iE tF(ii]Jό(&ii/' 2\D(yOi`i8fC(kP@iiҶy(yi in(Oiin% 6MT(<i࣡iE M(E@i@i'Hg(Wiiek`(iiA(@i`iek`K(oiiv  (Xi iV-8AY3(ii4Q_l(/ড6m(@ C@T% (Z@T5(mlUTW(n ` !iE'( ::m(Q.) .)_7(.).)w{a(%.)੡.){({.)@.):)({@.).):Wm(U&QYDB=(b'p`pqA(.'pp `AM(7@(Gq GqN V(^q(GqGqN(J?3˃@)$55ݞݞF3)$@Ŭ@ŬݞݞC&(*uq>A(V,qq`E(r6-r`-r`6U(-@7-r-r?#it(<7o o&&vV(9ӟI {(?_=௡\$1(1@@X`έD(OC\C(tC3`⬧(C`\+M(OEcc-8(Gs sN K(!@Gssl`u(vGsಡs] ? \(Gs@s`-(@JHLHL&](_4Jgg>@( OQ`Qu8P(,@O++!:>(P" "^}("P"" V(%r"ൡ".G߿(u"@" 1(Y   d[(<*H*H L(E @ ` ;&4>(/q5q57 sb(i_0m 0m@!(Y`  66.(@ ม 5`( @ ! Ch(@  !'9(>LELEV-{$r(@LE`LEV-`^ ( @&&K%(Wu u9y#+G?(ڶSS-q(S ໡ mD ja( @ r@H]x (%\ݙL +r'h(@ffj! +(Ifd`d`s)x(HB B 6e3B $`r ._3B $@`@`@ @`B3)B $ @ W(y@B @B  mj_(Ϥ@ww[eo(fww>@%(ҀK`KT?d3d(Ǒmmڅ`P(ؑ@m m $;(@8g8gv;V(22!_X(2@¡2!U_(¡W&aӯ(@áF (m`áL,@jK(á~`J(œ ġ?&PO(֓@ġ#K+(0ġ0r@HT(Y`@@š6Qi(š" (@ơ! v (v Pơ/řIř e(ơzgaԍǡ|  bx0(8 pǡ,@>  ǡڟz` )0ȡ|  |ȡ@z@ hhCat`ȡ|  (* Pɡz hh-#0Fɡ|  ,Α(LʡzsE܍pʡ| @ 0(AʡzhhÇV0ˡ| lh;dFˡzګhd>U,Jkˡ|  i P̡z ?h`jZhh̡|  '_m{͡z@h`厇`p͡| @ /XE͡z`Ԟh`MxF0Ρ| O(Ρ j9ɵ;(uΡ  3=(Pϡz#*܍3ϡ| @uF/ (С e?s($pС  ѥO(PС X(0ѡ !W,(ѡ 0(wѡ `0Dq(3Pҡ ѥϖ(йҡ L(ӡ  ̅kpӡ  uc̅ӡ  w({0ԡ  H((Õԡzhhz4ԡ| ঝ ?G(Pա lzhdPB\Kա| ଢ଼(uQ֡ݞzݞt&p֡| p ֡z(" o0ס| `(4סzHHgEh(ס|  kT̅|ePءz? n ء| ஝a,١z?a, p١|  kD ١zh φ0ڡ| ಝrd0(ڡ  , Nڡ 5(Pۡ <(ۡ *(xܡ  1(pܡ ;(@ܡ >(0ݡ ^$ݡ@zHDr@Keݡ| ` p (hIPޡz@hhBMnlޡ| ฝ k(xߡz ܍Cpߡ|  ^`a(lߡz@FV:܍i.0| ` )HKzh`6/| Tu$R P  t(`A Pʗ ,S(|  Y(pzr܍̍|  ?z('}0@zhd\c| @ U (%&zhdZ t\P|  XK(@xzShhFI}| elpz2L.| Ýc\X(H0 @3[Pp(mx zR (4f h (P `̣(s(| @F*[]atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]] lz6(AP zݞhhJ/| `ǝ:(l%`z`Ԟ lOp| ǝ7(#^^`  FD RC0 @ =xz HH˱x| `̝C(!yPz HH=h}| ͝ `4 ]F[@ ϝ8'(p@z@HH. hj| ֝ V C0@z@H | ם ZG5z`Ԟhd '܇%P| `ם+-$Ezݞ:lW| םb\pz]qt2| ם$Z(}0z! lC| ؝@z@HD39kͥ|  x̅z`>Qp|  旖?̅ozOhhtnT0|  O̅zz hhXG|  ̅! Pz>7 | ` [O̅|zIhh Xip|  H̅zzhh/6Ȍ0|  %-̅ t (l @r^(4OP `5RQ a ?z:d2d < |   d(p  ?zhdQ\l |  (&0 @vz`Ԟhd%\ | ` th(  z(P  8 (z   8(! ݞz`Ԟhd@+ʰ\p |  >\(k~ zhh BE0 |  xFG(,n @Ŭzhdi0)\0 |  Q(1P@Ŭz@hd@\|  #~8(!ݞ[@5s={p V W̅01 @Ŭ($0 X .+|@ Ц.. P ,#(~P @W?x(~ `XE(| W X(7p `1F*struct { key string; elem func(string, *tls.Conn) http.RoundTripper }F*[]struct { key http.http2FrameType; elem map[http.http2Flags]string }UvP໮z`ԞHD:^-X| F<(` b3j!` ( pzhh[" | Hzo0z`ԞHD.M(:| `y1z`ԞHDg-mP| č(pzyHHNߞh|  )(pz2hh| E0z> T'l̎%| `gĆz΃r܎mP| Ng(Pz ħHH.gh~n| ( *<e p z@H@!q({| 804T g 0 zg:m| `YZqϬzHH-hP|  ٭zHHi'|  +#4Vp z@`J|  D&J( 0zhh% | `({z HHuhʍP|  j̅+`z@hh/p: |  HҎw(|p zB(3܍ |  AE81('0!zhh>9$!| `6|!(zHK P"|  ́(m"z hh#|  p({p# .zhd˻\#|  y[(00$@yzhdy\$|  m(c$-zhdߘ6\P%| `3(l %`-zmHHs+h&| Л p&-z(3 &|  ]H((0'-zhd'R\4'|  "(l|'z@Df?܍P(| ` Ӹ(|(z;ƶ4܍)| *j$p)źpl)|  ̅0* z(x|* @w-l( * (h2P+ (dZ + Ql(Z , QE\(=p, ȥ _8, @ nw(̎0- pӏj(P- (f2((-  k(P. ໮IgK(.  ޥ(`/ yX(p/ Ϭ}G(|/ S(00 ϧ`(0 ܧF(0 p֚Q(P1 (RWf(|1 (2 ໮(|p2 Ϭ׍t(:2 뛝L(03 @  S̅n3  i̅n3 xd(8P4 }JP(xn4  F*func(context.Context, *tls.ClientHelloInfo) (*tls.Certificate, error)tpvjRP5z3%dn5|  Ri(06zhhRnp6| @  ( 6z4hh WHR07|  (M7z@hh 8L7|  1Ԍ5(|RP8z@hhzKo8|  c5@(9z K܍`p9| @ 娊(|9z@hh=\]0:| TTl7):z` Y#m̔:| 0$MiP;zG|@;| ĔX)$<z }÷lp<| @ j9<z?$90=| 2$=zBжl?[=| _(|P> ۭ (x> @yf(? 40j(p?  \̅"? `r C(N0@[ VW(R @8 I(@zhhePA|  R( A,@,(B9(BzJhdhʤdpB| PP\B:BzqGx:0C| @  ̅*C ~4j*(}Cz ȧHH]+h$PD| P(:~D ȧiz(u:E ȧ~n(opE W(LToEo&3(\0F6z x968tF| 54$Fz;lқPG| `5p\GzWAMtTH| (VpH `-ڭ(WH ʧغ( p0I ;F*struct { Streams []trafficlogger.dumpStreamEntry "json:\"streams\"" }S(,I 8w(q0J {#>(zJ rpJ@_zHDJcPK| -K@_z@HDbL| &YpLz!8'HL| 3 Qp0M@z@HH9M| `\c(M Jf (0PN @_IZ (rN @z.(O #I(pO + (CO 7w($0P @ (H+PzhhMBVP|  }PQzh`=yQ|  w(Rzhdt\(fpR|  M k(R@zhdJ\Lf0S|  Ҍh(5SzhdoP\S|  D(fPTz@hh\ OT| `z?(`qUzHHJ h6pU| F*[8]struct { key reflect.Kind; elem func(reflect.Value) interface {} } d|,(qVݞzhd8J\7pV| a(, V5z HHh0W| |X$2 WԞzWA#l,W| @ NkyPX z`Ԟ 2mX| Y p(x Y mB(vpY  ,(Y F(0Z  ϟY1(qZz+hh7Z| !;^(BP[ @WH(4[ 4,HMRTZ\Wz@p(ȓqp\| #1u\ͫzQď10]| $(]]z4HHu6hГ]| `$4`7P^ͫzԏ^| $2`_`Gzt}ԏ0p_| %/n(_ tgd(0` @$. `z!Sb `| `& ̍1m(vPa@zhd%\Va| ' ?vbz@h`m`opb| `' ؇z b7z g^q0c| `*Q"! c zT| \c| *BfM { Pd7z<(}a$qd| `+.(`{ e@ƞzŨEH4qpe| ,Ouq P/ eH7%8# t,0fz <YG gf| , e<{ fצz =x<grPg| - x0t Zgz7 U rh| `-[p{ phz58/,rh| .}/h 0iz Q,i| `.n(ii Ԯ:X/(Pj @S 7;̅ j צ:@(dk Ԯ n<((pk լ&*(5k (L0l `E((l  6(El (Pm Ub3((m F*struct { F uintptr; X0 *http3.RawServerConn; X1 *quic.ReceiveStream } (h0̅z PnzhhĊn| @2ϛ ozP Qpo| 2 U c(boz`3hh20p| 38(1p .5(rp 7{lu(OPq M(#sq 60(1r `AF%(pr 71qs( r ՞ B(0szQhhss| 4h(,s  vx]( -Pt`zF\t| 5@4 u`ɤ~0Ԟ(puzz /lqu| 6]$݁0vz #nl Lv| 9 p(v`<zhd~\)LPw| @9 6o1wz`<h`{wwHLx| 9 שׂpxzh`jx| 9!(80yzLHH'?Chvry| : (Gyzhdv\Pz| @: ai(zzhdU\{| :AutovacuumVacuumThreshold,json:"autovacuum_vacuum_threshold,omitempty"F*func(context.Context, string, string, *govultr.DomainRecordReq) errorO  {@@'"P|z{|F || ;3#U(}   0< (LZp}) -(Õ}z@hhOn0~| < i(~zDTk}܍0~| < 3v̅PPzhhMa&| `= TV̅P ¤vpz@HDTQPЀ| @ tPd@0zh`+u| A'N$%zo/ĦP| `A5  ͞zAi v| Ax.ڀp͞zRHHWA֓Ѓ| @BUv0 z@ o=| BsB y<  + Dq;R PhB+ W$B 1A "  +zHDRWp| `C( B3iSІz2H@ВLJ0| C J:|s@ŬzhhD+tS| C u(vPz +hhֈi=| DHĆ.z܎ p| `DU Љz@H 0| D  z?h`:}d| D ](P@Ŭz hd+j\į| E j(=Bzhd\0Rp| F qD(hЌAzhd'q\0| G ֩b(F`Azhd,*\| @G bH(|P Bzhd@H\| G 5A(=Bzhdfl\XRp| G 4&(Џ Azhd+@\$0| H fKy(Azhdm \| @H  (P`Bzhd\| H ( žzhdQu\p| H  `Z(>>В Czhdw \R0| Ib5(xE@zkHHQhu| @I \mq>PzBh`:R| I OzAh`/fp| I U[TЕz`Ah`wFؔ0| J 7?/z Bh`N{| @J UbF>PzBh`VܭR| J klzAh`6np| J "]0Иz`Bh`J0| K `P zžh`'S| @K k Pz`@h``66| K  =?z Ch`fHSp| KF*struct { F uintptr; X0 *[]uint8; X1 *error; X2 proto.MarshalOptions }+Ҩ ~z͞fP ڃp| @Lrr ³ p?М*L" %G?0*L^e h *Ld@ (<| *L( -p !zu\Т| `_ &`!0z@̞h`9Fp| aO(f  "(Pzhd\(f| a (zhd(^j\Lfp| a e(uХ@zhdDd\0| b s(/zhd\a\ے| `b V̦(5P̞zhdNd\| b8ܸ X4 !]Q" \u @4I/$!pz :_lFTШ| @cSg 0z`ܝ|~g +| @dfHn  zHO cP| e"kbɆɛzHDT| eb (0p5z LHHHEhЫ| f $|Y0@ŬzǛhhft| `f h|$1@ŬzɛhhH`t,P| fT6@Ŭz@nޯ+| f@(yp ɛL $1Ю~zݞl0| g (x zʜ4:܍"| h o̅ PLzhh'S| i 6(og ~zhhGI p| @i Qhбz h`8Z-T0| iKI(o @̜`(" ̜F*[]struct { key protoreflect.Name; elem protoreflect.FieldDescriptor }F*[8]struct { key protowire.Number; elem protoreflect.FieldDescriptor } ( гCzhh΂`10| `j`( ĞzHHMghx| j qPCz@h`Y")| j n(Cz` hhrX:p| k c(#жz` hhA`0| `kЛ(Lz` HHhɅ| kv7$ PCzk#:D!l| kwG$zkzlp| l :̅ʁ йLzkhhi>0| `l v+c(HCz`hhImQ| l P2PLz`ԞH᮵ | l (Cz@hhL(p| m ]~(tмCzhh@0| `m %(Cz^hhԿD| m|3( P]@gg ڿs(Cz`DhhŔ| mcip.z@:ďxп| n "( 0Cz#hh C2| `n T u Ξz hȝX :P| n$YZ`.z( ^¢| nN(=(p¢@hh h ̅p¢~z@Ŭhh]0â| o|k< ΢ ܜ+@О s7QR0ϢhB+ sya$BϢ1A ( AЌSϢzHH@QВLJPТ| `v |sТ@Ŭzhh$ btSѢ| v sw(vpѢz 7hh{i=Ѣ| v2/Ć.0Ңz:C7܎ Ң| wǵ.Ңz|UT PӢ| `wG*struct { F uintptr; X0 client.Client; X1 chan error; X2 net.Listener }G*struct { F uintptr; X0 string; X1 chan error; X2 *masq.MasqTCPServer }G*struct { F uintptr; X0 func(zapcore.Entry, zapcore.SamplingDecision) }G*struct { F uintptr; X0 *client.udpSessionManager; X1 *client.udpConn }G*[8]struct { key http.http2FrameType; elem map[http.http2Flags]string }G*struct { F uintptr; X0 *sync.Mutex; X1 *bool; X2 http.ResponseWriter }G*struct { Code int "json:\"code\""; Message string "json:\"message\"" }G*func(trafficlogger.dumpStreamEntry, trafficlogger.dumpStreamEntry) intG*queue.Eager[go.shape.[]github.com/sagikazarmark/locafero.searchResult]G*go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }G*[]struct { key protocol.StatelessResetToken; elem quic.packetHandler }G*[]struct { key protocol.StreamID; elem quic.streamControlFrameGetter }G*func(context.Context, string) (*govultr.Backup, *http.Response, error)G*func(context.Context, string) (*govultr.VNCUrl, *http.Response, error)AutovacuumVacuumCostDelay-json:"autovacuum_vacuum_cost_delay,omitempty"AutovacuumVacuumCostLimit-json:"autovacuum_vacuum_cost_limit,omitempty"G*func(context.Context, string) (*govultr.Domain, *http.Response, error)G*func(context.Context, string) (*govultr.S3Keys, *http.Response, error)G*func(context.Context, string) (*govultr.SSHKey, *http.Response, error)G*[8]struct { key protoreflect.Name; elem protoreflect.FieldDescriptor }H*struct { F uintptr; X0 *uint64; X1 *time.Duration; X2 bool; X3 string }H*atomic.Pointer[internal/sync.indirect[*internal/abi.Type,interface {}]]H*[16]atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]]H*struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) }H*[]struct { key string; elem func(string, *tls.Conn) http.RoundTripper }H*struct { F uintptr; X0 httputil.switchProtocolCopier; X1 chan<- error }H*func(context.Context, string, []libdns.Record) ([]libdns.Record, error)H*struct { F uintptr; X0 *server.udpSessionManager; X1 <-chan struct {} }H*struct { F uintptr; X0 io.ReadWriter; X1 io.ReadWriter; X2 chan error }DomainAprotobuf:"bytes,2,rep,name=domain,proto3" json:"domain,omitempty"H*[8]struct { key protocol.StatelessResetToken; elem quic.packetHandler }H*[8]struct { key protocol.StreamID; elem quic.streamControlFrameGetter }H*struct { Algorithm pkix.AlgorithmIdentifier; PublicKey asn1.BitString }H*func(context.Context, string) (*govultr.Invoice, *http.Response, error)AutovacuumAnalyzeThreshold-json:"autovacuum_analyze_threshold,omitempty"H*func(context.Context, string) (*govultr.Cluster, *http.Response, error)H*func(context.Context, string) (*govultr.Network, *http.Response, error)H*func([]uint8, []uint8, protocol.PacketNumber, []uint8) ([]uint8, error)I*struct { F uintptr; X0 client.Client; X1 chan error; X2 net.PacketConn }I*map[uint16]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }I*struct { F uintptr; X0 *tls.weakCertCache; X1 []uint8; X2 interface {} }I*struct { F uintptr; X0 func(context.Context, bool); X1 context.Context }I*[8]struct { key string; elem func(string, *tls.Conn) http.RoundTripper }I*func(context.Context, context.CancelFunc) (certmagic.Certificate, error)I*[]struct { Code int "json:\"code\""; Message string "json:\"message\"" }PrefixBprotobuf:"varint,2,opt,name=prefix,proto3" json:"prefix,omitempty"I*struct { F uintptr; X0 func(quic.packetHandler); X1 quic.packetHandler }I*struct { F uintptr; X0 func(*tls.ClientHelloInfo) (*tls.Config, error) }I*func(context.Context, string) (*govultr.Upgrades, *http.Response, error)I*func(context.Context, string) (*govultr.UserData, *http.Response, error)I*func(context.Context, string) ([]govultr.VPCInfo, *http.Response, error)I*func(context.Context, string) (*govultr.Database, *http.Response, error)I*func(context.Context, string) (*govultr.Instance, *http.Response, error)I*func(context.Context, string) (*govultr.Snapshot, *http.Response, error)[4pg@=yp8=+xnfp@=+}ph`=yDh j=U@; h  =U@0p&h=/KI9`` =+ERk9hF @E@]³ > j Q K [Q `- Ѐ`s  S]@  g_ x W ݻd  #dr' @1l ~p@ c!(](Bl` +mL9gG@¤ ywtm P;ș hetz //p //;;9h.~@~H ׭i{9hMy~~T9h`{~~T{"p ~`~;w9h~~T|^9h@F~ ~T`d~p, ~~;}q9h@c~~H ׭c9hRc~@~YGj]F`]FX?4  ]F]Fe@Vw³  WB9h`*s*s,p@ *s*s.op@*sӓ³ *s ?+kx( i:p `zg +U9hL LԮ Ϛ;@: 'Fi(h 8(s` !@Ŭ\( @!@Ŭ u IK9@@oo#LL`t@@y PL`8k=h 0iiOPi i i@ (ii|;"F9hSii`zIFp@ i@in*3 i٭!}@t2Et2E,A(n S i'f( i`i`XapQ ii$"pO iח @?92`iiE pN@ ii?(Si@idꨋpp;$@pc `Lgp` LhܤO9 L L$(Q&(` @5(} @~W( @@yQ r(> @Иox9h` @@`:ryh  `)@-q@4 Q ''lRTq!{: ?  [): 3j( /,- ` u'x() ȗ@ݞ)lh ) ;;;;.=UFA(/ܵ(; HhH`hH;D(@ *@Ŭ O۴ 5n 5n2 (R`TFEFE\0(ph?"@_FE㵗$$L9``@FES@Τ$$Ę`yFEΤC/ apH?z`=-  `H?N@0 9h+ ++x<`h YSu+ + b^- ^-X,ul S!/J /J 7c³ @ `ϤՒdGp ,Y³ #  W:V=` =+p#= =(`pp pO@z`9hI ȣd@(R7 7mFGr A@ AV%q9hN+ o_) pW@, o@ u`- `]3l³ - hvx( E EE-t9hX;Ex: 9hyY;/ 0(!ђA@ \Y !  (@e(G ` <9hă {cc:Ԯ9f(B c cdW(@ cc}q p@2 cc- b2 @cX.CN I3 ciK 4*99'TpH`FA$(!@IK(  LLLH4Lhy"\pV@LӼLʮ Mt@Q/O nOD `t?Q` _ b `% Qh@ ` ` `t@`Q` _,$l({`Qk Kjp; `t Qh@ `( ̈́ u`QR84x0 L)uQ* ̪ڤpS`< Q@QHN`Ap`!Qu LC' "Q u"`Q u:#Q'³ @5`$ Q< moO5%Q -{+m&QB y,@QY֢9@S"k  ppDT".np[@T`"J09h$W" ) N@Z "@@46:ܹ$ s\" qVpt\"?\;p{:^@"8 !jyp,_"8+Mó Ja ":-#?pb@d` "RB0p,@e "نppbf !"֙cph!"?\ T&Uk!" /pyk@""ďrUpm""J3Vp-@o#"N dn;o`#"ؙ1apo#"rp @p $"Icpq$"u 4.s@v$"L ]?*9h<w@%" m$ =<@|%"Z9h`> "&"p. 9h? "`&"p. ϗ(9hO "&"p. \]z9hNP" '"p. &Y9h_c"'"p. kU9h("'"p. lI9hW"@("p. l9ht@"("p. JBs9hO")"p. @9hR"`)"p. W9hx@")"p. 9h " *"p. Uq9htF"*"p. 8ß9h "*"p. "vo9h z"@+"p. %9h[<{"+"p. Z@>9h`? ","p. kֺ9hc"`,"p. }9h)","p. 9h? " -"p. ϊ9h%  "-"p. a\9h P "-"p. M]e19h"@."p. $I9ht "."p. $o9h(P"/"p. SS9h`"`/"p. s9h%"/"p. NC9h" 0"p. D9h &`"0"p. ւ9hT}0"@PAR9hc.}@1"TR!9h~1"'&SK7D9h@~2" W] ]9hy~`2"י]Lo\9hx.~2"TgeT9h 3"ch&u9h#@3"hO89h3";ix9hy@4"ٙ@jZ9h4"^@mw9h|@5"^r 2k9hU`5"s<9h?5"+tbL9h? 6"GP@w 9hz@6"ڙx6ó9h.6"yy/QO9h[@7"P@zcO 9h7"Գ{59h@8"^|,.'9h`8"^{?s` fP @ 8 .609h 9  ǣ-(Bl 9  zL _9 G@¤+(  @:  fZ@Ic:cW+@zp `H 0m;0m ;i5 `;Lu 8 _uJ ;  8&JPg( <  6lCg` LE<LE/ 5<&@ *t @=&@E~h  O =&}%b` >&w.M4 `>&w.e  >&w.ehx͋@ ?&w.)={( r ? My Mp;GYb?Yb` 7- GX  @@ S@Y>@ h a! @=\@O/ '! 0A0` 1# `A%u@ƞn4 G# A%u@ƞEILU R% B%Y vu3& B%!Q(- q ' B%`E- _' @C%` a *  C Şо^(rD  f6_(7~`D >hhAP A D I` - h E` 10g- M EyeDbf 4@E\wX.=<" n`` @F i j9` F 9@EM 5a G p>ל Mb `G G6x(@g @G@^/ ap  Hwz`/ _HwPC/  Hw(^H/ b @Iw P@{ Iw6E- JwN@Tv%``Jw s6 Jw!L$7#p5 KEЖ(@]fKf!Lgh fKf@ - `@L_H!(Lf cx- MJ `#-  `MJ0n(/ @MJ H댨N5 ` NJ`U N;1 0- \ CN;and³ M7 $Ĝ@O$] ! g8 KOK'`Ĝ bP6@0P0 i_.6`PmƗ' 0Xa^gmPm-Ɯ4Î(?m Qmb(M ? Qf۟ ?`8 QfV H8 @Rf ` ц- ў 9 Rf-PFpC69 gS g; C1`S1)ʜ dž@ GSGᮕ$4Ih` TǓcv9hn T>@J&Y(4TD@Ŭ'A(@UƧx( EUE x(L` EVEK x(gE`VE5yhhVФU ³  ? l Wl'FN³ BlWl'F5³ lW^'FkG³ @D ^-@X^-'F³ xD lXl'FYY³  lYl'FߡD1³ ` ^-`Y^-'FRߑ³ | ^-Y^'FJ*tree.NodeIterator[github.com/apernet/quic-go/internal/utils.ByteInterval]J*[]struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) }J*struct { F uintptr; X0 func(*http.Server, net.Conn, http.Handler, bool) }J*struct { F uintptr; X0 func(string, string, net.Conn) http.RoundTripper }J*go.shape.957378fe0bb00c3d391e5bb75bbf944ec5c239e07918068cb08c7a047ff2913cEKLz @Y 55[55@¤#LQQ`^55\55@¤9L `Z 55`\55@¤Lx(_55\55@¤J*go.shape.8b7904c80154b83ecf596893bf0803eca9f198932213ffb2fa1e3e98ed863b60IntValueAprotobuf:"varint,3,opt,name=int_value,json=intValue,proto3,oneof"J*go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899J*struct { F uintptr; X0 *error; X1 *error; X2 bool; X3 *error; X4 *error }J*struct { F uintptr; X0 *http3.ClientConn; X1 bool; X2 map[uint64]uint64 }J*func(context.Context, string) (*govultr.Bandwidth, *http.Response, error)J*func(context.Context, string) ([]govultr.VPC2Info, *http.Response, error)MaxPredLocksPerTransaction/json:"max_pred_locks_per_transaction,omitempty"J*func(context.Context, string) (*govultr.Neighbors, *http.Response, error)J*func(congestion.PacketNumber, congestion.ByteCount, congestion.ByteCount)W3 ŞŞ`~ @ƞJ*func(impl.pointer, impl.pointer, *impl.coderFieldInfo, impl.mergeOptions)K*go.shape.struct { encoding/json.v reflect.Value; encoding/json.ks string }K*interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool }K*func(context.Context, time.Duration) (context.Context, context.CancelFunc)K*[8]struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) }K*func(go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer })K*struct { F uintptr; X0 *tun.TCPNat; X1 context.Context; X2 time.Duration }AutovacuumVacuumScaleFactor/json:"autovacuum_vacuum_scale_factor,omitempty"K*func(context.Context, string) ([]govultr.ReverseIP, *http.Response, error)K*func(context.Context, string, *govultr.RestoreReq) (*http.Response, error)K*func(context.Context, string) (*govultr.KubeConfig, *http.Response, error)K*func(context.Context, string) (*govultr.ReservedIP, *http.Response, error)L*func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)L*struct { F uintptr; X0 *http.http2clientConnPool; X1 *http.http2Transport }L*struct { F uintptr; X0 *http.http2dialCall; X1 context.Context; X2 string }L*struct { F uintptr; X0 chan bool; X1 chan struct {}; X2 *http.persistConn }L*struct { F uintptr; X0 *http.Request; X1 chan bool; X2 io.ReadWriteCloser }L*struct { F uintptr; X0 *certmagic.solverInfo; X1 *certmagic.tlsALPNSolver }L*struct { F uintptr; X0 *server.udpSessionManager; X1 *protocol.UDPMessage }L*struct { F uintptr; X0 *quic.packetHandlerMap; X1 []protocol.ConnectionID }MaxParallelWorkersPerGather0json:"max_parallel_workers_per_gather,omitempty"L*func(context.Context, string, *bool) (*govultr.IPv4, *http.Response, error)L*func(*wire.AckFrame, protocol.EncryptionLevel, monotime.Time) (bool, error)L*func(protocol.PacketNumber, protocol.PacketNumberLen) protocol.PacketNumberL*struct { key protoreflect.FullName; elem protoregistry.extensionsByNumber }M*struct { F uintptr; X0 client.HyUDPConn; X1 *net.UDPConn; X2 **net.UDPAddr }M*ringbuffer.RingBuffer[github.com/apernet/quic-go/internal/protocol.StreamID]M*struct { F uintptr; X0 string; X1 afero.Fs; X2 *string; X3 locafero.Finder }M*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn] BoolValueCprotobuf:"varint,2,opt,name=bool_value,json=boolValue,proto3,oneof"M*struct { F uintptr; X0 context.CancelCauseFunc; X1 context.CancelCauseFunc }M*func(context.Context, string, *tls.Config, *quic.Config) (*quic.Conn, error)M*func(context.Context, string) (*govultr.BlockStorage, *http.Response, error)AutovacuumAnalyzeScaleFactor0json:"autovacuum_analyze_scale_factor,omitempty"MaxLogicalReplicationWorkers0json:"max_logical_replication_workers,omitempty"M*func(context.Context, *govultr.ISOReq) (*govultr.ISO, *http.Response, error)M*func(context.Context, string) (*govultr.LoadBalancer, *http.Response, error)M*func(context.Context, *govultr.VPCReq) (*govultr.VPC, *http.Response, error)-|Z(-l @`³ @ ` 4-T&-Е-(&W8(al E }IK(; m N l` l _W mP` h% $3|l [| mP` %%92C(@~@n~ F-_p+3l E n~G`H"r Jl n o~`!tq p ~F!r-!rQpl ` oG`dBl 9F p`0` -.(p x1 -pw= ]F` T. @q {wp@ ]F` - @r f}³ E ]F`2(KrK K@MIӋh Nq Kx1 -\Q(r 66`4:^(@ s E@` @P(s E@` @_(@ysy E` \(N@tN E` u??(׊NtN E` b;R( @LuL J ^(b`u FK(Au @!AG(K v rd?(KvK .`U()L@v G!XX9l "@ @wXI , If(ILw X@!D(ux G!@!(YL@`x XLZ(ux QfP(i yi 052î _ h  i-G H?`-VpN h =` 376-} V(+@ "-:(IV0qq qB@y(@4& &  G!!ߧ(YW6A`A  `e(@6rr @@@e(W8o o ߇ E(: E )`)a( ; M *x$C(q?@  p` (A8@? wG\-*N6(YA @\~ =PYl *7 HL&]H?h ?0(P4Jgg PQ ׅi(NQ`Q t]x/](Q""  @4(ST@u" "  6@[SH('v""  /P}(E @   XQfJ>(- @  <\l 4*G ;&<\(@<< N l`/5ơt7d(7@&& j! d@ Pl OL &j! 22ltp(:@&& )So(@BB EhOsS(o @  ?CWLl GX r@HNNRu³ W<` =-PHN4N@.yƿ³ ? =-DN.N#Y/NX|h #} ! =z-FN2N ([% % p;]X.0;;(   WH?H(ߘ   dbE\G(@ 3`2`3O("   6 "t([   G!ca$(5@ `  c`/(U>ff XQf No ³ L4 w`<\-بN( ³ 5 w`-H<ָ ³ +`5 w`-l ³ >5 w`t$-X c ³ c6 kGp7UYF(@ff 4 5~ݞt1_>g5L³h 1A<5H@~@th 1*]H(ǓǓ  }`+l @n L,jŤ5@@`³ S>l p 0r@H/QtQ08(9iՊՊ Z a@Z˔(Պ`Պ Oa@q7(ՊՊ Y a@.(_ _ gg:J(A v;VN*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *net.netFD; X4 int64 }N*unique.node[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]N*struct { F uintptr; X0 *int; X1 *go.shape.[]go.shape.string; X2 *[4]uintptr }`(H W^^ ;@N*cache.Option[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]N*struct { F uintptr; X0 *int; X1 string; X2 bool; X3 control.InterfaceFinder }N*func(context.Context, string) (*govultr.DatabaseUsage, *http.Response, error)N*func(context.Context, string) (*govultr.FirewallGroup, *http.Response, error)N*func(context.Context, string) (*govultr.ObjectStorage, *http.Response, error)N*func(context.Context, string) (*govultr.StartupScript, *http.Response, error)C,5eT `ܝ`t^޵5G`@@bth ^N*struct { F uintptr; X0 *int; X1 *unix.Sockaddr; X2 *error; X3 *[65536]uint8 }N*[]struct { key protoreflect.FullName; elem protoregistry.extensionsByNumber }N*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 reflect.Type }lj(1 {elO*map.group[uint16]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }O*struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }O*struct { Type asn1.ObjectIdentifier; Value [][]pkix.Extension "asn1:\"set\"" }O*unique.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]O*weak.Pointer[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]O*ringbuffer.RingBuffer[*github.com/apernet/quic-go/internal/wire.DatagramFrame]O*struct { F uintptr; X0 net.PacketConn; X1 *client.clientImpl; X2 **quic.Conn }O*struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2startPushRequest }O*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest }O*func(acl.HostInfo, acl.Protocol, uint16) (outbounds.PluggableOutbound, net.IP)O*func(context.Context) (*govultr.ContainerRegistryPlans, *http.Response, error)O*func(context.Context, string) (*govultr.BackupSchedule, *http.Response, error)O*func(context.Context, *govultr.UserReq) (*govultr.User, *http.Response, error)O*func(context.Context, *govultr.VPC2Req) (*govultr.VPC2, *http.Response, error)O*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }O*[8]struct { key protoreflect.FullName; elem protoregistry.extensionsByNumber }P*struct { F uintptr; X0 func(string, func() error); X1 string; X2 func() error }P*func(context.Context, string, *net.TCPAddr, *net.TCPAddr) (*net.TCPConn, error)P*struct { F uintptr; X0 client.HyUDPConn; X1 chan error; X2 network.PacketConn }P*struct { F uintptr; X0 network.PacketConn; X1 chan error; X2 client.HyUDPConn }P*go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts)P*struct { F uintptr; X0 chan struct {}; X1 http.RoundTripper; X2 *http.Request }P*struct { F uintptr; X0 <-chan bool; X1 context.CancelFunc; X2 context.Context }P*struct { F uintptr; X0 *server.udpSessionManager; X1 **server.udpSessionEntry }P*struct { F uintptr; X0 func(string, string, syscall.RawConn) error; X1 string }P*cache.LruCache[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*[]*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*[]cache.Option[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*func(context.Context, string) (*govultr.BareMetalServer, *http.Response, error)P*func(context.Context, string) (*govultr.DatabaseBackups, *http.Response, error)P*struct { items_data []yaml.yaml_node_item_t; style yaml.yaml_sequence_style_t }P*func([]uint8, protoreflect.Value, uint64, impl.marshalOptions) ([]uint8, error)P*struct { F uintptr; X0 impl.Converter; X1 impl.offset; X2 reflect.StructField }P*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.Converter }P*struct { F uintptr; X0 reflect.Type; X1 map[reflect.Type]*impl.coderFieldInfo }P*struct { F uintptr; X0 reflect.Type; X1 reflect.Type; X2 *impl.coderFieldInfo }Q*atomic.Pointer[internal/sync.entry[go.shape.interface {},go.shape.interface {}]]Q*struct { F uintptr; X0 *struct { sync.Once; v *x509.Certificate }; X1 *[]uint8 }Q*struct { key string; elem func(zapcore.EncoderConfig) (zapcore.Encoder, error) }Q*struct { key protocol.StreamID; elem quic.incomingStreamEntry[go.shape.*uint8] }Q*func(context.Context, *certmagic.ACMEIssuer, acme.Account) (acme.Account, error) AttributeGprotobuf:"bytes,3,rep,name=attribute,proto3" json:"attribute,omitempty"Q*func(protocol.EncryptionLevel) (protocol.PacketNumber, protocol.PacketNumberLen)Q*struct { F uintptr; X0 *sync.WaitGroup; X1 *quic.Conn; X2 *http3.RawServerConn }Q*func(context.Context, string, string) (*govultr.NodePool, *http.Response, error)Q*struct { F uintptr; X0 *bool; X1 *int; X2 *error; X3 unix.Sockaddr; X4 []uint8 }Q*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.structInfo }Q*struct { F uintptr; X0 func(impl.pointer) (impl.pointer, *impl.coderFieldInfo) }! 6h =` V-ryJ 6h?!=Eljlj` ɉɉ׿ 6h{8 "=E` ‰‰r 6h8`"=E̹̹` ້້b 6hA"=E@` @ll 6h B"=E@dd` @EP- 6h`=<\<\ 6h9`EM j' j'ᶓ 6h *EMx'x'! 6h>`E  + +}T+T+n2} 6h;B4E ++}++ 6h l` 4-4--Е-Е--{p 6hB E ++}++d 6hE r+r+}w+w+xw 6hh5E $+$+}xB+xB+i 6hE R+R+}]+]+W 6h. 6E **}++ 6hQ E ++}++JLV 6hsE |K+|K+}N+N+7 6h]E g+g+}n+n+:] 6hx@E p+p+}q+q+Vo 6hE e+e+}f+f+"hz 6h*E tx+tx+}8}+8}+Vk` 6hç$E Xp+Xp+}p+p+ 6h׌` ''V-''͡ 6h:$E ̎+̎+}<+<+UiK 6hW %E l +l +} + + 6h@P` %%V-%%" 6h@/` d d V-` h( 6hD@e` V-,,$ 6hme` HHV-`ddB"&- 6h ~d-p!p!  FP ~d-p!Xf& 6h~x x ` ]n 6ho~F""-X"X" 6h p~` 8!8!0!!1 6h_@~`x`x_ 6h o~F!!-!!^ 6hIE 8~t"YEi6 6hE~[a, , #? 6h5=~4w4w\kL 6h 2` V-  q. 6hw=p]F` T. T. [(9 6hq]F` - -  h iF]F;c3hh\ 6h]F`  J| 6h=`S]F` / / ] 6h ']FEI h o ]F#! 6hE`q]F`29s 6h7]FMK 6h)GT]FcI$j>0 h ̚]F  p9 6h']F4$!WI 6hԭ]FMJ ) 6h (]F8 6hU`k]FJ $`" 6hJ]FhFhFet 6h 8]F` 8m8m sr 6he@]F$ qVF 6h ƥK`  V-4 4 KH4 6hGAK@!86 6hC@KK@((Me@ 6h f`۟KK@M  6hKK@00M& 6hNq rKx1 -Nf 6hڛɥK85 R?] 6hK$#*zk 6h`K$#*u 6hyࠤj!) 6w 6h[@j!`PP6 6hī` ؝K؝KV-|K|K:" 6h`U*s` MMBXMXM# 6h" 6h ϥ____)N 6hNgϥd&__1__| 6hsTxy` 4e`4e`V-f`f`e' 6h@ xy"/`/`@|5`|5`< 6hgyYJHi`Hi`1k`k`sm> 6hࣤNYJl`bl`b14cb4cbtq 6h@ +@$"h$"h@@X 6hLLJ __T_T_ N 6h7@ѣ\(M\(M@!)M)M }7 u\(ML@!)ML) 6hg@|&M|&M@!'M'M4v] 6hKש&7,Y 6h]BrrLLLL~ 6hB٥!` P2P2V-22 6hL!N 44`33)6 6h"G!D D XE E ʻ 6h@yi-GGk׈ 6h i-`G`G('? 6h`i-ܧ?ܧ?('ϳ$ 6hOzi# ׯ W-Q 6hiG!|lF|lFXkFkF 6h6x iFEE-EEK 6h CiG!DDXXDXDb? 6h`i57 6hD EiG!%D%DX"D"D0Z 6h Bi! 6hߎsiG!-H-HX-H-H ߻ 6h%@iG!+H+HXL,HL,HxZ 6hl EiG!lClCX(C(C  6hEi$.H$.H.H.H˝R 6hl iG!؍?؍?XЋ?Ћ? 6hOi` CC0CC 6he2@ i\:H\:H`:H:H! 6hn@i$9H$9H`9H9H& 6hi4H4H`4H4H" 6h'@|iG!0B0BX@B@BUq 6h@i6H6H`H7HH7H/.͓ 6h?@iCC`HCHCH9' 6hLsi7H7H`8H8Hdl 6hi@ti1H1H` 2H 2HL 6hEi@5H@5H`5H5H_l 6hݣi2H2H`L3HL3H N@ i2HC`L3HC͠) 6hF i@H@H!}@4AH4AH1{ 6hliOHOH!}@xPHxPHGt 6h@i`HH@!LHLHgd 6hi` YHYHV-HZHHZH2@ 6h:@i` HUHHUHV-(VH(VH% 6h FiG!cGcGXaGaGV@ 6h2ti` HH z 6huiG!XHXHXHH Z 6h*`ui4 @H@H . HHa>5 6hy i Z 6h`9& DvDve 6hZ@y&{1 6hm` __V-|`|`w 6h n I:4V}4V}: Z}Z}KU.' 6h7I3W>??K 6h~n }G!88td> 6hG G! ` ؒؒ 6hU`1 ;GG@`@;|ą|ą@ŅŅ9f` 6h~P7 XllL 6h]#Up-HHz tt#/ 6hH@` ( N( NV- N N . 6h!` NNV-NN ~Z. 6h{@mssdz]>1 6hyQ d 6hQ 34 l l . | | } 6h( ( : ) 6h\ N.)_2 xxf/ 6hm P_ Q ?K 6h Kj! %%_%% 6hj) RQfo 6h_XdPdP g\ 6hQ44  . Ī Ī ' 6h)`;;)|&|&Ry&y&qN 6h)`;;)R d&d& &&BP 6h #G!@!= 6h*6 UUVV "g@ *6 UV| J 6h! *6 (( 6h@*6 ^^``8? 6h*6 [[]]j 6h*6 XXhYhY ҎW @*6 XhY4@H?`-C 6h++MJ  6hwQq'=E' 6hE Xr ,񤝍 6hJݟ" _^d 6hQ`74 `` . pp? 6h   6hU@p`   6h` ` e.e.~pl+ 6h.x616166`{0 6h y6@36@366`] 6hy6886`Ė" 6hyJ6;;6`V^ 6h)p!AxIxIuI?  6h Y/` ,.,.V-/./.A5B 6h=376-A< 6hཨ376-ʑ؜ 6h ֤` IIK  * 6h +` IIK 81 6hI@ ` IIV-II5cV 6h@BKKjW 6hG!@!v+ 6hW 1qqBXC>sV 6h19` HD>HD>TE 6h G!>>@!>>ƪ 6h*@g` HwHwV-wwI 6h@w` ~Z~Z 6h ά&)Scccc 1` 6hya}&)Scccc'x. 6h&)SccccJ@)A 6ha@&)SDcDcXcXcS! 6hp&)Scc(c(c3 6h q&)S$c$c8c8cs[Ez 6h&)Scccc>= 6h4&)Scc0c0c 6h# Z&)Scccc~ 6h4`&)Scccc#0 6ha[&)Scccczh 6hE&)Scccc%= 6hV&)Scccc`2 6hg`&)Sxcxccc\ 6h p&)Scccc[f 6hb&)S81e81eL1eL1e 6hp&)Scccc~t 6hx@c&)Scc1e1e 6hw:&)SDcDcXcXcwآ 6ha&)Scccc 6h: q&)STcTchchcx@ 6hb=&)Scccc 6h >&)SccccS 6h: ~&)Scccc{U 6he >&)S0c0cDcDcl 6hUW&)S`c`ctctcyug 6h͋>&)Sccccn:v 6h{sYb`  f fV-ff > @  -Pih2 6hW<=-PHNPHN@D 6h? =-DNDN#Y]s$@ 6h#}=z-FNFN8ڲ 6ha`@=.N.NM *-N-N% 6h'@0~*`OO?hOhO-D 6hR` 2O2OV-3O3Osz 6h/ %p;]XPXPX.0( P( PAf 6h1 A%p;],O,OX.0(O(O{8 6hW%p;]OOX.0,O,OY, 6hGA%p;]OOX.0܇O܇OW4 6hg?%p;]@5P@5PX.0p6Pp6P^ 6h}@%p;]PPX.0$P$Pae5 6h%p;]NPNPX.0tPPtPPy}G 6hk%p;]| P| PX.0P PP P໭ 6hRA%p;]%P%PX.0&P&PI 6h3@B%p;]TPTPX.0PPnJ 6hE%p;]\P\PX.0$P$P$ 6h_%p;]1P1PX.0\/P\/Pe 6hqB%p;]PPX.0PP Z 6h_C%p;]PPX.0HPHPh 6h %p;]tOtOX.0qOqO  6h F%p;],O,OX.0OO 6hx%p;]fOfOX.0HhOHhO!v 6h`F%p;]OOX.0`O`O" 6h Xԯ 6hY XaE 6ha`C dbTQTQE\,TQ,TQF? 6hl\w6 `P`PM0 6hۨ\w6 PPVX 6h۩\w6 PP3 6hߪ\w6 PP"o 6h3[പ\w6 PPŲ 6h@\w6 0P0P(%hi 6hu@\w6 PP܇- 6hI[ܨ\w6 PPPP 6h4W\w6 PP2 6h@\w6 pPpPԤ 6h_[\w6 PPsl 6h\w6 PPI~ 6h\w6  P P 6h`X\w6 PPo/ 6h ݨ\w6 @P@Pחu 6h@\w6 PP9d 6h4@Ȭ\w6 `P`PG5 6h?Y\w6 8P8PM@ 6h@@\w6 TPTP 6h4\w6 PP# 6hK\w6 tPtP ~ 6h>@ @8q 6hݨ 6 YY|8 6ha`ި 6 @Y@Y_ʂf 6h 6 YY]n_ 6h\@ 6 `Y`Yw`tt-lo 6hI$w`Xu 6hc`kGp7Xb 6h]@$j!  B2 B2d@ 0B20B2>4y 6h`&$j! :2:2d@ ;2;2Yo"p 6hMO$j! 402402d@ D02D02c4 6h g`OK{Bh 6h?Qfbb4 ȜbȜbuim 6hHRf4 > 6hў`Rfbb4 bbP 6hC6R g` $h$hV-hh2x 6h^?CererW4Q 6hh5?CYrYrWi# 6hJ` [Nv 6h^FՊ| ß ¶ 6h ՊgSgST Kvp4>  ɲw>  / 6hVl!_өP(U ;;?!@w.9F ?Cb̅ ;;@BF@~@(؞ư1{p@ `r 'h|@ `` U0|F0A ` " 6h; %|{ A `A 1 PB ĝ`r 2]<(4B ੝@ 9l(~ C !R*[]*unique.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]R*unique.indirect[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]R*unique.canonMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]l 6hX^-!_@3 6hx`Xl!_ JE|0E kZE 1OUHȗE  ~|e PF ؚ 5k F @Σ  S| G `W.+flpG   G   V|0H ϣ "'|H , ɞ| H `ϣ`{ hZ-|PzPI ੝='9I o Z?nXHy6J @ )f5pJ ϣ  <_|C J @rԥNPЮ 0K `5 p/̆K  c.K e K `r@v v?`e PL @v`r kG|!L `9& 6hL:#XHHG`HHNF 6h@$G!\H\HX4^H4^H ħ|d M H K| 0N ໮^{'N y@ H"|CnN @  h2q| PO ħlwO 1`r O@8| P @ # |g pP ໮@CU8 P ໮`n &i|(0Q '@ZqQ `* No| Q 'fGoX PR @7(' R ۭ A|oS @ P2|Me pS @ DP S  QO@0T,@pO 4 ST+OG"8qH> T ~  >I| PU @ ^@|U @ |e V  7 FE(|( pV ȧ; s|V ȧ r|{ 0W Ԯ | W @T :7|" W ` ](|~PX   |WX ZZ K|P Y `JYe 6hz `[55@c(< 7|Y `^ 4|Z 0Z @=`;s 6h \55mmc(= >.O|dZ _ | P[ @=R*struct { f func() bool; once sync.Once; valid bool; p interface {}; result bool } ;| ]\ h㈚ 6h w @+ AȟHȟH>` H H^1\ t h|0] `J`J |]  &R*struct { F uintptr; X0 quic.streamSender; X1 protocol.StreamID; X2 *quic.Stream } 8\|`P^  ̧ 3| ^ `OVH?_ צԮ & |)p_  9(__ @}L60` b 贊|( ` ή ׎h|e ` `` EN|ґPa @ vq|Hi a Y!A b J s.|pb H`QBb  {0c Ԯ |n|m c ` 2P0|c 7  Z| Pd  Hz d `  X\e  R*func(context.Context, string) (*govultr.ContainerRegistry, *http.Response, error)R*func(context.Context, string) (*govultr.DatabaseMigration, *http.Response, error)R*func(context.Context, string, int) (*govultr.FirewallRule, *http.Response, error)R*func(context.Context, string, *govultr.BackupScheduleReq) (*http.Response, error) k - |-f ` 兟|{ 0g O@ rH.g  ` M| g @O | Ph @PݐFtch  \%|4i XaY piu x9@ + j *` i@hB@  N|W0j @R*func(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) |: ( j*Lw(`=(8ř lJ=(oy"7iM, =(ę_U@`05k,@=(ę_U@` 3_ $(B=(+,6H$B@=(o(@(!#R*Pܖ(! @/ C`($!P.qh(Q@(\׌ (? P*D (% (,s6`(~(v 48H:@( (v i((~q! +*((E  }kp("@`(FRn+q`h(: 0$Z P()o Cc@PʗP( ۢෝ0(M3̆P(/%` P o @@P(;@((1[ /ІyDP(1@_@{$@P(W d` ih<@`P(Į#@ @3׺ (-<PʗP(!/=`W$c P(x˜ yT4$D ee(j <+ (m` ee(j 4M T( `@~(rk${ ~(@B &$[ ~(@  Cl(E `~(^ *x(n~(^(~ ~(h. ^G!,.k~~(H ׭L/(Ӥ~~(` ~ F[$~@~(" ٌ9(\B}B}(~-h4$ (yHy%08  `(1 @ŤTG(  8xM *]F ]F(bIFdo ]F]F( M ]F]F(!tq( ]F@]F(5@b@@+ro ]F]F( @cc͝ * yF]F]F((f| o ]F`]F( JQWBh F]F]F(F' ]F ]F(`'W% G]F]F( )@NIG]F]F("ĚĚY Y- } ]F@]F(`ϝ$ϝ R @]F]F(̠< - `p@]F]F( J~%$ |]F`]F(4:@ \UI6e ]F]F( 5{dН e- !]F ]F( 'ߧ 5 )4 ke@]F]F(_J`ҝ#@w e@]F]F(d^(}h  @]F(3`7u sD1 X]F]F(IåoҝĆhJ]F]F(S``ӝd/$xj]F`]F(3J &]F]F(   .)r̅@]F ]F(TJӝ D^4C` KK(4Ѡu   ̛<̖ KK(۝ { K@K(#@@WkțmKK(mnrw5 CK(5 ܝx.'@#f K`K(3>fK(05 =/ =q K(N(l@K(n R+DK(05ɥ w5 @ @K(@0@l  K(@6@A| pqK(@ XyH `K(<lI(KK(PG@X@!Xy  (b`))\[` (b`) }h(? WࡤW(f "42l(@W(% a/R( r@WW(@CI($@*s*s(G!@! 0@ xy`xy(qa(ĸg` y(hҗsϡ N(hҗt /&"(s (sOo(&LतL(G!M@,7x)(J@L@L(G!;@ )kc({L(㬗b ZL(&& ܢ% h`L("=( ueB Ξ@ (Nפ%KؤO($C !!(j5^( ৤!(n  fEP/ "!@!(88' ū}|1@!((8@Ŭ?Ä 54;!!(  4@( `(e̜((G!X@!nD" (  9<̅Y ii(ԗg yF.(viતi(7n(9C@i@i(05 4@! Lii(`y5@?> W ii(Y'@8@J/(j@i`i(X@!W2hw `ԞiG! AA> Rf$yN i i(Zp ~P/  ii(V $ij i୤i(@ (T(j@i@i(K@;A ii(Mj`i9> \4(|Nii(K^t3_% i`i( Ѭj ˚'(Eii(%6!ѦYI(m&@i i('[\ ? ii(ח@y\;}(iతi(% Qk6uE  ʈB$( @i(hho (H٭٭;ə\2(ȗUlݞ T/  `(u'p(%m(yQ -|:\=  (.G((HԞ /І6(y@@'$m೤(l9@; pp@g}@((Q3l 䋚6u(IP@ @33(p.@  '`(( A/M$Vz(p. ;  v;.(@ (>L_` (#UQ  (F@ඤ(JYИ J6p(@(Pn@<\ȉ (^Q<HH gn(`@4 ](z ` (G!`UG VS(G   (O& ;V@ c ([  (㬗LU #@ (&& v%\! ๤ (. l; J (@@L( ˣ0n L(7,-?B`(]@@(G!`@WGWˬ( @`@(Q Q  5n\8(ߑ @(abѴ@G @(QEQf4D$@('mwHo༤@( ەn\@@@@( D@\@@( [ ݂ Up( Y/f/ ĥ@ `~(!JR-(Mo ::(: <p T|(  YQ(Ek {` (@yQ ࿤(Į#@Or 5 @( 3 #OB (@@ _DU̅v(m ``)U{ `(` bD6(-Rݞ: CDD{  ¤(јo ֝FLՎ 7¤( 3I 3(=).)¤.)(~QQRg&:  @ä(V@@?f: ä(V@@#> f EpĤEp(PP<W Q`ĤQ( R[@ zn(Q@zĤz(. ܁ ȗ Ť(4k" )ȗŤ(4@. Q ȗŤ(4QR ; HhH@ƤhH(\G$ HƤH(-. UG$ HǤH(-. $! H`ǤH(-. 'Tb$uHǤH(-. W(!| Ȥ(ݵ(?n5nȤ5n(D@lR@Ȥ(# nĮ { \@ɤ(n ݞ 0(V)~̆ɤ(  P +$]@ʤ( ()@ FE`ʤFE(5R =FEʤFE(@_" LNQFE ˤFE(0 6 @(,b.! aFEˤFE(Q0 ^,i" ˤFE(/5 DL` @̤I(/6ބE-ȇ@̤:( n JX$ H?ͤH?(;G2- +`ͤ+(ʨGΦ t${̅"pͤp(vΏ @  Τ($$`7Τ( $$5X+`S@Τ( tTh )@Ϥ(3`7u @{ɳ , Ϥ(3`7u  x@h Q8Ф(3`7u S/h {``Ф(3`7u khpФ(3`7u @  -p@ p Ѥp(R@Ӷ$SM`(@"Ѥ("-1q߳Ѥ(u dT@@Ҥ(u dT=%[JҤ(u dT$P #Ӥ=( |@GwIU%=`Ӥ=(`Ԩn[!(V.$=Ӥ=(\%m,$G.$= Ԥ=(=@)j 0(Uv%=Ԥ=(='p$%4n$%Ԥ(&TC!Kp@դp(P =  .(/դ/(|@@$ ֤(w `֤(7q n ݞ @<nl#  $@*֤(c! 4]<q` פ(.*ª Z?c(U@+פ("-J.= )qפq( ޟ@9] Rq@ؤq( ޟq )qؤq( ޟ@$U s٤( (cKMK`٤MK(㸗Ĥ/n/I]/5 r-٤q(5 ܝx=c`! q ڤq(3٤z K ڤq(6|' ڤq(<($- @1@ۤq(5ܝpq4 L1ۤq(^ۤ ݝ/P/ 1ܤq(ḖP/ ( `ܤ7(4/[P/ @) ܤ7(45B0O& ݤ& (x!pyܚ(4& ݤ& ( NEhO˃- IW5& ݤ& (\V@eV;O(5& @ޤ& (G!! pt $`* ޤo(V@Xl$H% ߤo(V@v) XA x + `ߤo(KO  (s- ߤo(V@(X?  (> (@@# M (YY@ڨ< Y`Q(/Ozw 4GYQ(/Ow7 4PY  Q(/Owg 4 Q(/Oݘ R4Q(/OܱN 4kY@Q(/Ow={ 4O `Q(/Ow 4Q(/O\VB 4Ӆ `Q(/Oǚ K!4uQ(/O`a?E 4u Q(/O }4u Q(/O5 ėj]4uQ(/O51d` u`@Q(/Oߤd 4G Q(/O*=]l 4uQ(/O:n=z(\ `Q(Y`<Ujt 4 @DQ(/O 8x (\ Q(B Ɲ1M| (\@Q(u ?($ Q(Bp(\`@Q(BY R( ]Q(BYK0(]Q(BY X (``Q(B5  (Q(B-ų|5`Q Q(D N !9Y |+ `x`x('jtu W+(H0<  (]@Q@"(~Tn(5Q"(@@Q *4 (ϛR"(L SOG (#W`"(!M   (:$X"(r@90,/ tX "(VfGf޸e ܟZ"(thmQ Y"(Rslq~M[@"(!6@ %@\"(a3  j340 (a]"(?a9 :P(R]`"(8T P (Ȼ@`"( ֒L 0w` "(ErDu\ d"(/;@@ lfY (= @g"(M; b (Aj@"(K  A (Y @k"((-  (R-l"(s ȃT (0Ow`"(9 mc (iT@x"(.v- ~\ ( x "(J-  (@y"(etxX^0 $r LZ( /8 |LZ@LZ(f"`̣ ۸ @ ̅,zLZLZ(I@v D ( b(,+/ P@` (-+8A"$F  (-EB V0T@  (Zz6. E (z7 ( =h(  (! =Rܖ @ (! ?&$x  (3W $   (3 L  `  (~(v P :   ( (v  ~U̅k :(5 t&9@(E *H *H(!@ .DP *H *H(@ _ ˅L$*@ *H(h  ;   (ϣMyQH ~&(h#@4& 5l` l(!@.`4 8 iq5 q5( P7~tF< <(_1r ~(2|H 5 5(! i 5 5(@ _Ju#U@z(@@ EJ| (=8I 8.(B >4M,(O8.8.(F@( ![|5 `Lu((8@Ŭg nLaP/ ?d  (+@+@$  (15 & @  (@u @ 7 |V  (u ݞsga8E(_d&@&(j! |dd@ s $ LELE(['mW(@&(—@^o( `&(@+x : (h&&(B@?x4, Hl+& &(+FIx@00{Da &(w./[ &(w.}%C;;LUW @&(w.yݠ#/ U &(!JW {@V &(!J8Qo1/ e@`&(@D$  IbBB(R iu 5L ̅\  (>nˬ(  (Pv;V'}(  (?\DDtb(  @ (?C/`DDB+ ;  (4WOǞ:bT$R@" (}C}  UF̅ `%(5@ƞn| W`# %(i@ƞ%j g? $ %(i@ƞ 8%x }$ %(Ş`D `w1 $ %(Ş`D} _& @%(iǞ( 4 |%()d >  (iǞǞ ^ (@` (, O@C:Q (,O@Ÿ   (iŞQzGH(S  (@k Z (!ŞJŞwk @ (2uŞ ~K (ᕗnOnh`%w2\/ [ (ʎ rdg((`(]` 3`@ =d((@(2` _" 5(? (]` 3`| e[$@(~(v 8P- \w(5X.uqp ~b@ b(G NC@˞ ēX|(  (n E(ݙ!(7` r(P@`!@(u 5y$ f!f([$ @:/ qe f "f([ ԗ(`J " ($ x̅+@4 @"@( kD$@h w@#w(;r;(_w#w(`9od6`< w$w(T(i `$w(BI(>$w(|I 6 %w(05 v`# }@G(/%( N p7e9(fx%x( cN p7f\P/ $Ĝ@&$(ŗ͞@͞HE/ @7 $Ĝ&$(W&7K&lN/ @'K(5X.1, 1K`'K(`O]@ ]0'0(_JĜŗ@ Uikr@ (m( 9 ,yg (m(Ɨ'  ag(m( sV#$@)m(Ɨ'g @Ɯ Lgm)m(RR (Zk *f(DolJ l `* g(WƗ@|@X(' $  g* g(;fWw( +(_ j! - -B h2+2( a8j7|D6@2+2(Hk8s@,Ǔ(!L@V/Ğ Oo06,Ǔ(H S, s'(0 ƻ@Ǔ-Ǔ(gq F` `-Ǔ(H S`'LDD,`-Ǔ(H S0,bpg ^ .Ǔ(H S x 697.Ǔ(!L@V=E S#0Ǔ.Ǔ(@ (۔@/۔(]@gglL /(5@ӗ 㿆|N0(?,-@q,"Xu* `0(>r<8_k`S` 0( N Id 1(D@Ŭ RŇ4h71(D@Ŭ ~3!D7 1(D@Ŭ8D7@2(D@Ŭ8E<=TD^`2(D@Ŭ8DYD_3(D@Ŭ8Dp`3(D@Ŭ8;}?D@3(D@Ŭ8D 4(D@Ŭ8`_D74(D@Ŭ8№D 4(D@Ŭ8YD'_@5(D@Ŭ8XA 5(>r<+Dxh@: 6(@@Ŭ `e5d`6d(V@ j(vd6d(@uO&6u &[}:(;8 7pA((`ękA@q 7Պ(< /-4o7Պ(/ǩHHQ@Պ@8Պ(? `G$kK$I`Պ8Պ(G ŏ; 9(LL ND Ք`9Ք(`۝urMP/ ?d9(+@+@$ :(15 #g :(@u @ ,aE|V@:(u ݞs KL({ B}@;^(~-jT dl;dl({_`.@6"T dl<dl({_.@6 U dl`<dl({_ .@64G X dl<dl({_.@6wʆ j =j(ȝ@A%r ^-=^-(bb@ V*struct { F uintptr; X0 *func(go.shape.*uint8); X1 *go.shape.*uint8; X2 *[11]uintptr }8t& -@>(7`M# .>(7 l!1?(7I{s,f 0Z 2`?^(!@ƞJ@ƞJд<x` 9!?^(  U(t=i @i(u 2${@i@i(;> i  Ph(xw Gi@^(7V*func(context.Context, *x509.CertificateRequest) (*certmagic.IssuedCertificate, error)V*[]acl.compiledRule[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound] I|t `UBo('m(LDgc! cg~`Bg~(˩[@H$hx Bo(@( U @b  |>|)`X C^('m(LDZp `V sN` L@vvP([u@ !V!"` H44WEĆ ! W!`8 ۥ@8&3(9p !W!N,@8*3*3O$9m` !W!i,@8H:3H:3s9 !@X!N,@88B38B3]9 !X!N,@8D3D3q,9h iYi`z@!DBDBr9h¡ i`YiVoXX7FX7F`( iYi2@!TH@F(` i ZiXQH EoI9h iZixXX;FX;F`)[9hd iZi !}@4G4Gy9h@ i@[i 1@!DEDEy쉳( [i7@!T>H=H( i\i"` =Hbh o@ ]@5@` dBh   @^/@`  NNY٣`p ^XH<H<Y(v6 @aI[7@!H<< ^(P 7 a` >n>VO9h%Q@8 HLbHL &]x ?x ?0}h *: `b5 <` Pw4w%( b h8X 'Nt&Nj Y<  c&\ pL1ecA=x c&(Cp1ec.1e(T &c&"` 4e3ex(] @d\w,ݞ6 "^^ d\wQ@8x(c e ,ݞ@8bh?9hs ^-`e^-u n Z*struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } }Z*map[uint16]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }Z*struct { F uintptr; X0 *struct { f func(); once sync.Once; valid bool; p interface {} } }Z*map[protocol.StreamID]quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream]Z*struct { F uintptr; X0 chan struct {}; X1 func(time.Duration, uint64, bool); X2 *uint64 }Z*struct { F uintptr; X0 *unsafeheader.Slice; X1 uintptr; X2 *abi.Type; X3 unsafe.Pointer }Z*func(context.Context, *govultr.SnapshotURLReq) (*govultr.Snapshot, *http.Response, error)Z*func() go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool }[*struct { F uintptr; X0 *http.http2ClientConn; X1 *error; X2 *[8]uint8; X3 chan struct {} }[*acl.compiledRuleSetImpl[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound][*func(context.Context, string) ([]govultr.DatabaseDB, *govultr.Meta, *http.Response, error)[*func(context.Context, *govultr.ReservedIPReq) (*govultr.ReservedIP, *http.Response, error)\*[]struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } }\*struct { F uintptr; X0 *func(go.shape.struct {}); X1 *go.shape.struct {}; X2 *[11]uintptr }\*map[*pflag.Flag]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)\*func() []acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]\*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }]*[8]struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } }]*struct { F uintptr; X0 *socks5.Server; X1 *net.UDPConn; X2 client.HyUDPConn; X3 chan error }]*struct { F uintptr; X0 *certmagic.httpSolver; X1 context.Context; X2 *certmagic.solverInfo }]*struct { F uintptr; X0 *tun.System; X1 net.Conn; X2 *tun.TCPSession; X3 metadata.Socksaddr }]*func(context.Context, *govultr.DatabaseCreateReq) (*govultr.Database, *http.Response, error)]*func(context.Context, string) ([]govultr.DatabaseUser, *govultr.Meta, *http.Response, error)]*func(context.Context, *govultr.InstanceCreateReq) (*govultr.Instance, *http.Response, error)zL-(n0`k Ixh  P-@%`$__"j(we@oe0 ! @!1 Tjp~`  !Pk ~!k FH!k J?L\(/( `v 0FJ @=U(n@ v 0P C`V> M(:[+(m.) w.)0}  _"\(@,ۗw,0i*@X,V(((w(0, "@##(|@(@x(0G!XCH &](}#x0"-bl . y616/66`Xcl `y6@36h266`"l y6886`݀l @ zJ6;;6`;(.&pzp0SM`6Z?|&(q@3& z& 0G!X@!?#g!y()=@{0D& +Ɓ+-ŭ(N@B{02 /2`/Y / /@l m` |WH qYV?HqYV@5l u@ `|` xY\WV-lyY]WV)(U"|"0 2 ! @?(;i" }"01@.`  jN( } 0 @ k  o³  t `@ixhkGih-4iNL6N\c = {< g '.vD ` D,P @XX [" c`| A ">ݞrcJ z  `A`r U6Dp ĝ@!A  FD.jЌ ` ` 'JD=0 @` yX a   @עhv  `{ @dv P `{ @Xg  ɭ ,*d  @ @~  p @@ G9 Џ  27tZ 0 @٭_DjK ٭ 9D0  @@G ${Dx P n . -$D ٭8 >cd  `r6ap ໮`n E Dd В '@Ϭ TKK0 `r ٭ d  ٭' l,   $  P `4A`r jDR  mZ`dl `r@O;+Zp @U`rA$4Е>8ϘIP@p&w 0 @%!Xl  `w`w @{e*DX  `; FeDsP  ; 4~Df @Ԟ ,zD, ^]` HG8Dp _ _` iAuLИ @@؞ (D0 @hh` Q֧a  ק`r@`ƉM(]  { $8] P ` =0 @෥~4"" \W<~`~4"@}G`ZS{ 6h= ~"Ӏ m=n~"4Ӏ6~๥~4 `R"V 6h`  FV-'A 6h`PG@@c@cXdd@!dd6Rq 6h` H H 44 8IT-̅1໥4@0ު1њ: 6h.o#  V y- ]F༥]F4F#b@c4@]F`]F4k\͗ h ]F'c$1c?Id]F`]F4 = @h]Fྥ]F4 "CC-  ]F`]F4# > 6hIG]FIsI' 6hd]FF>>#,>,>P@@$ ̚ ]F]F4 A Н61x4 yG]F`]F4Нe=  j]F]F4 G5`ѝ5 6h ]FyB q_ 6h )]F_( 6h@]F^$` / / a- 8]Få]F44h )  'mM 6h]FeJ m]?@ ]Fĥ]F43J@ D<%&ć@ ]F`ť]F4 @$ "- /]Fť]F4#pJϗ.>0 `ƥK4 kXĕe KƥK4Kϗ ۝YH(Tl K`ǥK4;@$K`۝(|/^ 6h ǥKK@M.LL$ 8,qnK`ȥK4;Y[f@ UBUA KȥK48q 5E<- '` K`ɥK4<@^`3 : ,- ڛ ɥK4 @@ ^- :f`ʥK4ϗ@@5@d@xBP@ʥ4h2@% Jr 6h˥W2222H2H2 r W20@12 A1H2@@1(B``̥46`` NWP 6h>*sG!NNNN@!DNDNyĆns*s`ͥ*s4(4Р Moґ 6hns ͥ*s_" MM ?v̅ `Υ*s49@@w\H*sΥ*s4:`h@  6s`_| `ϥ4@7ͣ F kIxYNg@ ϥ4hH7җr%C 6h|g <xyh. lU`lU`^V`V`G!HW`HW`32- AyХy480`R  6hѥziJ|@,{`,{`yJL|`L|` ? *]-@ ѥz4d c_7[Ĥ`ҥN4h F@`җ`t!ҥ4<, Af( `ӥ4hhҗ 6h  ӥh-=h=hh,,_W,-ȅ/|3`ԥ|34Uȗbȗ@@5> 6h\tqLG!__M@__,__m$`ե4TjNx  6h եuuxuxu $肐`֥ 4@& sN" 6h ֥ Ftvtv-vv"Ws 6hAFSi-xLxL@< 6h1B ܟ`KK`(K(K!KK;Y 6hh@ Ls LLB<L<LDD4Ј  KإK4Ωf"`̣,a@0Zn 6h_Y?K` LL~ܝܝ F``O,B !٥!4@Ŭb 6hr!N44'-44@7S`|!ڥ!408 iNeĆY@!`ۥ!4`7ԗ f fj 6h"!6,3,3"h% 6hu`X- - G`0 0 81 81 ̶^| 6hiBG!F F XG G G`H H p 6h7 @`B B @!C C 4D 4D ] 6hL G!A A K @!HA HA E 6hY@i3p(Ap(Ai *A*AL3)A)A е#@iޥi4;=' 3Uk- 6h8Ci4/'AA@!AAiߥi4Ax k eS @i`i4 ݟ\`n(Iii4 ݟ5@:§- 6hWi.H(D ii4k>Zp 6hDi-CCCC`0C0Cq 6hiCC`ЛCЛCCCP? 6hwiG!  H H > O 6h`iG!]G]GXYGYG9 K 6h BiG!t Ht HX H HG` H H  (` ii4vO[k  LDp(6x `i4@<@NdĆ+k ii4;? ħ  ħ *(i`i4`ݟ  tw-@ii4`P7?`  ti`i4Ϭ89@ * f\h ii4@+N@ @Ƕ8 6h)i'HH[HHdHdH ȉ) wi'H?[H?dH@?2xi 6h=i'HH[HHHHHH X@= Ti'H?[Ht?HH?nȆl i`i4P v|& CjX 6h/ iCC`CC C C"i 6hE Gib3&H&Hj!`'H'H(H(H' 6h_ZFi` ZHZH~d[Hd[H F[H[H QEi`i4 ݟjG| 6hE i` (A(A~XAXA FDADA= 6hO @!vv= @v@vP vv^y6P8 P4<, l@( P`P4hhҗ`Q 6h  Ph-/"/"hKPk`4_lO'Ov 6h%F` $Z$Z@@?[ `4! H9`}4 Q <@,̺`Q4QQ`'iWȆK@`46 $$80 dq@ 4>1Q@ j1+%(G73`734;(`r:Q  c(oo4;  J(Ez`q`4CQr 4E@4-G8?\ 6h3@3MMYP4P4P\Q\Q! 6hz "    4 3ĤP(C!.)`.)40.¤~@cR@ %P. 6haHN.)~TThhq!  V 6hwH O.)~DDXXq! r: H ''4uR~RR| 6hH'~x"x"Q8"8"QR""X: 9` 4:@m@@8 M 6hä~q! ڒ 6h`ä~q! ``{ K` K4;Ywg4z z4R  )`ȗ` 44 5?5n5n4@(@ R@ H!-@|`4)Į,Į/Į{\|4љ n ; *`(4< M 6h* (`  FV-d`{XT"FE`FE4\ <Ho3pFEFE4U0 ` ca_48IFE`FE4U8@6 s8RFEFE4@@@Ŭeԙ/ @`S4@D< ː- (S4@D<)$~"`S4d e ۗ@p( 6hapH?`9o&y 6h H?`9oBm 6h"V+` ~ Ff^- 6hx6+` 55~4545 F$5$5 Z - ++4@@R@k8 ++`+4! )) +VdJp4wݞ<$J|g, `4 T o"0(?6 44EV =E@i$ - `4V 50(y2q}44EV 8`c$[p )@`43`77u t R43`77u 7 6h"-؀ 6h "-r 6h@"..-....& 6h1"->O 6h6"-^9-a 6hE"x.x.- . ... 6h@֦"- 6hY C"-F 6h T`C"-  6hH@"-;.s 6h"-ɡ 6h"-pyO 6h}"-D 6h;#@"-6b 6hP#"-Xrn 6hqJ"t[.t[.- \. \.[.[. ڷ (J$`$4e#'ݗ@b(p 6hJ $` ].].l'<, `%4,e# xz%4u ' q$ 6h"-2#@$&=4@j!@ =@(#@=`'=48)K@ ${{Y=YU`='=4$ 04 / ' -K E@%=`(=4yK@z5c 6hD@= $l0l0RТ 6hSp -`I`IuI CJ( )p4љz@LH K@'`*p4$ ޗ  _-U(*p4nLعP `+47q n ݞ $Vg*+4= &}N 6hL$#"-N 6h]#"-љ 6h,#--"x-x--t-t- 6h?@#"-qh& 6h#"-# 6hԪ#"- 6hU#"-jyM K! q/q4^`8>3S*,- v$ " q`0q4<@^`3 [q K$ q0q4^M3 ] :- W `1q4** S:- Dr` 1q4q8 @߶ ̅ % q`2q4"@^`3 ^ 0 4 (% q2q4P>3, K0`3q45K@^@) ( ( 3744q=E'J2 6h9@& )L`g`gVDD*#d<D a44& 4H0ͫZͫ@0 cOvEL x`54 z0 zƓHDh ܊a654efH0uZu(T$@ `6o4l p V 86o46' :< e 6hL)4,Y,YdYY+X 6hf !̬!eR 0 :`84 >ac_ 6h@ [hVhVVV#@VV,((]|S<`94OWn &@‘  94iǞH7u,a$$`:4$ }sW@ƞ|W  [((sM>:4 聘 R{w`s@/ `;4.X Y. _ 6hyYh.4]W4]W^(^W(^WG!]W]W0&j3 ł?`<4Y7'  6hG-GDgYDgY qz @?`=4G-Gט fZ-@ =42 \$ `>4W@~@W`b8 0@D>4VO^.{ 6h:EMJ SS`.SSBHRu @?4%KŤ6@) gш 6hRu?EMJ SS`.SSލ6 6h` mXmX0nXnXV-`(mX(mX f$( `A4W@~@W` &Ԧ> X 6h*g 9$s>$s>c( u>u>s&6j 6h%@!X>> >>Q>>, 6hg!*x=p:LL4n-@C` 6h+!Q/`" xmv| ` ~MQ4/OX $ { o `NQ4/Od $ xC bNQ4/OK JÅ `Y`OQ4/O0"$^`t`OQ4/Oݘ 4 t `PQ4/Om R= `#YPQ4/Oߚ$ 7 ``QQ4/O;ՙUՙ  `YYQQ4/Ow j u``RQ4/Ox@( x RQ4/Om95w$ 0$ Y `SQ4/Ox &l, `YSQ4/O? 6h15TQ-[ yy x8 15 TTQ4*@ $ o׸T - `UQ4/O` 7/ UQ4B FX. o M`VQ4B<& /K ^5VQ4B+u=z/K 6h+٦`x`  0`w 6h+n% 6llUb Do@> +`X+4`r ( $ٍ1SX"4;@盙 9 4WU`Y"4Mo#  4@UY"4Mo#:GK, a[`Z"4M @@ Ͼ(@ 4?b@_Z"4)י8N W` @a`["4$,@: ;d :a["4$,@:F\ b`\"4Ʋ [R[ ]Zh 4@b\"4"κL !S9- ;c`]"4V@ @]@V*p $ @c]"4M$@L )L-@ec`^"4/ AA 4f^"4bs$eV 4g`_"4bSsr 4^k_"4\%Mo#ˠ 4 q``"4v;QU>` 4#ts`"48?\Kٙ*s 4@t`a"4Nabr 4za"4K?c~ 6hX kLZ 8e8e@!ee 6h ZÄÄ<Ƅ<Ƅ.讄讄h`r`c40dveܢdt 6hG@- F  /7 6h @  E PчPч}['DJ/C :֟d:4(vঢ় ` 5 ~@Xc`ec4J MM M D M@ -@`:cec4J`M`D` U(7-@;c`fc4JMD /-@<cfc4J@M@D@8AA 7 `g 4! RXN`,Z@4p4 6h! {$p ~ |  @(<~&`h~&42hGQU 6h{c1d { 6h8 q5t''=&&0##@u5h ' 0mi0m4\1  r8@ 0m`j0m4.W ̥-/jz4@@@.Nq 6h_ n8.< 0< 0 0 0$ 0$ 0fD/_  k8.4!@ =@' 6h6`کLu] X8X8-d8d8`hf7hf7p{ `*LulLu4SMO[yC 6h8m h;h;;;;; .0<8 m h;d;;e;;d; č-  `n 4"@|@8@@XQ 6h  8 i`m>@ `o 4hB"@  n; 6hϾ oj! +2+2|dd@ +2+2Y< `p&4w.@ÞxజS#9 p&4w.ÞÞM: `q&4w.PC@  Ck/ 6hkW,& ڛ*-cc91* 6h@? 9y#ee?#" Xd s r 4MyݞBXQXH. 6hdr 9y#ee?#TTP{ YbsYb4@Lȧ, 6h} `@i@ikGii-4i4i  6h ~ `@i@ikGii-iies 6hW  `iikG$i$i-ii` 6hz Ho,v,) Q - T`v 4囗ztFa 6h w= ,?N,?N-?N?N v= ,?N'N-?N'NgV 6h =  6hm=->N>N\c 6hϡ7= ANAN-`BN`BN{! $eY0`y045)zƞ× 9 6h390&-!O!OmN z`z4H7ƞ ?DP 6h z` /O/O01O1OV-p1Op1Osg 6h=@< !fT#=|<#=<$=T< :E!f!=$<!=4<l"=< 6hapGw`PP9od1N 6h_@Hw`ZZ9od< 6hHw`RR9odFMb 6hI w`__9odY 6hbIw`\\9odU 6hw#w` U U9od+#| 6h{`Iw`xrxr9od 6hIw`9od!I 6h w`XxXx9odV)͐w4)a0.;j 6hJw`9od(y 6h>$w`TT9od r3g0 @`]4cp_ i K4t<>t_. 6hA`5mDvsvsj!  ts ts#vsvsqK 6hd- du duw} 6h4A@d5@%-o d4Cd@ <@0 7@```4|ǗTLGJ: `ࠦ`42#`H$́`; Պ`Պ4hrΟ ٜt | 6h8 $_$___\_\_ ^Xr8 $_5__6_\_5_ 6- @ࢦ4"@|@8@@phr 6h 8 i`'ߧࣦ4hB"@ ߫p@`@4}Ҟ?[)CÑ4=O ȗद44@v8ȗ`44@r[̿< ȗ०44@-@(ȗ`4@4@b*struct { F uintptr; X0 *tls.weakCertCache; X1 []uint8; X2 weak.Pointer[crypto/x509.Certificate] }b*struct { F uintptr; X0 *func(go.shape.interface {}); X1 *go.shape.interface {}; X2 *[11]uintptr }$a ȗ44@sA`U ȗ 4૝4@L y 6h}l!!_Kt ȗ 4`4@фȗ44@jH~k ȗ 4ଝ4@ ( ȗ4௝4@} ȗ 4 4@(\PJȗ4`ŝ4@$[ 6h!~^-!!_jH]k ȗ4ŝ4@o P ȗ 4 Ɲ4@ pz!^-^-4ଦ.؞`wA͇ ȗ 4`Ɲ4@0<T ȗ4Ɲ4@g 6h l!!_1:f ȗ4 ǝ4@ =J` ȗ 4`ȝ4@ ȗ4ȝ4@.(ȗ 4 ɝ4@2HV ȗ4ɝ4@ KuC ^- ^-4`.؞b*map.group[*pflag.Flag]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)pɈ 6hGH, . 47.[@q6ȗ44@U2$ ȗ44@U)\N4ȗ4`4@mS 6h{@@iyk"#LL X^46' :<  jȆ@a554!{_` MȆa554!{_ Ȇ(a554!{_  xt- kRh+^4@@R@vҖ\ w @\ ++4 M(: <\(  զ(g /`  NN|S\(@ .֦.8~j! d=@!$ ֦(@ -:0().$=צ=8iUK̑@"h@nt(@5& צ& 8G!X @!?##(=ئ8`0 +1G@G(Q(Aئ8FW`j!<.!@I⋎$8 HL٦HL( &]x? ?4"(@NQ٦Q8=-M 2` Z (+ W`xڦ`x(j+ws(k;g"ڦ"81.T  8?.>g(M@h"ۦ"81. @ 8?`R`(|-l"ۦ"81.  Fh(@s"ܦ"81. @ 8?TV(x"ܦ"816. @ ]7(oy"ݦ"81.  8?b#2p(OOy"ݦ"81. @  8?bp (Tz"ަ"81.  @ 8?c1w(9.@{"ަ"81. @  8?TfZ54(}@ ߦ 8}  _"=(W&ߦ&86`6  E5-5()a&&86`6  F-6θ(Q@  8 PC`PPv;VDjBE(X@  8pC Ry`RRv;Vs Id`Z %(_lŞ\ŞbN >`] \w(X.@:@@80,Ë_4] \w(RͫXͫ@8j V$J^ \w(H w w @8 6(uc (n s/ ^w(`X.-䫄2R7G(\h w(@n `e[(L8 N : <p7epSN(_@mm8h`e,@h04f*func(*tls.Config, *tls.clientHelloMsg, *x509.Certificate) ([]uint8, *tls.clientKeyExchangeMsg, error)=9`@u j`j(ઝ@n +(P^^8~j! d=@!?<u j`j( ŝ@n f*[]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream] }f*struct { F uintptr; X0 chan struct {}; X1 *error; X2 *http.Request; X3 net.Conn; X4 **http.Response }f*struct { F uintptr; X0 *outbounds.dohResolver; X1 *outbounds.AddrEx; X2 chan outbounds.lookupResult }z@μpH<x jj(@@n ڄDTKH@y jj(@@n f*struct { F uintptr; X0 chan struct {}; X1 *http.Request; X2 *http3.RequestStream; X3 chan struct {} }f*func(context.Context, *govultr.ListOptions) ([]govultr.History, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Invoice, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Cluster, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Network, *govultr.Meta, *http.Response, error)g*[8]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream] }g*func(time.Duration, func()) interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool }g*struct { F uintptr; X0 *outbounds.directOutbound; X1 net.IP; X2 uint16; X3 chan outbounds.dialResult }g*cache.LruCache[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]g*func(context.Context, string, *govultr.DomainRecordReq) (*govultr.DomainRecord, *http.Response, error)g*func(context.Context, string, *govultr.FirewallRuleReq) (*govultr.FirewallRule, *http.Response, error)g*func(context.Context, *govultr.ListOptions) ([]govultr.Instance, *govultr.Meta, *http.Response, error)g*func(context.Context, *govultr.ListOptions) ([]govultr.Snapshot, *govultr.Meta, *http.Response, error)g*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 bool; X3 protoreflect.FieldDescriptor }h*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest; X2 *http.http2writeData }h*bbr.packetNumberIndexedQueue[go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899]h*func(protocol.ByteCount, protocol.Version) (ackhandler.StreamFrame, *wire.StreamDataBlockedFrame, bool)h*func(context.Context, *govultr.ListOptions) ([]govultr.PublicISO, *govultr.Meta, *http.Response, error)h*func(context.Context, string, *govultr.ForwardingRule) (*govultr.ForwardingRule, *http.Response, error)h*struct { f func() go.shape.*uint8; once sync.Once; valid bool; p interface {}; result go.shape.*uint8 }h*struct { F uintptr; X0 net.Addr; X1 net.Addr; X2 func(*tls.ClientHelloInfo) (*tls.Certificate, error) }i*struct { F uintptr; X0 <-chan struct {}; X1 func(); X2 *time.Timer; X3 *atomic.Bool; X4 chan struct {} }i*func(context.Context, *govultr.ContainerRegistryReq) (*govultr.ContainerRegistry, *http.Response, error)i*func(context.Context, string, *govultr.DatabaseAddReplicaReq) (*govultr.Database, *http.Response, error)i*func(context.Context, string, *govultr.DatabaseDBCreateReq) (*govultr.DatabaseDB, *http.Response, error)i*func(context.Context, *govultr.DBListOptions) ([]govultr.Database, *govultr.Meta, *http.Response, error)i*func(context.Context, *govultr.ListOptions) ([]govultr.ReservedIP, *govultr.Meta, *http.Response, error)i*func(context.Context, string, *govultr.ReservedIPUpdateReq) (*govultr.ReservedIP, *http.Response, error)Ɇ(@ P` %D$V-%D$}(ī ` ؝KtKV-|K@K(g 7|&M|L@!'M'M(" h8G!D ) XE DE I9h% ii G!NCNCXFCFCF(E ii$.H C.HC(h n@ iik$9HC`9HC($h  ii4HC`4HC!Gt9h` iixܘCܘC`CC `N- E iiR`@5HC`5HDCXS(9h iiϬ``G`G@!GG5ɥ ( ii"` YH,YHV-HZH7GrI(: ii` HUHFV-(VHhF-b!(m ` _4k}V-|`k} Þ4̅ xx05 4`@!l6( @` z˅V-t{d̅3(H ` ( NNV- NpNx(! ` NNV-N\ Nװ9h ;;;;R)R  ju9h{ ;;;;R)R  ITq9hU` pp ` lvlv ]9h@ >@BDKDK_(* gg"` HwwV-wTwRh . \wz6 PxP+l&p@@1 \wv%`G6 TPdP>pK2 \wė6 tPPȝl ]6 $j!  B2B2d@ 0B2\224,ųH+/řIř(Ȁ p o W/mZQ `r @@j*struct { F uintptr; X0 *int; X1 map[string]*x509.policyGraphNode; X2 map[string][]*x509.policyGraphNode } rp  `r W_P < $$ۿw A">ݞ1$$Y2_PA$">ݞ1O$v   xI7\lP oɭ @Wk @ ɭj*struct { f func() json.encoderFunc; once sync.Once; valid bool; p interface {}; result json.encoderFunc }  A`1">ݞ1, "`90 A1">ݞ1fW\h  ( @l0  H {R  ໮٭ @%~tO0  `r @@͢&   ;Hg0   @ W`t[  A">ݞ1 s""`h0 A @">ݞ1B]K  ҧ@ 4(=+[h 0 @=  է40U_Ȋl t 4ui 0 @ CountryCode^protobuf:"bytes,1,opt,name=country_code,json=countryCode,proto3" json:"country_code,omitempty"j*bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]4Btt ήJ @ G2 T٭ u| ̧ຬ " @٭T @cܿM @ j*func(context.Context, *govultr.ListOptions) ([]govultr.Application, *govultr.Meta, *http.Response, error)j*func(context.Context, string, *govultr.BareMetalUpdate) (*govultr.BareMetalServer, *http.Response, error) 6 @`J  pA Q">ݞ1`\ mA`Q">ݞ1\ f8pAQ">ݞ1\ EBCAQ">ݞ1 ] -spA@=">ݞ1I`X `@ @"@+@ZĤUp @@@T k (`Ae">ݞ1  [Si9`pA@e">ݞ1@ 6A$|  ǛǛ@ @LQp p @, mH8aS M DLL6NKCp M @ŬDHHÇ M<k@LLIAp M<kDLL" M@Ŭ<D44":čp @  (k,|X`ܜ "+Ϟk*struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } }k*struct { F uintptr; X0 *tproxy.UDPTProxy; X1 *net.UDPConn; X2 client.HyUDPConn; X3 string; X4 chan error }k*struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream] }k*struct { F uintptr; X0 *outbounds.standardResolver; X1 *outbounds.AddrEx; X2 chan outbounds.lookupResult }k*func(context.Context, string, *govultr.ListOptions) ([]govultr.IPv4, *govultr.Meta, *http.Response, error)k*func(context.Context, string, *govultr.ListOptions) ([]govultr.IPv6, *govultr.Meta, *http.Response, error)k*func(context.Context, *govultr.ListOptions) ([]govultr.BlockStorage, *govultr.Meta, *http.Response, error)k*func(context.Context, *govultr.ListOptions) ([]govultr.LoadBalancer, *govultr.Meta, *http.Response, error)k*func(context.Context, string, *govultr.ListOptions) ([]govultr.Plan, *govultr.Meta, *http.Response, error)l*cache.EvictCallback[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]l*[]bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]l*func(context.Context, string, *govultr.DatabaseBackupRestoreReq) (*govultr.Database, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.FirewallGroup, *govultr.Meta, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.ObjectStorage, *govultr.Meta, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.BareMetalPlan, *govultr.Meta, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.StartupScript, *govultr.Meta, *http.Response, error)m*[]struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } }m*struct { F uintptr; X0 *net.Resolver; X1 context.Context; X2 *net.dnsConfig; X3 string; X4 chan net.result }m*struct { key *pflag.Flag; elem func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective) }m*[]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream] }m*func(context.Context, string, *govultr.DatabaseUserCreateReq) (*govultr.DatabaseUser, *http.Response, error)m*func(context.Context, string, string, *govultr.NodePoolReqUpdate) (*govultr.NodePool, *http.Response, error)m*func([]uint8, []uint8, monotime.Time, protocol.PacketNumber, protocol.KeyPhaseBit, []uint8) ([]uint8, error)O`4v@`'=@+yy` f0i'=@+yy7 F0+9@`(=@řz;zF\,(=@ę_U@`yT\U`)=@ę_U@`y 3(z@)=@o y $$D `*@ @ E`r( sZ"8` *@/b-@߅ VIN(Fb@`+@~Slj! d=@!oؗ+@ _o7IDjPʗ`,P@p/RsoFQ碗\a-4U,P@QB/6 `ɤD, ^8y`-P@E@| c@Pʗ-P@ʗe˜@ F`X_`XhXm)`.P@`ɤ`ɤ0}|@`K@dXn(/~.~@F-80` Flqa` <`/~@X0Z@`a@` _"@(+~/~@PG`J@`bn / ˗@$ |~`0~@H ׭p0 0,8i~0~@`3axtG,Gp.@3~`1~@ea1$̗ͤxxsL HE`~1~@0GdGlnt 7T$ `2@< V',̅ 2@@ @pL0<)F`3@. &TuI*- d@]F3]F@#͗͗ cn- =]F`4]F@u͗͗ 5! N]F4]F@ Úh2 b ]F`5]F@ P32J 5=5- @]F5]F@ jdK@ x3@  ]F`6]F@d<@e$ VnQ³  ]F-- d&> <-  ]F`7]F@e#ϗ - @]F7]F@@823 |ђul ]F`8]F@; e f : t\)\i q ]F8]F@RK 4 (4$ٝ&Ӧ h iHK` ԧ0~d̪ F8, %X- 9K@55,?- 6@`:K@5<^``4t. ? K:K@<@(5^@3< MA̅9`;K@5@ϗ 9$T q;@"% % <l|g xy`<xy@S ,sP@` qJ o<PN@h1h Ԟ җ@qa7g`=|3@J A va4:tl=L@8;Ktnn җdR}L`>L@.`N :Ԯ &@r #U> @^@ ^n)E³ yKm'!dLSMLL] $L|L-LLLJol _Y ?K` La~ܝa F`al 7 `@`B ' @!C ' 4D ' {X~ i@i@<3 .|՗j r(:DGi`Ai@kd٭O@ $ wE x` iAi@\ 9p (l `BiG!t HCX HCG` HC hwK̅iBi@`ݟ5@V  D( i`Ci@<v/Ĥ 9Ĥ, 8`iCi@ Ni|@?|'(xl j0Ni`Di@ ND"`< 9CL( e7@iDi@O"Ni ħ Bal` i`Ei@ ݟv  * iEi@ ݟ>@,` i`Fi@`ݟ 7&ږl _ZFi` ZHdG~d[H dG F[HcG%`Gi@&| F@`( ZtH`G@Al@d;$}4Xm@`H@/@!@l@w@H@3ll)P@tQw @`I73@\@@@pG@ 07@ 3I3@\3p.$ $ԉoG r3`J3@ \ W뎼4J@@(\ @ `K @EG^FS ^F_ G+_$,K@@X:j^h h$\ Q`L~@ F@`(cm mm^({ dlLdl@`.@H~@.Cc@44Q44"{`M@&Į:` (ڗM T8 M@3 3t4NHR@$"pl\ .)`N.)@V¤)ZR@ $v XaH.)N.)@V¤@ .$gLD]XwH .)`O.)@V¤@ .$ krXi.)O.)@V¤@ .*<; m@ `P@V@h2 m@EpPEp@0.@~@cR@{ 4 xEp`QEp@PP$\`N5 ڗQ@`ٝJ`@T[XPQw<j) Q`RQ@ Ѭn ݞ WJ`zRz@u ੦Qc &"o\2| ,ۗ`S,@!@w"@;@H\X H; 98S@;֝J`@P[T4 *`T*@(@s@x9@ô 9Q"(w(T(@"1H@#d## |@FE`UFE@5  $  ;]0(Jp@FEUFE@#@4Sݟ z7F7lS}`V@/oSۗ`Ӟ ͫl "V+` 4~4 F4,(lS`W@ ( $(F#VL ~W@f Jl E `X@x< ~`ܗݟY X@     `Y/@E@@=@ w˸+Y@%n o Qz,7/v*`Z*@5@\ ?}- I-Zq@55)h- .`[q@5<^``8v,AX4 -r" q[q@^@(58>3 4. $" q`\q@<@(5^@3 TW1 @# q\q@<"3 U @/q`]q@5@>Mഝ 80p$$ q]q@H73`ޟz{B/- [r@0`^q@5q"@^$|? @& q^q@K@3 3 e( K1`_q@ߒU -P$ & q_q@꒗ߗ3 _ Ѳ 2``q@q('X>`> Gu7`o@n M* )Y ֌ӟ`a@! @0ڊ@w 4r`ӟa@! @0ڊwYd3c(;`b@4G! , k)S.(0@<b@G!4~*vk`| @F\(r`c@ \r0@ƞ4t-<mP 1 cc@)Ss p*`   c`dc@ 9_ v ү O\cdc@ dX`r`_ї K8 x9`e9@fXsW@F&(L3 ;e;@**!@*s4 (H`f@ @X e@` LIf@ޟ_Xz!L``g@= p/ _6 (5L* Kg@"% g/V [$P 4`9 `hHL@XLL4U Kh@4`ɤ/t04<ĮHf)t*K`i@\^`ɤT& ,[x ~@ QiQ@"($ ut`jQ@/O iݘ ( 83 jQ@/O<"5w,(Zg D6``kQ@/OAtt$,$)4WkQ@/O)aՙݘ ($~ }Y`lQ@/Ooՙr A_L `;lQ@/O2x |b)h `u`mQ@/O)a0aY;.\5 ơtQt]TyTyx/hyhy^Aq p= +`n+@}\@` d 4ZOn+@Z5v ԅS`o"@@8ز -R.O 6To"@/@K7 #@W`p"@Rx@9 H< @MXp"@8oRR J@4 Q~( [`q"@} Z֙ Z Z ?: Z00(AC_q"@0p; ;䐜$LD 0x_`r"@)י֙8N _HHzNVT g ar"@F_bc4b x 0#d`s"@9K/ K A 4es"@x @Z$Jl"%@f`t"@'̟8n ޡ* Ȇ @lt"@>c @{ؙ@ ؙ@  0}m`u"@8?\b q 0N6nu"@rF^K  ¼q`v"@_ /@t [, 4-sv"@R?\=@Z ԅNt`w"@@Raؙ =T 5n 0'yw"@8yr6^K 4I{`x"@R?\=@$$g` x @ ࠜ E`r@8hB `y @k2$(\74PHSd^ y @EX.v y3Dg{(Fb `z @~Slj! d=@! j@Y F *Hz*H@Z=T `7!4@4 !g$p`{$p@ ;N@5`g\Ad $hc{c@@IB+` @I u4Q ``|8.@<`>: =;X k | @ww@ n Wx`} @N GY@u ' ya }&@w.žC{D:  `~&@w.yȶƠ:ݞ>p? p;kG(ihTIJi$hx6Up{zu`H@Cd@ <@h,@ A- 1X  @oǞ{Ǟ)@`(Ğ {- /" `%@iǞ@ƞ@ƞ8hg k@% %@Y<7' %Lf ' `%@E  ?Ra5- x( %@Y}Y@`3ŞX,Ȳw`%@RͫXͫ70' E|t4%`  @e ~ ~)e`Z丘Şt|xw@ ` @I`kh>p4x \ {[HD hPD jԪ(?@m`m@Kc!@",@,,M?mm@ ]N < (+(f`f@H@ `e S `]ǓǓ@]O|Y|( qGl Ǔ`Ǔ@d8B ө$W(4Ǔ@y~'×0x65 {"@ L]1Ǔ`Ǔ@ ͜ p/- d\= Ǔ@!L@V7 ; $b@$$ MOĉN 4Ǔ`Ǔ@ ӜH% = CG(@`@tk@v`V@Ut@UgAE`@*L `f^l =_` =t jnV-<>t(jn]`@*L `f赍pA d@uhu5uO&iu,4u6uiu6u-Hjux3uǷ pd@udu0uO&eu.u6upfu0u-gu,.u:F^p i d@u8ku(9uO&lu9u6ulu9u-Dmud8u4CA@` @ǞCǞagh00@@ƞC@ƞ$&B0A`pA@Owٛ3^ k@@ww@ Vx`@N࣠GݜY@u '( I@,8A@@@ PBE`$^&n*[8]struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } }0Jԅll@pV_`ݞu ݞN@ԅ@l@l@p@W_`Wu W0,kcP8f~^@`3axtG, /x|^-@^-@pX_` . Ell@p`X_୦ u ݞ H[ l@l@pX_௦Ku W  KJ%| ^-^-@p Y_`<. 4:lGH,@H,@`ln  n*[8]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream] })v  @n 9$7@UYE `zz@>0+N@ 4N@LsG  z z@>0+N@ 4N@L  h zz@> 1+N@ 4N@L(A`2 @n ?`2$`27@n*struct { F uintptr; X0 bool; X1 *certmagic.Config; X2 context.Context; X3 string; X4 *certmagic.Certificate }<D]ӏӏ@@02(sQ @y+N@ 4N@LRN ` @>y+N@ 4N@L '>- z ^@oǞ{Ǟ)@`(ĞK)gx{ ` @>@{+N@ 4N@Ln*func(*quic.packetBuffer, protocol.ByteCount, monotime.Time, protocol.Version) (quic.shortHeaderPacket, error)n*func(protocol.ByteCount, monotime.Time, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)n*func(context.Context, *govultr.ListOptions) ([]govultr.BareMetalServer, *govultr.Meta, *http.Response, error)n*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPCInfo, *govultr.Meta, *http.Response, error)o*go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }o*struct { F uintptr; X0 <-chan struct {}; X1 *net.netFD; X2 chan error; X3 context.Context; X4 chan struct {} }o*[]struct { key *pflag.Flag; elem func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective) }o*func(*uint8, func() (*ed25519.PrivateKey, error), func(*ed25519.PrivateKey) bool) (*ed25519.PrivateKey, error) InverseMatchbprotobuf:"varint,3,opt,name=inverse_match,json=inverseMatch,proto3" json:"inverse_match,omitempty"o*map[string]struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }o*func(context.Context, int, *govultr.ListOptions) ([]govultr.InvoiceItem, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.DatabaseListAlertsReq) ([]govultr.DatabaseAlert, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPC2Info, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.NodePool, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPC2Node, *govultr.Meta, *http.Response, error)p*func(*tls.Config, *tls.clientHelloMsg, *tls.serverHelloMsg, *x509.Certificate, *tls.serverKeyExchangeMsg) errorp*[8]struct { key *pflag.Flag; elem func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective) }p*struct { F uintptr; X0 *singleflight.Group; X1 *singleflight.call; X2 string; X3 func() (interface {}, error) }p*func(context.Context, *govultr.ListOptions) ([]govultr.ContainerRegistry, *govultr.Meta, *http.Response, error)q*func(*tls.Config, *tls.Certificate, *tls.clientHelloMsg, *tls.serverHelloMsg) (*tls.serverKeyExchangeMsg, error)q*go.shape.struct { net.addr net.IPAddr; net.addrAttr net.ipAttr; net.src net/netip.Addr; net.srcAttr net.ipAttr }q*struct { F uintptr; X0 *httptrace.ClientTrace; X1 *tls.Conn; X2 context.Context; X3 *time.Timer; X4 chan error }q*go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }q*func(ackhandler.Frame, protocol.ByteCount, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)q*struct { F uintptr; X0 *http3.RequestStream; X1 *http.Request; X2 *http3.ClientConn; X3 *httptrace.ClientTrace }q*func(context.Context, *govultr.DBPlanListOptions) ([]govultr.DatabasePlan, *govultr.Meta, *http.Response, error)q*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.Converter; X3 protoreflect.FieldDescriptor }0ud 6hA!=^`pЉpЉSΉΉ^։։_ԉԉφ 6hi #=k,,B44,}īī̩̩XMq 6h=`#=^S藉藉^@ԟԟ_@j"- A `=4@`׆@`@`c.Cł4O ୧4u  ` ̚-'dT 6h`a`ش,ش,̛,̛,k`,`, ,,[?s 6h` |'|'~,',' Fȓ'ȓ'V-''/ 6h:`--x-x-k-- ̝-̝-wbȆ Pʗ௧P4 F` ` <%A$ : (yB@ `P4 //` ܶ%5$3 6h AeU!  6h7~` (b (b ~f f Fd d V- b b ݨ 6h- ~a!!!!!!n X. X. c 6hb~` o o ~Hq Hq F4q 4q V-o o $ 6h/~h0HHQn' 6h`&~` k k 0,l ,l ~l l F l l # ~೧~4000 <@@PHD ~`~4>Lx.0"8` . 6h6~m" ̌ ̌ n, , aP P d d $4d@ B}`B}4j` Są}[n 6ho]F(,,_j#Cr 6h ]F#HH2!N!44"T 6h G@]F!- I鹜s h e]F!IL. 6h`]FG $ oj 6h6]F-- - &>.i 6hJ]FG $ o?Sc 6hT]F!d$ h  4]F&K#0 =NS 6hAȥKK@M)%K Ɨ 6hiH 9K` 0~dd F88" 6h/aggw{ 6h7g*SM`TKTK6dKdK ކ 6hΫ*s]&+/= 6hΥ*s9MM5MM-`MMMMMu 6hegd&,_,_G____s__E~ 6h ҥNYJlblbtbtbMobobU zb zbu#F 6hsU N h hEh"h"hOththd&#h#h 6hҥ` $h$h~8&h8&h F4%h4%hV-#h#h\ 6h`p|3߇HuHu uuXuXuJ`uu2!ԅu` ࿧4m@&)uSMLL*' 6hKan X 6h:@ϩKan <<"ԈiK`K4Ω,A 8atT튜  i4ÉΉ06|G@f 6h@i@!dxDdxDm" {D{DN!0{D0{Do DDզ 6hIiQ`.;aM 6hGi,`|G|G` 8G8GGG`xGxGj> 6hiG!@WH@WH'h6Gh6GX5G5G@!|XH|XHe 6h+kiFشCشC!  3' 6hNIi.FFP%FFȩFȩFI|F|Fʳc 6h_% iXdGXdG[pgGpgGX2 Z̅ ŧi4 O@yD` L*H(Cg= 6hQi` @G@G0X@GX@G~H@GH@G F8@G8@G! 6hˮih. MHMH^NHNHG!EEm" d#k 6hP` x"x"~"" F""V-\"\"lQ 6hK F\\J LLԏԏ@LLq 6h<`  44ЗЗOme % 6h@ q @t|t|!}@oo",,@Ae 6h@x05 48݃݃@!  H 6h,K@;##@&&j QYw 6h @G!L3L3`@W0,0,GW--^ ** 6h @;p p @z\\N @@X 6h!˧YQ : <pp| pqq 8= ! YQ : <p@W| pqHX\k 6hf{    >  P 6hC! .)}TT ` `  _hh"|| 6hQ'~""Qh"h"QR " "{ ""a- 6h3@~ttQ00QRL)tp 6hfäEp}hVhV XX _xVxV"VVTA 6hx QEp}ZZ ]] _ZZ"[[eh: 6h)yB\ \ # `Ԫ Ԫ lR' 6hĤyB\ \ | | v 6h! ǤH_]I]@ 6huǤH| ! \k 6h۴5n D(D())R ((l; 6h/"OO-hh*;c 6h-`H?!3LL2XDD?3 6h"ͤp<$$S`<00] 6h,`Ϥ@ . 6hZV.V."HR.HR.-LV.LV.0V.0V.r 6h %` ta.ta.mTl 6h%` c.c.mTpV-le.le.a$h  `է4)' 8 PHtHs۱ 6h!KդpSM`DHDH6HH) 6hդ` IIIIV-IIK !] 6hR 7h. 0'b0'b+'b'b^(b(bG!,)b,)b& 6hM X& ;TfTfӹff)ffff -E0* קo4RX-uHt< 6h=zUU1̝U̝UN@U@U_D u ا4{$u  + D& |Y,|Y49 6h uاD& |Y|Y+dWdWƁ+WW-WWK 6h8) ` zYzY~zYzY F{Y{YV-{Y{YWg 6h dcG!XZXZX|Z|Zi.ĈZĈZe!4Z4Z6 6hdcG!P\P\XQ\Q\i.Q\Q\e!R^ 6h3PEcN[N[)3DY[DY[SP[P[/>( 6h4*9w*#ܳܳ|@@;& 5)L (O9 HL`ܧHL4&]? ?BkH 6h ^HL P>P>j>>t`>>B$1T >9 g`ݧg4%tޖ@#@ ( h.v` ݧgw8wXw\wlwHw݄ 0w 6h Ugzpv*W*Θ 6hY\QX@[\z\zxzxz1= 6h+@`xg'`  0`ddV-HH@ 6h_c@'" 2 ! @j 6h)"1@.`  44M. B C  4.@E@E@ v.W 6h:  @ k  ; 6h l  @ k  I 6h_ k8.0//-H/H/Z+J 6hnLu` HC7HC7v-C7C7j 6h%LuHB] 88-88`tb7tb7PP 6hF0 2LuHB] D8D8-P8P8`,k7,k7, 6h1 ky%Ś 6h?~ p;kG(i(iTIJiIJix6U8 6hGX@ x! 8?\N\NX=A 6hk( E` 2O2O~|2O|2O Fl2Ol2OV-2O2O) 6h`E` 02O02O~ 2O 2O F2O2OV-L2OL2OVv 6hE` 3O3O~44O44O F$4O$4OV-4O4Opݝ 6h %p;]{O{OX.0|O|O~O~O8O8Oݎ 6hS@ L.bOQOQK@IPQPQdѺ 6ho~3` R R2`RR &`0R0RP0tBtȇLbb4ė{`eZ4~ȦS fT#=T#=#=#=$=$= 6hf!=!=!=!=l"=l"=R 6h tfH<H<<< nP<P<]f 6hI "+$˝ D (@Kɏ`ɏ4@8|`۝ {U@  6h^w`33-䫄䫄332XX:X:rn 6h-?w!3` ` 2XXXjF 6h@ԩ$g C2 C2g-$D2$D2$c 6h $g@2@2g-A2A2! 6hKf |XbXb4 DbDb> 6h@SGhBjBj{ l 6h]ǓE|]]ch,vtvtDpwtpwtDxtxtn 6hAd@uhuhuO&iuiu6uiuiu-HjuHjujB 6h d@ududuO&eueu6upfupfu-gugu( 6h id@u8ku8kuO&lulu6ululu-DmuDmu~F 6hg,"2,"2g-!2!2= 6hb 0FI;EE% 6h `UEyB i=R 6hL`UEyB  @/ 6hg VEyB ̀ 6h=OyB  6h yB /g 6hyB r 6h( yB o@ 6ha `yB  6h`U ০yB c 6ht ਦyB @} 6h`yB  6hk੦yB s 6hJ`yB  6h]k`yB ` 6h!`^-G.gu 6hଦyB A6: 6h͇ ୦yB WE 6hT `yB \R$ 6hf `yB q 6h6mԩ^-G.L 6hyB ]Lf^ 6h$ @yB h 6h4yB r*func(acl.matchResultCacheKey, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound])r*go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer } 6hFBn$ r*struct { F uintptr; X0 *quic.wrappedConn; X1 chan quic.errCloseForRecreating; X2 *quic.Transport; X3 chan error }g3`r צ7x777.7 @` @ήK? 6h yB r*func(context.Context, string, string, *govultr.DatabaseUserACLReq) (*govultr.DatabaseUser, *http.Response, error)jW 6hyyB s*struct { F uintptr; X0 *tproxy.UDPTProxy; X1 *net.UDPConn; X2 client.HyUDPConn; X3 *net.UDPAddr; X4 *net.UDPAddr }s*[]go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }s*func(context.Context, string) (*govultr.DatabaseAdvancedOptions, []govultr.AvailableOption, *http.Response, error)s*func(context.Context, string, *govultr.ListOptions) ([]govultr.DomainRecord, *govultr.Meta, *http.Response, error)s*func(context.Context, string, *govultr.ListOptions) ([]govultr.FirewallRule, *govultr.Meta, *http.Response, error)s*func(context.Context, *govultr.ListOptions) ([]govultr.ObjectStorageCluster, *govultr.Meta, *http.Response, error)s*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 bool; X3 reflect.Type; X4 impl.Converter; X5 bool }t*func(*ecdsa.PrivateKey, func() (*ecdsa.PrivateKey, error), func(*ecdsa.PrivateKey) bool) (*ecdsa.PrivateKey, error)u*struct { F uintptr; X0 net.addrList; X1 net.addrList; X2 *net.sysDialer; X3 chan net.dialResult; X4 chan struct {} }u*struct { Protected string "json:\"protected\""; Payload string "json:\"payload\""; Sig string "json:\"signature\"" }u*go.shape.struct { Outbound github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound; HijackAddress net.IP }u*struct { F uintptr; X0 func(string, string, syscall.RawConn) error; X1 func(string, string, syscall.RawConn) error }u*func(monotime.Time, []uint8) (protocol.PacketNumber, protocol.PacketNumberLen, protocol.KeyPhaseBit, []uint8, error)u*map.group[string]struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }u*func(context.Context, string, string, *govultr.DatabaseUserUpdateReq) (*govultr.DatabaseUser, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.PrivateNetwork, *govultr.Meta, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.LBFirewallRule, *govultr.Meta, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.ForwardingRule, *govultr.Meta, *http.Response, error)u*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error)w޷$ =(g ` ܉V-݉ I|0 (]_. ^--G!0--9v(/n@~ ~HG!4~`IY`vk`Z`G Jm `] (8 ^h ^8"MLN`P#M L>0 @ i(-w-`GA(' e2 i i(k5\:H,C`:HDCz*8 y` ii(#x9+@J4Z Θ(`wP`wyԢv&vHD1\؉ (LQrP:൤8` Aw8AwBBw$= s` X ( ww(!*` ~ZKZf8(NQQH@M-M[ )2` Ys |`x`x("+` H65w̓m(:V""H@@_1. @_@ 8?_^s(Nt""H1@.  Ki^8?TO24 $1 @ LZLZ(5` deeV-Xee1ZC(e  H3`TpC NyT?`T`Nv;Vr/^('  H VX``V@Ub_\V@UJO6(f<@00H%67& bַ@Z =-̅`)   (iŞC)X2(X @  H1-u]Ie]j!YeFP1`\YU8Tl* \w(%@H7@06 `PDP$`, \w(05}6 0PP$>{u@, \w(05}6 PP2*L - \w(n @6 pP@PPLrP/ \w(05/%]ʞH6  PPӰ\\ 0 \w(PɞrD6 PP N8l(41 \w(v%ɞ%]6 PPq\U| >`2  (X.@:@@8R  3  (eQ@6 YxY \3  (eQ@6 `YY t(__(`Ԟj! 2X2d@ ( 2T2 ( __(`Ԟj! ,22d@ 22v*func() go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }0(ukPp  $ L/dr$ @3`r ((Fhp   ` @$p   ׭)rlp! ` ׭@ `r@$$i\$! ͣ n f/p,p" ɭ i i c p" ɭ @lg`lH,#H,([@MdgHgεL:L $(h8QkXHHG`H4He[ @M $(h8p9`G!\Hl\HX4^H]H3,٨$  `r `̣@005 Gp% ` `̣ ϧ@l% @٭ H xPȈPp& `r !-l/@nH,'H,([@Md@ggv*bbr.packetNumberIndexedQueue[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]v*func(protocol.ConnectionID, []ackhandler.Frame, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)}H\] p(   @l( `3A` `r1 _tp) @@ Gv*func(context.Context, string, *govultr.DatabaseMigrationStartReq) (*govultr.DatabaseMigration, *http.Response, error)$Xs l p* @ $ ݞ\z` $$v5v<+Ad">ݞ\ ` ټZ Op,  w*func(context.Context, string, *govultr.ContainerRegistryUpdateReq) (*govultr.ContainerRegistry, *http.Response, error)w*func([]uint8, impl.pointer, protowire.Type, *impl.coderFieldInfo, impl.unmarshalOptions) (impl.unmarshalOutput, error)x*func(go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer })y*struct { F uintptr; X0 *certmagic.Certificate; X1 *error; X2 *certmagic.Config; X3 context.Context; X4 bool; X5 string }y*func(acl.matchResultCacheKey) (acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound], bool)y*go.shape.struct { github.com/sagikazarmark/locafero.path string; github.com/sagikazarmark/locafero.info io/fs.FileInfo }y*list.List[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]y*func(protocol.EncryptionLevel, protocol.ByteCount, bool, monotime.Time, protocol.Version) (*quic.coalescedPacket, error)$p0g0=Lę+yMyoy XPM,?U`1=Lęę{+0+ 4ę`~L((L~D9B1=Lęσ_U@` U ơS$($(lT5`@`2=Lęy]zQęU `Xis X2=Lę_@烙(( )D f `w`3=L,_U@` zz, HdA9@3=L3ƙ,VE@`$,8B@`4L # @$t(;B 4L+_- !K A\wa`5L%ɗ S_Lɗ զ 9!( *8h` 5LY-@{@߅ (=1<. `6L_~l$)Dp?<6PLQBE@ TF P~ 4 \8M`e`7eLk` Ct@*@0ྜྷ((c}5X( 7~L<H0n^n >XIE` `8~L{"@@Ơ"&( k[ d8L (H@`(0$** <(O`9L@!Ť# N1 GΦ$ [M L>]F9]FLVJ Фѝ\hH^  ]F`:]FL@Ę >`Ϥqpd  b|]F:]FLh )A@&l  4  ]F`;]FLJT`kee J 7x$Nŀ|  K;KLu Gf@5 Ѡ"%@%C- )@ K`<KL5539  l- Q<KL5<of^@yfnZ z`=KL" ($Z MEL =L5n ąWLƘƘ"`֠Σ(>*sїuG!NMN|N@!DNN ejx`G%`?%Lh1h ԞE җpG x8!D|3?|3LhMh+(#89`@LLq`֞ Ej9՞,$@rL@LLt N`b 7$/(ldjnKh `AL&`ӗuL&T&X&`5`($r&0؈ A!Ln @Ŭ5(8g $%<5"!`B!LhH8W$X7>(iBh8G!F ) XG $G G`H ) ,(mp#vi`CiL8Mj<$(c8 iCiL ݟ!Ѧ: Xv՗@`v$|i`DiL.y8o 3 .@$$42iDiLKvO_@@ 22 ((*<D i`EiL28vY5 Ǵ}@iEiL`ݟkoo (9 mli`FiL2 8@ 2@@-lEb)@2 iFiL ݟ!Ѧ: Xv՗@`_9hE `Gi'`̣b3YBYBj!`<'H<'H'H'H4{`HGLr0Θ@`@` sl@X740cZ `HL 珙"oݞ$U,cW(WH9PlX4QHY@1>$Z3  n `ILuϘ@{'@ $ M(S,,ZDlאI73L[ \OMp@((p 90 `JLElΏ`@$$ 2BԉJLnG :w( q؅1`KL,@CG YYG@P$$PK LԮ0:\(v Kٗ'm~44 `L L vrٗ~՗@` N`s0)  LxLYm@؍@O OpOd IQ`5?]`M?]LܝJ `@`[dU(lR0W MLĮĮĮ ` : )`t`NL2 ϗ@Ť@Ťh-T@NL`4(@ @ }|M,ۗ`O,L!@w{" @;%8C|,ۗO,L nx* @@X$eyR`P*L(@ @  8$^4$1}vFEPFEL( c (@(@ 0(3$l@p`QpLtݞ`@ <)h$h w QL4E<<l ,d =  EJ`REJL`֝`Y 5$ ([isqRL*)5@ŤĤM- q q`SqL553Z 5h -qSqL5=^`U` x&-- '.`TqL5<of^@yf 8  # qTqL^sq 3` Y K/`UqL5"K}q9V W$ `$ qUqL"KU 3 U, P o% q`VqLK@  ^3 3s @2VqL5""{" a&kĤDo( `W7L4D#*Jx>(t@ / G3& W& LU@U@U U"**$<<WhM & `X& Lc Nǹ NV y4&V`y84,2:Ċ} ) & X& LCz/@3 0ͫI֘04,33Ċ * & `Y& LCz/@3 0ͫI֘0$B?i| 0c0@8YoL'mK(V@ $$+t[=@ӟ`ZL! @0Vr@$cӟZL! @0R] $$N0a@8`[Lg& ~y@ /6@(#%$  [L3 f|(4`~[x9@ƞ 0(WǮ'@`\L$ :1@ƞrk@ƞ5i$J} `\L$@J@@Q@ : $$OjH! `]Lg& ~y@ /6@4,z? H]#4LWU 1H@(0 0<4aIHL`^HLL@ hoȖo Ǽ $[ 0TLT@K^LQB<-@ \ PK@4H,(pٕ̆4~`_QL/O0+_`$ w `X?_QL/O`@ 1D ````QL/O"efǚ$ Y`c +`QL/O`@ԙ | ```aQL/O"efǚ R{y@ ` BaQL/O%yuy x$ IH u`bQL/O)a0<ՙ bmP `Y`bQL/O`@ Ν\ `ۗ`C`cQL/O%yuy x$ ֨p G`cQL/O<p7 ;̅s `dQLB5m5aK($(awx= d+Laj Hv $ < JR`e"Lr?\@F($T\ 6Te"LɅ녚K  V`f"L@?\ CR/ MYf"LyA,V,k, _a$ks8 0@^`g"Lx @ $+D < 0 / ///8/8/$ E\LunLuL[|@8@@ Dz+-l Ͼo`oj! +2t+2|dd@ +2|%2-ō 8o&L@gx+—" B^qJ  `p&Lw.<[—g—B p&Lw. @@@=@z` `q&Lw.—h:OT5 1q&L@x@x@—@ —Ơ$$ {Y{`rLH7@  ",59d|r%L@` ,$W(%`s%LA٘osYGz|$J[4 [} s L3ŞŞŞkėŞB@ tl f`tfL,@ _{``Q\V hДH`f  t LVҚ9&Ix` ($:f `u@Laj Hv 44s^܋@u@LI0D@Qݞ, 8ݝ '`0`vwL(X.p' 5vLJmMm(DmP\mx GfK`wKL KQ& @x(@1] ~1w1L@ m6;|@M@ ?@Td4A`xǓL!L@VS,`h=` cvd\F6@ǓxǓL]gc|Μ4Ҝ@S@@ԜL@ӜXTv )h0Ǔ`yǓL]x[d\ @ћ U-J8̅yǓL/Lm|`} ~ q <8³ K^`z!X;!Lg;Q3zL`iE }}Dp $iW&Pa^@`{L<@Ξ]@Ξ]@Ξ4(;jPc{L^^@?7 'zƗ {$-9h `|j]@PrPrgГrГrgДrДr16( |_ j! T`]FI-p>pi* 6h}]FI-p>pH 6hyG ]F)J !@F$ hJhJj 6hB ̥L (J(JL&KK JJg 6hG ?%d&d_d_'h__7  _ _F  ` `9J 2e`( 6hD?|3 C@uutuuuu(uuuul 6hl LG!__;__@__iд_д___1. 6h} >LG!p_p_;Ԟ_Ԟ_@Ĥ_Ĥ_G____lR 6h4 (%M(%MlLlLE . %M%M@!4L4L N 6hKh AN%8@!h Lh L$ I' 6hTO&MMSM`M`MMM`d Md M@!  M M[ϠC 6hsKa<<  -XXn ȗȗ`ʾ 6h*ةKa88-<<n Tи 6hW ٩KaHHġġ-ܡܡn ||. 6h(٩Ka88-PPn Y. 6h5" B!i^^@m ҝ 6h''HHttq 6h L _"44GxxsPP 6hb @;օօ@Gۅۅ|߅߅QԅԅMk% 6h:4mh h d -̒ ̒ wg 6hR$Rm`2۳j 6hvRP P $R m` 2 6h #̿ ̿ ` 6R  0 0 ?R o 6hmPEp}@A@A EE _TATA"hAhAMDBDBT 6hGP&P&&&8; && GP&x&&&8; &H&[s 6hZ`5,66i*@77(;(;-55Xt=t="R 6hC|O,X-X-i*@X0X0 3 3-<-<-Xd5d5z 6h ("x x @#-  @#  _bJ 6h+ +h1::p1X7X7ISL8L8p<;;ao==ΛC 6h)ϤyB` ' 6h)  yB#  a 6h RyB&   S 6hpФyB@M@ ~"b7 6h REJ== 44= Au|- 6h#Ҥ=~-00=. 6hYU'=# p 6h =iU00K00̑@00",0,0h@00] 6h# =iU<0<0K00̑@L0L0"ܕ0ܕ0h@D0D0} 6h# '=iU00K 0 0̑@00"00h@00v$ 37 374</ߗ 6-} 6h.@7KaaE@G`aa8`#C, 6hx-rCܓ؀3s9 6hv 31@<<"7<<"w 6hvݧgwwXwXwlwlwӖ݄ Gݲk 6hޫQWUxyxydC`_L.s 6h\Q=DxDx-TxTxM pxpx2`xx_ 6h\@Q=DxDx-TxTxM HxHx2`@x@xu 6hQ=8x8x-xxM HxHx2`XxXx2 6hUQ=4x4x-xxM DxDx2` x xt 6h$Q=xx-xxM xx2`xxW 6hM VQ=xx-xxM xx2`|x|xZW 6h\Q=xx-xxM xx2`xxG< 6h ]`Q=xx-xxM xx2`оxоxP 6h]Q=xx- x xM йxйx2`xx 4Z 6h)]`$Q=hxhx-̷x̷xM xxxx2`xxA2 6h^5VQ=0x0x-@x@xM  x x2`HxHx  6h` Q=0x0x-xxM xx2`@x@xT > 6hs dQ=xx-4x4xM xx2`hxhxX 6hQ=xx-xxM xx2`xxە 6h|5Q63 u8&~Z 6h@`xg'` H6H6 0`PPwV-44񋭒 6hR )"1hh.Tdd  8?

6h)b@&ϛ ڛ*M\-$e$eg!~T 6h %id33-ydc48 6h@% <lOlOלFPOPO\. 6h@}8R8R `R`R _HRHR"RRRR'$* ܨ\w4e}e} (>6 P`PTHUSDDI[ - ܨ\w405/QHėȞP6 PPP KzX(/ `ݨ\w4%]ɞPɞrD6 @PPg2 ި 4iQ@,d6 Y@YGxa 3 ި 4iQ@,d6 @Y\Y'Y 6h f G!@,Z@,ZC|$Z|$Z\3Z\3Z X,ZX,Z 6h @ܩB %<<` ,6||kB 6hr'mh,Ta,TaTaTa`epTapTa,@h@Ta@Ta04TTaTTaIel 6h.6 Pmh@a@aTaTa`e[a[a,@hpapa04[a[aG 6h)mhaaĮaĮa`e`ba`ba,@haa04teateaHF 6hw Ǔ 0`EmEm`UCmCm6 TDmDmCmCmv;V" 6h۔]@tt ttgtt}`̬t̬tgPtPt$NL5^4u 8* ԛ%^;tin' 6h*ܩpC RXrtXrty`RrtrtRttttututv;Ve 6hY??\ t tn XttO 6h@_ Bj! ,2,2-d@ 22 c|4|oΞg,"2!2gg-_ 6hs }-Ww 6hhVyBM ~xE 6h^-!E_.!*struct { F uintptr; X0 *forwarding.sessionEntry; X1 net.PacketConn; X2 net.Addr; X3 client.HyUDPConn; X4 *forwarding.UDPTunnel }b 1 6h  K mt̚" 6h$  K mt:0  00pPp @H{ݥ$ x($ ; $.p  `r%2L Q 3pt`rx@,({(A @`w`w@ v$tt\+̊P @uǫ 5`GX`p*struct { F uintptr; X0 *http3.roundTripperWithCount; X1 context.CancelFunc; X2 *http3.Transport; X3 context.Context; X4 string }*func(context.Context, string, *govultr.DatabaseConnectionPoolCreateReq) (*govultr.DatabaseConnectionPool, *http.Response, error) T `I@ `r@`$$$PX `@`r@` wL` 0u  M 0@{9+]F]FXsqd$J%&$(,( yS̅=ei]F@]FXd #p3맗F$d%Ub- ]F]FX5\ ` _W ]F]F(j^$` / q   ;  \]F ]FX!|@(@<$Xeg XhH7 F@`җ@s`a N$ דl@L`LX p.!@/8(BA X V uXN5i$s0LH\*iKX ?@ 052GG-GGϮj 1`ii(ʟ`HO 052GdG-G8GϮ$$ $iiXv/ } ǥMȇD@i@iX`ݟ`P6ȋ? 7 K`<D|iiX\H' l YP`lll% iiX ݟ>`r@ (.f{i i(ʟ`H> 052HH-!Hl HϮCg/i iXk8o  .e 68M2 i` i(ʟ`H" 052"H!H-(#H"HϮ$ b,O Θ XN!tP@` \`̣/ LLHL%F ( "RݞD ߗ ഝ Y- rr0@qX5<^H>ݝUݝݝ<94 2qqX5{"@"5 &,p.7X4%2UU4,il@ 7X%> 2 UU(Fhtps/ 7X4%2UUe(73& ` & XG!dr?L v!,$x(/5&  & XB`MgG!/X\@!?#  3H iAAXR#@ @q_@ @ŤP,$r0yӟ@X! @0yUǯv E7L 7)X?cr@?J^<8BL` X.OnON RO &@$$z#ρ ; Xn9X0`v IX!8 x1 X`WOXP?{ז&t`iPas@>`X ؘed$}efrhEl>p Vh XY~ ;G@v@ Dҡt(-@A X;@N('(~ <(s (0Dp8`3 c@ cX.AYP@KX:Ԯqs H@:n[ X@gX( ,儘024< KH \%Kܘ!X8 Ԭ5 `t@?>+ MQ "Q(Su/`"Ы)t CtMQ"QX"u  |@ 8@@$ / …`#QX/O"Ͻ`H@+$3u`$QX@@ޘMo@<T$h T0 T<- )]@$QXBE@` ,2V< @%QXY8; < +@ F@$u@(<4*rF ܋5+%+Xrxd`@3ݞ,@`4HH"<y] (+&+X#v gn,@4]G@$Y ԅ @V '"X@> ?\CR ($w; a@Y'"X@֙֙ hW$_a ,(p^4 8]:@]`("X³@Գ ֙$0,~:<H ]`)"X9?a3 K/ K (( 0Fyh)"XKghM@ ϙ@$ Z Ej@*"XK c @{ؙ@ؙ@( &۩-@n*"XRǝ<y%L p+"X̂@%֙@(@ ucQ$ h]~ 0S@r ,"XŸ*q 1ٙ,(Cf @s,"X-R?\=@ r$0,$p @z`-"XrF8> T(0(N5*H6{."X8nOt$,(Xk  {."XR?\=@ r$,(G"( 6|@/"XR?\&@ r$,(bT, (}/"Xo#O@?\>O$<<o@ 0 Xȗ 2 [-ࠜ  , 84,¶p @ 1:XEHX. !(l 5 `{<1<XG?5@.@Ag@! p- F0`2Lu(ʙՙ`ک HBg7] D8j7-P8h7 F{4ω3 X@ R @`BXGw 3 XB`%X +H[ww.sx9 @4 Xl[%4)PB@w   4&Xw.J%H7 j(P@ 5 Xx!UM6`MkG\Muy@U!U"MPg(S 6 XyU{";T!L@Vx6Y'@Yv;VxC@W$ ( - @ 6 XFcǞOǞ )cǞ;ǞLiKǀ ʼn `7 XYrǞ qǞ留 06(6/ ϡx=8=(V e ANT+N-`BNd+N0py 80X &1 ׁ  (0 0@90X dC  A < N (GD] 3y90(!@ƞJ@ƞO&dO-!O O Hm %:%Xi5@ƞ8)d3zd@A'@Y % ;%X8<@=zPrDQ ƞRiŞT✗@ƞ\w(? ; X!4!1!`?!3Zu<)c)!Z8S `< XaW d@ e@$>Ş(K4Ş0`@eԌS = X\ <=8oz@H=ŞPŞX40 $<H ~ = X  ,)= ]|,$0V`(Pc @> X1-`\u]A Ie]j!YeFP180V,@>X3囗Guݙ [,XC>@\ ?Xz@G@`$uݙ7,[7A - - w @wX Sۗ ܗ 4,fpg`i ޙ@X{զ@& %K( ̅Yg0`A0Xx(@@K!n ׈temBmXm۬V{{@ ``WwEBǓX!L@VƗ~$Q (n`ePvtrDpwtrDxt(r*struct { F uintptr; X0 certmagic.Certificate; X1 *zap.Logger; X2 *certmagic.Config; X3 context.Context; X4 string; X5 *certmagic.Cache }*func(context.Context, string, string, *govultr.DatabaseConnectionPoolUpdateReq) (*govultr.DatabaseConnectionPool, *http.Response, error)*struct { F uintptr; X0 bool; X1 protoreflect.FieldDescriptor; X2 impl.offset; X3 reflect.StructField; X4 reflect.Type; X5 impl.Converter }*struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2responseWriter; X2 *http.Request; X3 func(http.ResponseWriter, *http.Request) } [ =` ]FS]F@JM@H2  ` / Xr  "%&s @Txy@^nef<` 4e`X`V-f`Z`8l TO&MHKSM`MKMhK`d M(K@!  MXKHgA0 wU@@8|`۝@{U@@(>D0>ؙh ?Chttn D(ttW&tмt/`Dtt-0ttDtDtd(AV `GG!ekI Į R2~Jt f(.Y!AJ h 5 `x 0`3$] l4+"|# 54$$\XRHH4- X\w@05/QHėȞP%]@ʞT6 P$P[\XT `/ X\w@ iŞι e@`6 PP((E h܌?0 @Y\w@ʞ˞z @6 8PHP(+0Y 0`\1.   2f;@f3 - < ]*go.shape.struct { Start github.com/apernet/quic-go/internal/protocol.ByteCount; End github.com/apernet/quic-go/internal/protocol.ByteCount }*struct { F uintptr; X0 func(context.Context, context.CancelFunc) (certmagic.Certificate, error); X1 context.Context; X2 context.CancelFunc }MSD [  3 @ 0(vqN(F0\8@ϙT$,Ñ-*func([]uint8, protoreflect.Value, protowire.Number, protowire.Type, impl.unmarshalOptions) (protoreflect.Value, impl.unmarshalOutput, error)*struct { F uintptr; X0 *struct { f func() go.shape.bool; once sync.Once; valid bool; p interface {}; result go.shape.bool }; X1 *[4]uintptr }*map[netip.AddrPort]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*list.List[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]]$a~* 6h*`!=E00G̘̘^FllS ЛЛ^F||_ GDD4 `_=dP Q3@` w(`Q0@8h``=dę3ƙ@)-,4D<ǽ 6h,= @!,,k~ 7v~2ԙ:D adOE\!B l XE# $LLu\,7 ~@b~dM80@(P0@,:˗0~4Q"n<X"nD$2t4 b~d`0 ˗!"o 6h~PG@` ` F@p p x0< < X @! DEU/ 6hR~PG@""F@""x0 " "X @! Dz 6h8"}}1H~~@#}}}}d#}}#84' (7b `edM(:H 0Ab4̗5祗6P17jLao]Ff]Fd< qNdT 6h`Ū]F#!$;c3QI"4 6h ]F#$OcddУУ;c3(`Z4 6hΩ]F` $mc1S h ]F /˦uIX2~I0[(om]F i]Fd[ϤIϤIΗ  p (% 6h=e]F PP### ; @@ h ]FQX3dj Y5\ 6h> ]FI$ -p>p݊L4 U ]Fk]Fd HdèHϨΗۨ$Q(O@]F@l]Fdh`͠x K0W6 !sT- DlKd5efK@ 5K 0% ^` ( HF< c KmKdefK@ 5K 0% ^` 3l<<mqHn nd&D&6 Ǫ(f0υ@Ӛ8pv1 6hHm-((dd.""q&&ӪDJDJ[= 6hJ<PNd&aa'haabb b b|a|apbpbD 6hp`b16@6`"((B |3p|3d sJ@`s ha ׬ b$4_ i@@qLd[XwJ@` t@`(A0$ K`\tqLd&3,N i 7 ) 6h@L_"74_4_m" __$_$_7__t 6hƪO&TLTLSMLL LL`LL@! $L$Lᱠԅ`KsK4GG`rݞݞa<t !1 6hit9 ,9 ,9 C = = t7 t7 L> > U!T: T: u? ? @@Hi tudfz @ @੤ ੤0dǘ 6h0`niOii-GGى" CC ?r>"@i@vi4ʟ`H)a "052GPG-G$GϮ$; 6hp# Ci-CC9Mό#.* 6h۫i 'A'A k &A&A2`%A`%A9A9A}( +9@aE@ @K@$-@(Tj 6hwPddQ> `PPF44`;zdϙ'4 ЙQE4 (0<<+wQȉ' @dFUXrG$R,`44  d[XwJ@` (A0$$  d. :Ԯz( @:H:& Y 6h9@;ĦĦ@``QhhQQРРPlY 6h Q L~O& ;VPP@wm`:G( UTo@6`dld)ĮĮqĮĮ Į R@(v 6h zg DD-n k T<@) ;;;;d(vR ,9R8;DOt5 6h O, (v++ : <--~| 6h߳Ѥp;ig*K"-hTi 6hҤp;ig*K"-ry 6h[J`Ҥp;ig*K"-q 6h~ =4040## &'0'0h .0 .0!$ 6h9p *h Ih Iq) qH0J 6hcK ٤MK` ԡKԡK 8`KK 0`\K\KV-` p>-s 6h[ s*7&b>b>!&CV>V>La>La> 6h gs 9) >>H>H> [ܝ>ܝ>0>>XDio[@d@g 9(],@04X @TQ|}QKd(@h LoKPKhK@l<@[4,j.DtQd/OLO9 (405  Qd/O0+"$ǚ,84 1d Qd/O*"bY p@(K0n 6h5 W`x 0`33] l4l4| 5 5$_ 6h5%+ 5 6䑁䑁('Y0(,Ql@P"d[͑8($40M 4QP@"d@gLa "κL$s,40! 4QQ"d@8" L>R$纙,0$+ a@["d8?\W$_a t$@(@,00 X :` "d³@)י ֙x;s$],84xeb"d8>HJ@o@ $:04,aAt 7d`"d ~s?\Pc (au@000ht_y| e"d³@)י ֙x;s$],, 0h"d?\rF@ ?%@$P@(40ۛK @i@"d]y-ؙSN@/[$;,40$9 u @mࣩ"drؙ@b$F,$MOt $Sp"dM/@C i@ =@FŸ@ps@ 40хV @.@w "dR]ySN@ $!M, 6h7 g 9N X|;&  l`LL[9V 6h;` 9\\N |;&l`0(|`<<d" ^+զ9!զ Q(Z).@,կ 6h<~֋֋ j! ֋֋d ֋ ֋= ҋ ҋ@!ՋՋ\| 6h_`Ѫ8.w*// // B//w//-'w// H- % ਩Lu4@%@@HB] 8@a7-88`7TL~2<7V  d n n nww n$0|<XHhL=U  ds3@iw$K4 nPww n\dX>7BBd`r.RC ᕗuOu00 PxX0 6h@:%p;]@P@Pq\FX.0BPBPEPEPIPIP\ f 6h s%<8O8OmOOYTOTO ܪOܪOOO!4|vh 6h% o\ZQ\ZQ\[Q[QS@H!bO\Q\QdVQVQ_1 6hk zbhQhQ5kQkQOd`Q`QbQbQ4(J!8[୩d+@Cy@M9.]@ I]$@0 6heH6ZZZZZZg!Z!ZtlUv`  d  ٝ& T`\B``>@d xh40u\5g @drp)ԙj"̞oܖ$,X< I`wdPH<S)<  < c 6hwVs{`}{9od. 6h% JwVs{`XX}{9oddYL. 6hf wK,{`?6`?6('n 84}Rp@K಩KdR] ' `K ,"4Q5B 6h6O0*EH6H666ܺ$ _if: 6higmh a aXaXa4a4a`e(Ya(Ya,@hPaPa04([a([ap⢋ 6h{ mhaa[a[a a a`et\at\a,@h(a(a04_a_aV ~ 6hyg@(mhhahat_at_a|a|a`e0`a0`a,@haa04aaaa 6hg`)m ``j! ``@!`` aRmmd@Ŭ@Ŭ,@@@{@{@R^-r?@k @mdxD೩D ]6 gttu\ m෩md 29?Ɨ{oO`) lh 6h ǓpCT@rm@rm 0`rmrm Uqmqmqmqmv;VchlsmlsmW;S 6hǓpCRUmUm 0`UmUm STmTm|Tm|Tmv;Vch@Vm@Vmgv 6h ǓpCN,am,am 0`amamN`m`m`m`mv;VchXbmXbm 6h ǓpC O}m}m 0`l~ml~m`O0}m0}m}m}mv;Vch~m~m+ 6hiǓpCO 0`|m|mO$|m$|m|m|mv;VchK 6h] ǓpC Ntwmtwm 0`,xm,xm`Nvmvmvmvmv;Vchxmxm a ۔@۔4]]m /]@ttgtXtgPtt zsH̅ ༩4!a !@ b!LÐ 6hx!rxisxis6fsfs\r\os\os!_cscs"PksPks($< 6h0`@t|r|rk@v`V@r@r@Udrdrtrr@U r rݜu 6h7@1`@t r rk@v`VDrDr@Urrt,r,r@Urr7X 6h71`@tXqXqk@v`Vqq@Uqqtqq@UHqHqq 6h72`@tlqlqk@v`Vqq@ULqLqt8q8q@Uxqxq%6 6h^`2`@t|q|qk@v`Vqq@UTqTqtqq@Uqq'0 6h_2`@tqqk@v`Vqq@Utqtqtqq@UqqV 6hp 3`@tqqk@v`Vqq@Uqqtqq@Uqqw 6h3`@tqqk@v`VTqTq@Uqqtqq@Uqq]9 6h3`@tqqk@v`VLqLq@Uqqt,q,q@Uqqܩ 6h7@4`@tqqk@v`V q q@Uqqt$q$q@UqqѨR 6h4`@tPqPqk@v`Vqq@Uqqtqq@Uqq2M 6h'_5`@tqqk@v`Vqq@Uhqhqtqq@Uqq:^ 6h1 `@tx)rx)rk@v`V<*r<*r@U`+r`+rt&r&r@U,r,r$W5Z  p @ƩddE M N@ Ǘ@5@3- ٜ> 6h0D]()Q()Q; \P(QP(Q -.Q.Q <@H -Q -QF&8+Q+Qic 6hIiǩՊ! LrSLrS D}u-4Ii@ ȩՊdK@qH5 PGO"@x 6h 9Ք`'g#"u"uTLI7V`ɩd ww$0|<XHhLH[$ʩd@ўs3pw΢$K4Pww\E @@+ʩ@+dܝ ՝ @($,h2@lp.@HDn y^ x g~@˩g~d x x6 n A%@0DHD! 2Wg~˩g~dWWX n B%@0D*struct { F uintptr; X0 *struct { f func() go.shape.*uint8; once sync.Once; valid bool; p interface {}; result go.shape.*uint8 }; X1 *[4]uintptr }*list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]]*struct { f func() go.shape.interface { Error() string }; once sync.Once; valid bool; p interface {}; result go.shape.interface { Error() string } }w g]F@Ω]F(۪!۪` $mc,,ָ̈ KΩKXGG`r_e'$a< qg|:KϩK(GG`rPa ,n HǒȐ i yi Щi(ʟ`H] 052dH H6THH-LHHϮD@Q! ЩX4൤F3@4R,4R83И<z}(I`ѩ Ih ?˵(4Ed$-;'=f@((Dҩ hG!4~`IY Y`\vk`Z`a@G JvR(;p"ҩ "h1@T. 'TT@N a` - 8?@b(uv @ө hyU{";=EWT!L@Vx6Y'@Yv;V'WxC@W(v ө hyU{";T/`D!L@Vx6Y'@Yv;V'ZxC@W$:/ $Ĝԩ$(`D&`Ξg C282g-$D292Їt6m ^- թ^-(bb@ G.*func(context.Context, string, *govultr.DatabaseAdvancedOptions) (*govultr.DatabaseAdvancedOptions, []govultr.AvailableOption, *http.Response, error)*struct { f func() (map[string]int32, map[string][2]int32); once sync.Once; valid bool; p interface {}; r1 map[string]int32; r2 map[string][2]int32 }*map.group[netip.AddrPort]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*tree.Node[go.shape.struct { Start github.com/apernet/quic-go/internal/protocol.ByteCount; End github.com/apernet/quic-go/internal/protocol.ByteCount }]$$>K ةLN -wݞ&L71_(*KةK `ra8̃܃-<n [}l WK`٩KiaH ġ-ܡPbn |l|l (@KکKia8(-Plbn u- 6 lکLuL@6@ 6@ߪ@ @] X8e7-d8 c7c( 辙@۩\ j! )2$%2|d-@d@ *2t$2 <@+ ۩\wL|@ɞc {t /%]@Ȟ6 P|P-\( ܩB >`%<` ,06|Ł]~y(* ݩ^pC RXrtqty`RrtrRttstut(utv;V@@V{Lbݩ   i(,P8 @<*func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }*bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error)@@po<_@@=pP Q3@` 0Ҟ@`(`Q0y 4, 1{IF]F]Fp@gYcH@(@# ;c`Ū$4ܴU$ e@ ]F]Fp( Wϗ(dϗ0I1,,<9Ehg xy xyp([S ,P@U Х U Х$_ (HDNr!!pR<@ X8@n B@8c<D1iE 9[/wi`i@ʟ`H O@y9052GG- ӤӤ j8UDpH='TDD̡# ppp *՘ޗ <(ߗ@4 82<XtS 0 }' qpߒU  #.T8 < P4& @& pWU( ,.V0>2 V3>4@<d:ӟp! @0lyw( , z800JltphGb} x$ט.(٘H,@@| 0`z p$3sȫ5s@ƞ (@ƞ 0B4˻5W8D<a &I[I[pD ԬxX O@ i[ ,a 8{o{5vϡt31@;;"7;;XTי #4#4p8<]84 v<?DH˝LLT$, tQp/OEdtYtAt 8 05vD u`@Qp/Ow<$S(),<0@44(t YRV"p?\/#Q@ $#,0<8y^ hD;Z"p@8 R_ $?\,w4lh  QY "p@8] doRW$ _a(_M@0 Z"p8]rHoRP'T֙|Xk(Q@X"` "p1. zT06 @u`$ 8? ,,eSn"p@J ]@(@ vN$cQ(LH$ԚI 4t"pr`N@Reٙ$F,@ a40$ Dx@"pr?\@s @F ߘ@(,@,40}!x"{ ~&~&p _@I>h hX \  @I, 0<,Q &p"@FB@+x }%@B[(@4@8Rmq- M &p[+qx+{xsT0+ @ &pw.`@"Þ—C@,C) rZ̅Q @P `&pv%@@Ơ\?WǠ7(Q p8[yU{";T!L@Vx6Y'@Yv;V'[xC@W0c  @  pA @9|Ǟ vǞɿ $`,{-s{  Y| @ ps;.ǞCǞ},@Z\& };r d .k,JN%.\JN6.JN .6TLNJN CP@@%%p=z DEH77X.@ƞ4!<✗@ƞHCtB( @ pf>{p`g>@[ `x/@,,clN)X! ffp1x( h2@)@ *$IR(nK- 3`Ǔp>ػƗyO`*6@Ǔp!L@V8CC ,; Hbd wT|ќ$$ L @p4kd@p#i pp3^p ǗD w@U -@p@@Ŭ `n`M@. |(\, `XX?t@pD@ŬǗǗ|z|z,W^8@`^~PN `ũT(%{0 0p\12F.   ;@f3 - < ]44F`  p>/V@ #y&V,g-Q044i(tp>/V@ #yGV,g-Q 0*struct { F uintptr; X0 *zap.Logger; X1 *certmagic.Config; X2 string; X3 certmagic.Certificate; X4 func(); X5 bool; X6 func() (certmagic.Certificate, error) }*[]bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*struct { F uintptr; X0 []*net.TCPAddr; X1 []*net.TCPAddr; X2 *tfo.Dialer; X3 string; X4 *net.TCPAddr; X5 []uint8; X6 chan tfo.dialResult; X7 chan struct {} }*interface { RegisterEnum(protoreflect.EnumType) error; RegisterExtension(protoreflect.ExtensionType) error; RegisterMessage(protoreflect.MessageType) error }*struct { F uintptr; X0 func() go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }; X1 *[3]uintptr }*struct { F uintptr; X0 func() go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }; X1 *[4]uintptr }*struct { F uintptr; X0 func(context.Context, string, string, syscall.RawConn) error; X1 func(string, string, syscall.RawConn) error; X2 *tfo.Dialer; X3 *bool }\u 6h#!q*q*E `N*`N*))Ia N*N* q*q*}P*P*V 6h ~Fr!r!-r!r!80`!`!(s!(s!@0` p!p!F 6h{`~F88-TT80tttt@0` @@Fk&C 6h<۪]F$#IwcU, 6h4`]Fn  ``v $ 7$&$$ XXh** 6hT`E*sSMMM ] MM!}@MM h-$M$M`MM< 6hgxyklK`lK`lP`lP`w |:`|:`fG`G`'hD`D`lI`lI`;h <=`<=`t 6hs@% *` *DhDh& *, *3& *r& * g g *hhߪ} 6hAG!uu4~LuLu`IuuY`uuvk`LuLuZ`uuG Juu۵ 6huO&KKSMLL lKlK`xKxK@! KK!I' 6hΩKa<<oodrdr-~~n PnPn.`@@(uss(:[ 6h إKaȌȌ  -$$n $$.`(uԘV 6hi Ka-n ЩЩ.`titi(uܥ 6hB@i 052@G@GD-dGdG î GGϮ"  6h M`i9O%`@!LEDLED)Mh Z ~vG  i4iB@yg',`|GC` 8Gt@G,C`xGC 6hmDUi߰ F F  EE1EEEEFFEEo\E\ENY 6hCieDeD1'OjDjD&>$oD$oDk Ԙ2 6hhiM FFEFF[FF kcuM@ 6h{i052,$H,$H @@[ @ @-P%HP%H î %H%HϮRM 6h|i% Q@@@@k60X@0X@yyHN@HN@O&uE \@\@^&lA@lA@F@F@k 6hmܪi% QxGxGk6GGyyO&uE @G@G^&S 6h2 i052"H"H @@[(@(@-(#H(#H î #H#HϮ 6ho'ܲܲ'88W``_҄A`Z 6h)@Ť yB`  w 6h)  ̩ ̩  yB#   $ 6hQŤyB & 6h R @ @ yB& 4(PSI  FEd4E@Ŭ  5 {"$0kcO 6h{ ФyB$$ S^b 6h#pNU!.K1UHH/: 6hZ?&ttT* _ mDttj! ptpt-XtXtLL 6hߤFU F H SS) =W SS 6h/`(`dXdX0 +XX1lXlX0X0X1GXX@G`X`XXXF# 6h >SorVV[T-_HHkH5? 6h&I[ss<<<<<<s(<(<sl<l<y 6h\ Q@Myy-,y,yM[yy yy)2`yy~j 6h`Q@MXyXy-hyhyM[yy yy)2`|y|y9 6h'Q@Myy-yyM[yy yy)2`yy 6hu Q@M̽y̽y-ܽyܽyM[\y\y pypy)2`yyӟ 6h:Q@Myy-,y,yM[yy yy)2`\y\y@m 6h@5Q@M y y-,y,yM[yy \y\y)2`yy`h 6hW<Q@Myy-LyLyM[\y\y (y(y)2`lylyn 6hO5@Q@Myy-yyM[ԲyԲy yy)2`$y$yM%u 6hQ@Myy-yyM[lyly xyxy)2``y`y0\ 0i] = 'dn @` )a(0,+|/. 6hy]@&+7vS# 6h'"@@_1. @_@ 8?_捲 6h,"1@. MMLL Ki^8?T!U 6h{ lLuGy8c` `p7p7  n7n7 l7l7s 6h$ 66L;L;6;;$[omw;;% 6hl&6`*d*d6 0d0d F[y- 8d 8d*d*d00 _kWq,&d@@8 "@>@ߦq(ߦ R@ߦ( .: 6hW a #w#@i@ikGii-ii&n @U2 6hdk%.6. .6TLNTLN C-T 6h[ f@EQEQ#bCQCQc\BQ\BQ;`[?Q?Q/< NQNQ܍HHk@D ^ /\wd ėʞDiŞ EH77-!^D@8 6h' vwh+w+`Co(<2X,,~. 6h, 'K,hDj! V 6h] ǓpC RDZmDZmy`RZmZm 0`[m[mRYmYmYmYmv;Vch \m \m! 6h- Ǔ 0`=m=m Qm(>mQ=m=m6Q=m=mv;Vch 6hN Ǔ PC`PP0Mm0MmMmMmv;V-chMmMmk- 6hT`@tqqk@v`Vrr@U r rttqtq@U( r( r> 6h 6d%A=u=up; <,u<,u  ( 6h(@ x! W0j!>8? 6hx_@ x! W0j!>8?*bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*[]struct { key netip.AddrPort; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]] }*[8]struct { key netip.AddrPort; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]] }*[]bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]hk(@&< xG!XX1KLH@L Kb`@!UHK+(&= x""@LHL1#bb11@I?(uDc@> cxg;;G!E׻ .X= `Y`vk`Z`i.@!.l#(/S@ ? x\Y2a.   ;e3 @a2a <Y]e#tY?(`]ݞ?\ t>sn Xt>ssDt>s*bbr.WindowedFilter[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]4,U,`a A |.%ɗ CkTkզ2! `."2ɗ$g($$cPA |.@.@!@  !@0.H`(֞ h`ʳӸp5-B | `rɗ !!/,LE@X-\ GK(0 @e`C e|ʗ5"<"C"$J"0@ =~̅Opl]F D ]F|;$ţB$ţI$'H39Η FΗP$ϝ 88'@*sD *s|@Цї \M їug$ @,%u049hT` *sE*seSMHMHM ] MM!}@MM h-MMp J` L`F L|җﬗn2 @q0`d)tth7Xo  (A  GLN@H@YcSiL-xLL@LF7q"` !G !|8_!'@\ O`n Bh@ nMg*  iHiL"`-"-X.i052GL{@-G{@Ϯ|@(H9~pi`I i| :1fOoOഝ 8xO8 XX鐹PNi J i|E { 4 8<`rDALP1`8ThhN19@}J |+ G@`ؗ@`X7$(`0(:`dPP,5 @ K |v%`U0:8:1ٗ@pQU(>(U0 8 @P VHDDg7C?0ұ@@`L @|`:GG : Em N@4a8<@0vA`H? M H?|j3` S<@"@ 9S$}@(+,}.(`ko+M +|Z )@S\ )g uo$+%<&@0*ppdKN |  $C) (<؞,0o4T8"< /-cp`O p|<@ =@ ݗݗ@TӘo44M /@W P |% 9 =x=x .@$=(*Q0 - 2P q|5*L3L}%ef""88HQ |y@ /~t  [' 4&`d(g,9K4TP!@ `<`R | %2 ~|` ԙ`~$٘(420C2<U@HWP88HD S |y@ /~t  [' 4&`d(g,9K4WM&tIPcS c|BX`՗@`P#`̣X3`r\ZdM@l0X@pWt6`p|880|I[T I[|05 9ܘQ85@# (PP0ːl g`UgLn4ЩPD "}4*Rzv*W*<4cK)ýA V Q|/O"Ͻ`۽$us(5w0$$PC V |.@.@!@  =!@0.H`( ttt8LuW Lu|>8I`9: `<('@(>lPUlpDƁĆ{ `X |' 0`cV@ @ `@$@( n,ww n8<4w Y> Y | E@ @\@2@~U(40@84 ()  Y  |Qzwh?`~Ş X.@ƞ( 0M1'23ll{A8ͅ` Z  |N~`=4dŞ<+ŞDN@`L:Tx@Xz\6@d0A.w`[ w|j3? S̞<@"@ 9S$}@(+,}.SgM2 \ Ǔ|xC ]ΞIT~Z,y 4 Pylq 44JwH/\ |`8ࠠD Ǘ`֜ #Ǘ/Ǘr$;Ǘ@r(?r,GǗ@T0@m|(0] 0|%ġi@A- ę@ƞ@ƞA@ƞ$*@ƞ,4@ƞ8DĆ{`^ |'ܜߛ 0`ڜcV@ @ `@$@(,ww8*struct { F uintptr; X0 *[]uint8; X1 protoreflect.FieldDescriptor; X2 *error; X3 proto.MarshalOptions; X4 protoreflect.FieldDescriptor; X5 protoreflect.FieldDescriptor }*bbr.WindowedFilter[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*func([]ackhandler.Frame, []ackhandler.StreamFrame, protocol.ByteCount, monotime.Time, protocol.Version) ([]ackhandler.Frame, []ackhandler.StreamFrame, protocol.ByteCount)*struct { value []uint8; multiline bool; flow_plain_allowed bool; block_plain_allowed bool; single_quoted_allowed bool; block_allowed bool; style yaml.yaml_scalar_style_t } ! |0/ a@}ggggֱl5poϡt16$sh$sh@6`"i5p|ϡtP16j"j"@4d"4d"6`"JU( h +uFE>;Χ I bR  `` $6Gd(d d yU{"S,\;cvT!L@Vh=\x6Y'@Yv;V'WxC@WC:(= e yU{"y;T!L@Vx6Y'@Yv;V'Y;Zb@ZxC@W7Z*<(w `f \Y2a.   2e;e3 @a2a <Yx(}x gxfg> g)Ab`f>{>[44?<I gǓp@D@1|@3@?@t@  $ ,]&l$ 6hG! , ,ek`0,0,o,,~,,,, !,,,,f 6h ~`F=!=!-=!=!80$`!$`!@!@!@0` `!`!Fd 6h~`F!!-!!80#!#!!!@0` $!$!F 6h~HQna|| [!aQr 6h%G!<`<`4~X`X`X__3t`t`Y```vk`$!`$!`Z`"`"`@!#`#`%*` 6h 0xyG!\`\`4~]`]`XW`W`3_`_`Y`H``H``vk`a`a`Z` c` c`@!d`d`VeM 6h:t=LG!__4~__X__34_4_Y`P_P_vk`__Z`ĩ_ĩ_@!0_0_)! 6hyK ?'!SMLL#hLhL] $L$L"ԥLԥL-LL`LL6!wD0`uini4U!y7y@ OCii-GCى_^ 6hvNiD'K'jj-lGlGl8-饻 6hǪiG!d.Fd.FXX"FX"F3F3F$\2F\2F$F$F(F(Fԡ5F5FWD#ۻAP3@p4M _9P[%Q\!>^\$@'m@ 6hEz 'L݀L݀'߀߀ÀÀWpԀpԀ_΀΀҄YP@ 6hoG J3'tTtT'8W8W77j66iPl?l?88n܉' sd> 4\@\Q`R$ Иݞ0` d?wd7wBD@w:wi\k 6ho@@G!؈؈4~X  3Y`TTvk`Z`,,@!Ｄ 6h) N4  "  GG ` ` Ea .  O 3Я 6h`}e&e& f&f& _e&e&"$e&$e&  @n&@n&xi&xi&08 6h+cFE>;Χ I R  ` $ 6h1}PFE<EESDIDIUU Ǐ 6hcQ05M||-zzzzL@8[ d,|d,|zz)`2X\u{\u{ 6htQ05M||-\}z\}zL@8[ ,|,|zz)`2Xv{v{U 6h6 kQ05M||-`;z`;zL@8[ d-|d-|zz)`2Xhw{hw{BŤ- 6ho NQ05M||-zzL@8[ .|.|zz)`2Xy{y{&N 6ht@Q05M||-pzpzL@8[ .|.|0z0z)`2X<{{<{{ 6hWkQ05M, |, |-yyL@8[ J|J|&{&{)`2X{{P 6 6h{Q05M||-4y4yL@8[ ||$z$z)`2X@{@{YY 6h5Q05M||-pTzpTzL@8[ /|/|PzPz)`2X{{$ 6hbNQ05M | |-X zX zL@8[ 1|1|zz)`2X\{\{7 6hY OQ05M4|4|-$Mz$MzL@8[ 1|1| z z)`2X{{U{ 6htOQ05MH|H|-tztzL@8[ p2|p2|zz)`2X{{# 6ht PQ05M\|\|-vzvzL@8[ 3|3|zz)`2X{{H 6ht`Q05Mp|p|->z>zL@8[ 3|3|4z4z)`2X|{|{[MG 6h#YPQ05M||-xzxzL@8[ 4|4|,z,z)`2X{{p 6h,Y`Q05M||-zzL@8[ 4|4|zz)`2X{{{ 6h5YQ05M||- z zL@8[ 5|5|zz)`2Xp{p{?9 6h>Y Q05M||-4 z4 zL@8[ d6|d6|zz)`2XL{L{.KG[ 6hGYQ05M||-zzL@8[ 07|07|XzXz)`2X({({R% 6h QQ05M||-lzlzL@8[ 7|7|(z(z)`2X{{ p 6hPYQ05M||-xzxzL@8[ 9|9|xzxz)`2X{{! 6hYYQQ05M||- z zL@8[ 9|9|HzHz)`2Xp{p{ ңt 6hQ05M$|$|-1z1zL@8[ :|:|zz)`2Xd{d{ң 6hu RQ05M8|8|-rzrzL@8[ ;|;||>|HzHz)`2X{{ @ 6hxRQ05M||-lHzlHzL@8[ IzIzzz)`2X{{& 6h… #Q05M||-l_zl_zL@8[ >|>|zz)`2X { {] 6hQ05M||-zzL@8[ t?|t?|zz)`2X{{A 6h u@Q05M||-0|0|L@8[ H|H|zz)`2X4{4{1q 6hӅ Q05M||-LzLzL@8[ @|@|$z$z)`2X̾{̾{uY 6huQ05M(|(|-zzL@8[ @|@|zz)`2X{{aT 6h}Y lQ05M<|<|-9z9zL@8[ A|A|lzlz)`2Xx{x{\ 6h aQ05Md|d|-XzXzL@8[ DC|DC|\{\{)`2X { {I% 6hY SQ05Mx|x|-zzL@8[ D|D|l{l{)`2X{{ 6hYSQ05M||-8z8zL@8[ LF|LF|4{4{)`2X{{a 6h̪Q05M | |-XyXyL@8[ O|O|x7{x7{)`2X|| e 6huQ05M||-zzL@8[ G|G|<{<{)`2X{{Xr¡ 6hu@Q05M||-.z.zL@8[ H|H|` {` {)`2X8{8{Y 6hu bQ05M | |-0z0zL@8[ pI|pI| 6h9u" 7d3d3+.. 7 )/7  ::E 6hO("1. 44@DD@ @8?T@`Ha 6h."@T;S1@. @$t@(6 P\P Zf_ 6hன  L[ m9 6h1\B ցց\\D"Wjyf76#ȁȁDQ 6h`L}zRzR ,{R,{R _$zR$zR"4zR4zR  ȃRȃR~R~RN 6ho]1]@iigP jP j|cX6giiiiHS 6hIhSǓyU7l7l{"$8l$8l;P8lP8lT6l6lx6Y8l8l'@Y7l7lv;VxC@W88l88lz? 6hǓ 0`h@mh@mS>m>m6 T8?m8?m>m>mv;Vch@m@mgj 6h5^`%"^^;t;tn @U!^ch bnbnG@ 6h`]0<Q<QxS_ j! QQ :-T { 6hI`8Պ7]z\@]z\^|\TwSTwS^|\}C^ 6h*@`W .@He@~@.Cc@00$/ 6hlC!_{.lvIj#m 6hlC!_{.lv" 6hE `zx! & "Y"YMOhYh V8 6h zx! & "Y"YMOhYh`.  6h h `zx! & 8#Y8#YM.Oh.Yh- *bbr.RingBuffer[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]]H@ l0Cª 3E X.I_+!~I: ,0<0(CU܆qc`ê PE@Į#@&Į )Į,ĮĮĮ<Į L`$iDFwe Ī e Ayݞ u e 7 |ף}~u``ʗLL\d0p`.~Ī ~flr x@~{@$g`(,< NH `f]FŪ]F(#£##!$;c3QI"`Kު o@]F`ƪ ]F ͗@͂ +#͝7 Ν<cϤ\((.r ǪX\@Ц3@` "b$SML LL %@]@Ʋ@]s@ ( ^$d0 4HDd tyi Ъ "@5S> ]y-ؙ³$S,N@4KS8-@ddv0=\9 Ъ  jj ࠜ,j8D P.`X`r\<8f;C_Ѫ 8.<>"@ @@@:s+`ܝ Y@(@,@04H<t!  `Ҫ `? nww nsu  A,58+D+@E+@FD0k L & Ӫ &8\@$@(,@8@<3@L(Fr\^@Ӫ  'E<D@ŬƗ {$L4h2M8^<^@DJHSǗIH<|N/ Ԫ OwwsОu  A,58+ОD+@E+@FPPƬ `ժ  N+Ş"N`c7 0 7,!4җ<,@)A`-D!iHPP徚b  ֪  N+Ş"Nc7 0 7,!4җ<,`@)A`-D!iHPP>^3֪  N+Ş"N d7 0 7,!4җ<,@)A`-D!iH*struct { pairs_data []yaml.yaml_node_pair_t; pairs_start *yaml.yaml_node_pair_t; pairs_end *yaml.yaml_node_pair_t; pairs_top *yaml.yaml_node_pair_t; style yaml.yaml_mapping_style_t }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point] }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point] }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point] }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point] }*func(monotime.Time, protocol.PacketNumber, protocol.PacketNumber, []ackhandler.StreamFrame, []ackhandler.Frame, protocol.EncryptionLevel, protocol.ECN, protocol.ByteCount, bool, bool))Ih <]Fܪ]FG$#IwcqE9hm`iܪi:% Q^@^@k68G8GyyO&uE GG^&*struct { f func() (go.shape.map[string]int32, go.shape.map[string][2]int32); once sync.Once; valid bool; p interface {}; r1 go.shape.map[string]int32; r2 go.shape.map[string][2]int32 }w h $K Vf+1x1f7KaDs(&| ߪ x!@^?\Uc^6Uw@VkG\UDyU@_!_"Vo_`{ WxbP+ ߪ\wp05/QHėȞPh?`TaȞ`h%]l}t6 PP*struct { Code int "json:\"code\""; Message string "json:\"message\""; ErrorChain []struct { Code int "json:\"code\""; Message string "json:\"message\"" } "json:\"error_chain,omitempty\"" }*struct { F uintptr; X0 *struct { f func() go.shape.interface { Error() string }; once sync.Once; valid bool; p interface {}; result go.shape.interface { Error() string } }; X1 *[4]uintptr }*[]struct { Code int "json:\"code\""; Message string "json:\"message\""; ErrorChain []struct { Code int "json:\"code\""; Message string "json:\"message\"" } "json:\"error_chain,omitempty\"" }*struct { F uintptr; X0 *func(go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer }); X1 *go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer }; X2 *[11]uintptr }pp+9   jj @,j8DP \. d`rh\TXq$mf OE0.ݞզ$`$,ݞ<EզD #L|P,$2X;` PQB$@ Į`ɤ. PD/``hTF P~ W>j  6hsnث~ G!` 4~X3Y`vk`Z`@!XT4  ]F ]Foe稗zΗ Η(0e8e@H)HPX Β4 J ]Fp ϗϗ q(9H0]Ř8e@ibHPl 6h$ުK Vf+1x1f7KaHD2usmhP p7x7&ӥM$h,ˬ-h0h8җ@?2 6hL G!@ @ K XX@ X@ 9 C LU!u%X 6hvi x052GG p@p@[@@D-GG î dGdGϮ88) ` i#C@@@$@ BE@@v@`ԗ@` 6@`(00#4H 6h`i G!BHBH4~CHCHXEHEH3 M(:DDQ@ˆˆr@s@j@`̈`̈,s 6h' `@@ .@Hv ȶȶ~@AA. C CC8D8Dc@EEȉlD '4\(LkĮnĮ `@@.@H~@A\A. CBC8DCc@EDb*8 6h"{ M Q ӳ ||: <DDpPPd,,m``߳\\ 6)l   ^ @ n- ;ȗ 6 @؞v-7}+$ 6hwV 9Tk  LLCmJt4 %n @Ѥo RT(Aݗ,'4p6<z#@hЗ`YH 6h= Z ?&$t$tQ#(?0_ mDttj! tt-tt@ 6hW  ?&ttVW _ mDttj! tt-ttx9X 6hH`Q @V@VWԷVԷV4VVWwY 6hlt@ 1 TTeN@ITT T T?XSXS9N@I'SSYXTXTSS($_~c lPTc c 9v0X@ 3 ۧM@9X 7g_  2$%%#&! 6hIPSc  K [ [ *[[ G[[*T[T[ Z `[[Ov9[h 6h]! ~luluN uuj! uud|u|u=uul`uu@!dudu{suu+$lu 6h9\OQ 05MXxXx-hxhxL@8[ pxpxxx)`2XxxkXX4 < Qaj@@+. p   ݘ *@D@aЉn E` QtY X:j F@`@`՗@`$W@`,kQ4 8Y]@PPc$sU@ ""@s9L@.l%֙$(t4Bt@ktL@8T86u  "%@]@ Ʋ@%@k @]s> @(Җ, 4@8 <u "@X O@]@Ʋ@%@ k @$]s(>, 4DD\_@8. 8.!@#@@B@vOw @,Yw@0 [47 <`@88+SK9Y   + MQ[i9@Ŭ`@Ŭz$_%@(k@,w@0w4 hp<g`  &w.H7",[aaJy Ы 6h` (a@SN@SN&j!V&k|`ڕ8?SNSNA} 6hY:% p;]DODO̜0OO'OO <לF)|O|OWE0  @  L`X ٝ+I+@At@"@!x@")B`O 6h@N 9~p[p[ N [[j! ZZd\[\[=pZpZl`]]@!YYf 6hCǓ 3`TpC N`fm`fmyTgmgm?`T 0`gmgm`Nememememv;Vch -H!iLTT2p$ `@  N @+Ş"N c $,,!4 <,`D> -H!iLTT;xr`3   N @+Ş"Nc $,,!4 <,D> -H!iL*interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) } K|`k%( P7 G!<``4~X``3t``Y```vk`$!`p `Z`"`!`@!#`H#`s1(IK aNɭG!(uu4~Luu`IuuY`uuvk`huuZ`,uLuG Juu @̈c|os@( P7 G!؈L4~h3Y`Tvk` Z`,x@!䏆 . (@=`( G!}Y(}Y4~~YD~Y`IY`YY`Y܀Yvk`YHYZ`hYYG J܅Y Y Y @XYGbᕗnIZ 6@fG!rYrY*`tY sYvk`XvYuY| wYwY( m" "]6@9^@l6 '  I^Tߝ{61>a 6 w6aY^ (Zb8S(NS@  o[\[@@H! \ע`,  o/x-<`\d[<@I[z\;_ MH - <@H VL]iPʗPV9â GN 4% F#] d%>#-%0I#h8Y#9hb`7]z\@]z\\\+r9heRb`7]z\@]z\\\B)' (* \(L` W .@He@~@h.C0c@0|*interface { FindDescriptorByName(protoreflect.FullName) (protoreflect.Descriptor, error); FindFileByPath(string) (protoreflect.FileDescriptor, error); RegisterFile(protoreflect.FileDescriptor) error }$#B  -y}@ ^`aEjE@_@sE`.Afj|Ewj8 d` , j~ ~ F@`a@4~n$j@`(@`0bn /8a@3P0`TPG`JXE@\˗`hTݏZl]F ]F2h82@`͠H2`͠L"`͠PITU#@XI@\2@`b\4  ]F ]FNe3e G(0p8pӝ@Y`GhGӝp|(Y@  /t/E! 0T!&ƈ g`0t0Qǭ%_%m&{c!LLP܈!! !UKӗs$"(@Ŭ4`<i=1@@88DN,HD@.̉z`"p>JFc4 3$U,P:൤4@ % Z,[VyU\Y{";yXT!L@VITUx6Y'@Yv;V'@XyXfXxC@Wjb(g&GG!ekI V= ^2 /e=`^2`/q ^Y / ^ /Į R2~Jt f(.Yxp '(' Ǔ!L@V/L}~ Ɨ ~,C-Q 0Xn`e`)>)`X@)X@)Q;]J 6hpĪ~ G!  4~| | X 3 Y` vk`( ( Z`  @!  U!   6h F`B}  1n(1101 bh( lxy`0xy4 Vk& G!\`@\`4~]`\]`3_`x^`Y`H``_`vk`a`a`Z` c`lb`@!d`c`Fk 6hs` G!(u(u4~LuLu`IuuY`uu\tutuvk`huhuDuuZ`,u,ua@TuTuG Juuuh 6hw`i m" DD $D$D DDjIdtDdtDjrDrD`"E`"E|D|DR'HEHEjDDDDG9{ 6hDi ok&TDTDVDVD:!F @ : \\H 6hIQ M?] 999~\G\G N L9L9j! EEd,G,G=JJl`AA@!lGlGmLL 6ho dl `.@H~@x x .  C22c@x0x0ppiQd'd'  ( 6hՎ@¤ x! ƗyB.`   ]!   6h9S 9P"P"~ܹ"ܹ" N ""j! \"\"d̹"̹"=""l`t"t"@!""m""7!h 6hQϤ &yBp& &S&h p:pd@xxG8 6h@ x!UM4-r4-r6`MkG2r2r,r,r\Muy@U 2r 2r!U/r/r"Mh.rh.r#3r3r*struct { Success bool "json:\"success\""; Error struct { Code int "json:\"code\""; Type string "json:\"type\"" } "json:\"error\""; EABKID string "json:\"eab_kid\""; EABHMACKey string "json:\"eab_hmac_key\"" }{' 6h|{ x! && NN5OhYh 5J* 6h x! && PNPN5OhYh m"  d >O(֕`z˻FiYiYW`hlYjYj!loYnY<.pYpY!@IpYpYF*lru.Cache[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*fips140cache.Cache[go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int },go.shape.struct { crypto/internal/fips140/ecdsa.pub crypto/internal/fips140/ecdsa.PublicKey; crypto/internal/fips140/ecdsa.d []uint8 }]TH#nL`@R =Uo 8/$ę,ę4烙8G`<}HaI@L@Pdd&xPh`S `rɗ ! !KF_~@/, T`(X / @]F@T ]F1#hn8# I?#@2 YFbO͗ _$<8oG")G@ ]F U ]F03?d@c /f"2Id  $$ $$$,834(8PP5\(mDiV i/`Na#G!$H(05 .4O .8ǰ<%@HӰ`6L*_9hwV  9Tk  KWqċQWQL tYkQ I]G!4~3Y`vk`Z`XP$(nX "rsJ F(@0@4@8vN<]@SQH@Lh`IΩ oY "rMr K (ؙ0ǝ8R@FHuPقTy%\TV$# `Z &w.Jx6'%H7—a———U|$a@ @[ &w.xJ%H7——a—6'TT9zЌ. \  !ȞddŞ+Ş Ş$,4<<WD6@LP8j1 B ] B +X7ݞ@` @`i{@YfJ $Cŗཡ(L@,Y04Oŗ8[ŗD*simplelru.LRU[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*struct { F uintptr; X0 *unique.canonMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; X1 uintptr; X2 weak.Pointer[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; X3 *[52]uintptr }}] Ho !%(3#A#EL(4#%NL(-PKb5(W`- `a @ @@#w#@iPikGi,i-iȭi&n @UjpgǓ yU(mxm{"mlm;4mmTmm/`Dmm!L@Vx6YTm\m'@YmLmv;V'Z\mmxC@Wm|mrgNĤ  cp*LD  S7a` 0mFI;Em*internal.LruList[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*map[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]*list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]]-=% 6hP"= f->>0.0.^\*\*9$,$,iyIBYB ^55u7e 6hm@ 4 x-x-E . (-(-E''ED'D'''(. +)C <'<'M 6h9 x! ƗyB.`]! Fh'h' 6hP S x+x+lt+t+++t+t+~++l++++`\+\+` + +++M~;+ 6h]P 9â GN 4%4%] d%d%-%%l`G#G#`?#?#hL@#L@# 6hID ,P xF)#)#Zc=$.#$.# `j`; # #[h #h #nș 6h.@~ h. !!!!^@!@!G!!!HT!T!Y``!`!a@!!0.!.!m"Dｶ 6hOpC]F J JJJ HH!YG CC@3 D D,tEtE$GG$:Y 6hț`K     j!   -@!*544ܢܢ@  ixJy 6h,q ȥK ppXX1KQfLL9`@((j!Lȩȩd#ĤĤHHkG`XX{ǔ 6hH@` !%(3#A#EL(4#%NL(-Kb5f 6h~ Ii XlDlD DDYM hDhDj ̖D̖D( DDb 0D0DeC - DD2 DD 6h i M\@\@$Ȣ@Ȣ@052GG`'fO@@-GGn @@ î GGϮ7QoA 6hw`i )N  K  #A #A,!A,!AAAXAA@!hAhAw 9NAAj{ A A=f 6h($ CCXCCX1KQfhEhE9`@DGDGj! LHHd#CCdFdFkG`JJ 6hP ɪ' `FF .@Hv ~@U/ 6hyK _m{`'&'&!\(&\(&! )& )&ɒ ")&)&-*&*&x=`"L+&L+&="+&+&;",&,&Y| 6hx _m{`-&-&!`.&`.&!/&/&ɒ "/&/&-0&0&x=`"P1&P1&="2&2&;"2&2&լ 6h4rԫ 4Ju i/'(>(>`>>j!d$>$>@!>>*5>>@[ 6h[<`+" 1@T. ,G,G'TTdDD->>fr 6h]'0 ?L6L6<7<7P 6 6ʺ77c?6666# X6X6pD$ a 66r` 6h f G! bb -D bb4 Mbb, b bƞHbHbgE . C7 6hgbǓ yU(m(m{"mm;4m4mTmm/`Dmm!L@Vx6YTmTm'@Ymmv;V'Z\m\mxC@WmmNʁ 6h7 )  VX``VX[rX[r@UZrZrb_\r\r\V@UZrZrh |r|r yryrch \r\rx 6hT `;dl `SS.@H~@SS.XTXTCQQc@XRXR~QQull? 6hT ;dl `OO.@H~@XPXP.PPCHNHNc@NN~MMull?4 6h U <dl `@L@L.@H~@LL.MMCJJc@KK~8J8Jull?SN 6h X <dl `xVxV.@H~@(W(W.WWCUUc@UU~pTpTull? 6hv  % -\Y\YN&(im= 6hƬ ժ  K  BCK -P-4h ?A  6hb ժ  K  BCK -P-4h ?A  .Ks 6hc Bg~ X.Vԇq1/cch  6h8' "WWErMWϕ1c+W  X*struct { F uintptr; X0 *struct { f func() (go.shape.map[string]int32, go.shape.map[string][2]int32); once sync.Once; valid bool; p interface {}; r1 go.shape.map[string]int32; r2 go.shape.map[string][2]int32 }; X1 *[5]uintptr }*simplelru.EvictCallback[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]B3 F@/B}B} ( 1n10188IX4G]F]FP`͠ĚĚz@ ΗΗ- Sd$H%I&.Ě(]dĚ,gdĚ0 @ţ4pp4ԇ4]F]F(P`͠f"2GϤ 4[?ŘSp@$XDŽ ӝ`cޞd_hk`ltltP?{٘H$ؘ,( ,U'48j'`<@$DosEP<OIbdiZ7cc:Ԯ6`p?s "N yZĤb)Ĥw)Ĥ ۘ2$Z (Is@E,@0W4 @hda7+ e"?a3 9%֙L $@<,^48u<HT ŸX՟@\<`\\b"(r"?a9<@p q$r=(ٙq4*8<Ÿ@@HT1ٙXldB[,yr"S?a9\ { ( 08<@DpHU@rL?Pr=TǠ@` ,4 &w.J%H7"6'x—a———6h(3v  Z,[T|`Sw@[V8[yU{"K;yXTC\!L@Vx6Y'@Yv;V'@\\;Zb@[xC@WhhW}H;wH  }@ƞwė@ƞ8=@ƞ E@ƞ @ƞ(G=@ƞ0w@ƞ8Z@ƞ@u41HieL@ƞTsȫ\6@`*go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }*map.group[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]*list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]]*struct { f func() go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts); once sync.Once; valid bool; p interface {}; result go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts) }*struct { F uintptr; X0 *func(go.shape.struct { internal/poll.rfd int; internal/poll.wfd int; internal/poll.data int }); X1 *go.shape.struct { internal/poll.rfd int; internal/poll.wfd int; internal/poll.data int }; X2 *[11]uintptr }*struct { Strict bool "mapstructure:\"strict\""; IPv4 []string "mapstructure:\"ipv4\""; IPv6 []string "mapstructure:\"ipv6\""; IPv4Exclude []string "mapstructure:\"ipv4Exclude\""; IPv6Exclude []string "mapstructure:\"ipv6Exclude\"" }*go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899 }*[]go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899 }9)l yKx _m{`'&<%!\(&%! )& %ɒ ")&d%-*& %x=`"L+&%="+&|%;",&%)rl xy _m{`-&%!`.&%!/&%ɒ "/&0%-0&%x=`"P1&X%="2&H%;"2&\%*go.shape.interface { Close() error; LocalAddr() net.Addr; Read([]uint8) (int, error); RemoteAddr() net.Addr; SetDeadline(time.Time) error; SetReadDeadline(time.Time) error; SetWriteDeadline(time.Time) error; Write([]uint8) (int, error) }*struct { f func() go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool }; once sync.Once; valid bool; p interface {}; result go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool } }*struct { key go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]] }lW 6h 0~ h. {!{!Ǥ^~!~!G!`}!`}!HY`!!@a@z!z!0h!h!m"D!D!D\Tɓ|@E ~ଫ~G0 "@G@`Ga@$0().,8"@@GTX0YGZQa['F 6hnͫB} ^9âabGkGTTN dUdU] \V\V<-TWTWl`44`88,5I8 iF ]F஫]FŁ EcHI@@͗ @2ZIb (@$82(@)ഝ*>+40 7o]F௫]F@yݞ cIlI@@LP@ #$;(c@,T01P22͗3<4Wk9G2]Fఫ]F3`Ϥ!33I 3A ޞ yݞ$$,Xm0!d4Ϥ8_ti౫i 4̘@8=.x052lGG HH[HdHD-LHH î  HHϮHH_Y`ziಫi7y٭:໮Xv # .[ .j0@$|՗(g)՗*YN,s4w<x'Dw 6h Gi E ??d?d?D"Ĉ?Ĉ?Wj&aB?B?f?f?k|?|?(@?@?EY< 6h` . ~~9`~~Kl@ ``~`~Sؓ~ؓ~4 ~~@S~~ S~~-~~ . p~p~Pg@|~|~aY 6hVz ''u+jHH'gz$$ :@xz@OlP ණ   HFN`PKٗX'm~`ฤh)t@xnP@`k( җ K\(vXٗj} 6hQ 9""~X"X" Sl##N ""j! @"@"dH"H"=@"@"l``"`"@!h"h"m""m4#4#|t5H/ห Si n$n0*<GHTS\'d_p-hc*\;YE+ 6h)פq  yB###N pKpK -KK   ` K K9N 6h Rؤq yB&&&N KK - K K `Z?j@6`pDLHs.xt`ccx 7@` 5`O@aX7`p a(XW4%@3<TX@D/H< 6h ̪Q 05M||p-TEzTEz\x/L@8[ ,E|,E|{{)`@ 2Xl{l{ 6h)uQ 05M||p-`|`|\x/L@8[ x|x|{{)`@ 2X{{3 6hWQ G!4~XfxfxSx`xx`x50bx0bx3Y`vk`Z`@!tkxtkxo8ixix tp0ţ ^ī"?a3 9 %֙(L08@<@8uHT` Ÿd՟@h<l ( 6hW(" 1. X X zT  06 @u`$ 8? tlQz`9A ƫ E̿}ȗIOq ((B4 @L}X d h@T 6h7B G!heheL4~eeee3XeXeY`ЈeЈevk`eeZ`ee9y#0e0eW`̅e̅e 6h90  c!4!1!`?!@O@O3ZOOh} OOu<)OOc)!OOZtOtOY2 6h7~ D  \17Q7Q2F:Q:Q.6Q6Q  ,8Q,8Q $9Q$9Q;@f8Q8Q37Q7Q -9Q9Q < ]$6Q$6QTR 6h25@Nf G!@<@<X<<j! ==K{  = =ߝ ==/ d]==c <<`*==U{== t<t<<<<*[]struct { key go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]] }*[8]struct { key go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]] }FnB}ͫB} (x^9âapbGkGT\N dUx] \V<-TWw Ϋ *sk`E6_o}ؚ} ګF6xBѻ ^]&?M+BM/0RM`wBQ(bhϫZ  /t/K)E! 0T!&ƈ g`0t0C`tQǭ%_%m&{c!P+xTt Ы73Kgl !ϙ@$[(^o,4@<p@PgdN*acl.compiledRule[go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }]*map[acl.matchResultCacheKey]*internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]\\EBӫ PT)Ϙ l SP`lH(挗4!'`<:DP LX7T@Xn̢}rBY9h4rzԫ 7v4Ju i/'>>`@>@>j!d > >@!<><>*5>>0Et:ի &|0, ""@ "@, ʎ~@$%y@(@, a Fě-*[]acl.compiledRule[go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }]*bbr.RingBuffer[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899 }]sn~ث~ @ "GG!` 4~X3Y`vk`Z`@!H#5 q٫K7%`>%`P5@E%@L%@S%@X5@ `5@$Z%@(K@,K@0h5@4p5@8f@<a%@@x5@Dd`?&Ĉ'ګA~#Jz 6(08<l۟D4& ܟH`ܟLؔܟPf&ܟTq XJ\TT@wi۫iԗ@#C $0ԗ@`v@` ԗ@`(6@`01@8͙@<˘`3@#D! ޥH!ѦLT0RD|U=ܫ= T@$ @)U@ޗ5$+ޗ, @8<)@@p@D9UHI8ޗ@LUP@@07X ݫXX`K P [ [/oKSK ۗ`Ӟ$rܘ (4,50 4Ԅ 8 L<L@)=p QޫQtPP|@8@@@@X e"(XM<*@@*DC"E*FH@G*H*IJf(r@R"߫"(T_1. 3TT @>  I T`  @-v_@ j! 8?|l6lB   c} OE^ȗn}-Uj(,E8D PB\h p-x|"&0 n  > nww ns y``$ 0 < H ThB`slu xw+@C 4E &w.JC C%H7xa———*V &w.——%H7C Cxa—J|K,  `OwwsОߛ y``ڜ$ 0 < H ThB`slu xw+О*map.group[acl.matchResultCacheKey]*internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*acl.compiledRuleSetImpl[go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }] 6h.~ G!,U ,U H_ _ 4~V V XHQ HQ 3W W Y`HW HW \\ \ vk`$Y $Y Dh^ h^ Z`[ [ @!hS hS DSaC 6h .i  41@GG"7GG@!@d`'vU!E 6hSi 47B7BƠ/' 5B5B6B6B05 4@:B@:Bvk`(B(BZ`/B/B@!xCBxCB ;B;BDBDB FBFBU!DBDB]Y0 6hi x052lGlG HH[HHY@~$D-LHLH@@ î  H HϮ 6hN pi k oBoB lBlB HnBHnBBB BB |qB|qBy WBBlhBhB(lyhBhBBBR 6h`} zdhdh o}o}-t}t}t}t}ی}}O  ` `$$,},}P}P}o}o}  TRZ 6htc G!E %A\\N )\ )\[\\j !\ !\\\) 3\3\)[1\1\7 t\t\ : 6hF   j k7 ^% Cz XZ%B&4/: 6h _9  x! ƗyB.`]! 2c(FP 6hrC  \1Q>Q;@fQ>Q < ]:Q:Qޙ 6hb 7]z\@]z\`CCD\\[ 6hL   jjAҌҌ6 l lg`A"nmmB $mmW- 6h M   ،،A996LٌLٌg`A"n4ی4یB $PڌPڌy 6hM   >>A))6@@g`A"nAAB $ A Ag 6hM   D0D0A6|1|1g`A"nh3h3B $22ߨ[ 6h5v xx  PA((CLLc"nttv) $T T yXD  ,> 6h6`,Ǔ  0`llyUmm{"0m0m;DmDmTXmXm/`Dplpl!L@Vx6Y`m`m'@Y|m|mv;V'ZllxC@Wؤmؤm&@XlXl^b 6hA@   0k0kj!sv &0k0kkk }kk1XkXk<pkpkQDkDk*struct { F uintptr; X0 *fips140cache.Cache[go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int },go.shape.struct { crypto/internal/fips140/ecdsa.pub crypto/internal/fips140/ecdsa.PublicKey; crypto/internal/fips140/ecdsa.d []uint8 }]; X1 *[16]uintptr }<1( ]i шN r!!`ӭ߭ 7`giqi {iN ܈`N`N `i!tNn @ @ c} OE^ȗn}-Uj(,8 DBP\ d-l-pXE#|d` #9` `E̿}ȗE#IO(B( 4@}LȗX \߿` $b KO PQș '$E@0&4n@%D~ݞHTFP m_Dɗ g^4 qKH`ݝh% $N(T`ݝ,d8Z@`HfPK@Xl@\5`rݝhd738Ap@*} jp(@02G@Do@X`@l[|J\o\FF>oܻ)\@; Q5@ Į߼@@(@<@PL@dȗ h\l&xn뼗^pm*struct { key acl.matchResultCacheKey; elem *internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]] }*struct { F uintptr; X0 *udpnat.Service[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]; X1 *context.Context; X2 *udpnat.conn; X3 metadata.Metadata; X4 go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }; X5 *[11]uintptr }*[]struct { key acl.matchResultCacheKey; elem *internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]] }*[8]struct { key acl.matchResultCacheKey; elem *internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]] }.MpǓyU8D>84/8/8),8,8S)8)837878w:8:8Ja 6hKffg> g)Ab`|ˆ|ˆf>{>[R 6h\J*DD[eppf>{p`g>@>@%``[ `x/@`( ?勚 4`0 4m >dDx->>f)! 6h-Ǔ 8[,l,l 0`-l-lyUtmtm{"mm;mm<,l<,lTmm!L@Vx6Ymm'@Yܭmܭmv;V'[x-lx-lxC@W8m8m&@< m< m: 6h ǓyU g)Ab`pdžpdžf>{>[} 6hNfg> g)Ab`dždžf>{>[T 6hNfg> g)Ab`dždžf>{>[J 6hA Oj[ef>{p`g>@>@%[ `x/@kոV 6hwH+0|\0|\hBMJ l\l\wy\y\Bm\m\ p\p\ K\\4Hv\Hv\)s\s\S p\ p\3L~\L~\w\\b 6h`P̗̗[ef>{p`g>@>@%藆藆[ `x/@t 6h_PѤXX[ef>{p`g>@>@%tt[ `x/@nԥ 6h]ӏ  a@ j j;hhd@9( 1h:7:8h8h( ] 6h  x! 8V C.?*%V! $r/o *struct { F uintptr; X0 *struct { f func() go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts); once sync.Once; valid bool; p interface {}; result go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts) }; X1 *[4]uintptr }~GZ̍Pe #=,cřP }ř0烙@řlt@oyř+@ę5`a-@,##H`0@$=+}ř烙@Mƙ@ř_ Tt dtu`v@`xcř 2{2 33(`Tw{`j `pvS`5 `% ^nt"&ӗϦ !@$ N(?i @3ӗ H@PYK@Tt@Xa@\@p@`/P@/|N &y(&]i шN r!!`ӭ߭ 7`giqi {iN ܈`N`N `i 0O!HDi *'`9Iߗ ՘ > Ul*>ݞ`UAq$,7K4[ Ԟ8f<Y@@5D*fips140cache.Cache[go.shape.uint8,go.shape.struct { crypto/internal/fips140/ed25519.seed [32]uint8; crypto/internal/fips140/ed25519.pub [32]uint8; crypto/internal/fips140/ed25519.s crypto/internal/fips140/edwards25519.Scalar; crypto/internal/fips140/ed25519.prefix [32]uint8 }]*go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }*struct { F uintptr; X0 *struct { f func() go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool }; once sync.Once; valid bool; p interface {}; result go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool } }; X1 *[4]uintptr }*[]go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }*struct { F uintptr; X0 *func(go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer }); X1 *go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer }; X2 *[11]uintptr }3 5ϡti  41@$C$C"7CC@!@d`'vCCU!CC40J`33 9c/cpZ>:70 uW$@,B30g;I\\I\;K\xJ\G! L\K\E׻ .Y`dM\L\vk`N\N\Z`\>"n pp$**{hAx.x.)_NN1k 6hfc ȭȭ ttj XA  .C|ΐ|ΐc`A||"n ${hA)_͐͐tcs(`>&@*Ơ@@B@x* 5$@(ݚ,蚗4[<[D LʎT\dxl,p\|h ? cǞOǞ)cǞi Ǟ qǞ (留0icǞ8݌Ǟ@HXǞL} T@XAxǞ2@+Ǟ|蹜; 6h ] @R@R >R>R-BRBRu](DR(DRIeCRCRYeFBRBRe~f7R7RP1IRIR-2]|~@I@I:Pu 6h D  1+R+R-HRHR`\1R1Ru]-R-RA ((R((RIe]d~d~Wׇ$$ DbmHoXXxHTHT1`  /*; 6hmhs_h_h}ZhZhwh&hN &<&zhzhhҝ-`h`hl`]h]hMHYhHYhU1 6hi""@LHL1QYԅHԅH#bHH H Hb11@ԇHԇH@a 6h' ,T,T'GG! lTlTI\"T\"T|@x#Tx#T ' /'T'T; 9N ߗ@G!T!T T Tւ T T  (T(T?qr 6hPcg;d[d[;[[G![[EX[[[[= `{Y`t[t[vk`D[D[Z`[[i.[[@![[ [ [<[<[ƛ 6hLI3 eo _ }   iq4 y[s  יl;l;4;;p;;qD<D<? 6hLZ ` eeUb1-heheH#_b# !ib!C^Z# #^!+ !`R 6h~ ec kk0hxhx ddj XA PhPh.rrPATTCc44`A"nP[P[ `$8e8e{hAhh[ 6hK9 +_8_8K8K8$I8I8wU8U8p8p8KL8L8Z9̞8̞8$$8$8^@a8a8TP8P83b8b8w080888BD8D8}X8X8( 2 x|[`b[b 4 `D G!SS4~0SS7]z\@]z\Y`SܡSvk`SHSZ`hSS\\\l 6h  9`@9 u[@dw@̵5޵~[BB1@V@X 6h@Kffg> g)Ab` ˆ ˆf>{>[8D@D(, 6h -Ǔ 0`,6l,6lyUTmTm{"pmpmS,\5l5l;mmc6l6lv6l6lTmm!L@Vh=\5l5lx6Ymm'@Ymmv;V'W6l6lxC@Wmm&@,m,mmf 6h-Il Lx! ƗyB.`]! . _ y" 6hJJl Lx! ƗyB.]!" . _ Q 6hxP dT a(@ff;|e|ed@F9( 1h:7:ff Q *struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }D@[Mt,3e XWOѩ˕ sW+s V/ n 8@G!(YY4~DYY`IYԈYY Y`YPY\PYYvk`YYZ`YTYa@\YYБYYG JdYY|px7@f ]`wr}L@`J@`@ [(0X8w@IH L*sTt@`\-טdAf`g`hiH?@[lMpxȳz Rg" ?a3 "@:ss$9(0L@<.@lH <PďT%֙\dlpt|BtktQб`Ԑ lh" 3 9%֙"@ L@$.(s04B8DPT`ktltpBt|% l|^SUQfl Rj""@LHL1QYԅH|H#bHt{H H{Hb11@ԇH@|H@Uh`(^Q @k V\]Q@UF@]nCyUW {"Ca,y;Cy]C]y])=;; 6hUؤ`K`K׸ƈQLKLK`ǭ  KKKKj! KK-KK @!KK*KK 6h@ & G!nfnfXcfXcf!dofdofwffyXfXfa 6 w6aY^ (Zb$[ 6h5 1< 9~ N j! $$d=ttl` @!\\8 Z ̌̌'U!C ܊܊( 6h Y \YNN2alNlN.TNTN  OO NN2eNN;exNxN3NN @a,Uxh\@|/y@V-*interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error); FindMessageByName(protoreflect.FullName) (protoreflect.MessageType, error); FindMessageByURL(string) (protoreflect.MessageType, error) }v( @ ""  V\]Q@UF@]?]nCyUW {"Ca,y;Cy]C]y]] !d-!6`mL_ 6hE1~HQna0TT N N ihhttGt'!t'!Gn!n!a|!|!+E(!(! [!aNw 6hD*sO&6%MM` MM&@M@M,|M|M ',&MM3&V&ضMضMMMMMMM#DMDM!||i`i$8xۮܟQԗ $算0XN4M@2DLX˘Yu\'˘`jde^ԗhL lp:˘t xvm$D9'?'9 z$QF([),Tؗ@4 P@8aؗ<jDOϘ@`HaPPX#z \X7x.|G(9  6hpx!hh.dd%7T&}!||hh,,}<$$``$3Co9 4& & $q   >$% &ɘ (ɘ 4˙ @-˙ LXdpp+p|VV 7@V@X7#P,&O$ GM%`r$k(P?{0?@ƞ8k@ƞ@xHrP_"TosXYjWZ&[\yX`j lÔ@pΔ@taxXttM%`@$ kP?{ۺ@ƞM$n 0X@4Q8Jؘ9Y&:ٔ;<]ؘ=>䔗@n&DsW@ƞL?@ƞTr@\r@`adXlI 6h%g;VVd\V\VXVVvk`VVi.VVX8 VV  V V\VV VV VVp`VVs`VVJXJrVVrTVTV \2,} $ GM%`r$k(P?{0?@ƞ8k@ƞ@xHrP_"TosXYjWZ&[\yX`j lÔ@pΔ@taxX(,` `$ GM%`r$k(P?{0?@ƞ8k@ƞ@xHrP_"TosXYjWZ&[\yX`j lÔ@pΔ@taxX 6h[ G!v>v>CPK&[Pr>r>7& @!w>w>t>>g>>A4!>>|>|>>>Pz>z>g|>|>2 6huQ "505M||*%%%-lxlxtYE@L@8[ xxzz)`2X{{h ܐؘLZLZ$ &+((A0 A8O@@ҚLgZOP9 1T`rX`0h㘗@`lG *tM7*U NO^U@}8 6hؘ@LZ ^ eepZ*h= PePeee!ee[`g`-`e`e>DeDe*eeeeseeyZee}veeee]\ 6h ct߄t߄QnaL1L1c $ۄ$ۄ.4݄4݄iXX, , Z\8\860!'0A77/ }XC 3&$ݚ蚗[[Sx ]x(08 @—H9aP-X`,:h;pIaxIYaWeMu$a &$w.)\@@2\C)@@qx'@CHC;\a b),$@'@<@D\@y@.XC `&$ݚ蚗[[Sx ]x(08 @—H9aP-X`,:h;pIaxIYaWeQ]B 6hm Z,[hihiViiyUii\Yii{"иiиi;ܹiܹiyXiiT i i!L@VITU(i(ix6YDiDi'@Y`i`i|i|iv;V'@XiiyXiifXxC@WiiE;t  $W :`h- OE[}}} f$sȫ(W,6@4H<~@@= T=\= d=l t|zĤ(`==T z 6h9h Ǔ 0`llyUmm{"mmyXlXl;$m$mT8m8m!L@Vx6Y@m@m'@Y\m\mv;V'YHlHl;Zllb@ZDlDlxC@Wmm7Zllch&@ll5@nlnl 6hǓZ,[mmVmmyU ק>//@I֘?S"0 ]Ʋx @(R,t4r<FD#L5#TJ\R#dO l"@tM@x|]ߘ@,@纙Y֙o_1 6hM` 7e tt"  " W`LL  '"0."o hha`D@ v 6hG~â m<+-#>] !!-!!6`DD`m[  6h!lu l2l2$22 L22S"22^#2222P8d2d2}u +22kb" pr2pr2v i pp2pp2 Pq2Pq2 |o2|o2}i2i2u t2t2L#22#w2w2b 6hq֤6(I(I>IIV4J4Jc0 J0 J;J;J.HUJHUJpHJHJTJTJqJJ|XJXJtaJtaJI^J^J"$ mJ mJ܅J܅J}JJgDJDJu$J$J7$`J`J,+J,+J 6h3c G!P[P[YJ1@>d&33ܖ[ܖ[Zjs $[$[_P Ȝ[Ȝ[ [[MP[[ [3uP\H; t`T &$ݚ蚗[[ Sx]x —$9a(-,0,:4;8Ia<@DIHLYaPWTeX$c 6h18  n`Dii `V((#w#iikGii C@`didiS>S:SSSS@I6S6S=eT 6hY x!@^xtxt?\ytytUHztHztc^{t{t6U{t{tw@V|t|tkG|t|t\U}t}tDP~tP~tyU@_~t~tmDtt!_HtHtj! ĀtĀt"V`t`to_,t,t`tt{ W#TtTtET 6h.E0jt!Qt!Q\1 Q Q2FHQHQ.QQ  dQdQ ,Q,Q ;@fQQ3\Q\Q -`"Q`"Q < ]`Q`QRA1%3F@fQQi_:3F*struct { F uintptr; X0 <-chan struct {}; X1 go.shape.interface { Close() error; LocalAddr() net.Addr; Read([]uint8) (int, error); RemoteAddr() net.Addr; SetDeadline(time.Time) error; SetReadDeadline(time.Time) error; SetWriteDeadline(time.Time) error; Write([]uint8) (int, error) }; X2 chan error; X3 context.Context; X4 chan struct {}; X5 *[3]uintptr }(*FEŬ%%FE8 %`;S[K`>J+`>g שm|˵`H ׵>>/` n(; |,+z 4Ed$-;'=f@(qc_(\"Ǭ%%"81@R7v@. RTAvT˾T R}+@Kv@ Z ,y,` Z@Ou @  ^-8?/y S ׾ ?6` RC`L40 Ȭ\wZ|@ɞC v77%x<'@DJ@`H@ƞP0X4@`\dd@ƞlS@ƞte@ƞ|@ƞu[T@_M@ƞ6 `PP*atomic.Pointer[go.shape.struct { unique.node = unique.node[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.dead sync/atomic.Bool; unique.parent *unique.indirect[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.mu sync.Mutex; unique.children [16]sync/atomic.Pointer[go.shape.struct { unique.isEntry bool }] }]/NG i`ˬi<^OW1 ՗@` ̘@` W@`(ԗ@`0M@8e h<֊@jqD՗ H՗@LK'Pኗ oTĤX̘Ĥ\$`sltq`h|h˯ $$t;i̬i<\k : (j`0t Ԭ4Xv809<'`7DO7HP@LPP9QӋTW@\2%@`89@d#`̣x|D@/6ח@9H9@ 8QB `ά&<w.[0s—) ;:J:Y:\Ίߊn1-1B1iav%"[[囧 6h;̬iXGGP9$F$FA% GGk G Gm" RGRGD GGC 4TG4TGk G Gk G GaGGc QGQGYk#k lGlG +G+G/G/Gދ@G@G9oFoFzx 7G7G=G=G Pɡ 6hW ĤQ&Ir&r&ɇVYhԇ 1/cch X27Ώ 6hS W %[K84'q'שfdKmK'(vK)fd$3f@( 6hF/`*irU--d--X--Qf--?iq--9`@----3..j!`*d<-<---kG`..-- P-P-PP$5i`..KDK 6hF`WW,X,X K XXXX X XUt -XXg XX X X_8`XX;XXC|W|WKWWD1TWTW XX X X X1`X`Xr PWPWS~ʀ 6h: (SN(``t)`A'#A  (oX@%=Z;&Z;+ZZdE 6hS < bRR;}P RP RbdUG1.d Rd R;64 =bRRdfb/ ezL 6h0  }=}=~=~=[ 9==X (=(=Wă=ă=[p=p=N! w=w= s= s=9{={=(u=(u=$ B4=4=L?( 6hm6t2H-Y` x!@^xt`r?\yt rUHzt0rc^{tr6U{tPrw@V|trkG|t-<>-"H:!['['a'a'1L?-L?-@9-9-C@e'e' `H'`H'wOd'd'a^'^'^@d'@d'H@'H@'[`N'`N'{'{'+:oĎiM<iiT:1٭OvA|՗kvĤ 2v$T@(# .4-8O<#D0@LvPQBRjT՗Ĥ`O`ʝdO`ԝԝ˘#'{C-1 6hFE %[K84'q'שfdKmK'(ԁԁvK)fd$  3f@(|:e 6hy`FE %[K84'q'שfdKmK'(vK)fd$3f@(A, 6h7@Τ %[K84'q'שfdKmK'(  vKTT)fd$ll3f@( 6hSΤ %[K84'q'שfdKmK'(vK)fd$3f@( 6h@Mp #3p! N(IIC)'#AĂIĂIEUA-(I(I;&܅I܅I;e!)(!^ 6hV`&  B`hghgM8g8gg g gG!gg/ggX<g<g\` g` g@!gg?#Xggs@&g@&g& >\#g\#g8*'g'gq]g]gq_g_g agag3bgbgcgcg| 6h1 g;DWDW;WWG!WWEdWWXTWTWY`WWvk`WW& Z`8W8Wi.4W4W@!\W\W 8 WW/& WW\WW  W WwGWWp`WWX`WW\-`W`Wc 6hq*G!XX<h0nXnX!zG JXXm" XX. pXpXoXoXNtXtXp?vXvX@'`.XX`.TXTX\X\Xx?ЙXЙX LXLXͶ XX XX`.(X(X; 6h   c"d:!1@C wO-^[2"R 6h|@TFI;a` d!@Eob=' 3ayz\bD} B C (m 4b%yC Z,[hiܳiViiyUii\Yi0i{"иiLi;ܹiXiyXidiT ii!L@VITU(iix6YDii'@Y`iԾi|iiv;V'@Xi iyXi(ifXxC@WiDi.~ 6heA ǓZ,[XmXmT|`Sw@[mmVmm8[mmyUmm{"4m4mKmm;4m4myXmmTLmLmC\hmhm!L@Vx6Ymm'@Ymmv;V'@\mm\mm;Zmmb@[mmxC@WŞ 1(,4<8vD™ŞL!™ŞTt=Ş\~d~l]vtzv|@EvvZ~ێ쎘sȫW6@OEz*func(go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }, go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP })50d 6h} %[K84''q'שfdKmK'(  vK)fd$3f@( 6h %[K84''q'שfdKmK'(vK)fd$3f@(<̛ 6hl %[K84''q'שfdKmK'(XXvK)fd$3f@(Y(| 6h`?h.^ 6h @7 a% .X=N&`[Y[YD7c[Y[Y&+iEJ-D\YD\YP7.ZYZY*lru.Cache[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]C<  (^b  j!sv & }1<nommdmbm3myi mĔ*simplelru.LRU[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] ȑ#l5_F @.}!(4@YHjLkX!kdh-@t{@-:H.}~?_@ӡ _3:ߡ``FC]F`%]Fl CC@h p2F`'x2`Iצ ģ(㦗 ģ,聯 ģ0c428<`q>!?c@rAdBcD!H͗LcÚPYΩT‚ \a/'lgЗx@=4r($08@ Ș HLTiI@X`Fd. ^pg ^tg ^xM ^|X6 ``Y MQyII*6`prrë`9eGu/`(l @As fט<yט7@`$%@Ý(՗[,H?0 8r |@D`|DaHXWT@\`ט.hx. l:bpúFx%F|@!iQ^XsĤYXF6@Yq@*l @As fט<yט7@`$%@Ý(՗[,H?0 8r |@D`|DaHXWT@\`ט.hx. l:bpúFx%F|@!iQ^XsĤYXF6@SĐG j+"l?a3 9%֙ "@,8N0L@8.<|^DďL)T\sdslПptBxktttPl <QkGc - lQ& @A( 4 @D LMNjPj\7hk7l[-ࠜx.y<7ࠜ5%`c}v7  @Ѩ   /&l{"@@C@ Ơ"& x$@( @,Vݞ0+8—@[@Dx@H ,@LPaTxM\l @`@d[@h@l#@p7—tC—xO—|C),n\lmS 0 le)e@ ?f$=@ƞ(}@ƞ0+Z819b<Y@Ҹ@LX;@ƞdSė@l Ntsȫ~yz]F @, }_ėHW6@*internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]*go.shape.struct { encoding/json.name string; encoding/json.nameBytes []uint8; encoding/json.nameNonEsc string; encoding/json.nameEscHTML string; encoding/json.tag bool; encoding/json.index []int; encoding/json.typ reflect.Type; encoding/json.omitEmpty bool; encoding/json.omitZero bool; encoding/json.isZero func(reflect.Value) bool; encoding/json.quoted bool; encoding/json.encoder encoding/json.encoderFunc }*internal.LruList[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]88oX c@7cp? `W@$ W X( X0Ed(=\<\Y`>\=\vk`?\>\& Z`LA\t@\i.HB\(B\O O  M)\ C\lB\7  C\HC\S G E\D\u`0F\E\`G\F\O-H\HH\%1 8 @ @@ n`Dii `V((#w#i0ikGii ,iiC@`dii ?x `쭘W .7 :biY @`$ט.,W 0F481|@[DOHWL@T1@X!i\I@dFhT٘Hl7Hp#Htx+'@Ý&IW6@.D̐@j`A"x ]@Ʋ@Jx %@(R,<4r<FD@L#P5#Xs`ihR#pO x"@WN^]ߘ@,@纙قY֙aؙ((sj /ІYb CYb (x xibCfa)f aBkG$Tf/f6Tf/f] Uf+fb0Wy-Vf'fH('`44fyb5f2f ;`9f"7fWFf*go.shape.struct { github.com/apernet/quic-go.buffer *github.com/apernet/quic-go.packetBuffer; github.com/apernet/quic-go.remoteAddr net.Addr; github.com/apernet/quic-go.rcvTime github.com/apernet/quic-go/internal/monotime.Time; github.com/apernet/quic-go.data []uint8; github.com/apernet/quic-go.ecn github.com/apernet/quic-go/internal/protocol.ECN; github.com/apernet/quic-go.info github.com/apernet/quic-go.packetInfo }B 6h~G!h!h!H4~!!X!!`I Z 3!!Y` ! !\`!`!vk`x!x!D!!Z`!!a@@!!!G JD`#G Z `5G>7 6hD@IiE BB%TBTBxtBxtBAxBxB L]BL]BlP ^B ^BOBB>P B BCCk!x!O 0C0C s%BB]4B4Bk \B\B2YBYB+D[BD[Bn'm 6hmriE /H/H%/H/HA lPO>Pk!x!O  s%]k 2+n'? 6hd`N %[K84'q'שfdKmKS)(vKv,)fd$3f@(FN";pMp 4@ݞ#DIUI3p!XI N(Ip[IC)'#OIAĂI*IEUA8tI-(INIT^I;&܅IRI;  I T`  @-v_@ j! 8?4 6he`b%H7]z\@]z\CF>y[D\\%{0 |T@*LSX;g;FI;ja` d)k!@Ejojdjxjb=' j3j)k.kay0kz\3kb!kD,+k}7kWh j p;Q =9n{w``=VFBj! |d-@=d@ >x9@ *struct { F uintptr; X0 *lru.Cache[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]; X1 *[63]uintptr }s1 6hK ~G!\"\"D'""H4~L"L"X0"0"`""3h"h"Y`T "T "OO\( "( "vk` " "D " "Z` " "a@ " "@!""D`5G`X3 6h3 ~G!!!D'|!|!H4~!!X!!3!!Y`!!OO\!!vk`!!D|!|!Z`H"H"a@""@!H"H"G` " "D`5G`| 6h@ ]i LLшXLXLN ,L,Lr!8L8L!`LLLL8"M8"MӭDLDL߭ lLlL7`giLLqi LL{iLLN LL܈`LLLLHLHLN`P#MP#MNLL иLиL`LLipLpL(L(L!LLv 6h?"FE %[K84''q'g שHHm``|  fdKmK'(44LLvK)fd$3f@( r 6h!@ˤFE %[K84''q'g שm|fdKmK'(vK)fd$3f@( 6h Opx!ll HoHo.|g|g7T&nniiSa\\}<^<^,pddeeYYot`t`vvyy#||&#}~חM 6hR *4Ju rU/'T%.T%.dX&.&.Qf&.&.?`'.'.iq9`@D(.D(.3l).l).k@!$+.$+.*5+.+.G`,.,. PP$5i`P5 6hE ;d4Vd4V@2V2VNVV( V V'(VVfVfV~ XVXV<(lVlVs VVuVuVs5V5V)VVcyVyVlMVlMV2PVPV2sVsVVVtJVJV}8GVGV+O,:V,:VIIVIV#)VV_V_V|l| 6h|`? ( ]Xe a& cNcN%jNjN|3l`Nl`N| Ĺ`ڕ̌a9caU aIca;kNkNYca;xNxNsXqNqN 6hV p;Q 9n{w``VFBj! |d-@d@ >x9@ %q 6hg@#H,y&&IM0g0gɇ,V,MOhYhԇ 1dgg/cch X2,ut 6h/&H,y&&IMggɇVMOhYhԇ 1d@g@g/cch X238 N i`p!!i(`r6` # GP`%d`9eAh'@tlx@u'@'@)O@ 8wחPPOvIE%@%חLחkחyO .=9hmIi@riiOHE @/H@/H%CCA lPO>Pk!x!O  s%]k 2+n')j] t!!"rJ/@@$@ @$R(;08,@FHP]Xb`՟@]hlttԳ|֙³buݕM Ÿ՟@`@<^[x9 "v!!"p. 1Zo:ZഡX@A k߫(CZ|0 8 @ivƬH8 P @ڦX6ڦ` |hqp@ۦx `ҩeFۦ7@0 A@sv@ܦAܦ7@ݦ&ݦ@ަ  ߟ%sa6 6hFêe ! @!0l0lxmxmFpp$$F||`rrF  FP P `HHW`  hh DD ,,pp`44P?P?cb 6hM`~G!!!D'8t!8t!H4~0!0!Xh!h!`Iu!u!mT3!!Y`!!\!!vk`(!(!Dh!h!Z`!!a@Ts!Ts!@!!!{G Jw!w!nD` g)Am00\\{>dDD-[BHD hMX,>>fPD \ u`##^@@"`C9 M8 u(efC4)a@85@<}%@@@D@H"@LnV@P>@ߦTq(ߦ\R@ߦdF*@l@p:@t@x>@|q@P@>@@ r@r@r@>@'r@1r@wV@hKY~`~(Z`n>G`{G!\""D'"x"H4~L""X0""`"d"3h"0"Y`T ""OO\( " "vk` "D "D "8 "Z` " "a@ " "@!""D`5G`Kh3[~`~(sn>G`{G!!T!D'|!!H4~!!X!!3!!Y`!X!OO\!L!vk`!!D|!!Z`H"!a@""@!H""G` "|"D`5G`IRd`*(h8 Ԭ7v4Ju rU/'T%.$.dX&.l%.Qf&.@&.?`'.&.iq9`@D(.'.3l).\(.k@!$+.*.*5+.T+.G`,.,. PP$5i`*go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }a9h @7>G`{G!TbTbD'PUbPUbH4~UbUbX`Vb`Vb`\>\vk`?\?\& Z`LA\LA\i.HB\HB\@![[O O  8[8[ [[ Ճ [[M)\ C\ C\7  C\C\S G E\ E\u`0F\0F\`G\G\ O-H\H\ 6h\ǓZ,[|"l|"lT|`Sw@[!l!lV"l"l8[ll 0`"l"lyUԦmԦm{"mmKllEl#ll#l;mmyX"l"lTmmC\ll!L@Vx6Y m m'@Y@ߦTq(ߦ\R@ߦdF*@l@p:@t@x>@|q@P@>@@ r@r@r@>@'r@1r@wV@ -$ecN 6h[ZbG!SS4~0S0S4 SS" GG \SS`7]z\@]z\Y`SSvk`SSZ`hShSEa .  S S\G#,Dn\\*bbr.entry[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]*[]bbr.entry[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]a` &&   ` C9 ]@$`֞(L`<,Ej0+4.@D7`=L}jPqT/U VX`dƙpq^rcȗdCOpK N࢜a࢜ ֟KĤ 勚૭(v]@,sË4g> g)Am0 \D{>dDx-[BHD hMX,>>fPD*bbr.WindowedFilter[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]*map[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }]*internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] 6h|ڥ!4Ju    <4<4 XX4X4QfІ4І4?`449`@443j! 44-44Kb 44k@!<4<4*5l4l4G`44J " iE4242"22B/ 6h i1X@X@&L MD@D@<u@@Я@Я@i@@Gȫ@ȫ@"@@L<@<@##t@t@<@<@`@@u@@Rj4@4@j @@s%#4@4@ C\@\@ %&9݋ 6h੬GRRG!RRekIXRXR RRV= ^RR2 /RRe=`^(R(R2`/hRhRq ^RRY /RR ^RR /8R8RĮ RRR2XRXR~JDRDRt RRf(.RRYhRhRS KRR<dRdR=RR4 R R`RR gRR  R RRR_PRPRl8R8RJ 6hpK ` g8F68F6!Qj! , TQ6TQ666'J6J6L6L6pl6pl666{(6(6X6X6@k6@k60606)x~6x~65hH6hH6 {6{6)g666?TU6TU68P68P6{]6]6E?0r60r6. fC669gX6X6*map.group[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }]*internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] v^H (ч 䟜@>G`{"G  G!D'` H4~X`3Y`OO\vk`DZ`a@@!G`P:4`*struct { key go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }; elem *internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] }*[]struct { key go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }; elem *internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] }*[8]struct { key go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }; elem *internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] }(#ixi`ŭ))iX9k j `j#P 'Pחj$'(k0N8 k@R`jDxH'@d7hɗlHpNt,PHxx |@`͘a@@x@x@`pk@`k@`e`ku .kOx@N@$]ח͘K'ኗ orɚ9hǭ yQɭG!@@H4~伃伃XXXY A344Y`\vk`HHD<<Z`a@ƒƒ@!ăăŃŃUP:Gz4G  6h~ G!@!@!H4~X!X!X!!`IpH!pH!Y LI!LI!AXK!XK!3!!Y`!!\8!8!vk`P!P!D!!Z`!!a@E!E!@!!!R!R!G JO!O!M!M!UD`a!a! F!F!#G(e!(e!`Lm!Lm!5Gi!i!@nDO 6h`ǭ  G!ȼȼH4~X`U4I4IY A3llY`XX\,,vk`DZ`ƒƒa@ÃÃ@!ŃŃƃƃG V$J$JUP:Gz4G < 6h   -PiPi=|PhPhiiD$iD$i1PhPhp4ip4i,-i,-id'i'iWtyityif'ririwii"YiYiohh 4Fi4Fi0iiSiiL h h,h,hWii'8i8i28i8i i i vivi)2@h@hw>ThThWBiBi>2XQXmiXmigDciDciDiDiP 6hs sË4fg> g)Ab`m||f>{>d -!![BHD hMX,>>fPDWM 6h VH_tH_t\_t_t]L`tL`tQ@U`t`tF@]\at\atnCatatyUdbtdbtWbtbtpctpct ctctpdtpdt{"dtdtpetpetCeteta,tfttftyftft;tgttgtCgtgtyxhtxht]DitDitC]itity]HjtHjtP X ` &ed FCl ^$ GdϤ2h{d GĘ DJӧ; 6h7b~!G!|J|JXLLY` g)Ab`m|lf>{>d -!`![BHD hMX,>>fPD bT  (~DLVH_t r\_t4r]L`t$rQ@U`trF@]\atrnCatDryUdbtԌrWbtrpct,r ctlrpdt\r{"dtȋrpet|rCetra,tftryftr;tgtrCgtryxhtt\h@t?t]At@tQ@UBtBtF@]CtPCtnCDtlDtyUFtEtW(GtFt4HtGt @ItHtLJtIt{"XKtJtdLtKtCpMtLta,|NtMtyOtOt;PtPtCQtQtyRt(Rt]StDStC]TtPTty]UtlUtq5:5#if_!XX#p0 .. 8 "6[`@ 8@# nK 1 n(? L4M8 @-@LiP.T@`8@dw@hl`@xs|h2@ n    [w8@){0@?જ@9@PB@?[  % ]! ? pB`$+0y``< M૜HwTXXEp0 ..8 "ў6[`@ 8@#K 1(?s4M8 @-@LiP.T@`8@dw@hl`@xsО|h2@    [wڜ8@){0@?ڜ@9@PB@?[  ۜ% ]!O pB`ۜ$+ۜ0y``ڜ< MۜHwT2 6h׍6i$s~ E59Okj@Zv `@#@]OH@!_hkv 4U|vIM#uj#k RFRFkOCU!aV 6hX!/$Rjj* YRm! Oa iR*m ̠̠%00h,, &&ppim  `m R -*<*ff!o DD=0 6h4g$(ȤU ml7ڤm <`Pw`Pw(w* gw gw \wxwxw4ww0ww!)!:XwXw4Khswhsw4M M 6hX!f$R* YRm! Oa iR*m %h &&͆͆im  `m R -*<*!8ц8цpφpφo ՆՆJr 6h -Ǔ$"V#l#l\h)lh)l]L)lL)lQ@U(l(lF@]0)l0)lZ(,l(,lnCP*lP*l 0`+l+lyUmmW(l(l#l#l  %l %l$l$l{"mm%l%lC%l%la,d&ld&lyp%lp%l;ĪmĪmC%l%ly#l#l]#l#lC]&l&ly]'l'lq5:5#if_!% 6h6Ǔ%!V-l-l\3l3l]2l2lQ@U1l1lF@]p2lp2lnC$3l$3l 0`44l44lyUmmW41l41l-l-l /l/l/l/l{"ШmШm0l0lC0l0la,1l1lyl0ll0l;mmC0l0lyD.lD.l]-l-lC]1l1ly]$1l$1lI&! %  [K84'  ?4 4 q'שfdKmK˵В В H ?(  vKx x n  ( ;4Et t )fd$( ( -@ @ 3f@(;'ܗ ܗ }'HIK=f@(  6hA [w&!-+R7##R;@<Id}+>CO#Mo0= SUSi[+W!Ju}e5Wo)S  s1 6h)h yǓ&]`Z,[llVll 0`,l,lyUll@ll\Yll{"ll;llyXllTll!L@VITUllx6Yll'@Yxlxlllv;V'@XllyXllfXxC@Wllƒb@q@ ch ll ̔l̔lρll ll3? ? ހNC C a44EL6?=ttKWKXe  .croa0G 0G M / / aa{H H an[(()L׍`i@6i!dO٭$ .# `r . s~ E59Okj@Zv `@#@]OH@!_hkvU|vIM#uj#kOCU! 6hcN '\YNN2aNN.0N0N  xNxN NN2eNN;eNN% 3ȊNȊNNN @aNN2aHNHN <ỶN̉NkNNaNN2@aNNN(NNNN@IܟNܟN@I^!NN NN@a NN-@IܨNܨNNN#a$@aNN!&XNN2^!9M 6hfQ'`sË4fg> .@Hg)Ab`m~@44.f>Cc@  {>d-[B{HD hMX,>>fPDrI09h`+>I&! %xh xh [K84'Pi Pi  ?e e q'שfdKmK˵g g H ?(t t df df vKPc Pc nf f (` ` ;4Ea a )fd$  -^ ^ 3f@(;'_ _ }'_ _ HIK=f@(z @A44PQ '$0&<nH%L~ݞPE@XĮ\.`TF1@X_@l_mhɗ@b@C Db_Dɗ ,0<HDT@`lxb_@V@g;};@Ǚb@k)Dui h F %]F(-$01 "-c$=$2<I t#m F2Og2ooKZ'Ici$%'@  D9RY 06FtSSP%K~ 6ht@*"((wST(T_1aaiT. @@TT@aST3TT>>@ @g   Uv _v` g-  ` -v_@ j@Z@! 8? 6h`:c(̑̑7 xx 44`F߿9_I+P+ЭЭ6bÑÑgߑߑn\\/||_S pȑpȑAʑʑ@%``AA.U<Ƒ<Ƒ70ϑ0ϑ/8͑8͑$v dd{n`00Z$$z$R 6hb($G!SS4~ȦSȦS4 XSXS%H" GG \tStS`C[Y`SSF>y[vk`dSdS`CCZ`4S4SEa . SS\G#,n<|7 ̌c8 O55 s;%},@Ş\hcĞicǞ$3Ǟ,X4Ǟ<y8DC@`H2PǞXFǞ`%3Ǟh:3Ǟp\Ğx z]i×@Ğ×X ?yc @c!X@Ğ4cO3|<@Ş*<ǞcǞX9<ķVR;  Ǟ ̢+?Ǟ/Ǟ CǞ(;Ǟ0&8 +f;勚Q'(n\(L` sË4fg> .@Hg)Ab`m|~@4.f>C c@ X{>d-`[B{HD hMX,>>fPD 6hR@FE*# %`kkKK;S[K`> m mJ+``l`l>\\g T]T]ש^^mD`D`|˵`jjH cc׵>II>LLaa/`lMlM  U U[[nbb(LL; dd|,+z tt4EYYd$KK-JJ;' }'00HI('ff?IK=f@(ZQUY 6h /O*$* pT3ph/NW'p`=;)--h=)T-T-&--p=- --"@-=T;^T--)g-- --)--KqH-H-@iU--) --67 6h@l+"""G!$hhX00X1KCH`LH@HHL  Y`vk`Z``` ̻̻hha@Kb`@!\\UHK"m"H$^H#K`1K`gHL` o`Й`pHU!5G> 6h!`o+"""G!dd$44XX1KCHРРLH@HHL  Y`vk`Z``` ̨̨hha@Kb`@!\\UHKG`<<"m"H$^H#K`1K`gHL` o`Й`pHU!5GZ 6h-b@T,"""G!!!$X((X1K<<CH\\`  LH@LY`\\vk`Z`ll tjtj<#<#a@Kb`4"4"@!p p UHKG`xx"m"ԉԉH$^Hlololqlq#K`1K`<<gH\\L0606`@$@$ o`H%H%Й`P&P&\\pHU!5GPP 6h@r,%i%-*^ϐ w|i:t:tSNt)|'|(1i-=;)"@ h z ih yh , =  a ii`f::i@wh : X ߥOO`r8$ ֗@(֗4, 50`54㯗58ﯗ5<@8Hj`PB$T@Ѧ\Md8zh%֗pq rEjsv@t@x2|Q$DV2֗j̘h"Nh}̘@=d@@@\j?֗Q@̘wkz)k`@y`$#w@`L֗@`o$M - 6h`A--V V > >   VB  > {" M>\ PePeV !?X\Me\MeǀQfLeLe?`LIeLIe0He0HeyWH |Oe|OeV j! `Oe`Oeh:V!H V Qe QeKb @!FeFe* 5LKeLKeG`NeNenh Zl+(Zo2 `"""G!$hDX0X1KCH``LH@HL `Y`4vk`Z`` ̻8ha@Kb`@!\UHK"m"H$^H#K`1K`gHL` o`Й`pHU!5GKgh! ]o+(so2 `"""G!d$4XXX1KCHР,LH@HL `Y`4vk`Z`` ̨8ha@Kb`@!\UHKG`<"m"H$^H#K`1K`gHL` o`Й`pHU!5Gt%]9h@ cr,%>@i%-tttt\t\t*^ϐ w|ittSNt)|'|(tt1i-=;)"@ h z ih yh , = Fժ 6hxB}.!9âaH 1bG1m<+-#>kGKKN LL] MM0-NNE"l``#bBAL H1oHϥH"!d64-uB}yB},(`D e9dâaXH 1bGH1m<+H-@#>kGK(N L4] M0-NPE"#bBA,L H1oHϥH"\` ]F |==]F#͗͗ 33$4 8<c@$@D}ϤH"LP )X-\W6dDJeΗfgGhicjok8l mnMeo{@pqWerΗst|J 'p Zaekeue$8@ JJIĚJ3@f"2CϤ7ŘJ83#  ptt 6hӫ2ů}}Z52< C@x~x~:_y O O0'kl4;~;~TTwDDG-~-~~~CCޯ ~ ~5~5~OOMM;F<<̣_~_~T~T~/}}PnU}}p}p}n}}C~C~}}HH,~,~}} ~ ~)""zh~h~ޣQ~Q~~~BA~A~W`pX!%HWBBW(L% L(0L8@Ƙ@L`*PTo`'hhЗQpEt4 |ƘߞP6 Lߞ ߞL fߞǘ Mߞ ' !X6`6h6'`*@Ԛ9@Ԛf uЗaʙr@Ԛ2f =Hu$%ǘ >(8ǘ0+r`4`r@fH.TKǘ@X@\@`Fdp6eHfgh^ǘihfjk@lb( 6hUܫ=3(â=!Ut.0ql0l0{Jב/C@@4040\.*U ] (0(0&_l`#yUuV0000J4040)-8080y*`00/00!0!0E0E03U;0;0. 0 0l0l0o00;0000Ss-1+4n,WLx%X9T] â6%PbGH   0@` t`LH%6l%%`N 0N ]  6%ߪ% 6-(, KbL*###f#iLrLBd(6k"c$xh`H 86st& 6hIn@5n4-P;;$!M&Sn]n[t(v|"*(X;+0gnqn@.5:n8{nYR?`;n@%%  f5In@5n4-<44P;L9;$!!M&Sn]nУ[t(@>v|^"8N*S(,X;<++`"0gn\qn;@.50:T0nxt8{nlYR?`;,n`o@%%L6 B։FFX(7 Z7Zx,I@0H4OE8.7<: @s bH8PŞT(@\լ`a2@Sdhsȫl~`8p( ا%ژt% (8`<,U@0p28iY @!sD sL?`T2@ئ\Ťd2hlp(VtN@|֮@讘P@!i`rt@NJ @^ט128ژ(I@՗@`WWဝ)Z}f"`̣ Kژ^ژ@`2 9Z  (i* W6@~h]FGG]Fdd`͠hJ33 qJ`͠(3,zJ ۟@P ʝPd hd`͠lg )p> (tl$ (xj (|r@ds$@z$@}@eImΗ@$J)eϤ'p7ep@wϤ3@v2J 'J )zΗ ѝdhlExʃΗ`ޞ%e@@>@͗/e#9JՃ9e )?`(33 KϤϤS@Ce(U :J R,냗Xa@`ҝdC{ 6hkoM+:0h.G!QQ܊܊<<<')SHH.)D5D5*`LL+OO5)KXX<Ks@8N8NŠ̌o``XTT@@`[[ ,__,bbSHfHf\j\jLTTWRRY`tEtEvk`FFZ`FFiSܨQ}"+,llPPjLJLJ5@!pnpno~~:,I,@GT{T{TtTtww<Kh1??MJPPop1 o ??Kd @@*func(go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }, go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }) int)q 6h@=/WL%9]â6%bG 0@`څ` tt`LH%6ll%%`N N ] 6%ߪ% 6-(( Kb*###f#l`,,`,,`  iLrLB(606kcx`86#`#@6{L L#*struct { pragma.NoUnkeyedLiterals; Flags uint64; Size func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }) struct { pragma.NoUnkeyedLiterals; Size int }; Marshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error); Unmarshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error); Merge func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }; CheckInitialized func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error) }*func() *struct { pragma.NoUnkeyedLiterals; Flags uint64; Size func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }) struct { pragma.NoUnkeyedLiterals; Size int }; Marshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error); Unmarshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error); Merge func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }; CheckInitialized func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error) }+eŇ 6hB@3]i $3L$3LшD4LD4LN h5Lh5Lr!4L4L!`5L5L|6L|6LH7LH7LӭT8LT8L߭ 7L7L7`gi@eL@eLqi dLdL{i8L8LN eLeL܈`3L3L;L;Lt>Lt>LN`>L>LNfLfL  fL fL`?L?LifLfLdgLdgLZ  @L @LxHLxHL KLKL/xhLxhLt/gLgLK)ULULE! 0XiLXiLT!&hLhLƈ iLiLg`0jLjLt jL jL\VL\VL0jLjLC`CLCLtQXLXLt`Lt`L`t\Lt\Lǭ%@kL@kL_%kLkLm&kLkL{<{<{{{nDSn/n||,},}|,+z}} llMS$ ,"VSn ; /o&;85 o_ShS (;-qSzS@>&$;+S''o  >;Χ I R   ` J$((o}'%o> O_ -R`FE`FEgM4 @c^d `j` Sw`n;;)Sx! G! xЦx2S;Sp @H g ̪|m(|((  H{"#w#\y+(kGz6z><{L{dnDSn/\n|X,}|,+z}H lMS$ ,"$VSn ; /o&0;T85 @o_ShS (;-0qSzS@>&$;+S''do ek( |>;Χ I R   d` J$(h(o}'%o>-YL 6hH`W3B1B1flD1lD1WgK1K1gf`E? )T0T0SL0L0Lg\)1\)1HkX?fʪ5#g`P1P1K-g^Hp0p07g00iHt_1t_1T1T1 =1=1 p71p71 (:1(:1w/@V1@V1U1U1W[1[14Y14Y1H@Mrj|`1`1 ?)D'C{H'O1O1HS1S1)00)00x6c|g1|g1^r0c10c1% *G1G1Ag *I1I1tK1K1o *XJ1XJ16I1I1L *XH1XH1_PE1PE1 { 11KgL6{00 Ifor%`*6)I11Ug 1 1%000000L$M1$M1=<1<1f1111r!11r,0,0Q  51 51X 11L11_g11r@p1p1x0x011Ĝ8181 @)I$1$160000%600!@00t0t07@`Q1Q1r11M@ i1i19If1f1L (1(16  k1k1~ 6h)TKvT..'*W pĐJ)ϐ3,TpZ.Z.N9T~pڐ[RT`y.y.~_"(=)p3p -IT"h\.\.?5\.\.S=p-0~KuNGp*-A~ƩWQ)/MYTQpةc@R~۫c~X)[p9-o6epgH-gW-TiTIyTHT8MAM@̆@׆g -g@0=T{_)8=f-TopTypf)@=m)H=pt)P=u-Tp'X=-Tp'{)Tpp2`=T;(n.(n.T@@)l.l.h=)pl.pl.&(.(.pp=- z.z."@Ps.Ps.-w.w.t~h.h.~n.n.-%T~T3T~-T [AT~ U~n=÷<.<.Tp)Tpx=THϷ=TS$.$.۷;T^)=pi)tO-Tp)Ğ.Ğ.)gl.l. hp.hp..k.k...]@.@.-<.<.#..) ..sW^qr]:tx-,idiv2., ; %!i))(+-up??ip53->: ..|0|1> [("")) ) +: @s PB n=][} ] > [ ] 25\x\a\b\f\n\r\t\v\u\UnsusmsPMAMpmam00µTZgt--%s[]to%vts80TE//./]){}"::% ,W/h2%wTe%T ">OKca*.EC%x%p%d-t-N-w-A-p-j-D-F-X-d" 0b0x0X0oOUCNST=# (LlLtLuMnLCPePcCcScPdNdMePfCfPiNlZlSmLmSkPsLoNoPoSoZpCoZsMcCsCnYi}}NSMXos%qltloCEh3\\\"ToA4V1V6V2V3V5A3INCSCHHSDHDSKXLPMBMDMFMGMRPXRPRTTA=" "" m if\d\D\s\S\w\W\E:]/i$1| !! `!<<<͏\'UPrav1v2<-brt0GTLTtrpb>>&^+=-=*=/=%=&=|=^=&&||++==!=<=>=:=go msgudpsniuriTUNtcp443bbrymltlsaclurlingB/sbpskeyRSADSAURInilcgodnsftpssh::1set): PWD../finptrobj() gc %: gp *(in n= - NaN P m= MPC=], < end > ...]: ???pc= G125625nanSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUTCµsμszsh%s hclenvinitun///%25ip:%+v'"'EOFnewACKGETGet200404100://0 ,h1:%dTXTtxtPUTnftaddnatip6853MD4MD5KEMexpSETintmapKey�HanLaoMroNkoVaiTTLSOAPTRSRVOPT"}}dupmaxnet notAnyu00argb2bVia.js?*[ageviaIf-204206304400500‍‌ANYechPGPOIDAPLAVCCAACDSDLVEIDGIDHIPKEYL32L64LOCNIDNXTSIGSPFUIDX25:0x%0X\# macMAC %q | : ` inf"""1.1----0b-0oTAG forallanytapgtpifbvrfsitvtigrecanEndbgpmrtntkrip @ %#xackpto103503*/*302403421425getECHLZSUseE ('''DD;GT;Gg;Gt;Im;LT;Ll;Lt;Mu;Nu;Or;Pi;Pr;Re;Sc;Xi;ac;af;ap;dd;ee;eg;el;gE;ge;gg;gl;gt;ic;ii;in;it;lE;le;lg;ll;lt;mp;mu;ne;ni;nu;oS;or;pi;pm;pr;rx;sc;wp;wr;xi;AMPETHREGampdegethregshyumlyenatmx25pppbifash=> INT<<=>>=&^=varoptreqrepb2sinfowarntimejsonobfsaddrnamerenoyaml:443acmePOSThostquicKB/sMB/sGB/sKbpsMbpsGbpsarchtruemap[icmpigmp ftpshttppop3smtp) = dialreadfile on pipebindunixwaitseek/tmpHOMEopenstatsynclinkallgallprootitabsbrkidledead is LEAFheapbase at Has used of <==GOGC] = s + ,r2= pc=none+Inf-Inf: p=cas1cas2cas3cas4cas5cas6 m= sp= sp: lr: fp= gp= mp=) m=3125AtoiquitJuneJuly as hour in /etc%s%s %v helpbool", " %s %sbashfish:%d tomlproppathargs\u00INFOWARNnull'\''DATAPINGIdleOpenHost<>HEADEtag0x%xDateconngzipdate%x Gone1080p256.keyhashsans127.fromocsp.crttypeAAAAipv6Linknft|hookruleConninitusertcp4tcp6udp4udp6%08XAuthshashashaHPKEmd5asn1tag:int8uintchanfunccallElemCtrlkindArgsCall != MarkAhomChamKawiLisuMiaoModiNewaThaiTotobitsNameTypeMX: PrefMBoxtextPortCodeDataNone--%sintshtmlOsFsBoolTimelinedeepFullauto1RTT0RTT --From.css.gif.htm.jpg.mjs.pdf.png.svg.xmletagvaryxn--SHA1NONEalpnportPKIXSPKIIPIXIPGPATMAAXFRCERTGPOSISDNIXFRNSECNULLRKEYSVCBTKEYTLSATSIG-tlsTYPE%+v %+vPWD=PATH,#=:pcg:CASTshashashashashasha sha sha else cap -> fail-inf...`%TAG.inf.nanTrueTRUENull.NaN.NAN.Inf.INFYAMLmetalistspancasevoidslowfast{%s}downvlanvethbondDOWNipipvti6xfrmsitebirdbootdhcpisisospfxorpenumlazyweakpostflagALPNX448certzlibzstdX509AMP;Acy;Afr;And;Bcy;Bfr;Cap;Cfr;Chi;Cup;Dcy;Del;Dfr;Dot;ENG;ETH;Ecy;Efr;Eta;Fcy;Ffr;Gcy;Gfr;Hat;Hfr;Icy;Ifr;Int;Jcy;Jfr;Kcy;Kfr;Lcy;Lfr;Lsh;Map;Mcy;Mfr;Ncy;Nfr;Not;Ocy;Ofr;Pcy;Pfr;Phi;Psi;Qfr;REG;Rcy;Rfr;Rho;Rsh;Scy;Sfr;Sub;Sum;Sup;Tab;Tau;Tcy;Tfr;Ucy;Ufr;Vcy;Vee;Vfr;Wfr;Xfr;Ycy;Yfr;Zcy;Zfr;acd;acy;afr;amp;and;ang;apE;ape;ast;bcy;bfr;bot;cap;cfr;chi;cir;cup;dcy;deg;dfr;die;div;dot;ecy;efr;egs;ell;els;eng;eta;eth;fcy;ffr;gEl;gap;gcy;gel;geq;ges;gfr;ggg;glE;gla;glj;gnE;gne;hfr;icy;iff;ifr;int;jcy;jfr;kcy;kfr;lEg;lap;lat;lcy;leg;leq;les;lfr;lgE;lnE;lne;loz;lrm;lsh;map;mcy;mfr;mho;mid;nap;ncy;nfr;nge;ngt;nis;niv;nle;nlt;not;npr;nsc;num;ocy;ofr;ogt;ohm;olt;ord;orv;par;pcy;pfr;phi;piv;prE;pre;psi;qfr;rcy;reg;rfr;rho;rlm;rsh;scE;sce;scy;sfr;shy;sim;smt;sol;squ;sub;sum;sup;tau;tcy;tfr;top;ucy;ufr;uml;vcy;vee;vfr;wfr;xfr;ycy;yen;yfr;zcy;zfr;zwj;AumlCOPYEumlIumlOumlQUOTUumlaumlcentcopyeumliumlmacrnbspordfordmoumlparaquotsectsup1sup2sup3uumlyumlacE;bne;nGg;nLl;ngE;nlE;drop[]%sax25dlcisliprosehdlclapbfradskipfddiirdafcppfcalfcplXXX_mod dep IMAGCHARgotoPathKindEnumdef=0000sharedebugerror%s:%dlevellinuxcountemail testbytesspeedtls: EarlyECDSAfalse(nil)Errorfileshttpsimap2imap3imapspop3shostsCNAMEwriterouteclose (at no IPchdirmkdirlstatgetwdpipe2defersweeptestRtestWexecWhchanexecRschedsudogtimergscanmheaptracepanicsleepgcing MB, stack got= ... max=scav ptr ] = (trap:init ms, Go: r0 r1 r2 r3 r4 r5 r6 r7 r8 r9 r10 r11 r12 r13 r14 r15 r16 r17 r18 r19 r20 r21 r22 r23 r24 r25 r26 r27 r28 r29 r30 r31 pc link lo hi fault and tab= top=[...], fp:1562578125denyMarchAprilmonthLocal %sSliceArray%s_%sCOBRApropspathsaliasvaluesocksparse/auth%.2fs"NaN"fatalDEBUGERRORPANICFATALarray&"':***@%d %sRange:pathHTTP1HTTP2%s %q%s=%sHTTP/AllowFound.jsonuserschainrenewlocks.locknamescache%v %vcleartokenHS256RS256ES256ES384ES512title%d-%dtabledportdaddr%d:%destabStateSHA-1P-224P-256P-384P-521int16int32int64uint8sliceSlotsfunc(kind=GreekOthercntrldigitpunctAdlamBamumBatakBuhidDograKhmerLatinLimbuNushuOghamOriyaOsageRunicTakriTamilTypeAClassRetryfcntlorderfloatuintsbools[=%s]test.break%s.%sInt64Group\u202%s%+d -%s for PlainRegexretrylocal.avif.html.jpeg.wasm.webpUTF-8utf-8%s*%dtext/rangeRealmbad nauthzQUERYED448ISPKIAFSDBCSYNCDHCIDDNAMEEUI48EUI64HINFOHTTPSMAILAMAILBMINFONAPTRNINFONSEC3RRSIGSSHFPUINFOCLASSdns: udp: %d %d (%s)basicBasic%s/%slabel%s-%smatchrune --- .%09dline !!str!!seq!!map%YAML-.infFalseFALSE+.inf+.Inf+.INF-.Inf-.INF!!intstylestart%s %sdummyvxlanipoibownergroupGuardFloodencapEnd.XEnd.TEnd.Sbabeleigrpgatedzebrafieldctype0-RTT1-RTTOHTTP BOM)TableFloatAopf;Ascr;Auml;Barv;Beta;Bopf;Bscr;CHcy;COPY;Cdot;Copf;Cscr;DJcy;DScy;DZcy;Darr;Dopf;Dscr;Edot;Eopf;Escr;Esim;Euml;Fopf;Fscr;GJcy;Gdot;Gopf;Gscr;Hopf;Hscr;IEcy;IOcy;Idot;Iopf;Iota;Iscr;Iuml;Jopf;Jscr;KHcy;KJcy;Kopf;Kscr;LJcy;Lang;Larr;Lopf;Lscr;Mopf;Mscr;NJcy;Nopf;Nscr;Oopf;Oscr;Ouml;Popf;Pscr;QUOT;Qopf;Qscr;Rang;Rarr;Ropf;Rscr;SHcy;Sopf;Sqrt;Sscr;Star;TScy;Topf;Tscr;Uarr;Uopf;Upsi;Uscr;Uuml;Vbar;Vert;Vopf;Vscr;Wopf;Wscr;Xopf;Xscr;YAcy;YIcy;YUcy;Yopf;Yscr;Yuml;ZHcy;Zdot;Zeta;Zopf;Zscr;andd;andv;ange;aopf;apid;apos;ascr;auml;bNot;bbrk;beta;beth;bnot;bopf;boxH;boxV;boxh;boxv;bscr;bsim;bsol;bull;bump;cdot;cent;chcy;cirE;circ;cire;comp;cong;copf;copy;cscr;csub;csup;dArr;dHar;darr;dash;diam;djcy;dopf;dscr;dscy;dsol;dtri;dzcy;eDot;ecir;edot;emsp;ensp;eopf;epar;epsi;escr;esim;euml;euro;excl;flat;fnof;fopf;fork;fscr;gdot;geqq;gjcy;gnap;gneq;gopf;gscr;gsim;gtcc;hArr;half;harr;hbar;hopf;hscr;iecy;imof;iocy;iopf;iota;iscr;isin;iuml;jopf;jscr;khcy;kjcy;kopf;kscr;lArr;lHar;lang;larr;late;lcub;ldca;ldsh;leqq;ljcy;lnap;lneq;lopf;lozf;lpar;lscr;lsim;lsqb;ltcc;ltri;macr;male;malt;mlcp;mldr;mopf;mscr;nbsp;ncap;ncup;ngeq;ngtr;nisd;njcy;nldr;nleq;nmid;nopf;npar;nscr;nsim;nsub;nsup;ntgl;ntlg;oast;ocir;odiv;odot;ogon;oint;omid;oopf;opar;ordf;ordm;oror;oscr;osol;ouml;para;part;perp;phiv;plus;popf;prap;prec;prnE;prod;prop;pscr;qint;qopf;qscr;quot;rArr;rHar;rang;rarr;rcub;rdca;rdsh;real;rect;rhov;ring;ropf;rpar;rscr;rsqb;rtri;scap;scnE;sdot;sect;semi;sext;shcy;sime;simg;siml;smid;smte;solb;sopf;spar;squf;sscr;star;subE;sube;succ;sung;sup1;sup2;sup3;supE;supe;tbrk;tdot;tint;toea;topf;tosa;trie;tscr;tscy;uArr;uHar;uarr;uopf;upsi;uscr;utri;uuml;vArr;vBar;varr;vert;vopf;vscr;wopf;wscr;xcap;xcup;xmap;xnis;xopf;xscr;xvee;yacy;yicy;yopf;yscr;yucy;yuml;zdot;zeta;zhcy;zopf;zscr;zwnj;AEligAcircAringEcircIcircOcircTHORNUcircacircacuteaeligaringcedilecircicirciexcllaquomicroocircpoundraquoszligthorntimesucirccaps;cups;gesl;gvnE;lesg;lvnE;nGtv;nLtv;nang;napE;nges;nles;npre;nsce;nvap;nvge;nvgt;nvle;nvlt;race;gob: not etherchaosatalkcslipslip6rsrvdadapthwx25ddcmpltalkhippifcfb0fcfb1fcfb2fcfb3fcfb4fcfb5fcfb6fcfb7fcfb8fcfb9EntryStartpath Ed448IDENTFLOATconstNamesIsMapOneofEnumsInput\%03oname=enum=json=weak=oneofclientserverloggerfwmarktls.calistenremotedarwinreqURLconfigstderrmethodnotextupload%.2f%%urgent%s[%d]0x%04XX25519%w%.0wlengthkem_idtls13 %s: %s, not StringFormat[]bytestringnetdnsdomaingophertelnetreturn.local.onionndots:sendtoip+netsocketspliceacceptno '/'readatTMPDIRrenameremovewaitidsysmontimersefenceselectSIGEMTscalarGOROOTmipsleobject unused objs next= jobs=status goid sweep B -> % util alloc free span= prev= list=, i = code= addr=], sp= m->p= p->m=SCHED curg= ctxt: min= max= bad ts(...) m=nil base 390625hangupkilledallow/proc/errno SundayMondayFridayAugustminutesecond%%-%dsError:Usage:tfvarsdotenv$HOME/callerBasic udphopCauses"+Inf""-Inf"\ufffddpanicDPANICnumberGOAWAYClosedactiveclosedCANCELPADDEDCookie

bytes=schemeexpectstreamExpectPragma.
socks Locked

%s.
dns-01_truncrenew_obtainissuerforcedreason_plus_DELETEAcceptdetailpolicyoutputdeleteOUTPUTdirectrejectStreamsecret-----
STREETuint16uint32uint64structchan<-<-chan ValueCommonLetterNumberSymbolArabicBrahmiCarianChakmaCopticGothicHangulHatranHebrewKaithiKhojkiLepchaLycianLydianRejangSyriacTai_LeTangsaTangutTeluguThaanaWanchoYezidiheaderAnswerTypeNSTypeMXLengthMBox: SerialExpireMinTTLPort: WeightTarget want cmd/go*?[]\^Uint64 int64%w: %stime: squashremain
    	geoip:ECT(0)ECT(1)--%s
Servercookieoriginsocks5%s: %wSHA256GOST94SHA384SHA512IQUERYSTATUSNOTIFYUPDATERSAMD5NOTIMPBADSIGBADKEYBADALGACPKIXDNSKEYNIMLOCSMIMEATALINKUNSPECZONEMDnil rr\\\044\\\0920.%02d%.2fm %.0fm %0.16x%0.16XbearerBearerexec: empty rune1 exporttoml: yaml: !!bool!!nullscript3:04PMonlink802.1qbackupalwaysbetterfollowlayer2stableunspecdevicebridgetuntapipvlanipvtapACTIVEBACKUPgenevegretapip6tnlip6greGw: %sinlineEnd.B6End.BMEnd.ASEnd.AMnh4 %snh6 %siif %diif %soif %doif %sin: %skernelstatic%s:%d proto2proto3Proto2Proto3sint32sint64doublesyntaxpackedjstypefailedParamsbrotlipsk_keIgnoreUTF-16AElig;Acirc;Alpha;Amacr;Aogon;Aring;Breve;Ccirc;Colon;Cross;Dashv;Delta;Ecirc;Emacr;Eogon;Equal;Gamma;Gcirc;Hacek;Hcirc;IJlig;Icirc;Imacr;Iogon;Iukcy;Jcirc;Jukcy;Kappa;OElig;Ocirc;Omacr;Omega;Prime;RBarr;Scirc;Sigma;THORN;TRADE;TSHcy;Theta;Tilde;Ubrcy;Ucirc;Umacr;Union;Uogon;UpTee;Uring;VDash;Vdash;Wcirc;Wedge;Ycirc;acirc;acute;aelig;aleph;alpha;amacr;amalg;angle;angrt;angst;aogon;aring;asymp;awint;bcong;bdquo;bepsi;blank;blk12;blk14;blk34;block;boxDL;boxDR;boxDl;boxDr;boxHD;boxHU;boxHd;boxHu;boxUL;boxUR;boxUl;boxUr;boxVH;boxVL;boxVR;boxVh;boxVl;boxVr;boxdL;boxdR;boxdl;boxdr;boxhD;boxhU;boxhd;boxhu;boxuL;boxuR;boxul;boxur;boxvH;boxvL;boxvR;boxvh;boxvl;boxvr;breve;bsemi;bsime;bsolb;bumpE;bumpe;caret;caron;ccaps;ccirc;ccups;cedil;check;clubs;colon;comma;crarr;cross;csube;csupe;ctdot;cuepr;cuesc;cupor;cuvee;cuwed;cwint;dashv;dblac;ddarr;delta;dharl;dharr;diams;disin;doteq;dtdot;dtrif;duarr;duhar;eDDot;ecirc;efDot;emacr;empty;eogon;eplus;epsiv;eqsim;equiv;erDot;erarr;esdot;exist;fflig;filig;fllig;fltns;forkv;frasl;frown;gamma;gcirc;gescc;gimel;gneqq;gnsim;grave;gsime;gsiml;gtcir;gtdot;harrw;hcirc;hoarr;icirc;iexcl;iiint;iiota;ijlig;imacr;image;imath;imped;infin;iogon;iprod;isinE;isins;isinv;iukcy;jcirc;jmath;jukcy;kappa;lAarr;lBarr;langd;laquo;larrb;lbarr;lbbrk;lbrke;lceil;ldquo;lescc;lhard;lharu;lhblk;llarr;lltri;lneqq;lnsim;loang;loarr;lobrk;lopar;lrarr;lrhar;lrtri;lsime;lsimg;lsquo;ltcir;ltdot;ltrie;ltrif;mDDot;mdash;micro;minus;mumap;nabla;napos;natur;ncong;ndash;neArr;nearr;ngsim;nhArr;nharr;nhpar;nlArr;nlarr;nless;nlsim;nltri;notin;notni;nprec;nrArr;nrarr;nrtri;nsime;nsmid;nspar;nsube;nsucc;nsupe;numsp;nwArr;nwarr;ocirc;odash;oelig;ofcir;ohbar;olarr;olcir;oline;omacr;omega;operp;oplus;orarr;order;ovbar;parsl;phone;plusb;pluse;pound;prcue;prime;prnap;prsim;quest;rAarr;rBarr;radic;rangd;range;raquo;rarrb;rarrc;rarrw;ratio;rbarr;rbbrk;rbrke;rceil;rdquo;reals;rhard;rharu;rlarr;rlhar;rnmid;roang;roarr;robrk;ropar;rrarr;rsquo;rtrie;rtrif;sbquo;sccue;scirc;scnap;scsim;sdotb;sdote;seArr;searr;setmn;sharp;sigma;simeq;simgE;simlE;simne;slarr;smile;sqcap;sqcup;sqsub;sqsup;srarr;starf;strns;subnE;subne;supnE;supne;swArr;swarr;szlig;theta;thkap;thorn;tilde;times;trade;trisb;tshcy;twixt;ubrcy;ucirc;udarr;udhar;uharl;uharr;uhblk;ultri;umacr;uogon;uplus;upsih;uring;urtri;utdot;utrif;uuarr;vBarv;vDash;varpi;vdash;veeeq;vltri;vprop;vrtri;wcirc;wedge;xcirc;xdtri;xhArr;xharr;xlArr;xlarr;xodot;xrArr;xrarr;xutri;ycirc;AacuteAgraveAtildeCcedilEacuteEgraveIacuteIgraveNtildeOacuteOgraveOslashOtildeUacuteUgraveYacuteaacuteagraveatildebrvbarccedilcurrendivideeacuteegravefrac12frac14frac34iacuteigraveiquestmiddotntildeoacuteograveoslashotildeplusmnuacuteugraveyacutefjlig;lates;napid;nbump;nedot;nesim;ngeqq;nleqq;npart;nsubE;nsupE;nvsim;smtes;vnsub;vnsup;[%d]%seetherpronetarcnetcslip6ip/ddppimregeconetfcfb10fcfb11fcfb12%v: %v.proto 	
"`build	STRINGimportswitchIsWeakSyntaxIsListMapKeyFieldsOneofsValuesOutputGoTypevarintUnknownversionconsolewindowsandroidreqAddrdisabledns-santls.keyzerosslacme.caduckdnsgodaddydefaulttcp-tlscommand%.2f %schanneltlssha1tls3desInitialEd25519MD5-RSAserial:(PANIC=integercomplexfloat32float64runningopenbsdsuccessoptionsrecvmsgsendmsgconnectlookup writeto::ffff:no port (trap fstatatforcegcallocmWcpuprofallocmRunknowngctraceIO waitsyscallwaitingforevernetworkUNKNOWNcleanup:events, goid=  mark  s=nil
 (scan  MB in pacer: % CPU ( zombiegc bits, j0 = head = ,errno=panic: GODEBUG nmsys= locks= dying= allocssignal Signal  m->g0= pad1=  pad2=  text= minpc= 	value= (scan)	types : type 19531259765625abortedstoppedTuesdayJanuaryOctober-070000Z070000, time.[flags]invalidCONNECTUpgradecapitalISO8601RFC3339iso8601rfc3339Verbose%sErrornil keynumber HEADERSTrailerRefererCookie2expiresmax-age; Path=OPTIONS
flags= len=%d:method:scheme:status (conn) %v=%v,trailerhttp://upgradechunkednosniffCreatedIM Usedsocks5hHTTP/1.privatemailto:http-01accountattemptelapsedmanagedrenewalissuersED25519storagersa2048rsa4096ed25519rsa8192timeoutexpiredrevokedcontentBearer verbosedomains&limit=pendingheaders, url: dstnat;accept;--dportAlt-Svc/onlineSHA-224SHA-256SHA-384SHA-512AES-CBCHPKE-v1eae_prkderivednumeric2.5.4.62.5.4.32.5.4.52.5.4.72.5.4.82.5.4.9uintptrSwapperChanDir using , type=closure Value>ConvertControlAvestanBengaliBrailleCypriotDeseretElbasanElymaicGranthaHanunooKannadaMakasarMandaicMarchenMultaniMyanmarOsmanyaSharadaShavianSiddhamSinhalaSogdianSoyomboTagalogTibetanTirhutaTypeSOATypePTRTypeTXTTypeSRVTypeOPTTypeWKSTypeALLanswers recordRetry: Refreshaccept4cgroup2runtimeos/execfips140net/urlstrings[="%s"]Float64!BADKEYnsuµmh'%s' %sUsage: tcp+udpsuffix:(empty)initialExpiresSubjectutf-8''charsetrefererrefreshname %qproblem[%s] %wRSASHA1BlockedNOERRORFORMERRREFUSEDYXRRSETNXRRSETNOTAUTHNOTZONEBADTIMEBADMODEBADNAMEdohpathIACPKIXCDNSKEYbad offNOTIMPL%16.16x%12.12xquic ivquic hpInstAltInstNopalt -> nop -> any -> !!merge!!float (with 802.1adfailure802.3adgenerictestingdormantmacvlanmacvtapbareudptunnel6HairpinDst: %dDst: %sVia: %sSrc: %snowhereEnd.DX2End.DX6End.DX4End.DT6End.DT4out: %smroutedmap keyfixed32fixed64messagepackageserviceeditiontargetsNot-ECT%s (%s) %s %#vcapablequic ku(devel)alt-svcpurposerequestDOHPathOpenPGPDEFLATEInvalidCommentIntegerAacute;Abreve;Agrave;Assign;Atilde;Barwed;Bumpeq;Cacute;Ccaron;Ccedil;Colone;Conint;CupCap;Dagger;Dcaron;DotDot;Dstrok;Eacute;Ecaron;Egrave;Exists;ForAll;Gammad;Gbreve;Gcedil;HARDcy;Hstrok;Iacute;Igrave;Itilde;Jsercy;Kcedil;Lacute;Lambda;Lcaron;Lcedil;Lmidot;Lstrok;Nacute;Ncaron;Ncedil;Ntilde;Oacute;Odblac;Ograve;Oslash;Otilde;Otimes;Racute;Rarrtl;Rcaron;Rcedil;SHCHcy;SOFTcy;Sacute;Scaron;Scedil;Square;Subset;Supset;Tcaron;Tcedil;Tstrok;Uacute;Ubreve;Udblac;Ugrave;Utilde;Vdashl;Verbar;Vvdash;Yacute;Zacute;Zcaron;aacute;abreve;agrave;andand;angmsd;angsph;apacir;approx;atilde;barvee;barwed;becaus;bernou;bigcap;bigcup;bigvee;bkarow;bottom;bowtie;boxbox;bprime;brvbar;bullet;bumpeq;cacute;capand;capcap;capcup;capdot;ccaron;ccedil;circeq;cirmid;colone;commat;compfn;conint;coprod;copysr;cularr;cupcap;cupcup;cupdot;curarr;curren;cylcty;dagger;daleth;dcaron;dfisht;divide;divonx;dlcorn;dlcrop;dollar;drcorn;drcrop;dstrok;eacute;easter;ecaron;ecolon;egrave;egsdot;elsdot;emptyv;emsp13;emsp14;eparsl;eqcirc;equals;equest;female;ffilig;ffllig;forall;frac12;frac13;frac14;frac15;frac16;frac18;frac23;frac25;frac34;frac35;frac38;frac45;frac56;frac58;frac78;gacute;gammad;gbreve;gesdot;gesles;gtlPar;gtrarr;gtrdot;gtrsim;hairsp;hamilt;hardcy;hearts;hellip;hercon;homtht;horbar;hslash;hstrok;hybull;hyphen;iacute;igrave;iiiint;iinfin;incare;inodot;intcal;iquest;isinsv;itilde;jsercy;kappav;kcedil;kgreen;lAtail;lacute;lagran;lambda;langle;larrfs;larrhk;larrlp;larrpl;larrtl;latail;lbrace;lbrack;lcaron;lcedil;ldquor;lesdot;lesges;lfisht;lfloor;lharul;llhard;lmidot;lmoust;loplus;lowast;lowbar;lparlt;lrhard;lsaquo;lsquor;lstrok;lthree;ltimes;ltlarr;ltrPar;mapsto;marker;mcomma;midast;midcir;middot;minusb;minusd;mnplus;models;mstpos;nVDash;nVdash;nacute;ncaron;ncedil;nearhk;nequiv;nesear;nexist;nltrie;nprcue;nrtrie;nsccue;nsimeq;ntilde;numero;nvDash;nvHarr;nvdash;nvlArr;nvrArr;nwarhk;nwnear;oacute;odblac;odsold;ograve;ominus;origof;oslash;otilde;otimes;parsim;percnt;period;permil;phmmat;planck;plankv;plusdo;plusdu;plusmn;preceq;primes;prnsim;propto;prurel;puncsp;qprime;rAtail;racute;rangle;rarrap;rarrfs;rarrhk;rarrlp;rarrpl;rarrtl;ratail;rbrace;rbrack;rcaron;rcedil;rdquor;rfisht;rfloor;rharul;rmoust;roplus;rpargt;rsaquo;rsquor;rthree;rtimes;sacute;scaron;scedil;scnsim;searhk;seswar;sfrown;shchcy;sigmaf;sigmav;simdot;smashp;softcy;solbar;spades;sqsube;sqsupe;square;squarf;ssetmn;ssmile;sstarf;subdot;subset;subsim;subsub;subsup;succeq;supdot;supset;supsim;supsub;supsup;swarhk;swnwar;target;tcaron;tcedil;telrec;there4;thetav;thinsp;thksim;timesb;timesd;topbot;topcir;tprime;tridot;tstrok;uacute;ubreve;udblac;ufisht;ugrave;ulcorn;ulcrop;urcorn;urcrop;utilde;vangrt;varphi;varrho;veebar;vellip;verbar;wedbar;wedgeq;weierp;wreath;xoplus;xotime;xsqcup;xuplus;xwedge;yacute;zacute;zcaron;zeetrf;nbumpe;notinE;nparsl;nrarrc;nrarrw;sqcaps;sqcups;vsubnE;vsubne;vsupnE;vsupne;%s %s; ieee802rawhdlcnetlinkproto: = "`ILLEGALCOMMENTPackageDefaultMessageImportsMethodsbad loghysteriainsecureHysteriaplatformstandardtls.certacl.filepassworduserpasshttps://filenamedurationdownloadprogresstlsmlkemCurveID(tls echDOWNGRDDOWNGRDhttp/1.1finishedSHA1-RSADSA-SHA1DNS nameGoString01234567netedns0[::1]:53loopbackcontinueunixgramtimeout:trust-adshutdownrecvfromfile+netinvalid address raw-readsendfilereadfromsignal: readlinktruncatescavengepollDescsynctesttraceBufdeadlockraceFinipanicnilcgocheckrunnable is not pointer, errno=BAD RANK status unknown(trigger= npages= nalloc= nfreed=) errno=runtime.[signal reflect.GODEBUG= newval= mcount= bytes, ----- stack=[ minLC= maxpc= stack=[ minutes status= etypes 48828125infinitystrconv.parsing ParseIntno anodeEMT trap/uid_map/gid_mapThursdaySaturdayFebruaryNovemberDecembertime.UTC%!Month( [flags] %s %sstringTofunctionintSliceTrailers15:04:05PANIC=%vomitzeroPRIORITYSETTINGSfont/ttffont/otfhijackedNO_ERRORLocationhttponlysamesite; SecureHTTP/1.0If-MatchIf-Range data=%q incr=%v ping=%qbad_flowpriorityprotocolHTTP/2.0Trailer:trailers%s_%s_%sboundaryHTTP/1.1no-cachePROPFINDidentityhttp/1.0ContinueAcceptedConflict[^\w@.-]subjectsfc00::/7lock_keycert_key%s/%s/%ssso-key instance%s|%d|%siptablesnftablesredirectREDIRECTrejected%s|%s|%s/trafficReq-AddrTX-BytesRX-BytesLifetimeMD5+SHA1SHA3-224SHA3-256SHA3-384SHA3-512SHA2-256nil PoolexporterECDH PCToptionalexplicitdefault:2.5.4.102.5.4.112.5.4.17FuncTypestruct {ArmenianBalineseBopomofoBugineseCherokeeCyrillicDuployanEthiopicGeorgianGujaratiGurmukhiHiraganaJavaneseKatakanaKayah_LiLinear_ALinear_BMahajaniOl_ChikiPhags_PaTagbanwaTai_ThamTai_VietTifinaghUgariticVithkuqiClassANYQuestionTypeAAAATypeAXFRSerial: Expire: MinTTL: Weight: Target: Priorityoverflowgo/typesnet/httpgo/buildchacha8:boolfuncurlquerybad instDuration float64/dev/tungeosite:GET_0RTT (local)HTTP/3.0\.pN\d+_distinct --%s %s: %s Receivedus-asciiif-matchlocationbad_pathif-rangeNO_PROXYno_proxybad timeECC-GOSTINDIRECTCensoredFilteredSERVFAILNXDOMAINYXDOMAINBADTRUNCipv4hintipv6hintAMTRELAYIPSECKEYReservedNSAP-PTRflags:; ; EDE: ; ESU: %s: (%s)%s %s:%d/v2/vpcs/v2/vpc2quic key#fips140readbuf:CTR_DRBGSHA2-512InstFailInstRune[:word:]Assigned\\([^$])toml: %s2006-1-2!!binarytextarearequiredlayer3+4layer2+3encap2+3encap3+4datagrammode(%d)LearningProxyArpuniversetable %dxmit: %sdnroutededitionsrepeatedOptionalRequiredRepeatedsfixed32sfixed64BoolKindEnumKindKind(%d)extendeefeaturesreserveddraft-29gQUIC %d[%d, %d]quic-go1no-storetext/cssbytes=0-prefetchMessagesTypeSVCBIPv4HintIPv6Hintcert_req1609Dot2KeyValueDateTimeBecause;Cayleys;Cconint;Cedilla;Diamond;DownTee;Element;Epsilon;Implies;LeftTee;NewLine;NoBreak;NotLess;Omicron;OverBar;Product;UpArrow;Uparrow;Upsilon;alefsym;angrtvb;angzarr;asympeq;backsim;because;bemptyv;between;bigcirc;bigodot;bigstar;boxplus;ccupssm;cemptyv;cirscir;coloneq;congdot;cudarrl;cudarrr;cularrp;curarrm;dbkarow;ddagger;ddotseq;demptyv;diamond;digamma;dotplus;dwangle;epsilon;eqcolon;equivDD;gesdoto;gtquest;gtrless;harrcir;intprod;isindot;larrbfs;larrsim;lbrksld;lbrkslu;ldrdhar;lesdoto;lessdot;lessgtr;lesssim;lotimes;lozenge;ltquest;luruhar;maltese;minusdu;napprox;natural;nearrow;nexists;notinva;notinvb;notinvc;notniva;notnivb;notnivc;npolint;nsqsube;nsqsupe;nvinfin;nwarrow;olcross;omicron;orderof;orslope;pertenk;planckh;pluscir;plussim;plustwo;precsim;quatint;questeq;rarrbfs;rarrsim;rbrksld;rbrkslu;rdldhar;realine;rotimes;ruluhar;searrow;simplus;simrarr;subedot;submult;subplus;subrarr;succsim;supdsub;supedot;suphsol;suphsub;suplarr;supmult;supplus;swarrow;topfork;triplus;tritime;uparrow;upsilon;uwangle;vzigzag;zigrarr;bnequiv;npreceq;nsubset;nsucceq;nsupset;nvltrie;nvrtrie;metricomieee1394proto: _UNKNOWNprotobufXXX_weakNum(%#q)dst mathrecoveryrecvmmsgKyber512Kyber768IsPublicFullNameJSONNameIsPackedMapValueExtendeeServicesIsClosedzigzag32zigzag6400000000Ping modespeedtestobfs.typepinSHA256hysteria2ParseBoolinterfaceping modeconnectedlog-levellog levelacme.typeauth.typeTCP errorsessionIDUDP errordata-sizeuse-bytes completetlsrsakex%s %x %x config_idHandshakeProc-Type method: (MISSING)%!(EXTRA broadcastmulticastfiles,dnsdns,filesipv6-icmplocalhostip6.arpa.attempts:no-reloadraw-writemissing ] parsing fork/execcontinuedtimerSendpollCacheprofBlockstackpoolhchanLeafwbufSpansGC (idle)mSpanDeadinittracescavtracepanicwaitchan sendpreemptedcoroutinesignal 32signal 33signal 34signal 35signal 36signal 37signal 38signal 39signal 40signal 41signal 42signal 43signal 44signal 45signal 46signal 47signal 48signal 49signal 50signal 51signal 52signal 53signal 54signal 55signal 56signal 57signal 58signal 59signal 60signal 61signal 62signal 63signal 64signal 65signal 66signal 67signal 68signal 69signal 70signal 71signal 72signal 73signal 74signal 75signal 76signal 77signal 78signal 79signal 80signal 81signal 82signal 83signal 84signal 85signal 86signal 87signal 88signal 89signal 90signal 91signal 92signal 93signal 94signal 95signal 96signal 97signal 98signal 99copystackfinalizer ms cpu, (forced) spanq.n= wbuf1.n= wbuf2.n= s.limit= s.state= B work ( B exp.) marked unmarked in use) , size = , tail = newosprocrecover: not in [ctxt != 0, oldval=, newval= threads=: status= blocked= lockedg=atomicor8 runtime= sigcode= m->curg=(unknown)total < 0traceback(durable)} stack=[ gp.goid= lockedm=244140625ParseUintinterruptbus errorWednesdaySeptember-07:00:00Z07:00:00localtimehelp for Flags: boolSliceuintSlicetun-stack%s %q: %sempty urlgeoip.datundefinedLevel(%d)LEVEL(%d) of type omitemptyimage/bmpimage/gifimage/pngvideo/avifont/woff; Domain=HTTP/1.1 :protocol[%v = %d]data_flowauthorityhttp2: %wwebsocketnet/http.HTTP/1.0 at line: hmac-sha1._%s._%s.%sgrant_typeoauth2: %q/v2/iso/%squicv2 key[:^alnum:][:^alpha:][:^ascii:][:^blank:][:^cntrl:][:^digit:][:^graph:][:^lower:][:^print:][:^punct:][:^space:][:^upper:][:xdigit:]rune stream end2006-01-02balance-rrGOING_DOWNGOING_BACKNewDst: %sWeight: %dSyntax(%d)Sint32KindUint32KindSint64KindUint64KindDoubleKindStringKinddependencyoneof_declgo_packagedeprecatedinput_typeMinRTT: %spath_probeearly-datasameorigintoken_typeexpires_inParams keyocsp_multipsk_dhe_keauthz_dataArrayTableBackslash;CenterDot;CircleDot;Congruent;Coproduct;DoubleDot;DownArrow;DownBreve;Downarrow;HumpEqual;LeftArrow;LeftFloor;Leftarrow;LessTilde;Mellintrf;MinusPlus;NotCupCap;NotExists;OverBrace;PlusMinus;Therefore;ThinSpace;TripleDot;UnionPlus;backprime;backsimeq;bigotimes;centerdot;checkmark;complexes;dotsquare;downarrow;gtrapprox;gtreqless;heartsuit;leftarrow;lesseqgtr;nparallel;nshortmid;nsubseteq;nsupseteq;pitchfork;rationals;spadesuit;subseteqq;subsetneq;supseteqq;supsetneq;therefore;triangleq;varpropto;NotSubset;gvertneqq;lvertneqq;ngeqslant;nleqslant;_reserved1infinibandieee802.11%v See %v UnknownX%XUNKNOWN_%dweakFieldsAlpha(%#q)slow_startEnumRangesHasDefaultExtensionsIsMapEntryClient modeServer modeclient mode  HTTP closedconfig fileletsencryptserver modeTCP requestUDP requestskip-uploadperforming tls10servertls: alert(local errorpublic_namec e traffictraffic updApplicationCERTIFICATEPRIVATE KEYinvalid oid%!(BADPREC)submissionsnil contextsetnonblocki/o timeoutraw-control/dev/stdout/dev/stderrunreachableassistQueuenetpollInitreflectOffsglobalAllocmSpanManualstart traceclobberfreegccheckmarkscheddetailunspecifiedcgocall nil s.nelems= of size ) returned runtime: p ms clock, nBSSRoots=runtime: P exp.) for minTrigger=GOMEMLIMIT=bad m value, elemsize= freeindex= span.list=, npages = , a123456=[ p->status= in status idleprocs= gcwaiting= schedtick= timerslen= mallocing=bad timedivfloat64nan1float64nan2float64nan3float32nan1float32nan2float32nan3GOTRACEBACK) at entry+ (targetpc= , plugin: running < 0runtime: g : frame.sp=created by 30517578125bad addressfile existsbroken pipebad messagealarm clocktime: file ACTIVE_HELP Aliases: stringArraystringSlicestringToIntgeosite.datmust be set[%dm%sRFC3339Nanorfc3339nano.WithCancel.WithValue(MarshalJSONMarshalTextshort writehttp-serverhttp2serverhttp2clientEND_HEADERSENABLE_PUSHpartitionedCookie.Path; Max-Age=0/index.html ErrCode=%v, settings:stream_idleack_mysterybad_connectTTL expiredEarly HintsBad RequestBad Gatewayacme_clienttls-alpn-01identifiersretrying_incert_failedstorage_keyserver_namedistributednum_choicesocsp_statusthis_updatenext_updateremote_portmaintenancecertificate%s/zones?%sduckdns.orgdeactivatedHTTP %d: %sstatus_codeRetry-After,"nonce":%qsubproblemsLast-ActiveSHA-512/224SHA-512/256BLAKE2s-256BLAKE2b-256BLAKE2b-384BLAKE2b-512psk_id_hashgeneralizedapplicationbad argSizemethodargs(reflect.SetMath_SymbolPrivate_UsePunctuationDives_AkuruMedefaidrinNag_MundariNandinagariNew_Tai_LueOld_PersianOld_SogdianPau_Cin_HauSignWritingWarang_CitiClassHESIODdnsmessage.authoritiesadditionalsend of filegocachehashgocachetestrandseednoparchive/tarcrypto/x509archive/zip -%s, --%sparse errorfinal tokenread packetunset rule remote-addrH3_NO_ERRORH3_ID_ERRORIn-Reply-ToReturn-Pathretry-afterHTTPS_PROXYhttps_proxymissing CSRid mismatchflags: do; ; SUBNET: ; COOKIE: ; EXPIRE: /v2/account/v2/domains bytes ... InstCaptureInstRuneAny[:^xdigit:]array tablemapping endyYnNtTfFoO~!!timestamp02 Jan 2006balance-xorbalance-tlbbalance-albnot-presentIfindex: %dFixed32KindFixed64KindMessageKindnested_typeoneof_indexallow_aliasoutput_typejson_formatdeclarationProfile: %s (replaced)param valuenamed_curveAES-128-GCMAES-256-GCMExport-onlyHKDF_SHA256HKDF_SHA384HKDF_SHA512InlineTableBernoullis;CirclePlus;EqualTilde;Fouriertrf;ImaginaryI;Laplacetrf;LeftVector;Lleftarrow;NotElement;NotGreater;Proportion;RightArrow;RightFloor;Rightarrow;TildeEqual;TildeTilde;UnderBrace;UpArrowBar;UpTeeArrow;circledast;complement;curlywedge;eqslantgtr;gtreqqless;lessapprox;lesseqqgtr;lmoustache;longmapsto;mapstodown;mapstoleft;nLeftarrow;nleftarrow;precapprox;rightarrow;rmoustache;sqsubseteq;sqsupseteq;subsetneqq;succapprox;supsetneqq;upuparrows;varepsilon;varnothing;ThickSpace;nsubseteqq;nsupseteqq;EnumOptionsFileOptionsString(%#q)fallthroughFieldRangesFileImportsCardinalityHasJSONNameHasPresenceIsExtensionTESTING KEYping addresscheck-updateShow version%s %s %s %sbandwidth.upTCP redirectaddress.ipv4address.ipv6HTTP requestconservativetls.sniGuardtls.clientCAacme.domainsContent-Typeauth.command test failedtlsunsafeekmclose notifyremote errorc hs traffics hs trafficc ap traffics ap traffic PRIVATE KEYECDSA-SHA256ECDSA-SHA384ECDSA-SHA512SSL_CERT_DIR%!(BADWIDTH)multipathtcp127.0.0.1:53pointtopointno such hostunknown portCIDR addressinvalid portcan't happenexit status sweepWaiterscleanupQueuetraceStringsspanSetSpinemspanSpecialtraceTypeTabgcBitsArenasmheapSpecialgcpacertraceharddecommitmadvdontneeddumping heapchan receivesynctest.Runcleanup wait span.limit= span.state=bad flushGen MB stacks, scan: total scan: class worker mode nDataRoots= nSpanRoots= wbuf1= wbuf2= gcscandone runtime: gp= found at *( s.elemsize= B (∆goal , cons/mark maxTrigger= pages/byte s.sweepgen= allocCount page summarytimer_deletens} value: {}, want {r1= [recovered]bad recoveryGOTRACEBACK=bad g statusentersyscallwirep: p->m=) p->status=releasep: m= sysmonwait= preemptoff=cas64 failed m->gsignal=-byte limit runtime: sp=abi mismatchout of rangewrong timerstrace buffer152587890625762939453125illegal seekinvalid slothost is downchild exitedI/O possiblethis commandversion for Examples: Subcommand 'float64Slicereading filecapitalColorcontext.TODOshort bufferPUSH_PROMISECONTINUATIONhttpmuxgo121image/x-iconCookie.Valuehttp2debug=1http2debug=2push_promisedata_on_idleheaders_evendup_trailers100-continuerecv_goaway_content-typestatus code Multi-StatusNot ModifiedUnauthorizedI'm a teapotNot Extendedproxyconnectregistrationmax_durationFileStorage:client_hellocert_managercertificates.compromisedstorage_path/v1/domains/Replay-Noncehttp requestHYSTERIA-PR-unauthorizeddial error: invalid baseSERIALNUMBER has no name has no typereflect.CopyCased_LetterOther_LetterOther_NumberOther_SymbolSpacing_MarkCypro_MinoanMeetei_MayekPahawh_HmongSora_SompengSyloti_NagriRCodeSuccessRCodeRefusednot pollableinvalid pathgotypesaliasrandautoseedbad kind: %sunknown namemapstructureLittleEndianwrite packet/dev/net/tununset rule6 Protocol(%d)Hysteria-UDPidle_timeoutempty packetGSO disabledhttp3-serveridle timeoutMime-VersionX-ImforwardsX-Powered-Bymax-forwardsMax-Forwards (sensitive)max_attemptsauthz_statusStale AnswerDNSSEC BogusNSEC MissingCached ErrorInvalid Data ; PADDING: bad rdlengthbad SVCB keyhmac-sha224.hmac-sha256.hmac-sha384.hmac-sha512./v2/registry/dev/urandomunknown sizeInstAltMatchunexpected )altmatch -> anynotnl -> stream startdocument endsequence endtail commentnot a number' in struct caller errorfamily errorBondMode(%d)LacpRate(%d)ProxyArpWiFizero IPRangeSfixed32KindSfixed64Kindmessage_typejava_packageoptimize_forswift_prefixruby_packagedebug_redactdouble_valuestring_valueverificationis_extensionPhase: DRAINToken: %#x, Doing 0-RTT.EventNoEventlocal_updateaccess_tokenparam lengthuncompressedCircleMinus;CircleTimes;Equilibrium;GreaterLess;LeftCeiling;LessGreater;MediumSpace;NotPrecedes;NotSucceeds;OverBracket;RightVector;Rrightarrow;RuleDelayed;SmallCircle;SquareUnion;SubsetEqual;UpDownArrow;Updownarrow;VerticalBar;backepsilon;blacksquare;circledcirc;circleddash;curlyeqprec;curlyeqsucc;diamondsuit;eqslantless;expectation;nRightarrow;nrightarrow;preccurlyeq;precnapprox;quaternions;straightphi;succcurlyeq;succnapprox;thickapprox;updownarrow;NotLessLess;NotSuperset;unknown type = struct { ieee802.15.4FieldOptionsOneofOptionsprotobuf_keyprotobuf_valFieldNumbersShow version.bindInterfacequic.sockoptstransport.udptls.clientKeyobfs-passwordSOCKS5 servername is emptyTUN listeningTUN TCP errorTUN UDP erroracme.dns.nameempty domainsresolver.typeauth.passwordauth.userpassauth.http.urlskip-downloadtlsmaxrsasizeaccess denieduser canceledPKCS1WithSHA1ECDSAWithSHA1cipher_suiteskey expansionmaster secretCLIENT_RANDOMSHA256-RSAPSSSHA384-RSAPSSSHA512-RSAPSStrailing dataSSL_CERT_FILEemail addresslame referral/etc/servicesinvalid port stop signal: wakeableSleepprofMemActiveprofMemFuturetraceStackTabexecRInternaltestRInternalGC sweep waitsynctest.WaitSIGQUIT: quitSIGKILL: killout of memory is nil, not value method heap metadataunimplemented span.base()=bad flushGen created at: , not pointer != sweepgen MB globals, work.nproc= work.nwait= nStackRoots= flushedWork double unlock s.spanclass= MB) workers=min too large-byte block (runtime: val=runtime: seq= failed with timer_settimefatal error: idlethreads= syscalltick=load64 failedxadd64 failedxchg64 failedmp.g0 stack [nil stackbase} sched={pc:, gp->status= pluginpath= : unknown pc called from runtime: pid=3814697265625invalid base level 3 resetexchange fulltimer expiredsrmount errorpower failure/etc/zoneinfoparsing time out of range in duration is too large_activeHelp_ AddConfigPathdurationSliceSetConfigNamemissing Levelbind-protocoltun-pre-check in host namesni guard: %wnot supportedWINDOW_UPDATESTREAM_CLOSEDCONNECT_ERRORAuthorization; PartitionedCache-ControlLast-ModifiedContent-RangeAccept-RangesIf-None-Match403 Forbiddeninvalid range[FrameHeader unknown timersend_too_muchFQDN too longsocks connectReset ContentLoop Detectedfield name %q%v %w (ca=%s)removing_hashstapling OCSP172.16.0.0/12lock acquiredcert_obtainedXDG_DATA_HOMEAppendRecordsDeleteRecords%s %v: %w: %sAuthenticatorresolve error/dump/streamsinvalid ASN.1bad IV lengthshared_secretempty integerunsupported: dalTLDpSugct? relative to Letter_NumberGunjala_GondiMasaram_GondiMende_KikakuiOld_Hungarianname too longData: []byte{crypto/subtlegocacheverifyhtml/templateinstallgorootUsage of %s: (default %q) (default %s)time.Durationencoding/json (default %v)cleanup rulesTUNSETOFFLOADHysteria-Authimage/svg+xmlaccept-rangesauthorizationcache-controlcontent-rangeif-none-matchlast-modifiedgzip, deflatecpu features:bad signatureForged AnswerNot SupportedNetwork Errorin-addr.arpa.MBZ: 0x%04x, refresh_token/v2/blocks/%s/v2/databases%s/%s/recordsgovultr/3.6.4/v2/instances#failfipscastHMAC-SHA2-256HKDF-SHA2-256invalid UTF-8missing tablemissing fieldmapping startinput error: write error: active-backuplack of bytesEnd.B6.Encapsunknown valuereserved_namedefault_valuephp_namespaceINVALID_TOKENpto (Initial)remote_update1; mode=blockclient_secret[DEBUG] %s %sNoDefaultALPNKyber768-X448LocalDateTimeDownArrowBar;DownTeeArrow;ExponentialE;GreaterEqual;GreaterTilde;HilbertSpace;HumpDownHump;Intersection;LeftArrowBar;LeftTeeArrow;LeftTriangle;LeftUpVector;NotCongruent;NotLessEqual;NotLessTilde;Proportional;RightCeiling;RoundImplies;ShortUpArrow;SquareSubset;UnderBracket;VerticalLine;blacklozenge;exponentiale;risingdotseq;triangledown;triangleleft;NotHumpEqual;varsubsetneq;varsupsetneq;getTypeInfo: MethodOptionsXXX_sizecacheunknownFieldsshort messageshort addressIsPlaceholderReservedNamesquic.sockopts.transport.typebandwidth.downTCP forwardingUDP forwardingfailed to run TUN TCP closedTUN UDP closed/etc/hysteria/unsupported CAsniff.tcpPortssniff.udpPortsoutbounds.nameoutbounds.typeserver stopped test completebad record MACinternal errorX25519MLKEM768/etc/ssl/certsx509sha256skid/etc/protocolssingle-requestunknown mode: prefix length not an ip:portinvalid Prefix (core dumped)/proc/self/exeuserArenaStateGC (dedicated)read mem statsupdatemaxprocsasynctimerchangcstoptheworldprofstackdepthtraceallocfreeGC assist waitfinalizer waitsync.Cond.WaitSIGABRT: aborts.allocCount= Value of type runtime: mmap(nil elem type! to finalizer scan: class L finalizers + GC worker initruntime: full=runtime: want=MB; allocated allspans arrayno deferreturnbad restart PC, called from -thread limit stopm spinning nmidlelocked= needspinning= schedticks=[ randinit twicestore64 failedmemprofileratesemaRoot queuebad allocCountbad span statestack overflow untyped args out of range no module data in goroutine runtime: seq1=runtime: goid=invalid syntax1907348632812595367431640625no such deviceis a directorytext file busyfile too largetoo many linkslevel 3 haltedlevel 2 haltedprotocol errortoo many userswindow changedtime.Location(: extra text: /etc/localtimehelp [command]%s version %s stringToStringBasic realm=%qinvalid format.WithoutCancel.WithDeadline(unexpected EOFContent-LengthPROTOCOL_ERRORINTERNAL_ERRORREFUSED_STREAMMAX_FRAME_SIZE; SameSite=Laxbytes %d-%d/%dERR_UNKNOWN_%dfirst_settingsping_on_streamtrailers_boguscontent-lengthread_frame_eofinvalid methodPRI * HTTP/2.0unknown error unknown code: Not AcceptableCloseWrite: %w %s at: %s inserting_hashcache_capacitynew_expiration192.168.0.0/16acquiring lockcert_obtainingreleasing lock[%s] Renew: %wstatus unknownacmez (%s; %s)UDPIdleTimeoutzero parameterdata truncatedunsafe.Pointer on zero Valuereflect.Value.unknown methodCombining_MarkDecimal_NumberEnclosing_MarkLine_SeparatorRCodeNameErrorResourceHeaderunreachable: malformed filesyscall failedcrypto/fips140mime/multipart\.+*?()|[]{}^$FSNOTIFY_DEBUGenable offloadinvalid offsetHysteria-CC-RX0-RTT rejecteddos_preventionH3 error (%#x)H3_FRAME_ERRORquic-go HTTP/3Accept-CharsetDkim-Signatureaccept-charsetneed more dataREQUEST_METHODchallenge_typeACME challengeEC PRIVATE KEYDSA-NSEC3-SHA1DNSKEY MissingRRSIGs Missing ; KEEPALIVE: ; LOCAL OPT: , timeout %dms20060102150405/v2/backups/%s ... omitting invalid packetunknown dsbyteInstEmptyWidthmissing quotes%04d-%02d-%02d%02d:%02d:%02ddocument startsequence startLink not foundsegs %d [ %s ]reserved_rangefield_presencePhase: STARTUPNO_VIABLE_PATHpacing limitedtime_thresholdcleanup failedmax-age=604800invalid headerrequest failedValue: []byte{types mismatchKyber1024-X448Raw Public Keyexplicit_primeexplicit_char2expected 'inf'expected 'nan'ApplyFunction;DifferentialD;DoubleLeftTee;DoubleUpArrow;LeftTeeVector;LeftVectorBar;LessFullEqual;LongLeftArrow;Longleftarrow;NotTildeEqual;NotTildeTilde;Poincareplane;PrecedesEqual;PrecedesTilde;RightArrowBar;RightTeeArrow;RightTriangle;RightUpVector;SucceedsEqual;SucceedsTilde;SupersetEqual;UpEquilibrium;VerticalTilde;VeryThinSpace;bigtriangleup;blacktriangle;divideontimes;fallingdotseq;hookleftarrow;leftarrowtail;leftharpoonup;longleftarrow;looparrowleft;measuredangle;ntriangleleft;shortparallel;smallsetminus;triangleright;upharpoonleft;NotEqualTilde;varsubsetneqq;varsupsetneqq;protobuf errorMessageOptionsServiceOptionsinvalid kind: protobuf_oneofXXX_OneofFuncsXXX_extensionshttptest.serveReservedRangesSpeed test modecongestion.typeTUN TCP requestTUN UDP request$HOME/.hysteriaacme.dns.configgandi_api_tokennamedotcom_uservultr_api_tokenempty auth typeempty proxy urlmasquerade.typefailed to servehttps://%s:%d%sspeed test modex509keypairleafrecord overflowbad certificatePKCS1WithSHA256PKCS1WithSHA384PKCS1WithSHA512ClientAuthType(extensions typeextensions dataclient finishedserver finishedunknown versionx509usepoliciesmissing addressunknown networknegative offsetnot a directorycopy_file_rangecomputeMaxProcsupdateMaxProcsGallocmRInternalGC (fractional)write heap dumpasyncpreemptoffcheckfinalizersforce gc (idle)sync.Mutex.Lockruntime.Goschedmalloc deadlockruntime error: scan missed a gmisaligned maskruntime: min = runtime: inUse=runtime: max = requested skip=bad panic stackrecovery failedmorestack on g0stopm holding pstartm: m has ppreempt SPWRITEmissing mcache?ms: gomaxprocs=randinit missed] morebuf={pc:: no frame (sp=runtime: frame ts set in timertraceback stuckruntime.gopanicunexpected kind476837158203125no such processadvertise errornetwork is downno medium foundkey has expiredbad system call: cannot parse ,M3.2.0,M11.1.0 %s [command]no-descriptionskey is an aliasUDP not enabledHalfClosedLocalapplication/pdfapplication/oggfont/collectionapplication/zip; SameSite=Nonenegative updatehttp2xconnect=1trailers_pseudobad_path_methodAccept-Encodingrecv_rststream_multipart/mixedIdempotency-KeyPartial ContentRequest TimeoutLength RequiredNot ImplementedGateway Timeoutunexpected typebad trailer keywrite error: %wX-Forwarded-For[%s] Obtain: %wcert_cache_fillempty authz urlHTTP %d %s - %sidentifier_typeresolve error: Hooked-Req-Addrconnect error: is unavailableinvalid integer0601021504Z0700invalid booleannon-minimal tagunknown Go typeinvalid argSizeCurrency_SymbolModifier_LetterModifier_SymbolNonspacing_MarkSpace_SeparatorHanifi_RohingyaPsalter_Pahlavireflectlite.Setinvalid pointernot in a cgroupincomplete linejstmpllitinterptarinsecurepathzipinsecurepathGroup: bad kindInvalid Versionsocket open: %ssocket bind: %snet-udp-dial-%stoo little datanothing to packkey_unavailableIgnoring Retry.stateless_resetECN unsupportedaccept-encoding#multipartfilesAccept-Language/etc/mime.typesaccept-languagex-forwarded-forECDSAP256SHA256ECDSAP384SHA384no-default-alpn/v2/bare-metals/v2/ssh-keys/%s Go fipsinfo impossible date(?i)<(/?)scriptJan _2 15:04:05AddRange(%v-%v)invalid IPRangeinvalid kind %vCardinality(%d)weak_dependencyextension_rangeproto3_optionalunverified_lazyfeature_supportutf8_validationaggregate_valueedition_removedPhase: PROBE_BW0-RTT Protectedpto (Handshake)max-age=2592000x-frame-options%s (status: %d)Kyber512-X25519Kyber768-X25519/proc/self/auxvupn_domain_hintexpected 'true'DiacriticalDot;DoubleRightTee;DownLeftVector;GreaterGreater;HorizontalLine;InvisibleComma;InvisibleTimes;LeftDownVector;LeftRightArrow;Leftrightarrow;LessSlantEqual;LongRightArrow;Longrightarrow;LowerLeftArrow;NestedLessLess;NotGreaterLess;NotLessGreater;NotSubsetEqual;NotVerticalBar;OpenCurlyQuote;ReverseElement;RightTeeVector;RightVectorBar;ShortDownArrow;ShortLeftArrow;SquareSuperset;TildeFullEqual;UpperLeftArrow;ZeroWidthSpace;curvearrowleft;doublebarwedge;downdownarrows;hookrightarrow;leftleftarrows;leftrightarrow;leftthreetimes;longrightarrow;looparrowright;nshortparallel;ntriangleright;rightarrowtail;rightharpoonup;trianglelefteq;upharpoonright;google.protobufextensionFieldsfractional bytedata/check mathinvalid addressContainingOneofRequiredNumbersExtensionRanges0123456789abcdefSOCKS5 TCP errorSOCKS5 UDP errornamedotcom_tokenunsupported modeoutbounds.directclient connectedSkip upload testupdate availableno renegotiationSignatureScheme(hostLookupOrder=/etc/resolv.confnon-IPv4 addressnon-IPv6 addressunknown network no colon on lineinvalid ip:port invalid AddrPortinteger overflowdecoratemappingsgcshrinkstackofftracefpunwindoffGC scavenge waitGC worker (idle)page trace flushselect (durable)SIGNONE: no trapheap reservation/gc/gogc:percent, not a functiongc: unswept span KiB work (bg), mheap.sweepgen=runtime: nelems=workbuf is emptymSpanList.removemSpanList.insertbad special kindpage alloc indexbad summary dataruntime: addr = runtime: base = runtime: head = already; errno= runtime stack: invalid g statusGOTRACEBACK=nonecastogscanstatusbad g transitionschedule: in cgoreflect mismatch untyped locals missing stackmapbad symbol tablenon-Go function pointerless type not in ranges: sigaction failed23841857910156250123456789ABCDEFinvalid argumentinvalid exchangeobject is remotemessage too longremote I/O errorno route to hoststopped (signal)time: bad [0-9]*__completeNoDesc Global Flags: open sink %q: %wProxy-Connectionunsupported unitcontext canceledafter object keyhttpcookiemaxnumHalfClosedRemoteapplication/wasmSETTINGS_TIMEOUTFRAME_SIZE_ERROR*http2.TransportWww-Authenticate Content-Encodingnil *http.Serverinvalid settingssetting_win_sizestream_went_downover_max_streamscontent-encodingread_frame_otherUnencryptedHTTP2%s %s HTTP/1.1 User-Agent: %s transport is nilunexpected type host unreachableAlready ReportedMultiple ChoicesPayment RequiredUpgrade RequiredContent-Length: X-Forwarded-Hostinvalid host: %wacme.zerossl.comunable to unlock_acme-challenge.challenge_tokensapplication/json/records?offset=Duplicate Recordauthorization %sresponse_headers, problem %q: %sHost unreachableprotocol error: GODEBUG: value "TLSv1.3-SHA2-256TLSv1.2-SHA2-256length too largedivision by zeroRel: can't make reflect.MakeFunc: value of type Dash_PunctuationLowercase_LetterOpen_PunctuationTitlecase_LetterUppercase_LetterImperial_AramaicMeroitic_CursiveZanabazar_Squareinvalid dns nameRCodeFormatErrorunpacking headeroutput too smallallowmultiplevcsno such flag -%vregexp: Compile(bad time type %Tbinary.BigEndianHysteria-Paddingversion_mismatch-> Sending Retryproxy-connectionH3_MESSAGE_ERRORH3_CONNECT_ERRORhandling requestquoted-printableContent-Languagecontent-languagecontent-locationwww-authenticateinvalid encodingchallenge faileddns: bad netmaskdns: bad address%s/%s/records/%s/v2/firewalls/%s/v2/reserved-ips/v2/snapshots/%sexec: no commandcandidate is oneincorrect length[bisect-match 0xInstRuneAnyNotNLextra charactersunknown event %dduplicated key 'lower-layer-downVlanProtocol(%d)BondAdSelect(%d)AddPrefix(%v/%v)source_code_infocc_enable_arenascsharp_namespacephp_class_prefixclient_streamingserver_streamingedition_defaultsmessage_encodingidentifier_valueleading_commentsPhase: PROBE_RTTFINAL_SIZE_ERRORKEY_UPDATE_ERRORCRYPTO_ERROR %#xToken: (empty), unexpected writeno dynamic tablemax-age=31536000x-xss-protectionretrying requestEd448-Dilithium3ChaCha20Poly1305expected 'false'CloseCurlyQuote;ContourIntegral;DoubleDownArrow;DoubleLeftArrow;DownRightVector;LeftRightVector;LeftTriangleBar;LeftUpTeeVector;LeftUpVectorBar;LowerRightArrow;NotGreaterEqual;NotGreaterTilde;NotLeftTriangle;OverParenthesis;RightDownVector;ShortRightArrow;UpperRightArrow;bigtriangledown;circlearrowleft;curvearrowright;downharpoonleft;leftharpoondown;leftrightarrows;nLeftrightarrow;nleftrightarrow;ntrianglelefteq;rightleftarrows;rightsquigarrow;rightthreetimes;straightepsilon;trianglerighteq;vartriangleleft;NotHumpDownHump;NotSquareSubset;ieee802.11/prismgoogle/protobuf/EnumValueOptionsXXX_unrecognized-httptest.serve= for polynomial Check for updatesHTTP proxy serverno mode specifiedroute.ipv4Excluderoute.ipv6ExcludeSOCKS5 TCP closedSOCKS5 UDP closedfailed to connectHYSTERIA_ACME_DIRduckdns_api_tokengodaddy_api_tokennamedotcom_serverresolver.tcp.addrresolver.udp.addrresolver.tls.addrdecryption failedhandshake failureillegal parametermissing extensionunrecognized name/etc/ssl/cert.peminvalid BMPStringinvalid IA5String0123456789ABCDEFX0123456789abcdefxreflect.Value.Intpidfd_send_signalcontainermaxprocsgoroutine profileAllThreadsSyscallGC assist markingselect (no cases)sync.RWMutex.Lockwait for GC cycletrace proc statusSIGINT: interruptSIGBUS: bus errorSIGCONT: continuesync.(*Cond).Wait: missing method notetsleepg on g0bad TinySizeClassimmortal metadataruntime: pointer g already scannedmark - bad statusscanobject n == 0swept cached spanmarkBits overflowruntime: summary[runtime: level = , p.searchAddr = futexwakeup addr=, 0, {interval: {ns}}, nil) errno=results: got {r1=internal/runtime/thread exhaustionlocked m0 woke upentersyscallblock spinningthreads=gp.waiting != nilunknown caller pcstack: frame={sp:trace arena allocruntime: nameOff runtime: typeOff runtime: textOff 1192092895507812559604644775390625invalid bit size exec format errorpermission deniedno data availableunknown error 141unknown error 142stale file handlewrong medium typecorrupt zip file fractional secondCOBRA_ACTIVE_HELP%s [command-line]Transfer-Encodingrename failed: %w[UDPHop] [%s] %s in string literalseeker can't seekinvalid stream IDCOMPRESSION_ERRORENHANCE_YOUR_CALMHTTP_1_1_REQUIREDHEADER_TABLE_SIZE; SameSite=StrictIf-Modified-Sinceframe_ping_lengthtruncated headersunencrypted_http2bogus greeting %qreset_idle_streamtransfer-encodingmissing form bodyX-Idempotency-KeyMoved PermanentlyFailed DependencyToo Many RequestsX-Forwarded-Prototext/event-streamurlmaxqueryparams Email address: removing_subjectsload_if_necessarycert_ocsp_revoked^https://.+\.com$session is closedconnection closedunexpected result060102150405Z0700integer too large%%!%c(big.Int=%s)unknown type kind has invalid namereflect: call of reflect.Value.Lenreflect: New(nil)Close_PunctuationFinal_PunctuationOther_PunctuationOld_North_ArabianOld_South_Arabian from a write of multipartmaxpartswinreadlinkvolume (DEPRECATED: %s)%d overflows uint%f overflows uinttoo many segmentsbatch read packetinvalid IP lengthunexpected_packetpath %s validatednot a ClientHellodeadline exceededH3_INTERNAL_ERRORH3_EXCESSIVE_LOADH3_SETTINGS_ERRORH3_DATAGRAM_ERRORmessage too largeif-modified-sincex-forwarded-protosolving challengebad key algorithmSignature ExpiredNot Authoritative ; UPDATE LEASE: , timeout omitted os/exec.Command(exec: killing Cmdexec: not startednot a QUIC packetdivisor too largecandidate is evenKAS-ECC-SSC P-256missing closing )missing closing ]%s at position %dLink %s not foundxmit headroom: %dmarshaling %s: %vpublic_dependencyobjc_class_prefixtrailing_commentsidempotency_levelQUIC_GO_LOG_LEVELAPPLICATION_ERROR, MinAckDelay: %sUnknown EventKindgzip, deflate, br^.*\._Ctype_char$error_descriptionheartbeat_requestuser_mapping_datanon-hex characterincomplete numberinvalid characterDiacriticalAcute;DiacriticalGrave;DiacriticalTilde;DoubleRightArrow;DownArrowUpArrow;EmptySmallSquare;GreaterEqualLess;GreaterFullEqual;LeftAngleBracket;LeftUpDownVector;LessEqualGreater;NonBreakingSpace;NotRightTriangle;NotSupersetEqual;RightTriangleBar;RightUpTeeVector;RightUpVectorBar;UnderParenthesis;UpArrowDownArrow;circlearrowright;downharpoonright;ntrianglerighteq;rightharpoondown;rightrightarrows;twoheadleftarrow;vartriangleright;NotPrecedesEqual;NotSucceedsEqual;NotSucceedsTilde;nextId too large:Wrong socket typeXXX_OneofWrappersqr: too much data--httptest.serve=ContainingMessageIsStreamingClientIsStreamingServerGenerate share URICheck for updates.100.100.100.101/30SOCKS5 TCP requestSOCKS5 UDP requestHTTP CONNECT errorTCP redirect errorHYSTERIA_LOG_LEVELempty http addressoutbounds.http.urlinvalid port unionempty auth commandmasquerade requestSkip download testunexpected messageexport restrictionx509negativeserial/etc/pki/tls/certscannot be negativereflect.Value.Uintserver misbehavinginvalid IP address/etc/nsswitch.confinvalid criteria: unable to parse IPnetip.ParsePrefix(adaptivestackstartdontfreezetheworldtraceadvanceperiodtracebackancestorsgarbage collectionsync.RWMutex.RLockGC worker (active)stopping the worldwait until GC endssystem page size ( but memory size /gc/pauses:seconds because dotdotdotruntime: npages = invalid skip valueruntime: range = {index out of rangeruntime: gp: gp=runtime: getg: g=forEachP: not done in async preempt instruction bytes:mp.gsignal stack [bad manualFreeListruntime: textAddr frames elided... , locked to thread, synctest bubble value out of range298023223876953125input/output errorno child processesidentifier removedno locks availableRFS specific errormultihop attemptedfile name too longstreams pipe errorconnection refusedoperation canceledsegmentation fault: day out of rangeTime.MarshalJSON: Time.MarshalText: unknown time zone may not contain %qProxy-Authenticatefailed to send: %winvalid character context.Backgroundexceeded max depthin numeric literalhttp: blank cookiereceived from peerapplication/x-gzipFLOW_CONTROL_ERROR404 page not foundframe_goaway_shortUNKNOWN_SETTING_%dconnection is idleunexpected type %Ttrailers_not_endedGo-http-client/2.0Go-http-client/1.1Temporary RedirectPermanent RedirectMethod Not AllowedExpectation Failedbad Content-Lengthfield value for %qresponse write: %vresponse flush: %vinvalid IP-literalinserting_subjectstls-alpn challengeattempt %d: %s: %wmust be at least 8Connection refusedunsupported KDF idunsupported KEM idnon-minimal lengthtruncated sequencesequence truncatedreflect.Value.Callreflect.Value.Elemreflect.Value.Typereflect: Zero(nil)Caucasian_AlbanianRCodeServerFailureuse of closed file/cpu.cfs_quota_us/proc/self/cgroupunknown flag: --%stime: unknown unitfield is not validflag %q contains =flag redefined: %sbufio: buffer fullsocket connect: %sbatch write packetinvalid pool indexempty GeoSite nameheader_parse_errorunexpected_version<- Received Retry:invalid IPTOS sizeproxy-authenticateRequest.URL is nildecoding error: %vcleaning up solverchallenge acceptedsignature requiredbad authenticationbad extended rcodeno signature foundno secrets definedRSASHA1-NSEC3-SHA1use tcp keep-aliveoverflow packing a/v2/load-balancersrsa: key too smallcrypto/rsa: p == qgo fips object v1 unhandled part: %stag:yaml.org,2002:XmitHashPolicy(%d)RemoveRange(%v-%v)positive_int_valuenegative_int_valueedition_introducededition_deprecatedHYSTERIA_BBR_DEBUGCONNECTION_REFUSEDSTREAM_LIMIT_ERRORSTREAM_STATE_ERRORPROTOCOL_VIOLATIONAEAD_LIMIT_REACHED (frame type: %#x)unknown frame typeserver_0rtt_secretserver_1rtt_secretclient_0rtt_secretclient_1rtt_secretinvalid connectionhttp3:frame_parsedget, post, options^(.+)\[([0-9]+)\]$performing requestTLSSupportedGroupsheartbeat_responseneed a \n after \rDoubleUpDownArrow;DoubleVerticalBar;DownLeftTeeVector;DownLeftVectorBar;FilledSmallSquare;GreaterSlantEqual;LeftDoubleBracket;LeftDownTeeVector;LeftDownVectorBar;LeftTriangleEqual;NegativeThinSpace;NotReverseElement;NotTildeFullEqual;RightAngleBracket;RightUpDownVector;SquareSubsetEqual;VerticalSeparator;blacktriangledown;blacktriangleleft;leftrightharpoons;rightleftharpoons;twoheadrightarrow;NotGreaterGreater;NotLessSlantEqual;NotNestedLessLess;NotSquareSuperset;qr: internal errorEd25519-Dilithium2fdControlUnixSocketconnected to serverHTTP CONNECT closedTCP redirect closedHYSTERIA_LOG_FORMATempty outbound nameresolver.https.addrempty auth passwordempty auth userpassempty auth http urlmasquerade.file.dirclient disconnectedshow URI as QR codespeed test completeno update availablerevoked certificateexpired certificateunknown certificateunknown cipher typemaximum_name_lengthx509: malformed OIDx509: trailing datax509: unknown errorreflect.Value.IsNilreflect.Value.Floatparsenetlinkmessagecriterion too short too large for IPv4 too large for IPv6strongFromWeakQueueGC mark terminationsync.WaitGroup.Waitchan send (durable)SIGTRAP: trace trapwait for debug callcgocall unavailablepanicwrap: no ( in panicwrap: no ) in called using nil *unknown wait reasonnotesleep not on g0GC work not flushedunaligned sysUnused/gc/scan/heap:bytes/gc/heap/goal:bytes/gc/heap/live:bytesmarkroot: bad indexnwait > work.nprocs, gp->atomicstatus=marking free object KiB work (eager), [controller reset]mspan.sweep: state=sysMemStat overflowbad sequence numberpanic during mallocpanic holding locksmissing deferreturnunexpected gp.parampanic during panic , g->atomicstatus=unexpected g status_cgo_setenv missingbad runtime·mstartm not found in allmstopm holding lockssemaRoot rotateLeftbad notifyList sizeruntime: preempt g0runtime: pcdata is unsupported version14901161193847656257450580596923828125bad file descriptortoo many open filesdevice not a streamdirectory not emptydisk quota exceededillegal instructionstopped (tty input)/proc/self/uid_map/proc/self/gid_mapbad value for field/usr/lib/locale/TZ/time: unknown unit Proxy-Authorizationinvalid URL escape missing ']' in host%v write error: %v after array elementhttp: Server closedINADEQUATE_SECURITYINITIAL_WINDOW_SIZEIf-Unmodified-Sinceframe_data_stream_0 (%d bytes omitted)err must be non-nilTLS version too lowflow_on_data_lengthheaders_half_closedmultipart/form-dataContent-Length: 0 invalid header namenetwork unreachableSwitching ProtocolsPrecondition FailedMisdirected RequestService Unavailableinvalid Trailer keyConnection: close already registeredunknown status codeapi.letsencrypt.orgcached_managed_certtrying issuer %d/%dtls_get_certificateobtain_if_necessaryorder took too long (%s_identifier=%s)RequestHook enabledinvalid status codeNetwork unreachableconnection closed: unknown hash value negative coordinatesync.Cond is copiedunsupported AEAD id20060102150405Z0700unknown Go type: %vskip this directory2006-01-02 15:04:05reflect.Value.Bytesreflect.Value.Fieldreflect.Value.Indexreflect.Value.Slice are not comparableInitial_PunctuationParagraph_SeparatorCanadian_AboriginalKhitan_Small_Scriptzero length segmentRCodeNotImplemented/cpu.cfs_period_usembedfollowsymlinksgotestjsonbuildtextmultipartmaxheadersfile already existsfile does not existfile already closedbad flag syntax: %sunexpected InstFailbinary.LittleEndianpacket is too shortempty domain suffixunsupported_versionversion_negotiationClosing connection.quic: server closedQUIC_GO_DISABLE_GSOQUIC_GO_DISABLE_ECNH3_FRAME_UNEXPECTEDH3_MISSING_SETTINGSH3_REQUEST_REJECTEDH3_VERSION_FALLBACKContent-Dispositionmime: no media typecontent-dispositionif-unmodified-sinceproxy-authorizationinvalid Host headervalue for header %qevictCount overflowNo Zone Key Bit SetAPL prefix too longAPL length too long%02d %02d %0.3f %s invalid port %s: %v/v2/startup-scriptsexec: canceling Cmdno DoH URL providedmodulus must be > 1while parsing a tag2006-01-02T15:04:0502 Jan 06 15:04 MSTJan _2 15:04:05.000BondArpValidate(%d)BondFailOverMac(%d)RemovePrefix(%v/%v)descriptor mismatchjava_multiple_filescc_generic_servicespy_generic_servicesdeprecation_warninginvalid perspectiveinvalid sample sizetoken too short: %dhttp3:frame_createdtiming-allow-origindnsmessage.SVCParamParams value lengthP256Kyber768Draft00 "(),/:;<=>?@[]\{}array is incompleteDownRightTeeVector;DownRightVectorBar;LongLeftRightArrow;Longleftrightarrow;NegativeThickSpace;PrecedesSlantEqual;ReverseEquilibrium;RightDoubleBracket;RightDownTeeVector;RightDownVectorBar;RightTriangleEqual;SquareIntersection;SucceedsSlantEqual;blacktriangleright;longleftrightarrow;NotLeftTriangleBar;ieee802.11/radiotapinvalid nil pointerExtensionRangeArrayfield %v is invalidapplication_limitedgoogle.protobuf.AnyHTTP CONNECT requestTCP forwarding errorUDP forwarding errorTCP redirect connectdisable-update-checkdisable update checkcloudflare_api_tokeninvalid IPv4 addressinvalid IPv6 addressempty socks5 addressempty file directorymasquerade.proxy.urlempty string contentdownloading databasechecking for updatesunknown PSK identitycertificate requiredcipher_suites kdf_idx509usefallbackrootsgetCert can't be nilinvalid UTF-8 stringx509: malformed spkiinvalid DNS responseunexpected network: missing IPv6 addressunexpected characternegative Prefix bitsfloating point errorGC sweep terminationResetDebugLog (test)chan send (nil chan)flushing proc cachesSIGALRM: alarm clockSIGTERM: terminationclose of nil channelnotetsleep not on g0bad system page size to unallocated span/gc/scan/stack:bytes/gc/scan/total:bytes/gc/heap/frees:bytes/gc/gomemlimit:bytesp mcache not flushed markroot jobs done pacer: assist ratio=workbuf is not emptybad use of bucket.mpbad use of bucket.bpruntime: double waitpreempt off reason: forcegc: phase errorgopark: bad g statusgo of nil func valueselectgo: bad wakeupsemaRoot rotateRightreflect.makeFuncStubtrace: out of memorywirep: already in go37252902984619140625invalid request codebad font file formatis a named type fileconnection timed outkey has been revokedurgent I/O conditionstopped (tty output)time: invalid number/usr/share/zoneinfo/BASH_COMP_DEBUG_FILEjson: Unmarshal(nil)json: Unmarshal(nil json: error calling invalid write resultpad length too largehttp2: stream closedhttplaxcontentlengthMAX_HEADER_LIST_SIZE%s connection error: %sframe_settings_mod_6No space found in %qconn_close_lost_pingsettings_big_or_dupsassigned stream ID 0read_frame_too_largeinvalid use of queuehttp: POST too largeHTTP/%d.%d %03d %s invalid header valueunknown address typeRequest URI Too LongUnprocessable EntityInsufficient Storagecertificate is emptyrenewing certificate%s: file info is nilchoosing certificateencoding payload: %vcreating request: %wh3=":%d"; ma=2592000https://%s/dns-queryno address availableunsupported suite IDinvalid integer typeasn1: syntax error: number has no digitsbad karatsuba lengthreflect: cannot use returned zero Valuereflect.Value.IsZeroreflect.Value.Methodreflect.Value.SetIntEgyptian_HieroglyphsMeroitic_HieroglyphsLogValue panicked %s^([-+]?\d*)(\.\d*)?$unsupported type: %shas invalid keys: %shas unset fields: %sflag: help requestedno route to interneterror at line %d: %slistener already setSetting DF for IPv4.Setting DF for IPv6.H3_REQUEST_CANCELLEDhttp3: panic servinggzip: invalid headerheader line too longno identifiers foundno solver configuredbad OCSP signature: DNSSEC Indeterminateoverflow unpacking aoverflow packing hexoverflow packing opt/v2/private-networksKEM is not supportedKDF is not supportedinvalid PCG encodingsha3: Sum after Readexpression too largeinvalid repeat countexpected digit (0-9)invalid map key: %#vunknown scalar styleinvalid parser statewhile parsing a nodewhile scanning a tag/sys/class/net/%s/%sinvalid MPLS RTA_DSTjava_outer_classnameuninterpreted_option[BBRSender] [%s] %s FRAME_ENCODING_ERRORreordering_thresholdunexpected event: %vDropping 0-RTT keys.EventDiscard0RTTKeysquic-go token sourcerecovery:mtu_updatedrecovery:packet_lostsecurity:key_updated^.*\._Ctype_uint8_t$peer_allowed_to_sendDoubleLongLeftArrow;DownLeftRightVector;LeftArrowRightArrow;NegativeMediumSpace;RightArrowLeftArrow;SquareSupersetEqual;leftrightsquigarrow;NotGreaterFullEqual;NotRightTriangleBar;invalid field numberWARNING: %v See %v invalid map key typeqr: invalid pad sizecongestion_avoidancetls.clientCertificatecongestion.bbrProfileTCP transparent proxyUDP transparent proxyTCP forwarding closedUDP forwarding closedunsupported SNI guardunsupported ACME typeoutbounds.direct.modeoutbounds.socks5.addrunsupported auth typeserver up and runningdecompression failureunsupported extensioncipher_suites aead_idinvalid NumericStringx509: invalid versionunsupported operationreflect.Value.Complexsingle-request-reopenparsenetlinkrouteattrIPv4 address too longunexpected slice sizenegative shift amountdataindependenttimingsystem goroutine wait/gc/heap/allocs:bytesruntime: work.nwait= previous allocCount=, levelBits[level] = runtime: searchIdx = profiler hash bucketsdefer on system stackpanic on system stackasync stack too large_cgo_unsetenv missingstartm: m is spinningstartlockedm: m has pfindrunnable: wrong ppreempt at unknown pcreleasep: invalid argcheckdead: runnable g from outside bubble runtime: newstack at runtime: newstack sp=runtime: confused by pcHeader.textStart= timer data corruption186264514923095703125931322574615478515625block device requiredread-only file systempackage not installedlink has been severedstate not recoverabletrace/breakpoint trapuser defined signal 1user defined signal 2virtual timer expired/proc/self/setgroupstime zone offset hour Did you mean this? Available Commands:failed to connect: %wfailed to receive: %wCongestionConfig.TypeHYSTERIA_UDPHOP_DEBUGkey is not comparableafter top-level valuein string escape codefeature not supportedhttp: nil Request.URLUNKNOWN_FRAME_TYPE_%dframe_ping_has_streamover_max_streams_racetoo_many_early_resetsRoundTrip failure: %vheader list too largeUnhandled Setting: %vnet/http: nil Contexttoo many Host headersmalformed Host header%03d status code %d unknown address type command not supportedPrecondition RequiredInternal Server Errorhttp: proxy error: %vinvalid hex charactergetting directory: %wno certificate chainsobtaining certificateunknown PEM header %qqueueing renewal taskadvancing OCSP staplemissing directory URLapplication/jose+jsonBandwidthConfig.MaxTxBandwidthConfig.MaxRxinvalid outbound modeCommand not supportedoutbound %s not foundmessage limit reachedsequence tag mismatchunknown ABI part kind of unexported methodunexpected value stepreflect.Value.SetZeroreflect.Value.Pointerreflect.Value.SetUintConnector_PunctuationAnatolian_HieroglyphsInscriptional_Pahlavibad type in compare: /proc/self/mountinfoconcurrent map writespflag: help requested%s flag redefined: %srecord on line %d: %vflag %q begins with -bufio: negative countcause on an nil errorip: unknown version: interface not found: duplicate stream dataConnection %s closed.unknown_connection_idpayload_decrypt_errormisrouted packet: %#vtoo many open streamserror writing requestH3_INCOMPLETE_REQUESTduplicate setting: %dmissing :status fielduserinfo_in_authorityunknown OCSP status: buffer size too smallStale NXDOMAIN Answeroverflow packing aaaaoverflow packing nsecoverflow packing SVCBhttps://api.vultr.com/v2/object-storage/%sexec: already startedinvalid varint lengthAEAD is not supporteddecryption failed: %wsimulated PCT failureinvalid scalar lengthcrypto/rsa: p is eveninvalid named captureunhandled kv part: %sinvalid emitter stateexpected STREAM-STARTexpected DOCUMENT-ENDcannot marshal type: write handler not set02 Jan 06 15:04 -0700BondArpAllTargets(%d)unknown SEG6 Type: %dno hyphen in range %qjava_generic_servicesMax Datagram Size: %dHYSTERIA_BRUTAL_DEBUGinvalid ECN value: %dinvalid reserved bitsunknown ECN state: %dECN mangling detectedinvalid send mode: %dserver_initial_secretclient_initial_secretEventWriteInitialDataEventReceivedReadKeysDropping key phase %dtransport:packet_senthttp3:datagram_parsedcannot handle type %Tinvalid character %#Uexpected character %cCapitalDifferentialD;DoubleLeftRightArrow;DoubleLongRightArrow;EmptyVerySmallSquare;NestedGreaterGreater;NotDoubleVerticalBar;NotLeftTriangleEqual;NotSquareSubsetEqual;OpenCurlyDoubleQuote;ReverseUpEquilibrium;NotGreaterSlantEqual;message_set_extensionExtensionRangeOptionsmismatching field: %vinvalid QR version %dfinished without errorTCP redirect listeningTCP forwarding connectUDP forwarding connectinvalid config: %s: %sempty cert or key pathempty resolver addressmasquerade.listenHTTPSerror decoding messageinappropriate fallbackTLS_AES_128_GCM_SHA256TLS_AES_256_GCM_SHA384ECDSAWithP256AndSHA256ECDSAWithP384AndSHA384ECDSAWithP521AndSHA512extended master secrethkdf: counter overflow/etc/ssl/ca-bundle.pemx509: malformed issuerreflectlite.Value.Typemissing ']' in addressinvalid address familyoperation was canceledIPv4 address too shortmultiple :: in addressbad bits after slash: integer divide by zeroCountPagesInUse (test)ReadMetricsSlow (test)trace reader (blocked)trace goroutine statusGC weak to strong waitchan receive (durable)SIGTSTP: keyboard stopsend on closed channelgetenv before env initinterface conversion: freeIndex is not valids.freeindex > s.nelemsbad sweepgen in refillspan has no free spaceruntime: out of memory/gc/scan/globals:bytes/gc/heap/frees:objectsruntime: work.nwait = runtime:scanstack: gp=scanstack - bad statusheadTailIndex overflowruntime.main not on m0set_crosscall2 missingbad g->status in readywirep: invalid p stateassembly checks failed received during fork stack not a power of 2minpc or maxpc invalidnon-Go function at pc=4656612873077392578125argument list too longcannot allocate memoryremote address changedprotocol not availableprotocol not supportedaddress already in usenetwork is unreachable/lib/time/zoneinfo.zipHelp about any command Additional Commands:unrecognized level: %qmust be at least 16384unknown field type: %v into Go struct field json: unknown field %qhttp2: frame too largewrite on closed bufferbody closed by handlerapplication/postscriptDEBUG_HTTP2_GOROUTINESMAX_CONCURRENT_STREAMSframe_data_pad_too_bigunexpected empty hpackmalformed HTTP requestmalformed HTTP versionX-Content-Type-OptionsUnsupported Media Typecreating lock file: %v/v4/domains/%s/records<(.+?)>;\s*rel="(.+?)"performing request: %wmust be at least 65536overflowing coordinatezero length BIT STRINGinvalid number base %dinternal inconsistencyreflect.Value.MapIndexunexpected method stepreflect.Value.SetFloat to array with length Inscriptional_ParthianNyiakeng_Puachue_Hmongreflectlite.Value.Elemskipping Question Nameskipping Question Typeexit hook invoked exitflag %q does not existwrong number of fieldsipv4: fragment droppedinvalid address lengthinvalid padding lengthinvalid message lengthinvalid conn id lengthquic: transport closederror writing trailerswrite on closed streamhttp3: nil Request.URL/usr/share/mime/globs2/etc/apache/mime.typesgzip: invalid checksumaccess-control-max-ageinvalid HTTP header %sinvalid Trailer key %qhpack: string too longheader field %q = %q%sidna: invalid label %qcreating new order: %wUnknown hash algorithmbad OCSP response typeinvalid responder nameconn has no connectionNo Reachable Authorityunrecognized address: overflow packing uint8overflow unpacking txtoverflow unpacking hexoverflow unpacking optnsec bits out of orderextra APL address bitsport cannot be < 0: %dsimulated CAST failureout-of-range candidatecrypto/rsa: p * q != nsha3: Write after Readerror parsing regexp: expected a : separatorapplication/javascriptJan _2 15:04:05.000000mode %s segs %d [ %s ]java_string_check_utf8php_metadata_namespaceSetMaxDatagramSize: %dCRYPTO_BUFFER_EXCEEDEDpto (Application Data)Dropping Initial keys.EventHandshakeCompleterecovery:spurious_losssecurity:key_discardedhttp3:datagram_createdx-content-type-optionsunexpected length codeparameter out of orderCloseCurlyDoubleQuote;DoubleContourIntegral;FilledVerySmallSquare;NegativeVeryThinSpace;NotPrecedesSlantEqual;NotRightTriangleEqual;NotSucceedsSlantEqual;oneof type already setunknown parent type %TXXX_InternalExtensionsnon-numeric string %#qbuild line missing '='invalid UTF-8 detected0123456789abcdefABCDEFserver address is emptylisten address is emptySOCKS5 server listeningremote address is emptyempty DNS provider nameduckdns_override_domaindo not show URI as textunsupported certificateno application protocolech accept confirmationCLIENT_TRAFFIC_SECRET_0SERVER_TRAFFIC_SECRET_0tls: invalid PSK binderQUICEncryptionLevel(%v)/etc/pki/tls/cacert.peminvalid PrintableStringx509: malformed UTCTimex509: invalid key usagex509: malformed versionreflectlite.Value.IsNilunexpected address typemissing port in addressindex out of range [%x]ReadMemStatsSlow (test)chan receive (nil chan)garbage collection scanSIGSYS: bad system callSIGIO: i/o now possiblemakechan: bad alignmentclose of closed channelunlock of unlocked lock) must be a power of 2 system huge page size (runtime: s.allocCount= s.allocCount > s.nelems/gc/heap/allocs:objectsruntime: internal errorwork.nwait > work.nprocleft over markroot jobsgcDrain phase incorrectMB during sweep; swept bad profile stack countruntime: eventfd failedruntime: netpoll failedpanic during preemptoffnanotime returning zeroschedule: holding locksinternal/runtime/atomicprocresize: invalid argmisuse of profBuf.writeunexpected signal valuespan has no free stacksstack growth after forkshrinkstack at bad timereflect.methodValueCall23283064365386962890625operation not permittedinterrupted system calldevice or resource busyno space left on deviceoperation not supportedprofiling timer expiredCPU time limit exceededtime zone offset minutetime zone offset secondtime: invalid duration ShellCompDirectiveErrorCOMPLETION_DESCRIPTIONSUnknown help topic %#q checking if file existsprotocol already in usemissing protocol schemeinvalid URI for requestjson: cannot unmarshal into Go value of type unexpected map key typehttp2: handler panickedhttp: request too largenet/http: abort Handlertext/xml; charset=utf-8ENABLE_CONNECT_PROTOCOLError reading directoryunknown error code 0x%xframe_goaway_has_streamframe_headers_pad_shortframe_rststream_bad_lennet/http context value malformed HTTP responsenon-zero reserved fieldnetwork not implementedcommand not implementedVariant Also Negotiatesaccessing lock file: %vmaking OCSP request: %v%s/zones/%s/dns_recordshttps://api.godaddy.comsigning EAB content: %wprovisioning client: %wHTTP request failed: %dbytes.Buffer: too large", missing CPU support asn1: structure error: truncated tag or lengthbad karatsubaSqr lengthsyntax error in patternreflect.Value.Interfacereflect.Value.NumMethodtoo many pointers (>10)segment length too longunpacking Question.Nameunpacking Question.Typeskipping Question Classexit hook invoked paniccalled from %s (%s:%d) (rest of stack elided) Split called after Scanget file descriptor: %sunsupported domain typeunknown packet type: %stoo short connection IDmultiple SNI extensionsSNI host_name not foundmultiple ECH extensionspeer sent too much dataunknown error code: %#x:protocol must be emptyinvalid status code: %wmultipart: NextPart: %w/etc/apache2/mime.typestext/css; charset=utf-8invalid HTTP trailer %svarint integer overflowfinalizing order %s: %wdone waiting for solverauthorization finalizedSignature Not Yet Validoverflow packing uint16overflow packing uint32 ; LONG LIVED QUERIES: ; DS HASH UNDERSTOOD: dns: bad address familyoverflow unpacking aaaaoverflowing header sizeoverflow packing uint64overflow packing base32overflow packing base64overflow unpacking SVCBrecord type not SRV: %sapplication/dns-messagesetsockopt(IPV6_V6ONLY)setsockopt(TCP_NODELAY)unsupported version: %xFIPS 140-3 PCT passed: P224 point not on curveP256 point not on curveP384 point not on curveP521 point not on curveEd25519 sign and verifyed25519: bad public keyRSA sign and verify PCTcrypto/rsa: d too smallpattern bits too long: invalid escape sequenceunknown character widthwhile scanning an aliasBondPrimaryReselect(%d)Family: %d, Address: %smessage_set_wire_formatrepeated_field_encoding[BrutalSender] [%s] %s unknown packet type: %dinvalid first ACK rangetoken must not be emptyserver_handshake_secretclient_handshake_secretEventWriteHandshakeDataunknown cipher suite %dPeer updated keys to %dcontent-security-policyflate: internal error: invalid scalar encodingexpected value, not eofDiacriticalDoubleAcute;NotSquareSupersetEqual;bad %s slice length: %dmultiple files named %qmismatching cardinalityunsupported edition: %vinvalid Message.Get on invalid Message.Set on unknown connection typeunknown accessor: %v.%s%v has unknown kind: %vobfs.salamander.passwordTCP forwarding listeningUDP forwarding listeningunsupported DNS providerHTTP reverse proxy errorerror decrypting messagecertificate unobtainableTLS_RSA_WITH_RC4_128_SHAtls: malformed ECHConfigtls: server rejected ECHx509: malformed validityaddress string too shorttracecheckstackownershiphash of unhashable type cannot open standard fdsspan has no free objectsruntime: found obj at *(/cgo/go-to-c-calls:calls/gc/heap/objects:objects/sched/latencies:secondsqueuefinalizer during GCcheckfinalizers: queue: update during transitionruntime: markroot index can't scan our own stackgcDrainN phase incorrectpageAlloc: out of memoryruntime: p.searchAddr = range partially overlapsruntime: epollctl failed [recovered, repanicked]stack trace unavailable runtime: mp.lockedInt = runqsteal: runq overflowgoroutine stack (system)unexpected syncgroup setdouble traceGCSweepStartbad use of trace.seqlock116415321826934814453125582076609134674072265625level 2 not synchronizedlink number out of rangeout of streams resourcesfunction not implementedconnection reset by peerstructure needs cleaningfloating point exceptionfile size limit exceededRawSockaddrAny too small/usr/share/lib/zoneinfo/While parsing config: %smust start with a letterfailed to set fwmark: %wfailed to control fd: %wjson: unsupported type: Mon Jan _2 15:04:05 2006text/html; charset=utf-8unexpected buffer len=%vinvalid pseudo-header %qframe_headers_prio_shortread_frame_conn_error_%sstream %d already openedapplication/octet-streamPRI * HTTP/2.0 SM ConnContext returned nilRequest Entity Too Largehttp: nil Request.Headercreating ACME client: %vdecoding private key: %vgetting ACME account: %vfinal attempt; giving upcertificate has no namesunsupported key type: %Tunknown private key typeNS %s returned %s for %sapplication/ocsp-requestgot errors: HTTP %d: %+vauthorization failed: %wapplication/problem+jsonpolling order status: %wunknown request type: %dreflect.StructOf: field reflect.Value.SetComplexresource length too longunpacking Question.Classdnsmessage.MustNewName("dnsmessage.Option{Code: htmlmetacontenturlescapeinvalid ChaCha8 encodingValue kind is %s, not %sresult must be a pointercreate vectorised writerbuild IPv4 route addressbuild IPv6 route addressempty GeoIP country codeinvalid CIDR address: %squic: tls.Config not setinvalid QUIC version: %serror parsing packet: %sDATAGRAM frame too largeunknown encryption levelError parsing packet: %sinvalid IPV6_TCLASS sizeAdding connection ID %s.http3: headers too largehttp3: conn unusable: %sduplicate control streamH3_STREAM_CREATION_ERRORexpected Base to be zeroinvalid request :path %qMalformed Content-Lengthcould not write trailersignoring invalid trailerhttp3: invalid method %qinvalid argument to Intnidna: disallowed rune %Uvalidating authorizationinvalid responder id tagoverflow unpacking uint8exec: Stdout already setexec: Stderr already setinvalid argument to IntNbigmod: division by zerochacha20: wrong key sizeinvalid pattern syntax: sha3: invalid hash state(\$)(\{?([A-Z0-9_]+)\}?)duplicate %TAG directiveread handler must be setexceeded max depth of %dwhile scanning an anchorstreamSafe was not reset2006-01-02T15:04:05-07002006-01-02 15:04:05Z0700unable to parse date: %sMore than one link foundrange %v to %v not validnot a long header packetACK decreases ECN countsnegative bytes_in_flightunknown cypher suite: %dDropping Handshake keys.keys updated too quicklytransport:packet_droppedrecovery:metrics_updatedtransport:parameters_setpublic, max-age=31536000text/plain;charset=utf-8flate: maxBits too largeGODEBUG sys/cpu: value "", required CPU feature peer_not_allowed_to_sendhpke: invalid HPKE suiteneed a character after \NotNestedGreaterGreater;encodeArray: nil elementmismatching enum lengthsempty DNS provider configoutbounds.direct.bindIPv4outbounds.direct.bindIPv6unsupported outbound typeunsupported resolver typemasquerade.string.contenttls: protocol is shutdownx509: invalid RDNSequencex509: invalid RSA modulusx509: malformed extensionx509: malformed signature2006-01-02T15:04:05Z07:00no answer from DNS serverno such network interfaceno suitable address foundunexpected '[' in addressunexpected ']' in addressIPv4 field has value >255/proc/sys/kernel/hostnamegoroutine profile cleanupGOMAXPROCS updater (idle)chansend: spurious wakeup when attempting to open runtime·lock: lock countbad system huge page sizearena already initialized to unused region of spanunaligned sysNoHugePageOS/sched/gomaxprocs:threadsmissing type in finalizerremaining pointer buffersruntime: epollwait on fd slice bounds out of range_cgo_thread_start missingallgadd: bad status Gidleruntime: program exceeds startm: p has runnable gsstoplockedm: not runnablereleasep: invalid p statecheckdead: no p for timercheckdead: no m for timerunexpected fault address missing stack in newstackbad status in shrinkstackmissing traceGCSweepStart2910383045673370361328125no such file or directoryno such device or addressinvalid cross-device linkresource deadlock avoidedsocket type not supportedno buffer space availableoperation now in progressunknown command %q for %q Additional help topics:' does not support flag 'ShellCompDirectiveNoSpaceShellCompDirectiveDefaultno encoder name specifiednet/url: invalid userinfoQUICConfig.MaxIdleTimeoutcontext deadline exceededjson: Unexpected key typereflect.Value.OverflowIntjson: unsupported value: not at beginning of valuehttp: invalid cookie nametext/plain; charset=utf-8500 Internal Server Errorhttp2: Framer %p: read %vframe_data_pad_byte_shortframe_settings_has_streamframe_headers_zero_streamframe_headers_pad_too_bigframe_priority_bad_lengthhttp2: invalid header: %vhttp2: unsupported schemeread_frame_unexpected_eofhttp: invalid Host headerHTTP/1.1 100 Continue port number out of range invalid username/passwordreading email address: %v()[]{}<> "\!@#$%^&|;'+=no certificates availableobtaining new certificateserved key authenticationcreating OCSP request: %vreading OCSP response: %vparsing OCSP response: %v/v4/domains/%s/records/%sreading response body: %wHYSTERIA_FIREWALL_BACKENDno IPv4 address availableno IPv6 address availableinvalid protocol/port: %sGODEBUG: can not enable "unknown Go type for sliceexplicit tag has no childinvalid object identifierreflect.Value.SetMapIndexreflect: Bits of nil Typereflect.StructOf: field "inconsistent poll.fdMuteximpossible cgroup versionhash of unhashable type: slog: level string %q: %wmissing interface addressipv4: udp: invalid packetipv6: udp: invalid packetGeoSite name %s not foundunexpected frame type: %sDestroying connection: %sBUG: invalid send mode %ddatagram support disabledswitching to path %d (%s)write on closed stream %dH3_GENERAL_PROTOCOL_ERRORH3_CLOSED_CRITICAL_STREAMunknown pseudo header: %sunexpected type byte: %#xcould not flush to streamhttp3: nil Request.Headerblake2b: invalid key sizeContent-Transfer-Encodingstrict-transport-securitytrying to solve challengeocsp: error from server: overflow unpacking uint16overflow unpacking uint32overflow unpacking uint64overflow unpacking base32overflow unpacking base64overflow packing anything/v2/firewalls/%s/rules/%dcrypto/rsa: invalid primetesting simulated failurehour cannot be greater 23unable to parse float: %w2006-1-2 15:4:5.999999999while parsing a flow nodedid not find expected keyinvalid Unicode characterdid not find expected '!'_html_template_urlescaper(?i)<(script|/script|!--)2006-01-02 15:04:05Z07:002006-01-02 15:04:05 -0700Jan _2 15:04:05.000000000required field %v not setleading_detached_commentsTRANSPORT_PARAMETER_ERRORCONNECTION_ID_LIMIT_ERRORnot a short header packet, EnableResetStreamAt: %tECN capability confirmed.Skipping packet number %d updated RTT: %s (σ: %s)transport:packet_receivedtransport:packet_bufferedupgrade-insecure-requests^.*\._Ctype_unsignedchar$unexpected HTTP status %sdnsmessage.SVCParam{Key: ansiX962_compressed_primeansiX962_compressed_char2HPKE_KEM_P256_HKDF_SHA256HPKE_KEM_P384_HKDF_SHA384HPKE_KEM_P521_HKDF_SHA512HPKE_KEM_X448_HKDF_SHA512windows new line expectedClockwiseContourIntegral;DoubleLongLeftRightArrow;checkId: %d should be %d bootstrap type wrong id: cb27e3aa (May 26th, 2020)google/protobuf/api.protoinvalid Message.Clear on got %v, want *struct kindgf256: invalid generator blake2s: invalid key sizeunsupported transport typeunsupported BBR profile %qunsupported log level: %s bad certificate hash valueECDSA verification failurex509: malformed parametersx509: malformed extensionsreflect.Value.CanInterfacecannot marshal DNS messagetoo many colons in addressunclosed criterion bracketcriterion lacks equal signAs4 called on IPv6 addressprefix length out of rangeall goroutines stack traceSIGSTOP: stop, unblockableGC background sweeper waitnotewakeup - double wakeuppersistentalloc: size == 0/gc/cycles/total:gc-cyclesbad type kind in finalizernegative idle mark workersuse of invalid sweepLockerruntime: bad span s.state=forEachP: P did not run fnwakep: negative nmspinningstartlockedm: locked to meinittask with no functionscorrupted semaphore ticketout of memory (stackalloc)invalid use of gostartcallshrinking stack in libcallruntime: pcHeader: magic= traceRegion: out of memory1455191522836685180664062572759576141834259033203125no message of desired typeno CSI structure availableinvalid request descriptorname not unique on networkrequired key not available: day-of-year out of rangeUnsupported Config Type %qmust specify logging levelmalformed request body: %vmux-listen: %s[%s]: %s: %vsocket closed unexpectedlyinvalid port %q after hostintegrity check failed: %wunexpected status code: %dQUICConfig.KeepAlivePeriodmust be between 2s and 60sreflect.Value.OverflowUintencountered a cycle via %sempty buffer in CopyBufferhttp: invalid cookie valueread from empty dataBuffernet/http: request canceledstopped after 10 redirectsduplicate pseudo-header %qhttp2: Framer %p: wrote %vframe_windowupdate_bad_lenframe_priority_zero_streaminternal error: bad Writermalformed HTTP status codeaddress type not supportedHTTP Version Not SupportedreadLoopPeekFailLocked: %wgenerating private key: %vcertificate already cachedadded certificate to cache%s/zones/%s/dns_records/%s%s/zones/%s/dns_records?%sLiveDNS returned a %v (%v)final order is invalid: %wAddress type not supporteded25519: bad seed length: crypto/rsa: missing primescrypto/rsa: prime P is nilcrypto/rsa: prime Q is nilcryptobyte: internal errormlkem: invalid seed lengthbase 128 integer too largetruncated base 128 integerasn1: invalid UTF-8 stringnon sequence tagged as set using unaddressable valueunknown ABI parameter kind using zero Value argumentreflect.Value.MethodByNamesegment prefix is reserveddnsmessage.NSResource{NS: bare " in non-quoted-fieldbinary.Read: invalid type unknown session with port quic: transport closed: %sRemoving connection ID %s.http3: transport is closedreceiving datagrams failedQPACK_DECOMPRESSION_FAILEDinvalid content length: %whttp3: invalid Host headerinvalid argument to Int63ninvalid argument to Int31nblake2b: invalid hash size/etc/httpd/conf/mime.typesid (%v) <= evictCount (%v)malformed chunked encodinginvalid CR in chunked linedeactivating authorizationinvalid responder key hashUnsupported DS Digest Type ; NSEC3 HASH UNDERSTOOD: overflow unpacking NSEC(3) ;; TSIG PSEUDOSECTION: ; not supported cipher suiteed25519: invalid signaturechacha20: wrong nonce sizechacha20: counter overflowinvalid date-time timezoneunknown line break settingfound undefined tag handlewhile parsing a block nodeinvalid character sequencewhile scanning a directive_html_template_attrescaper_html_template_htmlescapertemplate escaped correctly2006-01-02 15:04:05 -07:00Application error %#x (%s)received a stateless reset, StatelessResetToken: %#x, MaxDatagramFrameSize: %drecovery:ecn_state_updatedtransport:alpn_informationgithub.com/apernet/quic-go^([^\[]*)\[([^\]]+)\](.*)$certificate is not trustedinline table is incompleteEncodeSEG6Srh: No Segmentsgoogle.golang.org/genprotogoogle/protobuf/type.protofailed to initialize clientHTTP proxy server listeningTCP transparent proxy errorUDP transparent proxy errorunsupported log format: %s must set either tls or acmeunsupported masquerade typefailed to initialize serverfailed to download databasefailed to check for updatesinsufficient security levelCurveP256CurveP384CurveP521cryptobyte: length overflowtls: short read from Rand: hrr ech accept confirmationunsupported string type: %vx509: malformed certificatex509: no valid chains builtcurrent time %s is after %scryptobyte: invalid OID: %vcgo stub: cgo not availableIPv6 field has value >=2^16As4 called on IP zero valueinconsistent process statusos: unsupported signal typeos: process not initializedPageCachePagesLeaked (test)SIGILL: illegal instructionSIGXCPU: cpu limit exceededmakechan: size out of rangeG waiting list is corruptedM structure uses sizeclass runtime·unlock: lock countprogToPointerMask: overflow/gc/cycles/forced:gc-cycles/memory/classes/other:bytes/memory/classes/total:bytesfailed to set sweep barrierwork.nwait was > work.nproc not in stack roots range [allocated pages below zero?address not a stack addressmspan.sweep: bad span stateinvalid profile bucket typeruntime: corrupted polldescruntime: netpollinit failedruntime: asyncPreemptStack=runtime: thread ID overflowstopTheWorld: holding locksgcstopm: not waiting for gcruntime: checkdead: nmidle=runtime: checkdead: find g runlock of unlocked rwmutexsignal received during forksigsend: inconsistent statemakeslice: len out of rangemakeslice: cap out of rangegrowslice: len out of rangestack size not a power of 2timer when must be positive: unexpected return pc for 363797880709171295166015625channel number out of rangefile locking deadlock errorcommunication error on sendnot a XENIX named type filekey was rejected by serviceunknown command %q for %q%sRun '%v --help' for usage. ShellCompDirectiveKeepOrderadding path to search pathsno sink found for scheme %qcan't parse %q as a URL: %vfailed to stat key file: %wmust be between 4s and 120sCongestionConfig.BBRProfileafter object key:value pairnet/http: use last responsehttpservecontentkeepheadersinvalid dependent stream IDhttp2: response body closednet/http: request completedDATA frame with stream ID 0frame_rststream_zero_streamframe_pushpromise_pad_shorthttp2: server read frame %vignoring invalid trailer %qinvalid WriteHeader code %vadd DATA on non-open streamnet/http: invalid method %qunsupported protocol schemenet/http: invalid header %suser must agree to CA terms%s: caching certificate: %vloading managed certificateloading renewed certificate/.well-known/acme-challengeno OCSP stapling for %v: %vunsupported record type: %sCan't find such a DNS valuebase64-decoding MAC key: %wauthorization took too longmust be between 2s and 600sdevice name cannot be emptyinvalid ASN.1 from SignASN1cipher: incorrect length IVreflect.Value.UnsafePointer is not assignable to type reflectlite.Value.Interfacereflectlite.Value.NumMethoddnsmessage.SOAResource{NS: abi.NewName: tag too long: invalid boolean flag %s: %vflag needs an argument: -%sipv4: udp: fragment droppedSIOCETHTOOL ETHTOOL_GTXCSUMSIOCETHTOOL ETHTOOL_STXCSUM<- Received Initial packet.duplicate pseudo header: %sinvalid HTTP header name %qaccepting stream failed: %whttp3: invalid response: %winvalid argument to Shuffleaccess-control-allow-originhttp chunk length too largeauthorization already validoverflow unpacking anythingunrecognized address familyoverflow packing APL prefixfailed to parse host %s: %wNewInitialProtectionKey: %winvalid P224 point encodinginvalid P256 point encodinginvalid P384 point encodinginvalid P521 point encodinginput overflows the modulusextendedGCD: a or m is zeroexpression nests too deeplyfloat cannot end with a dottag value must not be emptyinvalid leading UTF-8 octetincomplete UTF-16 characterexpected low surrogate areawhile scanning a simple keycould not find expected ':'while increasing flow levelunknown MPLS Encap Type: %d{Largest: %d, Smallest: %d}unexpected encryption levelinvalid packet number spaceInvalid cipher suite id: %dtransport:connection_closedrecovery:loss_timer_updatederror reading response bodyhkdf: entropy limit reachedHPKE_KEM_X25519_HKDF_SHA256NAF digits must fit in int8expected key but found noneunterminated literal string%v %v is already registeredmismatching message lengthsinvalid Message.Mutable on %v: assigning invalid valuenon-alphanumeric string %#qbuild line with missing keygf256: invalid polynomial: unsupported on this platformunsupported obfuscation typefailed to read client configTCP transparent proxy closedUDP transparent proxy closedfailed to load client configcannot set both tls and acmemasquerade.string.statusCodefailed to read server configfailed to load server configtls: malformed ECHConfigListEd25519 verification failureTLS_CHACHA20_POLY1305_SHA256TLS_RSA_WITH_AES_128_CBC_SHATLS_RSA_WITH_AES_256_CBC_SHAx509: invalid RSA public keyx509: invalid DSA public keyx509: invalid DSA parametersx509: negative serial numberx509: unknown elliptic curvecurrent time %s is before %serrors: target cannot be nilcannot unmarshal DNS message/proc/sys/net/core/somaxconnos: process already finishedos: process already releasedSIGHUP: terminal line hangupSIGWINCH: window size changeGC mark assist wait for workcomparing uncomparable type notewakeup - double wakeup (region exceeds uintptr range/gc/heap/frees-by-size:bytes/gc/heap/tiny/allocs:objects/sched/goroutines:goroutinesgcBgMarkWorker: mode not setmspan.sweep: m is not lockedfound pointer to free objectmheap.freeSpanLocked - span fatal: morestack on gsignal runtime: casgstatus: oldval=gcstopm: negative nmspinningfindrunnable: netpoll with psave on system g not allowednewproc1: newg missing stacknewproc1: new g is not GdeadFixedStack is not power-of-2missing stack in shrinkstack args stack map entries for invalid runtime symbol tableruntime: no module data for mismatched isSending updates[originating from goroutine traceRegion: alloc too large18189894035458564758300781259094947017729282379150390625protocol driver not attachedfile descriptor in bad statedestination address requiredunsupported compression for ShellCompDirectiveNoFileCompShellCompDirectiveFilterDirssearching for config in path%q is not a valid scheme: %v.hysteria-geoloader.dlpart.*https://api.hy2.io/v1/updatecan't unmarshal a nil *Level2006-01-02T15:04:05.000Z0700json: Unmarshal(non-pointer !#$%&()*+-./:;<=>?@[]^_{|}~ unexpected end of JSON inputhttp2: client conn is closedtext/plain; charset=utf-16betext/plain; charset=utf-16leapplication/x-rar-compressedinvalid header field name %qhttp2: header list too largeforgetting unknown stream idhttp2: Transport received %shttp: request body too largeunsupported protocol versionmissing required Host headerunexpected protocol version general SOCKS server failureTransfer-Encoding: chunked invalid empty Content-Lengthnet/http: invalid trailer %shttp: no Host in request URL%s: renewing certificate: %wconverting '%s' to ASCII: %vmatched certificate in cache/.well-known/acme-challenge/panic: active locking: %v %sSOCKS5 authentication failedmust provide a positive sizebytes: negative Repeat countcrypto/rsa: decryption errorcrypto/aes: counter overflowasn1: string not valid UTF-8big: misuse of expNNWindowedreflect.MakeSlice: len > capdnsmessage.MXResource{Pref: dnsmessage.PTRResource{PTR: abi.NewName: name too long: invalid path escape sequenceflag needs an argument: --%s%#x doesn't fit into 62 bitsRemoving 0-RTT queue for %s.setting up connection failedquic-go/http3 context value multipart: message too largemultipart: boundary is emptymalformed MIME header line: /usr/local/share/mime/globs2access-control-allow-headersaccess-control-allow-methodsinvalid byte in chunk lengthinvalid proxy address %q: %vpresenting for challenge: %wUnsupported DNSKEY Algorithmdns: svcbalpn: empty alpn-idcannot encode %d in %d bytespacket is too short: %d < %dDetECDSA P-256 SHA2-512 signfips140: verified code+data minutes cannot be greater 59seconds cannot be greater 60expected %s event but got %sincompatible %YAML directivetag handle must not be emptytag handle must end with '!'tag prefix must not be emptywhile parsing a flow mappinginvalid trailing UTF-8 octetfound unknown directive nameyaml: unmarshal errors: %s_html_template_rcdataescaper_html_template_urlnormalizerMon Jan _2 15:04:05 MST 2006failed to encode RTA_VIA: %vinvalid To IP %q in range %qexceeded max recursion depthinvalid Connection ID length, ECT0: %d, ECT1: %d, CE: %dtransport:connection_startedunknown encryption level: %dinvalid P224Element encodinginvalid P256Element encodinginvalid P384Element encodinginvalid P521Element encodingexpected newline but got %#Uinvalid character in commentcan't happen: encode type %sgob: cannot encode nil valueWrong Seq nr %d, expected %dmismatching end group markermissing Go struct field for failed to parse client config2001::ffff:ffff:ffff:fff1/126TCP transparent proxy connectUDP transparent proxy connectHYSTERIA_DISABLE_UPDATE_CHECKfailed to parse server configfailed to serve traffic statsunknown certificate authorityTLS_RSA_WITH_3DES_EDE_CBC_SHAtls: too many ignored recordstls: invalid outer extensionstls: invalid NextProtos valuetls: invalid server key sharetls: invalid client key sharetls: invalid session encodingtls: unknown session encodingx509: unsupported time formatx509: cannot parse URI %q: %sx509: malformed serial numberx509: cannot parse dnsName %qmismatched local address typeunknown IP protocol specifiedsync.WaitGroup.Wait (durable)SIGPIPE: write to broken pipeSIGPWR: power failure restartruntime: mmap: access denied /cpu/classes/idle:cpu-seconds/cpu/classes/user:cpu-seconds/gc/heap/allocs-by-size:bytes/gc/stack/starting-size:bytesgc done but gcphase != _GCoffruntime: p.gcMarkWorkerMode= scanobject of a noscan objectruntime: marking free object addspecial on invalid pointerruntime: summary max pages = runtime: levelShift[level] = doRecordGoroutineProfile gp1=runtime: eventfd failed with runtime: sudog with non-nil centersyscall inconsistent bp entersyscall inconsistent sp gfput: bad status (not Gdead)LockOSThread nesting overflowsemacquire not on the G stackruntime: split stack overflowstring concatenation too longinvalid function symbol tabletrace: reading after shutdownruntime: traceback stuck. pc=tried to trace dead goroutineruntime: impossible type kind45474735088646411895751953125too many open files in systemnumerical result out of rangemachine is not on the networkprotocol family not supportedno XENIX semaphores availableoperation already in progressTime.UnmarshalBinary: no dataCommand %q is deprecated, %s required flag(s) "%s" not setcobra_annotation_one_requiredsearching for config in pathsinvalid type %T for bandwidthPSK must be at least %d bytesio: read/write on closed pipehttp: '=' not found in cookiewrite on uninitialized bufferhttp2: client conn not usableMon, 02 Jan 2006 15:04:05 GMTapplication/vnd.ms-fontobjecthttp: idle connection timeoutMon, 02 Jan 2006 15:04:05 MSTMon, 02-Jan-2006 15:04:05 MSTinternal error: took too muchframe_pushpromise_zero_streamframe_pushpromise_pad_too_bighttp2: client connection lostHTTP/1.1 %d %s: %s%s%d %s: %shttp: panic serving %v: %v %sNon-Authoritative InformationProxy Authentication RequiredUnavailable For Legal Reasonsdup idle pconn %p in freelistcould not save account %v: %vreplaced certificate in cachereloading managed certificate%s: obtaining certificate: %w[%s] Renew: saving assets: %vrenewing managed certificatesno URL to issuing certificateHTTP request failed; retryingunrecognized order status: %sQUICConfig.MaxIncomingStreamscrypto/aes: invalid key size crypto/des: invalid key size crypto/rc4: invalid key size integer not minimally-encodedzero length OBJECT IDENTIFIER20060102150405.999999999Z0700reflect: Key of non-map type reflect: In of non-func type cannot be converted to type unable to cast negative valueinvalid decode hook signaturebufio.Scanner: token too longbind forwarder to interface: invalid ip header version: %dtcp header len is invalid: %dinvalid syntax at line %d: %sSwitching to QUIC version %s.GSO failed when sending to %snumOutStandingFrames negativeChanging connection ID to %s.Setting DF for IPv4 and IPv6.missing QUIC Datagram supportinvalid quarter stream id: %winvalid header field name: %qhttp3: no Host in request URLmime: invalid media parameteraccess-control-expose-headersaccess-control-request-methodtoo many compression pointersoverflow unpacking APL prefixexec: Wait was already calledFIPS 140-3 self-test failed: FIPS 140-3 self-test passed: crypto/rsa: |p - q| too smallpoly1305: unexpected overflowinvalid character class rangeinvalid timezone offset hoursfloat cannot start with a dotcannot assign boolean to a %talias value must not be emptywhile parsing a block mappingwhile parsing a flow sequenceunexpected low surrogate areacannot decode %s `%s` as a %swhile increasing indent leveldid not find the expected '>'did not find expected tag URIwhile scanning a block scalarwhile parsing a quoted scalarwhile scanning a plain scalarlwt bpf decode: lack of bytesBUG: internal error (unknown)descriptor mismatch: %v != %vjava_generate_equals_and_hashtext too long to encode as QRunexpect encryption level: %sRetrySourceConnectionID: %s, ACK doesn't contain ECN marks newly acked packets (%d): %drest when unpacking token: %dtransport:version_informationtransport:parameters_restoredoauth2: cannot parse json: %vstopped after \d+ redirects\zarray cannot start with commainvalid escaped character %#Utoml: table %s already existsgob: encoder: message too bigfile %q is already registerednon-contiguous repeated fieldmismatching extension lengthsinvalid type: got %v, want %v%T does not implement Marshalfield %v has invalid type: %vsyntax error (line %d:%d): %vfailed to parse CA certificateunsupported congestion type %qcannot bind both IP and deviceprotocol version not supportedTLS_ECDHE_RSA_WITH_RC4_128_SHAcalled entry on non-entry noderuntime.AddCleanup: ptr is nilx509: invalid ECDSA parametersx509: SAN dNSName is malformedx509: malformed issuerUniqueIDinvalid network interface nametrailing garbage after addressassignment to entry in nil mapSIGUSR1: user-defined signal 1SIGUSR2: user-defined signal 2SIGVTALRM: virtual alarm clockSIGPROF: profiling alarm clock (types from different scopes)failed to get system page sizeruntime: found in object at *( in prepareForSweep; sweepgen is reachable from finalizer /cpu/classes/total:cpu-seconds/gc/cycles/automatic:gc-cycles/sched/pauses/total/gc:seconds/sync/mutex/wait/total:seconds/godebug/non-default-behavior/runtime: epollctl failed with panic called with nil argumentcheckdead: inconsistent countsrunqputslow: queue is not fullruntime: bad pointer in frame invalid pointer found on stack locals stack map entries for abi mismatch detected between runtime: impossible type kind unsafe.Slice: len out of range227373675443232059478759765625strings: negative Repeat countinappropriate ioctl for devicesocket operation on non-socketprotocol wrong type for socketmemory page has hardware erroryear outside of range [0,9999]Config File %q Not Found in %qfailed to create tun stack: %wHop skipped: listen failed: %vlooking for beginning of valuein exponent of numeric literalMonday, 02-Jan-06 15:04:05 MSTnegative content size computedstream error: stream ID %d; %vframe_settings_ack_with_lengthillegal window increment valueHEADERS frame with stream ID 0frame_continuation_zero_streamhttp2: decoded hpack field %+vrunning on the wrong goroutinehttp2: panic serving %v: %v %spersistConn was already in LRUremoved certificate from cache[%s] Obtain: saving assets: %vdeleting test key from storageno certificate resources founddecoding lockfile contents: %wOCSP response needs refreshingattempting certificate renewalgetting issuer certificate: %vreading issuer certificate: %vparsing issuer certificate: %vexpected 1 zone, got %d for %sgot error status: HTTP %d: %+vhttps://www.duckdns.org/updateSOCKS5 request failed: %s (%d)crypto/rsa: verification errorcrypto/cipher: counter wrappedGODEBUG: unknown cpu feature "mlkem: invalid encoding lengthcrypto/ecdh: mismatched curvesasn1: cannot marshal nil valueMapIter.Key called before Nextreflect: Elem of invalid type reflect: Out of non-func type reflect: Len of non-array typeruntime: cgroup buffer length cannot parse value as '%s': %sGot NegotiationReply: %#v %#v build local socket address: %sipv4: tcp: session not found: ipv6: tcp: session not found: negative packetBuffer refCountpacketBuffer refCount not zerounexpected PATH_RESPONSE frametoo many gaps in received dataquic: ConnContext returned nilError sending Retry packet: %sduplicate QPACK encoder streamduplicate QPACK decoder streamhttp3: reserved frame type: %dmissing validateFirstLine functext/javascript; charset=utf-8mime: duplicate parameter nameaccess-control-request-headerschunked line ends with bare LFurn:ietf:params:acme:error:dnsurn:ietf:params:acme:error:tlstrailing data in OCSP responseunsupported critical extensiondomain must be fully qualifiedoverflow unpacking APL addressfips: invalid self-test name: sync: inconsistent mutex statesync: unlock of unlocked mutexfips140: verification mismatchsubtle.XORBytes: dst too short(\\)?(\$)(\{?([A-Z0-9_]+)?\}?)line `%s` doesn't match formatfloat cannot be assigned to %sunknown anchor '%s' referencedtag handle must start with '!'anchor value must not be emptyfound duplicate %TAG directivewhile parsing a %TAG directivedid not find URI escaped octetwhile scanning a quoted scalarfound unexpected end of streamfound unknown escape charactertransform: short source bufferMon Jan 02 15:04:05 -0700 2006invalid From IP %q in range %qApplication error %#x (%s): %soauth2: cannot fetch token: %v[ERR] %s %s request failed: %vParams: []dnsmessage.SVCParam{Key() is not supported on a %smissing keyKind string mappingunaddressable value of type %stype %s has no exported fieldsattempt to register empty nametype mismatch: got %T, want %vunquoted key %q must be quotedinvalid character %q in stringTCP transparent proxy listeningUDP transparent proxy listeninga certificate cache is requiredtls: no certificates configuredbad certificate status responseencrypted client hello requiredtls: unsupported public key: %TTLS_RSA_WITH_AES_128_CBC_SHA256TLS_RSA_WITH_AES_128_GCM_SHA256TLS_RSA_WITH_AES_256_GCM_SHA384failed to parse certificate: %wTLS: sequence number wraparoundtls: invalid inner client helloCLIENT_HANDSHAKE_TRAFFIC_SECRETSERVER_HANDSHAKE_TRAFFIC_SECRETtls: failed to sign handshake: x509: malformed GeneralizedTimecrypto/ecdh: invalid public keyx509: invalid basic constraintsx509: malformed tbs certificatex509: malformed subjectUniqueIDinvalid elliptic key public keyx509: certificate is valid for %d chains with invalid policiesencoding/hex: invalid byte: %#Ufmt: unknown base; can't happensotypeToNet unknown socket typezone must be a non-empty stringpattern contains path separatorslice bounds out of range [:%x]slice bounds out of range [%x:]SIGSEGV: segmentation violationinternal error - misuse of itab) not in usable address space: runtime: cannot allocate memorycheckmark found unmarked object/memory/classes/heap/free:bytes/memory/classes/os-stacks:bytespacer: sweep done at heap size non in-use span in unswept listcasgstatus: bad incoming valuesresetspinning: not a spinning mruntime: profBuf already closedfatal: bad g in signal handler signal_recv: inconsistent stateruntime: split stack overflow: ...additional frames elided... unsafe.String: len out of range11368683772161602973937988281255684341886080801486968994140625.lib section in a.out corruptedcannot assign requested addressmalformed time zone informationtime: missing unit in duration ShellCompDirectiveFilterFileExtdisable completion descriptionstrying to resolve absolute pathOnly GET and PUT are supported.address family not IPv4 or IPv6failed to bind to interface: %wjson: invalid number literal %qin literal true (expecting 'r')in literal true (expecting 'u')in literal true (expecting 'e')in literal null (expecting 'u')in literal null (expecting 'l')expected colon after object keymultipart/byteranges; boundary=http2: connection error: %v: %vframe_headers_prio_weight_shortPRIORITY frame with stream ID 0too many authentication methodsRequested Range Not SatisfiableRequest Header Fields Too LargeNetwork Authentication Requiredtoo many transfer encodings: %qnet/http: TLS handshake timeoutunable to acquire lock '%s': %vno certificates found in bundleloaded certificate from storageforcefully renewing certificateexpected one record, got %d: %vunexpected status code: HTTP %dJSON-decoding response body: %w{"e":"%s","kty":"RSA","n":"%s"}UDP not supported by HTTP proxyBindIP4 must be an IPv4 addressBindIP6 must be an IPv6 addressapplication/json; charset=utf-8ecdsa: signature did not verifycrypto/rsa: prime factor is nilcrypto/aes: len(dst) < len(src)reflect: Len of non-array type reflect.MakeSlice: negative lenreflect.MakeSlice: negative capinvalid return from write: got mergeRuneSets odd length []runeunsupported type for squash: %sSent NegotiationReply: %#v %#v unsupported virtio GSO type: %dGeoIP country code %s not foundconnection ID manager is closedsending path probe packet to %sreceived a HANDSHAKE_DONE frameunexpected encryption level: %scannot use GSO with a basicConncannot use ECN with a basicConnconnection in graceful shutdownhttp3: ConnContext returned nilhttp3: parsing frame failed: %wconnection operation prohibitedaccount status is not valid: %sgetting authorization at %s: %wdns: reading random id failed: overflow unpacking domain namesunrecognized APL address familydns: svcbalpn: alpn-id too longecdsa: reseed interval exceededed25519: bad signature length: line `%s` has an unset variableinvalid timezone offset minutescouldn't parse octal number: %wcannot store a table in a slice2006-1-2T15:4:5.999999999Z07:002006-1-2t15:4:5.999999999Z07:00found duplicate %YAML directiveincomplete UTF-8 octet sequencewhile scanning a %TAG directiveMon, 02 Jan 2006 15:04:05 -0700field %v contains invalid UTF-8cannot reset invalid %v messageno_standard_descriptor_accessorclient sent a preferred_address Ignoring all packets below %d.Canceling loss detection timer.session ticket keys unavailablereflect.Value has no flag fieldwindows new line should be \r\ncannot call BytesRange with niltoml: key %s is already definedencodeReflectValue: nil elementGot short response from netlinkcannot parse reserved wire typeinvalid Go type %v for field %v%T does not implement Unmarshalexpected 2 or 3 columns; got %dfailed to initialize logger: %s https://acme.zerossl.com/v2/DV90unsupported protocol scheme "%s"TLS_ECDHE_ECDSA_WITH_RC4_128_SHAchacha20poly1305: bad key lengthtls: unknown Renegotiation valuetls: NextProtos values too largetls: Start called more than oncetls: failed to parse private keytls13: label or context too long/etc/pki/tls/certs/ca-bundle.crtx509: unsupported elliptic curvex509: invalid constraint value: x509: malformed subjectPublicKeyx509: invalid private key lengthx509: cannot parse rfc822Name %qx509: ECDSA verification failurex509: unknown extended key usageinvalid policy object identifierx509: unknown SignatureAlgorithmgo package net: hostLookupOrder(unexpected character, want colonpidStatus called in invalid modeslice bounds out of range [::%x]slice bounds out of range [:%x:]slice bounds out of range [%x::]SIGFPE: floating-point exceptionSIGTTOU: background write to tty (types from different packages)end outside usable address spaceruntime: fixalloc size too largeinvalid limiter event type foundscanstack: goroutine not stoppedscavenger state is already wiredsweep increased allocation countremovespecial on invalid pointergetWeakHandle on invalid pointerruntime: root level max pages = _cgo_pthread_key_created missingruntime: sudog with non-nil elemruntime: sudog with non-nil nextruntime: sudog with non-nil prevruntime: mcall function returnednon-Go code disabled sigaltstackruntime: newstack called from g=runtime: stack split at bad timepanic while printing panic value28421709430404007434844970703125resource temporarily unavailablenumerical argument out of domainsoftware caused connection abort: day-of-year does not match dayfailed to create unix socket: %wpeer attempted to open stream %din literal false (expecting 'a')in literal false (expecting 'l')in literal false (expecting 's')in literal false (expecting 'e')invalid range: failed to overlapframe_windowupdate_zero_inc_connhttp2: server ignoring frame: %vread limit of %d bytes exhaustedwaiting on internal rate limitercertificate renewed successfullycould not determine the zone: %wfell back to default certificate[ERROR] key auth HTTP server: %vone usage of each socket addresspanic: http solver server: %v %spanic: certificate worker: %v %sapi returned unexpected responseecdsa: Sign called with nil optsecdsa: internal error: r is zeroecdsa: internal error: s is zeroed25519: bad public key length: crypto/rsa: public key missing Ncrypto/rsa: prime factor is <= 1sync: Unlock of unlocked RWMutexsync: negative WaitGroup countercrypto/des: input not full blockcrypto/aes: input not full blockcrypto/cipher: counter decreased" not supported for cpu option "ABCDEFGHIJKLMNOPQRSTUVWXYZ234567mlkem: invalid ciphertext lengthcrypto/ecdh: invalid private keyinteger is not minimally encodedcannot represent time as UTCTimereflect.MapOf: invalid key type MapIter.Value called before Nextreflect.Value.Grow: negative lendnsmessage.CNAMEResource{CNAME: dnsmessage.AResource{A: [4]byte{use of closed network connectioninitial table capacity too largecannot squash non-struct type %qexpected a map or struct, got %qbufio: invalid use of UnreadBytebufio: tried to fill full buffercan't determine encryption levelinvalid frame for send stream %dmime: expected token after slashaccess-control-allow-credentials ; DNSSEC ALGORITHM UNDERSTOOD: string exceeded 255 bytes in txtsetsockopt(TCP_FASTOPEN_CONNECT)unable to assemble crypto framescrypto/rsa: invalid CRT exponentinput overflows the modulus sizesubtle.XORBytes: invalid overlapchacha20: invalid buffer overlapdate time should have a timezonecouldn't parse binary number: %wwhile parsing a block collectiondid not find expected ',' or ']'did not find expected ',' or '}'found incompatible YAML documentincomplete UTF-16 surrogate pairwhile scanning a %YAML directivedid not find expected whitespacemultiple ,inline maps in struct invalid packet number length: %dinvalid connection ID length: %dnon-sequential packet number use lost packet %d (time threshold)unexpected read encryption levelEventReceivedTransportParametersEventRestoredTransportParameters0123456789ABCDEFGHIJKLMNOPQRSTUVbasic string not terminated by "CounterClockwiseContourIntegral;bootstrap type already present: variable length integer overflowgoogle/protobuf/field_mask.protogoogle/protobuf/descriptor.protoexceeded maximum recursion depthweak message %v is not linked in%v already implements proto.Enumfield %v has invalid nil pointerinvalid quoted key in build linebuild line missing '=' after keyunquoted value %q must be quotedcould not parse value for %v: %qgf256: invalid check byte lengthinvalid escape code %q in stringuse this URI to share your serverapplication/x-www-form-urlencodedbytes.Buffer.Grow: negative counttls: malformed outer client hellotls: failed to write to key log: tls: invalid server finished hashtls: invalid client finished hashtls: unexpected ServerKeyExchangetls: unknown public key algorithmx509: invalid RSA public exponentx509: SAN rfc822Name is malformedx509: invalid extended key usagesgo package net: confVal.netCgo = slice bounds out of range [%x:%y]SIGCHLD: child status has changedSIGTTIN: background read from ttySIGXFSZ: file size limit exceededbase outside usable address spaceruntime: memory allocated by OS [misrounded allocation in sysAlloc/cpu/classes/gc/pause:cpu-seconds/cpu/classes/gc/total:cpu-seconds/gc/limiter/last-enabled:gc-cycle/memory/classes/heap/stacks:bytes/memory/classes/heap/unused:bytes/sched/pauses/stopping/gc:seconds/sched/pauses/total/other:secondsmin must be a non-zero power of 2runtime: failed mSpanList.insert runtime: epollcreate failed with runtime: morestack on g0, stack [runtime: castogscanstatus oldval=stoplockedm: inconsistent lockingfindrunnable: negative nmspinningfreeing stack not in a stack spanstackalloc not on scheduler stackruntime: goroutine stack exceeds runtime: text offset out of rangetimer period must be non-negativetoo many concurrent timer firingsruntime: name offset out of rangeruntime: type offset out of range142108547152020037174224853515625710542735760100185871124267578125too many levels of symbolic linkscalled Execute() on a nil Commanddecoder not found for this formatattempting to read in config fileno encoder registered for name %qQUICConfig.MaxStreamReceiveWindowhttp: invalid or unsafe file pathpseudo header field after regularhttp: invalid Read on closed Bodynet/http: skip alternate protocolhttp: CloseIdleConnections calledhttp: error reading directory: %vinvalid header field value for %qpad size larger than data payloadframe_pushpromise_promiseid_shorthttp2: invalid pseudo headers: %vtimeout waiting for PING responseinvalid concurrent Body.Read callconnection not allowed by rulesetinvalid username/password versionunsupported transfer encoding: %qhijacked connection copy completecertificate obtained successfullyencoding certificate metadata: %vdecoding certificate metadata: %vno certificate available for '%s'cleaning up embedded provider: %vchecking authorization status: %wapplication/pem-certificate-chainno IPv4 or IPv6 address availablecrypto: requested hash function #bytes.Reader.Seek: invalid whencesync: RUnlock of unlocked RWMutexcrypto/des: output not full blockcrypto/aes: output not full blockGODEBUG: no value specified for "indefinite length found (not DER)struct contains unexported fieldsskip everything and stop the walkreflect: slice index out of range of method on nil interface valuereflect: Field index out of rangereflect: array index out of rangereflect.Value.Equal: invalid Kind to pointer to array with length too many Answers to pack (>65535)dnsmessage.SRVResource{Priority: dnsmessage.UnknownResource{Type: waiting for unsupported file typeunaligned 64-bit atomic operationconcurrent map read and map writetable must have positive capacityflag accessed but not defined: %sunknown shorthand flag: %q in -%sflag needs an argument: %q in -%sinvalid value %q for flag -%s: %vNo compatible QUIC version found.Closing connection with error: %ssending path probe packet from %ssendQueue.Send would have blockedGOAWAY frame: inconsistent lengthinvalid request pseudo header: %sinvalid TE header field value: %qpeer sent an unexpected frame: %Tempty hex number for chunk lengthsolving challenges: %w (order=%s)unsupported issuer hash algorithmoverflow packing uint64 as uint48oauth2: Transport's Source is niled25519: bad private key length: SigEd25519 no Ed25519 collisionsSigEd25519 no Ed25519 collisionssha3: invalid hash state functionregexp: unhandled case in compileinvalid timezone offset charactercouldn't parse decimal number: %wnumber cannot end with underscoreanchor '%s' value contains itselfexpected nothing after STREAM-ENDwhile scanning for the next tokeninvalid zero-length connection IDreceived ACK for an unsent packetunexpected write encryption levelerror creating new AES cipher: %srecovery:congestion_state_updatedleafCounts[maxBits][maxBits] != noauth2: cannot parse response: %vGODEBUG sys/cpu: can not enable "scalar has high bit set illegallyencoding: missing byte order markslice offset larger than int (%d)no support for proto1 weak fieldsinvalid SetUnknown on nil Messagecould not format value for %v: %vno support for proto1 MessageSetsfailed to shut down server cleanlyfailed to serve masquerade HTTP(S)expected an RSA public key, got %TTLS_ECDHE_RSA_WITH_AES_128_CBC_SHATLS_ECDHE_RSA_WITH_AES_256_CBC_SHAconnection doesn't support Ed25519tls: malformed key_share extensionTLS 1.3, server CertificateVerifyTLS 1.3, client CertificateVerify/etc/ssl/certs/ca-certificates.crtadding nil Certificate to CertPoolx509: unknown public key algorithmx509: invalid certificate policies%s %q is excluded by constraint %qx509: Ed25519 verification failurex509: unhandled critical extensionslice bounds out of range [:%x:%y]slice bounds out of range [%x:%y:]SIGURG: urgent condition on socketruntime: standard file descriptor out of memory allocating allArenas... too many potential issues ... /memory/classes/heap/objects:bytesruntime.SetFinalizer: cannot pass too many pages allocated in chunk?mspan.ensureSwept: m is not lockedruntime: netpollBreak write failedforEachP: sched.safePointWait != 0schedule: spinning with local workentersyscallblock inconsistent bp entersyscallblock inconsistent sp runtime: g is running but p is notinvalid timer channel: no capacity3552713678800500929355621337890625too many references: cannot splice: day-of-year does not match monthcobra_annotation_flag_set_by_cobraCommand can't be a child of itselffailed to create tun interface: %win \u hexadecimal character escapeexpected comma after array elementtimeout waiting for client prefacehttp2: aborting request body writehttp: connection has been hijackedhttp: persistConn.readLoop exitinghttp: read on closed response bodystream error: stream ID %d; %v; %vframe_settings_window_size_too_bigframe_windowupdate_zero_inc_streamnewWriterAndRequestNoBody(%+v): %vhttp: invalid Content-Length of %qBaseContext returned a nil contextunsupported authentication method looking up account with server: %vDo you agree to the terms? (y/n): certificate should not be obtainedrenewing and reloading certificatelooking up info for HTTP challengemaxEvents cannot be less than zerochecking DNS propagation of %q: %wfetching new nonce from server: %wserver rejected upload request: %sbytes: Join output length overflowcrypto/rsa: missing public moduluscrypto/des: invalid buffer overlapcrypto/aes: invalid buffer overlapcrypto/rc4: invalid buffer overlapmlkem: invalid polynomial encodinginvalid padding bits in BIT STRINGreflect: Method index out of rangereflect: Field of non-struct type reflect: Field index out of boundsreflect.FuncOf: too many argumentsreflect.StructOf: duplicate field " is anonymous but has PkgPath setreflect: string index out of rangereflect.Value.Grow: slice overflowconcurrent map clone and map writeFlag --%s has been deprecated, %s flag provided but not defined: -%sillegal base64 data at input byte parsing socket control message: %sError sending CONNECTION_CLOSE: %sRestoring Transport Parameters: %sProcessed Transport Parameters: %smissing retry_source_connection_idListening for %s connections on %sheader field is not lower-case: %sinvalid response pseudo header: %sDATA frame received after trailersinvalid Upgrade request header: %qempty NSEC(3) block in type bitmaprepeated SVCB keys are not allowedexecutable file not found in $PATHvalue doesn't fit into 62 bits: %dnon-200 status-code=%d for host %scrypto/rsa: public modulus is evenextendedGCD: both a and m are evenchacha20: wrong HChaCha20 key sizeinvalid nested repetition operatorinvalid or unsupported Perl syntaxhandleValue not implemented for %sdid not find expected node contentinvalid length of a UTF-8 sequencecontrol characters are not allowedillegal base32 data at input byte dnsmessage.SVCBResource{Priority: GODEBUG sys/cpu: can not disable "EncodeSEG6Encap: No Segment in srhbad tag in lazy extension decodingmismatching field: got %v, want %vinvalid quoted value in build linetraffic stats server up and runningunsupported signature algorithm: %vTLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHAtls: too many non-advancing recordstls: server selected an invalid PSKtls: invalid or missing PSK bindersx509: malformed extension OID fieldx509: wrong Ed25519 public key sizex509: invalid authority info accessx509: failed to marshal curve OID: encoding/hex: odd length hex stringos/signal: Notify using nil channelpersistentalloc: align is too large/memory/classes/heap/released:bytesgreyobject: obj not pointer-alignedmismatched begin/end of activeSweepmheap.freeSpanLocked - invalid freefailed to get or create weak handleattempt to clear non-empty span setruntime: close polldesc w/o unblockruntime: inconsistent read deadlinefindrunnable: netpoll with spinningpidleput: P has non-empty run queuefake timer executing with no bubbletraceback did not unwind completely1776356839400250464677810668945312588817841970012523233890533447265625ryuFtoaFixed32 called with prec > 9strings.Reader.Seek: invalid whencenetwork dropped connection on resettransport endpoint is not connected2006-01-02T15:04:05.999999999Z07:00non-positive interval for NewTickercobra_annotation_mutually_exclusivemissing EncodeTime in EncoderConfigfailed to stat certificate file: %whttp: server closed idle connectionCONTINUATION frame with stream ID 0Prohibited TLS 1.2 Cipher Suite: %xhttp2: server: client %v said hellohttp2: server processing setting %vWrite called after Handler finishedcertificate for '%s' is not managedpresenting with embedded solver: %vdirectory missing newNonce endpointurn:ietf:params:acme:error:badNonceserver rejected our nonce; retryingtraffic logger requested disconnectecdsa: invalid signature: r is zeroecdsa: invalid signature: s is zerocrypto/rsa: invalid PSS salt lengthcrypto/md5: invalid hash state sizesuperfluous leading zeros in length'_' must separate successive digits" is unexported but missing PkgPathreflect.MakeSlice of non-slice typetoo many Questions to pack (>65535)file type does not support deadlineinvalid argument %q for %q flag: %vunable to cast %#v of type %T to %TGot Reply: %#v %#v %#v %#v %#v %#v set socket option: SO_REUSEADDR: %sip header version: %d, GSO type: %dclose called for canceled stream %dinvalid frame for receive stream %dcrypto/blake2b: cannot marshal MACsmime: bogus characters after %%: %qhpack: invalid Huffman-encoded datadynamic table size update too largeoverflow unpacking uint64 as uint48dns: TSIG not last RR in additionalP224 point is the point at infinityP256 point is the point at infinityP384 point is the point at infinityP521 point is the point at infinitycrypto/rsa: invalid CRT coefficientcrypto/rsa: public exponent is evenbigmod: modulus is smaller than natbigmod: modulus for Exp must be oddchacha20: output smaller than inputsha3: invalid hash state identifiernanoseconds need at least one digitnumber cannot start with underscoreshould not be called with empty keynumber %f does not fit in a float32must set the input source only oncedid not find expected '-' indicatorfound extremely long version numberfound unexpected document indicatortransform: short destination bufferWrong sender portid %d, expected %dtimeout: no recent network activity %s &wire.NewTokenFrame{Token: %#x}%d exceeds the maximum stream countclient sent a stateless_reset_tokendidn't expect ECN to be unsupportedunexpected multiple session tickets0-RTT not allowed. Rejecting 0-RTT.unknown session ticket revision: %dmax-age=31536000; includesubdomainsflate: corrupt input before offset %s %s giving up after %d attempt(s)basic strings cannot have new linesfile %q has a name conflict over %vstring field contains invalid UTF-8%v already implements proto.Messagecrypto/blake2s: cannot marshal MACsdelimiters may only be "{}" or "<>"expected an ECDSA public key, got %TTLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHATLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHAunsupported SSLv2 handshake receivedtls: server did not send a key sharetls: server selected unoffered curvex509: zero or negative DSA parameterx509: invalid CRL distribution pointx509: invalid subject key identifierx509: malformed algorithm identifierx509: invalid X25519 private key: %vOIDFromInts(%v) unexpected error: %vx509: serial number must be positivelfstack node allocated from the heap) is larger than maximum page size (objects with pointers must be zeroedruntime: invalid typeBitsBulkBarrieruncaching span but s.allocCount == 0Scan trace for cleanup/finalizer on /memory/classes/metadata/other:bytes/sched/pauses/stopping/other:secondsuser arena span is on the wrong listruntime: marked free object in span runtime: unblock on closing polldescruntime: inconsistent write deadlineruntime: netpoll: eventfd ready for runtime: sudog with non-nil waitlinkruntime: mcall called on m->g0 stackfatal: recursive switchToCrashStack startm: P required for spinning=true) is not Grunnable or Gscanrunnable updateMaxProcsGoroutine: phase errorruntime: bad notifyList size - sync=signal arrived during cgo execution accessed data from freed user arena runtime: wrong goroutine in newstackruntime: invalid pc-encoded table f=444089209850062616169452667236328125ryuFtoaFixed64 called with prec > 180123456789abcdefghijklmnopqrstuvwxyzstrings.Builder.Grow: negative countstrings: Join output length overflowaccessing a corrupted shared libraryTime.UnmarshalBinary: invalid lengthCompletion ended with directive: %s could not discover absolute path: %w%s is not supported on this platforminvalid semicolon separator in queryjson: encoding error for type %q: %qhttp: unexpected EOF reading trailer LastStreamID=%v ErrCode=%v Debug=%qhttp2: server rejecting conn: %v, %sHeader called after Handler finishedRoundTrip retrying after failure: %vno acceptable authentication methodsHijack failed on protocol switch: %v%s: insecure CA URL (HTTPS required)unexpected response code '%s' for %s%s: could not make path relative: %vcustom certificate selection resultsmaintaining newly-loaded certificateusing externally-managed certificatepanic: tls-alpn solver server: %v %shttps://api.cloudflare.com/client/v4computing account JWK thumbprint: %vserver rejected download request: %sbytes: Repeat output length overflowbytes.Reader.Seek: negative positioncrypto/rsa: missing private exponentcrypto/cipher: input not full blockscrypto/sha1: invalid hash state sizecrypto/rand: argument to Int is <= 0hkdf: requested key length too largeIA5String contains invalid charactermethod ABI and value ABI don't alignreflect.Value.Equal: values of type reflect: NumField of non-struct typeinvalid boolean value %q for -%s: %vGot NegotiationRequest: %#v %#v %#v Sent Reply: %#v %#v %#v %#v %#v %#v build destination socket address: %sDestroying connection with error: %sDropping Version Negotiation packet.Increased send buffer size to %d kiBurn:ietf:params:qlog:events:http3-12reading stream type on stream failedcould not read quarter stream id: %wmalformed MIME header initial line: waiting for solver before continuinginitiating challenge with server: %waddress and mask lengths don't matchdns query failed with %s for host %spacket with long header is too smallECDSA P-256 SHA2-512 sign and verifyinvalid ChaCha8 Read buffer encodingchacha20: wrong HChaCha20 nonce sizeinvalid pattern syntax (+ after -): must set the output target only onceunknown problem parsing YAML contentdocument contains excessive aliasingdid not find expected did not find expected version numberlabel must begin with interface nameinvalid IPRanges during Ranges mergecannot merge into invalid %v messagestream data overflows maximum offsetmissing initial_source_connection_idInstalled 0-RTT Read keys (using %s)Installed 1-RTT Read keys (using %s)[DEBUG] %s: retrying in %s (%d left)HPKE_KEM_X25519_KYBER768_HKDF_SHA256edwards25519: invalid point encodingrange length is larger than capacityError converting to netlink sockaddrgoogle/protobuf/source_context.proto%v: MessageSet with no unknown fieldinvalid hex escape code %q in stringTUN is not supported on this platformmust specify one and only one addressfailed to parse client CA certificatemasquerade HTTP server up and runningcrypto: Size of unknown hash functiontls: unsupported certificate key (%T)TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256tls: failed to verify certificate: %sx509: malformed extension value fieldx509: RSA key missing NULL parametersx509: invalid CRL distribution pointsx509: unsupported private key versionx509: invalid Ed25519 private key: %v%d chains with incompatible key usagex509: unsupported public key type: %Teach group must have 4 or less digitsruntime: allocation size out of range) is smaller than minimum page size (/cpu/classes/gc/mark/idle:cpu-secondssetprofilebucket: profile already setfailed to reserve page summary memory_cgo_notify_runtime_init_done missingfatal: concurrent switchToCrashStack startTheWorld: inconsistent mp->nextpCouldn't put Gs into empty local runqruntime: unexpected SPWRITE function all goroutines are asleep - deadlock!semaphore wake of synctest goroutine 2220446049250313080847263336181640625value too large for defined data typecannot exec a shared library directlyoperation not possible due to RF-killtimezone hour outside of range [0,23]cobra_annotation_command_display_nameQUICConfig.InitialStreamReceiveWindowQUICConfig.MaxConnectionReceiveWindowcannot create context from nil parentbytes.Buffer: truncation out of rangeunexpected CONTINUATION for stream %dhttp2: unencrypted HTTP/2 not enabledhttp2: Transport sending health checkhttp2: Transport health check successRoundTrip on uninitialized ClientConnhttp2: server encoding header %q = %qhttp: TLS handshake error from %s: %vcould not save account to storage: %vaccount pre-registration callback: %vdone waiting on internal rate limiterunable to parse PEM certificate chaincertificate already exists in storagecould not get certificate from issuerserved key authentication certificatedefault certificate selection resultsrenewing certificate on-demand failedpanic: tls-alpn solver handler: %v %ssubtle: slices have different lengthscipher: message authentication failedcrypto/cipher: invalid buffer overlapcrypto/cipher: incorrect GCM tag sizegodebug: unexpected IncNonDefault of out does not point to an integer typecrypto/ecdh: invalid private key sizeexplicitly tagged member didn't matchreflect: Bits of non-arithmetic Type reflect: NumField of non-struct type reflect: OverflowInt of non-int type needKeyUpdate called on non-key type reflect: funcLayout of non-func type reflect.Value.Bytes of non-byte slicereflect.Value.Bytes of non-byte arrayreflect.Value.Bytes of non-rune slicemethod ABI and value ABI do not alignreflect.Value.Convert: value of type too many Authorities to pack (>65535)too many Additionals to pack (>65535)dnsmessage.TXTResource{TXT: []string{runtime: cgroup invalid buffer lengthparse error on line %d, column %d: %vSent NegotiationRequest: %#v %#v %#v Got Request: %#v %#v %#v %#v %#v %#v set socket option: IP_TRANSPARENT: %sgVisor is not supported in this fork.allocator Put() incorrect buffer sizeError sending INVALID_TOKEN error: %sError sending Version Negotiation: %sTemporary error reading from conn: %winvalid header field value for %s: %qopening the control stream failed: %winvalid Connection request header: %qwaiting for solver %T to be ready: %wurn:ietf:params:acme:error:connectionNSEC(3) block too long in type bitmapdns: svcbalpn: alpn array overflowingencountered unexpected frame type: %dbigmod: internal error: shrinking natcrypto/rsa: unsupported hash functionbisect.Hash: unexpected argument typecouldn't parse hexadecimal number: %wcannot have underscore after exponentexpected DOCUMENT-START or STREAM-ENDcannot parse invalid wire-format data%d not allowed at encryption level %sall ECN testing packets declared lostInstalled 0-RTT Write keys (using %s)Installed 1-RTT Write keys (using %s)unexpected write encryption level: %sPeer confirmed key update to phase %d[ERR] error reading response body: %vinvalid character at start of key: %cliteral strings cannot have new linestype not registered for interface: %sgob NewTypeObject can't handle type: GOLANG_PROTOBUF_REGISTRATION_CONFLICTshow QR code for server config sharingno certificate matches the pinned hash%s is not a valid port number or rangefailed to send ZeroSSL EAB request: %wmasquerade HTTPS server up and runningtls: invalid ClientKeyExchange messagetls: invalid ServerKeyExchange messageexpected an Ed25519 public key, got %Tinternal error: unknown signature typetls: server selected unsupported grouptls: unsupported signing key type (%T)tls: early_data without pre_shared_keytls: client sent unexpected early datatls: failed to sign ECDHE parameters: tls: server selected unsupported curvetls: missing ServerKeyExchange messagetls: internal error: unsupported curvex509: invalid subject alternative namex509: invalid authority key identifierx509: empty name constraints extensionx509: failed to parse EC private key: x509: cannot validate certificate for IPv4 field has octet with leading zerosyscall: readInt with unsupported sizeindex out of range [%x] with length %ymakechan: invalid channel element typeunreachable method called. linker bug?gcBgMarkWorker: blackening not enabledcannot read stack of running goroutineruntime: blocked read on free polldescruntime: sudog with non-false isSelectarg size to reflect.call more than 1GBv could not fit in traceBytesPerNumber1110223024625156540423631668090820312555511151231257827021181583404541015625strings.Reader.Seek: negative positionstrings: Repeat output length overflowcan not access a needed shared librarytime: missing Location in call to Dateafter decimal point in numeric literalfailed to parse Location header %q: %vhttp2: server connection from %v on %phttp: Accept error: %v; retrying in %vregistering account %v with server: %wTLS handshake aborted by event handlerhandshake aborted by event handler: %wsuccessfully stapled new OCSP responsepanic: ring buffer rate limiter: %v %sunable to find the main domain for: %scrypto/sha256: invalid hash state sizeecdsa: public key does not match curveinternal error: unknown string type %dasn1: Unmarshal recipient value is nilreflect.typeptrdata: unexpected type, reflect: close of receive-only channelreflect: Method on nil interface valueinsufficient data for base length typeconcurrent map iteration and map writeresult must be addressable (a pointer)flag %s set at %s before being definedSent Request: %#v %#v %#v %#v %#v %#v Could not determine native endianness.QUIC_GO_DISABLE_CLIENTHELLO_SCRAMBLINGunexpected size for SETTINGS frame: %dhttp3: unsupported protocol scheme: %smime: expected slash after first tokenunexpected content-type=%s for host %sinvalid P224 compressed point encodinginvalid P256 compressed point encodinginvalid P384 compressed point encodinginvalid P521 compressed point encodingrsa: internal error: gcd(a, b) is evenrsa: internal error: gcd(a, b) is zerobigmod: internal error: bad arithmeticcrypto/sha512: invalid hash state sizeextra bytes at the end of the timezonecannot have underscore before exponenttoml: number %d does not fit in an intline %d: cannot unmarshal %s%s into %sline %d: field %s not found in type %sdid not find expected could not find expected directive namefound an incorrect leading UTF-8 octetunexpected additional overlap scenariono support for message_set_wire_format%v: unable to resolve extension %v: %vdeprecated_legacy_json_field_conflictstype mismatch: cannot convert %v to %sinvalid connection ID length: %d bytes lost packet %d (reordering threshold)negative number of outstanding packetsCryptoSetup: keys were already droppedReceived 0-RTT read key for the clientfailed to read session ticket revisionGODEBUG sys/cpu: unknown cpu feature "Kind.String() not implemented for '%d'found wrong type: got %v, want messagename reference must be fully qualifiedinvalid field: no encoder for %v %v %vcannot encode %d bits into %d-bit codeinvalid octal escape code %q in stringfailed getting EAB credentials: HTTP %dcannot set both acl.file and acl.inlinetls: unsupported certificate curve (%s)TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256tls: internal error: wrong nonce lengthno mutually supported protocol versionschain is not signed by an acceptable CAx509: invalid subject alternative namesx509: invalid NameConstraints extensionx509: failed to parse URI constraint %qx509: invalid policy mappings extensionx509: failed to marshal private key: %vmath/big: buffer too small to fit valuex509: unknown EC private key version %d because it doesn't contain any IP SANsx509: invalid elliptic curve public keyx509: signing with MD5 is not supportedx509: trailing data after X.509 SubjectIPv4 field must have at least one digitmismatched count during itab table copyout of memory allocating heap arena map/cpu/classes/gc/mark/assist:cpu-seconds/cpu/classes/scavenge/total:cpu-seconds/memory/classes/profiling/buckets:bytesmspan.sweep: bad span state after sweepruntime: blocked write on free polldescsuspendG from non-preemptible goroutineruntime: casfrom_Gscanstatus failed gp=stack growth not allowed in system calltraceback: unexpected SPWRITE function traceRegion: alloc with concurrent drop277555756156289135105907917022705078125transport endpoint is already connectedSetctty set but Ctty not valid in childsyscall.releaseForkLock: negative count2006-01-02 15:04:05.999999999 -0700 MSTcobra_annotation_required_if_others_sethop interval must be at least 5 secondshttp: putIdleConn: keep alives disabledusername/password authentication failedcache full; evicting random certificateconverting identifier '%s' to ASCII: %vno certificate matching TLS ClientHellono OCSP server specified in certificateadding temporary record for zone %q: %wecdsa: public key point is the infinityecdsa: private key does not match curvecrypto/rsa: invalid options for Decryptcipher: incorrect tag size given to GCMcrypto/cipher: incorrect GCM nonce sizemlkem: invalid encapsulation key lengthtags don't match (%d vs %+v) %+v %s @%dasn1: Unmarshal recipient value is nil reflect: OverflowUint of non-uint type reflect.MakeMapWithSize of non-map typednsmessage.AAAAResource{AAAA: [16]byte{unable to cast %#v of type %T to %T: %wextraneous or missing " in quoted-fieldcsv: invalid field or comment delimiterGot UserPassNegotiationReply: %#v %#v set socket option: IPV6_TRANSPARENT: %sdropped unexpected encryption level: %sIncreased receive buffer size to %d kiBError sending Stateless Reset to %s: %scrypto/blake2b: invalid hash state sizemultipart: can't write to finished partinvalid indexed representation index %dvalidations succeeded; finalizing orderno certificate chains offered by serverurn:ietf:params:acme:error:unauthorizedbad signature on embedded certificate: ;; OPT PSEUDOSECTION: ; EDNS: version exec: environment variable contains NULed25519: bad Ed25519ph context length: rsa: internal error: e*d != 1 mod λ(N)fips140: no verification checksum foundmissing argument to repetition operatortrailing backslash at end of expressioncannot store inline table in Go type %stoml: number %d does not fit in an int8cannot decode node with unknown kind %dunknown problem generating YAML contentcannot marshal invalid UTF-8 data as %scannot encode node with unknown kind %dfound an incorrect trailing UTF-8 octetdid not find expected hexdecimal numberSEG6_LOCAL_NH4 has invalid IPv4 addressEither Dst.IP, Src.IP or Gw must be set %s &wire.MaxDataFrame{MaximumData: %d} Setting ACK timer to max ack delay: %sUnmarshalling session ticket failed: %sReceived 0-RTT write key for the server%s %s giving up after %d attempt(s): %wdnsmessage.HTTPSResource{SVCBResource: gob: cannot encode nil pointer of type can't represent recursive pointer type google.golang.org/genproto/protobuf/apigoogle.golang.org/protobuf/types/known/%v: MessageSet with no extensions fieldinvalid value: merging into nil messagebuild line missing '=' after quoted keycrypto/blake2s: invalid hash state sizefailed to creare ZeroSSL EAB request: %wclient doesn't support certificate curveoversized record received with length %dtls: received empty certificates messagetls: client didn't provide a certificatex509: malformed extension critical fieldx509: cannot parse IP address of length %s %q is not permitted by any constrainterrors: target must be a non-nil pointertime: Stop called on uninitialized TimerIPv6 zones cannot be present in a prefixinvalid span in heapArena for user arenabulkBarrierPreWrite: unaligned argumentsruntime: typeBitsBulkBarrier with type refill of span with free space remaining/cpu/classes/scavenge/assist:cpu-secondsruntime.SetFinalizer: first argument is failed to acquire lock to reset capacitymarkWorkerStop: unknown mark worker modecannot free workbufs when work.full != 0runtime: out of memory: cannot allocate runtime: netpollBreak write failed with stopTheWorld: broken CPU time accountingglobal runq empty with non-zero runqsizemust be able to track idle limiter eventgoroutine stack size is not a power of 213877787807814456755295395851135253906256938893903907228377647697925567626953125ryuFtoaFixed32 called with negative precaddress family not supported by protocolports not allowed with file URLs: got %vhttp2: timeout awaiting response headersFrame accessor called on non-owned Frameinternal error: expecting non-nil streamrequest header %q is not valid in HTTP/2http2: Transport encoding header %q = %qprotocol error: headers after END_STREAMwriteData(stream=%d, p=%d, endStream=%v)unrecognized or unsupported key type: %surn:ietf:params:acme:error:orderNotReadyauthentication error, HTTP status code: crypto/rsa: input must be hashed messagecrypto/cipher: output smaller than inputcipher: the nonce can't have zero lengthchacha20poly1305: invalid buffer overlapNumericString contains invalid charactercannot represent time as GeneralizedTimeMapIter.Key called on exhausted iteratorreflect: FieldByName of non-struct type reflect.Value.Call: call of nil functionreflect.Value.Call: wrong argument countattempted to copy pointer to FP registerreflect.Value.SetBytes of non-byte slicereflect.Value.setRunes of non-rune sliceunknown flagNotExistErrorMessageType: %vtime.Time year outside of range [0,9999]Sent UserPassNegotiationReply: %#v %#v reading original destination address: %sDropping (potentially) duplicate packet.received NEW_TOKEN frame from the clientconnection BUG: unexpected send mode: %dfailed to determine send buffer size: %wActivating reading of ECN bits for IPv4.Activating reading of ECN bits for IPv6.http3: invalid http header field name %qmultipart: unexpected line in Next(): %qmalformed MIME header: missing colon: %qevictOldest(%v) on table with %v entriesoverflowing NSEC(3) block in type bitmaped25519: bad Ed25519ctx context length: rsa: prime size must be at least 16 bitsrsa: internal error: inconsistent lengthfloat can have at most one decimal pointtoml: number %d does not fit in an int32toml: number %d does not fit in an int16line %d: field %s already set in type %sunsupported flag %q in tag %q of type %sclient sent a retry_source_connection_idCannot drop keys for encryption level %sflow controller reset after reading datamismatching version. Got %d, expected %d0-RTT was rejected. Dropping 0-RTT keys.Installed Handshake Read keys (using %s)quotedprintable: invalid hex byte 0x%02xedwards25519: use of uninitialized Pointunicode point needs %d character, not %dtoml: key %s should be a table, not a %smessage %T is neither a v1 or v2 Messageinvalid type: no encoder for %v %v %v/%vinvalid Unicode escape code %q in stringreceived signal, shutting down gracefullytls: internal error: unsupported key (%T)invalid value length: expected %d, got %dtls: unsupported decryption key type (%T)tls: failed to parse client certificate: tls: internal error: failed to clone hashtls: internal error: unknown cipher suitetls: no supported elliptic curves offeredtls: internal error: empty verified chainx509: cannot parse URI %q: invalid domaincolon must be followed by more charactersunexpected call to os.Exit(0) during test closed, unable to open /dev/null, errno=runtime: typeBitsBulkBarrier without typeWARNING: LIKELY CLEANUP/FINALIZER ISSUES /memory/classes/metadata/mspan/free:bytesruntime.SetFinalizer: second argument is gcSweep being done but phase is not GCoffobjects added out of order or overlappingmheap.freeSpanLocked - invalid stack freemheap.freeSpanLocked - invalid span stateattempted to add zero-sized address rangeruntime: blocked read on closing polldescstopTheWorld: not stopped (stopwait != 0) received on thread with no signal stack invalid timer: fake time but no syncgroup34694469519536141888238489627838134765625strconv: illegal AppendInt/FormatInt baseclone(CLONE_PIDFD) failed to return pidfdtime: Reset called on uninitialized Timertime: missing Location in call to Time.InTime.UnmarshalBinary: unsupported version help [path to command] for full details.Generate the autocompletion script for %snet/url: invalid control character in URLQUICConfig.InitialConnectionReceiveWindowmin and max hop interval must both be setwriteEndsStream called on nil writeFramerinvariant; can't close stream in state %vhttp2: server ignoring unknown setting %vCloseNotify called after Handler finishedWriteHeader called after Handler finishedhttp2: no cached connection was availablehttp2: Transport health check failure: %vtransport got GOAWAY with error code = %vmaking TLS-ALPN challenge certificate: %vcould not decode name.com's response: %wunrecognized Content-Type from server: %s{"crv":"%s","kty":"EC","x":"%s","y":"%s"}bytes.Buffer.WriteTo: invalid Write countbytes.Reader.WriteTo: invalid Write countcrypto/md5: invalid hash state identifierasn1: internal error in parseTagAndLength%s slice too big: %d elements of %d bytescan't call pointer on a non-pointer ValueMapIter.Next called on exhausted iteratorreflect: FieldByIndex of non-struct type reflect.Value.Addr of unaddressable valuetrying to get %s value of flag of type %sneeds a map with string keys, has %q keysunsupported type for squashed pointer: %sInvalid Version of Username Password Authconvert file descriptor to connection: %sset socket option: IP_RECVORIGDSTADDR: %sunable to obtain original destination: %sread len %d overflows bufs element len %denqueueing PATH_CHALLENGE for new path %sDropping a packet with an unknown versionSetting DF failed for both IPv4 and IPv6.http3: no cached connection was availablecontradicting content lengths (%s and %s)expected Required Insert Count to be zeroidna: internal error in punycode encodingurn:ietf:params:acme:error:serverInternaldns: length mismatch, want 0/2 but got %dout of order NSEC(3) block in type bitmapfips140: unknown GODEBUG setting fips140=RSASSA-PKCS-v1.5 2048-bit sign and verifyexpecting colon between hours and minutesfound an indentation indicator equal to 0Installed Handshake Write keys (using %s)unexpected Retry integrity tag length: %dreflect.Value flag field has changed kindGODEBUG sys/cpu: no value specified for """" not allowed in multiline basic stringtoml: expected %s to be a table, not a %sgoogle.golang.org/genproto/protobuf/ptypemismatching message name: got %v, want %vunexpected character after quoted key: %qtls: malformed ECHConfig, invalid %s fieldtls: private key does not match public keyruntime.AddCleanup: ptr is arena-allocatedx509: %q cannot be encoded as an IA5Stringx509: RSA modulus is not a positive numberx509: invalid policy constraints extensionx509: invalid inhibit any policy extensionall candidate chains have invalid policiesgo package net: using the Go DNS resolver bytes; incompatible with mutex flag mask persistentalloc: align is not a power of 2/cpu/classes/gc/mark/dedicated:cpu-seconds/memory/classes/metadata/mcache/free:bytes/memory/classes/metadata/mspan/inuse:bytesnon-empty mark queue after concurrent marksweep: tried to preserve a user arena spanruntime: blocked write on closing polldescunexpected state passed to panicrangestateacquireSudog: found s.elem != nil in cachefatal error: cgo callback before cgo call on a locked thread with no template threadunexpected signal during runtime execution received but handler not on signal stack stop of synctest timer from outside bubbletraceStopReadCPU called with trace enabledattempted to trace a bad status for a procout of memory allocating checkmarks bitmap173472347597680709441192448139190673828125867361737988403547205962240695953369140625Time.MarshalBinary: unexpected zone offsetunable to find a command for arguments: %vError while parsing flags from args %v: %s%s?cver=%s&plat=%s&arch=%s&chan=%s&side=%stried to delete unknown outgoing stream %dtried to delete unknown incoming stream %dlooking for beginning of object key stringmix of request and response pseudo headersPRIORITY frame payload size was %d; want 5Failed to parse goroutine ID out of %q: %vhttp2: server connection error from %v: %vhttp: multipart handled by MultipartReaderhttp: ContentLength=%d with Body length %dcould not decode account's private key: %vstarted background certificate maintenancestopped background certificate maintenancecould not determine zone for domain %q: %vcrypto/rsa: salt length cannot be negativecrypto/sha1: invalid hash state identifierpoly1305: write to MAC after Sum or Verifysync/atomic: store of nil value into ValuePrintableString contains invalid characterMapIter.Value called on exhausted iteratorreflect: negative length passed to ArrayOfreflect: Call with too few input argumentsmismatch between ABI description and typesreflect: cannot convert slice with length insufficient data for resource body lengthenable offload: check IFF_VNET_HDR enabledclosing connection in order to recreate itSwitching destination connection ID to: %sError occurred handling initial packet: %sError sending CONNECTION_REFUSED error: %sinvalid value for SETTINGS_H3_DATAGRAM: %dinvalid HTTP header value %q for header %qexpected first frame to be a HEADERS framehttp3: failed to read response headers: %winternal error: call to runtimeSource.Seeddomain name exceeded %d wire-format octetsSVCB keys not in strictly increasing orderdns: svcbipv6hint: expected ipv6, got ipv4gave up after %d attempts, last error : %sgave up after %d attempts, last error: %#vleading zero not allowed on decimal numbercannot have underscore after decimal pointinvalid array: want %d elements but got %dIncorrect element type in vf info list: %ddecoding failed: address family %d unknownmissing original_destination_connection_idreceived duplicate transport parameter %#xSending ACK because the ACK timer expired.packet %d not found in sent packet historyquotedprintable: invalid bytes after =: %qKeyValue should have at least two childrenarray elements must be separated by commasgob: encoded unsigned integer out of rangeexpected 3 columns for replacement; got %dcould not parse Go build info: line %d: %wTLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256tls: received unexpected key update messagetls: no supported elliptic curves for ECDHEtls: server did not select an ALPN protocoltls: server sent unrequested session tickettls: received malformed key_share extensiontls: invalid early data for QUIC connectiontls: client's Finished message is incorrecttls: handshake data received at wrong leveltls: SendSessionTicket called on the clientx509: failed to parse dnsName constraint %qx509: invalid X25519 private key parametersruntime: opened unexpected file descriptor /memory/classes/metadata/mcache/inuse:bytesruntime.SetFinalizer: first argument is nilruntime.SetFinalizer: finalizer already setgcBgMarkWorker: unexpected gcMarkWorkerModenon in-use span found with specials bit setgrew heap, but no adequate free space foundroot level max pages doesn't fit in summaryruntime: releaseSudog with non-nil gp.paramunknown runnable goroutine during bootstrapruntime: casfrom_Gscanstatus bad oldval gp=runtime:stoplockedm: lockedg (atomicstatus=methodValueCallFrameObjs is not in a modulereset of synctest timer from outside bubblesynctest timer accessed from outside bubbleGcSlice can't handle on-demand gcdata typesmult64bitPow10: power of 10 is out of rangeinterrupted system call should be restartedfailed to read configuration from input: %wInitialized: local=%s target=%s interval=%smultiple Read calls return no data or errorhttp2: client conn could not be establishedno multipart boundary param in Content-Typenet/http: timeout awaiting response headerstimeout waiting for SETTINGS frames from %vhttp2: server closing client connection: %vhttp2: unexpected ALPN protocol %q; want %qTransport: unhandled response frame type %TError enabling Transport HTTP/2 support: %vunable to write OCSP staple file for %v: %vhttps://api.gandi.net/v5/livedns/domains/%scould not encode form data for request: %wresponse had invalid Retry-After header: %sorder pending, authorizations remaining: %vexplicit time type given to non-time memberreflect: nil type passed to Type.Implementsreflect: CallSlice of non-variadic functionreflect: Call with too many input argumentsFlag shorthand -%s has been deprecated, %s bufio: tried to rewind past start of bufferset socket option: IPV6_RECVORIGDSTADDR: %sstream %d canceled by %s with error code %dDiscarded DATAGRAM frame (%d bytes payload)failed to determine receive buffer size: %whttp3: too many 1xx informational responseschunked encoding contains too much non-dataoauth2: cannot fetch token: %v Response: %sexec: WaitDelay expired before I/O completefailed to parse dns answers for host %s: %wrsa: internal error: modulus size incorrectexpecting colon between minutes and secondscannot have underscore before decimal pointtoml: decoding pointer target cannot be nilextra characters at the end of a local time!!binary value contains invalid base64 datafound character that cannot start any tokendid not find expected comment or line breakfound unexpected non-alphabetical characterfound invalid Unicode character escape codetransform: inconsistent byte count returnedrefusing to Unmarshal into non-zero IPRangetimeout: handshake did not complete in time %s &wire.DataBlockedFrame{MaximumData: %d}sent packet with unexpected ECN marking: %sedwards25519: invalid point encoding length''' not allowed in multiline literal stringfile %q has a package name conflict over %vreplacement with no module on previous linefailed decoding ZeroSSL EAB API response: %wtls: server's Finished message was incorrecttls: server sent an incorrect legacy versiontls: invalid server X25519MLKEM768 key sharetls: invalid X25519MLKEM768 server key sharetls: invalid X25519MLKEM768 client key sharetls: SendSessionTicket called multiple timestls: StoreSessionTicket called on the serverx509: invalid RDNSequence: invalid attributex509: invalid Ed25519 private key parametersx509: invalid Ed25519 private key length: %dx509: internal error: cannot parse domain %qcrypto/x509: error fetching intermediate: %wx509: failed to unmarshal raw CSR Attributesuse of WriteTo with pre-connected connectionspan on userArena.faultList has invalid sizesend on synctest channel from outside bubbleout of memory allocating heap arena metadataruntime: cannot remap pages in address space/cpu/classes/scavenge/background:cpu-secondsruntime: unexpected metric registration for gcmarknewobject called while doing checkmarkactive sweepers found at start of mark phaseno P available, write barriers are forbiddencannot trace user goroutine on its own stackunsafe.Slice: ptr is nil and len is not zeromult128bitPow10: power of 10 is out of range%v Logger.check error: failed to get caller fragments not allowed with file URLs: got %vfailed to send fd to control unix socket: %wHop after %s: local=%s -> %s remote=%s -> %shttp: putIdleConn: too many idle connectionshttp: attempting to traverse a non-directoryconnection exceeded flow control window sizehttp2: could not negotiate protocol mutuallyhttp2: 1xx informational responses too largehttp: Request.ContentLength=%d with nil Bodyretrieving next certificate in chain: %s: %wunsupported SOCKS5 authentication method: %dcrypto/sha256: invalid hash state identifiercipher: NewGCM requires 128-bit block cipherreflect: call of MakeFunc with non-Func typereflect: funcLayout with interface receiver using value obtained using unexported fieldreflect: function created by MakeFunc using reflect: slice length out of range in SetLeninsufficient data for calculated length typeerror remain-tag field with invalid type: %qencoding alphabet contains newline characterencoding alphabet includes duplicate symbolsError parsing Version Negotiation packet: %sDATAGRAM frame too large (maximum: %d bytes)activating ECN failed for both IPv4 and IPv6http3: server didn't enable Extended CONNECThttp3: received pseudo header in trailer: %smultipart: expecting a new Part; got line %qmime: unexpected content after media subtypeinvalid Transfer-Encoding request header: %qfailed to build dns question for host %s: %wfailed to finish dns message for host %s: %wfailed to skip dns questions for host %s: %wed25519: bad Ed25519ph message hash length: crypto/sha512: invalid hash state identifierneed at least one digit after fraction pointyaml internal error: please report the issueneither tag nor implicit flags are specifiedmapping keys are not allowed in this contextdid not find expected digit or '.' characterdecoding failed: buffer too small (%d bytes)ackhandler BUG: ackedPackets slice not emptyPTO timer in unexpected encryption level: %smax-age=31536000; includesubdomains; preloadoauth2: server response missing access_tokenmultiline basic string not terminated by """this should not be a top level node type: %s%s previously from: %q currently from: %qTLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256tls: internal error: unexpected renegotiationtls: invalid reconstructed inner client hellotls: no server certificates in client sessiontls: failed to find any PEM data in key inputx509: IP constraint contained invalid mask %xx509: certificate signed by unknown authorityhandleTransientAcquire called in invalid modehandleTransientRelease called in invalid modeclose of synctest channel from outside bubble may be in the same tiny block as finalizer transitioning GC to the same state as before?produced a trigger greater than the heap goaltried to run scavenger from another goroutineruntime: failed mSpanList.remove span.npages=exitsyscall: syscall frame is no longer validunsafe.String: ptr is nil and len is not zerocannot send after transport endpoint shutdownrequires at least %d arg(s), only received %dsink factory already registered for scheme %qcontext: internal error: missing cancel errorjson.RawMessage: UnmarshalJSON on nil pointerhttp: putIdleConn: connection is in bad statehttp: no Client.Transport or DefaultTransportunbuffered done channel passed in for type %THTTP/1.1 %d %s%sUnsupported transfer encodingnet/http: internal error: connCount underflowclient tried to switch to invalid protocol %qnumber of URL query parameters exceeded limitcould not determine authoritative nameserverscertificate has no names; removing from cachecertificate expires soon; queuing for renewaloverride disables querying OCSP responder: %v[ERROR] TLS-ALPN challenge server: accept: %vinvalid url scheme, expecting https:// prefixcrypto/rsa: message too long for RSA key sizezero length explicit tag was not an asn1.Flagmath/big: cannot unmarshal %q into a *big.Intreflect: nil type passed to Type.AssignableToreflect: internal error: invalid method indexparsing/packing of this section has completed%q shorthand is more than one ASCII charactersource data must be an array or slice, got %sbufio.Scanner: Read returned impossible countretired connection ID %d (highest issued: %d)Dropping packet with version %x. Expected %x.invalid request :path %q from URL.Opaque = %qcrypto/blake2b: invalid hash state identifierno response matching the supplied certificatefailed to start dns questions for host %s: %wfailed to create http request for host %s: %wfloat integer part cannot have leading zeroesDisabling ECN. All testing packets were lost.w must be at least 2 by the definition of NAFescape sequence is invalid Unicode code pointdetected mutation on the default bytes for %vdecode failure in lazy extension decoding: %v0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ $%*+-./:crypto/blake2s: invalid hash state identifierhttps://acme-v02.api.letsencrypt.org/directoryDuration for each direction in time-based modePSSWithSHA256PSSWithSHA384PSSWithSHA512Ed25519tls: server chose an unconfigured cipher suitetls: failed to parse certificate from server: tls: server did not echo the legacy session IDtls: server accepted 0-RTT with the wrong ALPNtls: received new session ticket from a clientruntime.AddCleanup: ptr not in allocated blockx509: failed to unmarshal elliptic curve pointx509: failed to parse rfc822Name constraint %qx509: malformed signature algorithm identifierx509: unknown curve while marshaling to PKCS#8x509: invalid elliptic curve private key valueslice bounds out of range [:%x] with length %ypanicwrap: unexpected string after type name: memory reservation exceeds address space limittried to park scavenger from another goroutinereleased less than one physical page of memorysysGrow bounds not aligned to pallocChunkBytesruntime: failed to create new OS thread (have runtime: panic before malloc heap initialized stopTheWorld: not stopped (status != _Pgcstop)select on synctest channel from outside bubbleruntime: name offset base pointer out of rangeruntime: type offset base pointer out of rangeruntime: text offset base pointer out of rangeboth Setctty and Foreground set in SysProcAttrTime.UnmarshalJSON: input is not a JSON stringERROR: unexpected ShellCompDirective value: %dcan't register a sink factory for empty stringfirst path segment in URL cannot contain colon%v Unsafe CheckedEntry re-use near Entry %+v. request Content-Type isn't multipart/form-dataGOAWAY close timer fired; closing conn from %vinternal error: cannot create stream with id 0http2: Transport creating client conn %p to %vprotocol error: received DATA after END_STREAMclient sent an HTTP request to an HTTPS servernet/http: internal error: misuse of tryDeliverbackend tried to switch to invalid protocol %q%s: caching certificate after obtaining it: %vcould not find the start of authority for %s%stimed out waiting to obtain certificate for %sunexpected state: %s - order already finalizedbytes.Reader.UnreadByte: at beginning of slicecipher.NewCTR: IV length must equal block sizemath/big: mismatched montgomery number lengthsreflect: nil type passed to Type.ConvertibleToreflect.Struct: fields with different PkgPath reflect.StructOf: illegal embedded field type returned value obtained from unexported fieldreflect.Value.Slice: slice index out of boundsinvariant failed: growthLeft is unexpectedly 0OCSP response contains bad number of responsesdns: svcbipv4hint: expected ipv4, hint is ipv6dns: svcbipv6hint: expected ipv6, hint is ipv4failed to perform http request for host %s: %wed25519: internal error: setting scalar failedrsa: generated p == q, random source is brokenedwards25519: invalid field element input sizemapping values are not allowed in this contextdid not find expected whitespace or line breaklwt bpf decode: failed parsing route attributeerror while reading transport parameter %d: %sTransport parameters changed. Rejecting 0-RTT.multiline literal string not terminated by '''google.golang.org/genproto/protobuf/field_maskUse bytes per second instead of bits per secondtls: malformed encrypted_client_hello extensionfirst record does not look like a TLS handshaketls: incorrect renegotiation extension contentstls: server selected unadvertised ALPN protocoltls: internal error: pskBinders length mismatchtls: server selected TLS 1.3 in a renegotiationtls: malformed encrypted client hello extensiontls: server sent two HelloRetryRequest messagestls: Config MinVersion must be at least TLS 1.3x509: malformed public key algorithm identifierx509: internal error: IP SAN %x failed to parseunexpected error wrapping poll.ErrFileClosing: slice bounds out of range [::%x] with length %yreceive on synctest channel from outside bubbleruntime·lock: sleeping while lock is availableP has cached GC work at end of mark terminationfailed to acquire lock to start a GC transitionfinishGCTransition called without starting one?tried to sleep scavenger from another goroutineracy sudog adjustment due to parking on channelfunction symbol table not sorted by PC offset: attempted to trace a bad status for a goroutineattempting to link in too many shared librariescobra_annotation_bash_completion_subdirs_in_dirhttp: server gave HTTP response to HTTPS clientflow control update exceeds maximum window sizewr.done != nil for write100ContinueHeadersFrame1xx informational response with END_STREAM flagprotocol error: received DATA on a HEAD request[FrameWriteRequest stream=%d, ch=%v, writer=%v]missing config pointer (must use NewACMEIssuer)opening distributed challenge token file %s: %vunable to delete stale lockfile; deadlocked: %wtimed out waiting for certificate renewal of %secdsa: hash length does not match hash functionchacha20poly1305: message authentication failedcrypto/ecdh: public key is the identity elementasn1: Unmarshal recipient value is non-pointer explicit string type given to non-string memberreflect.Value.Bytes of unaddressable byte arrayreflect: CallSlice with too few input argumentsregister-based return value has stack componentexpected type '%s', got unconvertible type '%s'bufio: reader returned negative count from Read^(\w+)\s*\(([^,]+)(?:,([^,]+))?(?:,([^,]+))?\)$Queueing packet (%d bytes) for later decryption:path, :authority and :method must not be emptyinvalid :protocol header in non-CONNECT requestbigmod: modulus for ExpShortVarTime must be oddfloat decimal point must be preceded by a digitfloat decimal point must be followed by a digitfound a tab character that violates indentationAckFrame: ACK frame contains invalid ACK rangesNot doing 0-RTT. Has sealer: %t, has params: %tinvalid string length %d: exceeds input size %dmap field %v cannot be set with read-only valuetls: CloseWrite called before handshake completeunable to generate random session ticket key: %vfailed to parse certificate #%d in the chain: %wtls: no FIPS compatible certificate chains foundtls: no supported symmetric ciphersuites for ECHtls: invalid EncryptedClientHelloKeys Config: %stls: CurvePreferences includes unsupported curvex509: X25519 key encoded with illegal parametersx509: SAN uniformResourceIdentifier is malformedx509: IP constraint contained value of length %dx509: internal error: cannot parse constraint %qx509: internal error: URI SAN %q failed to parsex509: only RSA, ECDSA and Ed25519 keys supportedx509: only CAs are allowed to specify MaxPathLenx509: failed to serialise extensions attribute: slice bounds out of range [:%x] with capacity %y is reachable from cleanup or cleanup argument runtime: cannot map pages in arena address spaceruntime: malformed profBuf buffer - invalid sizeattempt to trace invalid or unsupported P statusstrconv: illegal AppendFloat/FormatFloat bitSizenot enough significant bits after mult64bitPow10group id '%s' is not defined for subcommand '%s'peer tried to open stream %d (current limit: %d)net/http: extended connect not supported by peerinternal error: should have a body in this statenet/http: Hijack called after ServeHTTP finishedcertificate appears to have been renewed already[ERROR] TLS-ALPN challenge server: handshake: %vcould not decode the response from name.com: %wserver set unrecognized authorization status: %sretrieving alternate certificate chain at %s: %w%-8s %-12s %12s %8s %12s %12s %12s %12s %-16s %sout points to big.Int, but defaultValue does notreflect: CallSlice with too many input argumentsparsing/packing of this type isn't available yetbufio: writer returned negative count from Writelength of packet (%d) < virtioNetHdr.hdrLen (%d)connection BUG: unspecified error type (msg: %s)Activating reading of packet info bits for IPv4.Activating reading of packet info bits for IPv6.additional HEADERS frame received after trailersmalformed SRV value; expected: ' 'crypto/rsa: input must be hashed with given hashdates are expected to have the format YYYY-MM-DDcannot decode TOML %s into a Go value of type %sextra characters at the end of a local date timetoml: negative number %d does not fit in an uintreceived %d bytes on stream %d, allowed %d bytesinvalid Mutable on field with non-composite typefield %v has invalid type: got %v, want map kindlist field %v cannot be set with read-only valueinvalid status code (must be 200-599, except 233)crypto/tls: ExportKeyingMaterial context too longtls: server advertised unrequested ALPN extensiontls: server sent a cookie in a normal ServerHellotls: client offered only unsupported versions: %xtls: client using inappropriate protocol fallbacktls: client illegally modified second ClientHello/etc/pki/ca-trust/extracted/pem/tls-ca-bundle.pemx509: invalid RDNSequence: invalid attribute typex509: Ed25519 key encoded with illegal parametersx509: private key contains zero or negative valuex509: private key contains zero or negative primex509: signature returned by signer is invalid: %wthe :: must expand to at least one field of zerosslice bounds out of range [::%x] with capacity %yinvalid memory address or nil pointer dereferencepanicwrap: unexpected string after package name: s.allocCount != s.nelems && freeIndex == s.nelemsruntime.reflect_makemap: unsupported map key typesweeper left outstanding across sweep generationsfully empty unfreed span set block found in resetcasgstatus: waiting for Gwaiting but is Grunnablenot enough significant bits after mult128bitPow10strings.Reader.UnreadByte: at beginning of stringstrings.Reader.WriteTo: invalid WriteString countinvalid or incomplete multibyte or wide character# fish completion for %-36s -*- shell-script -*- tried to delete incoming stream %d multiple timeshttp2: request body closed due to handler exitinghttp: wrote more than the declared Content-Length (Client.Timeout exceeded while awaiting headers)unexpected Peek failure reading buffered byte: %vnet/http: Transport.Dial hook returned (nil, nil)%s: reloading renewed certificate into memory: %vrenewing certificate aborted by event handler: %wdecoding challenge token file %s (corrupted?): %vfailed to decode PEM block containing private keynot configured for on-demand certificate issuancesubject name does not qualify for certificate: %scould not remove compromised private key from useecdsa: internal error: truncated hash is too longcrypto/elliptic: internal error: invalid encodingchacha20poly1305: bad nonce length passed to Sealchacha20poly1305: bad nonce length passed to Openreflect.Value.Slice: slice of unaddressable arrayputPacketBuffer called with packet of wrong size!connection BUG: couldn't pack %s probe packet: %vDropping long header packet of type %s (%d bytes)Activating reading of ECN bits for IPv4 and IPv6.error parsing connection ID on packet from %s: %shttp3: expected first frame to be a HEADERS framefailed to read http response body for host %s: %wcrypto/rsa: public exponent too small or negativedatetime separator is expected to be T or a spacetoml: negative number %d does not fit in an uint8toml: error parsing key of type %s from float: %wlwt bpf decode: failed parsing attribute. err: %vclient sent an original_destination_connection_idVersion Negotiation packet has empty version listDisabling ECN. ECN counts decreased unexpectedly.received packet with unknown encryption level: %sPeer doesn't await address validation any longer.Congestion limited: bytes in flight %d, window %dexpected character %c but the document ended heresubslice address (%d) is before data address (%d)gob: registering duplicate types for %q: %s != %sgob: registering duplicate names for %s: %q != %qminHopInterval and maxHopInterval must both be sethttps://api.zerossl.com/acme/eab-credentials-emailcryptobyte: attempted write while child is pendingtls: received unexpected CertificateStatus messagetls: invalid signature by the server certificate: tls: invalid signature by the client certificate: tls: client offered TLS version older than TLS 1.3x509: missing ASN.1 contents; use ParseCertificatex509: invalid RDNSequence: invalid attribute valuex509: RSA public exponent is not a positive numberx509: unknown key type while marshaling PKCS#8: %Tmallocgc called with gcphase == _GCmarkterminationrecursive call during initialization - linker skewattempt to execute system stack code on user stackcobra_annotation_bash_completion_one_required_flagnet/http: cannot rewind body after connection losshttp: putIdleConn: CloseIdleConnections was calledgot CONTINUATION for stream %d; expected stream %dhttp: suspiciously long trailer after chunked bodynet/http: Transport failed to read from server: %vnet/http: HTTP/1.x transport connection broken: %wobtaining certificate aborted by event handler: %wunknown key type; only RSA and ECDSA are supportedinvalid hijack address (must be an IP address): %scrypto/elliptic: nistec rejected normalized scalarcrypto/rsa: prime factors are not relatively primecrypto/cipher: incorrect nonce length given to GCMchacha20: SetCounter attempted to rollback countercrypto/ecdh: public key does not match private keyLogValue called too many times on Value of type %Tdecoding failed due to the following error(s): %wNot adding connection ID %s, as it already exists.http3: HEADERS frame too large: %d bytes (max: %d)dns: svcbport: port length is not exactly 2 octetsoauth2: token expired and refresh token is not setfailed to parse dns message header for host %s: %wtoml: negative number %d does not fit in an uint64toml: negative number %d does not fit in an uint32toml: negative number %d does not fit in an uint16^[-+]?[0-9][0-9_]*(?::[0-5]?[0-9])+(?:\.[0-9_]*)?$ACK rate: %.2f (total=%d, ack=%d, loss=%d, rtt=%d)initial_max_streams_uni too large: %d (maximum %d)unknown transport parameter marshaling version: %d Queuing ACK because the packet was ECN-CE marked.received an ACK for skipped packet number: %d (%s)reflect.Value read-only flag has changed semanticsedwards25519: invalid SetUniformBytes input lengthslice offset (%d) is farther than data length (%d)invalid uint data length %d: exceeds input size %dgoogle.golang.org/genproto/protobuf/source_contextfield %v has invalid type: got %v, want slice kindcache must have GetConfigForCert set in its optionstls: missing signature_algorithms from TLS 1.2 peercrypto/tls: reserved ExportKeyingMaterial label: %stls: server's identity changed during renegotiationtls: server selected unsupported compression formattls: server offered only incompatible point formatstls: server sent an unexpected early_data extensiontls: client did not request an application protocoltls: client offered only incompatible point formatsx509: certificate has expired or is not yet valid: internal error: too many releases of process handlelimiterEvent.stop: invalid limiter event type foundpotentially overlapping in-use allocations detectedfatal: systemstack called from unexpected goroutinequery parameters not allowed with file URLs: got %vJSON decoder out of sync - data changing underfoot?protocol error: received %T before a SETTINGS framehttp: Transport does not support unencrypted HTTP/2loading managed certificate for %v from storage: %vgot nil TLS-ALPN challenge certificate but no errorunable to forcefully get new certificate for %v: %wcould not encode the form data for the request: %wcrypto/elliptic: Add was called on an invalid pointgodebug: Value of name not listed in godebugs.All: cannot assign type %q to map value field of type %qIgnoring Retry, since we already received a packet.Ignoring Retry, since a Retry was already received.HTTP Datagrams enabled, but QUIC Datagrams disabledauthz %s has unexpected status; order will fail: %secdsa: internal error: request size exceeds maximumcrypto/ecdh: internal error: isLess input too largetoml: error unmarshalling key type %s from text: %wtoml: error parsing key of type %s from integer: %wline %d: mapping key %#v already defined at line %dlwt bpf decode: received unknown attribute type: %dinitial_max_streams_bidi too large: %d (maximum %d) Queueing ACK because packet %d was missing before.expected = after a key, but the document ends thereslice ends (%d+%d) is farther than data length (%d)extension %v extends %v outside the extension rangefield %v has invalid type: got %v, want struct kindfield %v has invalid type: %v does not implement %vtls: invalid EncryptedClientHelloKeys PrivateKey: %stls: server selected unsupported protocol version %xtls: received a session ticket with invalid lifetimetls: internal error: session ticket keys unavailabletls: private key type does not match public key typex509: cannot verify signature: insecure algorithm %verrors: *target must be interface or implement errorfailed to correctly flush all P-owned cleanup blocksruntime: cannot disable permissions in address spaceruntime.SetFinalizer: pointer not in allocated blockruntime: use of FixAlloc_Alloc before FixAlloc_Init span set block with unpopped elements found in resetcasfrom_Gscanstatus: gp->status is not in scan statecobra_annotation_bash_completion_filename_extensionsuser and password not allowed with file URLs: got %v request header "TE" may only be "trailers" in HTTP/2http2: Transport readFrame error on conn %p: (%T) %vprotocol error: received DATA before a HEADERS framedid not find chain matching preferences; using firstdeleting temporary record for name %q in zone %q: %wrequest to delete the record was not successful: %wrequest to update the record was not successful: %wecdsa: internal error: unexpectedly masking off bitsdnsmessage.OPTResource{Options: []dnsmessage.Option{Got UserPassNegotiationRequest: %#v %#v %#v %#v %#v Ignoring spoofed Retry. Integrity Tag doesn't match.Activating reading of packet info for IPv4 and IPv6.activating packet info failed for both IPv4 and IPv6:path must be empty and :authority must not be emptyhttp3: invalid http header field value %q for key %vdownloading certificate chain from %s: %w (order=%s)successfully downloaded available certificate chainsrsa: internal error: b is not divisible by gcd(a, b)internal error: missing handler for resolver table: source and destination ip are not the same IP familyinvalid value for max_ack_delay: %dms (maximum %dms) setting loss timer for packet %d (%s) to %s (in %s)Starting key drop timer to drop key phase %d (in %s)unexpected character 'i' while scanning for a numberunexpected character 'n' while scanning for a numberprototext: error parsing unknown field wire type: %vfailed to connect (server may not support speed test)tls: unable to generate random session ticket key: %vtls: received unexpected handshake message of type %Ttls: unexpected server_name extension in server hellotls: client does not support uncompressed connectionstls: failed to find any PEM data in certificate inputx509: certificate specifies an incompatible key usageunique.canonMap: ran out of hash bits while iteratingunique.canonMap: ran out of hash bits while insertingnon-concurrent sweep failed to drain all sweep queuesexited a goroutine internally locked to the OS threadhttp: putIdleConn: too many idle connections for hosthttp2: Framer %p: failed to decode just-written frameillegal use of AllowIllegalReads with ReadMetaHeadershttp2: Transport failed to get client conn for %s: %vnet/http: CloseNotify called after ServeHTTP finishedsubject does not qualify for a public certificate: %sfound preferred certificate chain by root common namefound unknown private key type in PKCS#8 wrapping: %Tgetting certificate from external certificate managerforcefully renewing certificate due to REVOKED statusHTTP %d: JSON-decoding problem details: %w (raw='%s')crypto/elliptic: attempted operation on invalid pointsync/atomic: compare and swap of nil value into Valuepem: cannot encode a header key that contains a colonreflect: non-interface type passed to Type.Implementsreflect.Value.Slice: string slice index out of boundssmall map with no empty slot (concurrent map writes?)bufio.Scan: too many empty tokens without progressingSent UserNameNegotiationRequest: %#v %#v %#v %#v %#v <- Reading packet %d (%d bytes) for connection %s, %sserver sent reduced limits after accepting 0-RTT data-> Sending packet %d (%d bytes) for connection %s, %sreceived crypto data after change of encryption levelDiscarding received DATAGRAM frame (%d bytes payload)wire.PutStreamFrame called with packet of wrong size!received a packet with an unexpected connection ID %sAdding connection IDs %s and %s for a new connection.chacha20: internal error: wrong dst and/or src lengthcrypto/ecdh: internal error: mismatched isLess inputs^[-+]?(\.[0-9]+|[0-9]+(\.[0-9]*)?)([eE][-+]?[0-9]+)?$did not find expected alphabetic or numeric character %s &wire.RetireConnectionIDFrame{SequenceNumber: %d}wrong length for reset_stream_at: %d (expected empty)min_ack_delay (%s) is greater than max_ack_delay (%s)invalid value for ack_delay_exponent: %d (maximum %d)script-src 'none'; object-src 'none'; base-uri 'none'invalid GOLANG_PROTOBUF_REGISTRATION_CONFLICT value: unkown field number %d while unmarshalling GoFeaturesunkown field number %d while unmarshalling FeatureSethaving only HTTP server without HTTPS is not supportedcertificate is not valid for requested server name: %wcryptobyte: Builder is exceeding its fixed-size buffertls: server resumed a session with a different versiontls: server accepted 0-RTT with the wrong cipher suitetls: certificate used with invalid signature algorithmtls: Encrypted Client Hello cannot be used pre-TLS 1.3tls: client indicated early data in second ClientHellotls: failed to create cipher while encrypting ticket: tls: found unknown private key type in PKCS#8 wrappingx509: cannot verify signature: algorithm unimplementedx509: invalid RDNSequence: invalid attribute value: %sURI with IP (%q) cannot be matched against constraints, square brackets can only be used with IPv6 addresses, IPv6 addresses must be surrounded by square bracketsruntime.m memory alignment too small for spinbit mutexmin size of malloc header is not a size class boundarygcControllerState.findRunnable: blackening not enabledno goroutines (main called runtime.Goexit) - deadlock!trace: non-empty full trace buffer for done generationtrace: non-empty full trace buffer for next generation goroutine running on other thread; stack unavailable http: Request.Write on Request with no Host or URL setread loop ending; caller owns writable underlying conninternal error: expected to be already writing a framehttp2: received GOAWAY %+v, starting graceful shutdownhttp2: handler wrote more than declared Content-Lengthnet/http: can't write control character in Request.URLhttputil: ReverseProxy read error during body copy: %vhttps://acme-staging-v02.api.letsencrypt.org/directoryno matching certificates and no custom selection logicremoved certificate's compromised private key from usebytes.Buffer: reader returned negative count from Readecdsa: curve not supported by deterministic signaturesname is not in canonical format (it must end with a .)panic calling String method on zero %v for flag %s: %vbinary.Write: some values are not fixed-sized in type virtioNetHdr.hdrLen (%d) < virtioNetHdr.csumStart (%d)end of checksum offset (%d) exceeds packet length (%d)expected first connection ID to have sequence number 0error parsing packet, couldn't parse connection ID: %sexpected retry_source_connection_id to equal %s, is %sClient offered version %s, sending Version Negotiationinvalid value for SETTINGS_ENABLE_CONNECT_PROTOCOL: %dreceived pseudo header %s after a regular header fieldquic: HKDF-Expand-Label invocation failed unexpectedlytag handle must contain alphanumerical characters onlyexplicitly tagged !!binary data must be base64-encodedblock sequence entries are not allowed in this contextoption ,inline needs a map with string keys in struct Not enough samples (total=%d, ack=%d, loss=%d, rtt=%d) %s &wire.MaxStreamsFrame{Type: uni, MaxStreamNum: %d}received %d bytes for the connection, allowed %d bytesquotedprintable: invalid unescaped byte 0x%02x in bodyfield %v has invalid type: got %v, want interface kindtls: internal error: handshake should have had a resulttls: server sent non-zero legacy TLS compression methodx509: authority info access incorrectly marked criticalx509: too many intermediates for path length constraintx509: failed to load system roots and no roots providedeach colon-separated field must have at least one digitinternal error: negative process handle reference countmheap.freeSpanLocked - invalid free of user arena chunkcasfrom_Gscanstatus:top gp->status is not in scan stateat least one of the flags in the group [%v] is requirednet/http: request canceled while waiting for connectionnet/http: invalid byte %q in %s; dropping invalid byteshttp2: server: error reading preface from client %v: %vinternal error: can only be writing one frame at a timehttp2: Transport received GOAWAY from server ErrCode:%vfound preferred certificate chain by issuer common name[WARNING] Unable to delete invalid OCSP staple file: %vcould not start listener for challenge server at %s: %vcould not get records: Domain: %s; Status: %v; Body: %smust set at least one of Certificates or GetCertificateecdsa: internal error: shift can only be by 1 to 7 bitscipher.NewCBCEncrypter: IV length must equal block sizecipher.NewCBCDecrypter: IV length must equal block sizereflect: internal error: invalid use of makeMethodValuereflect.FuncOf: last arg of variadic func must be slicebufio.Scanner: SplitFunc returns negative advance countSending a keep-alive PING to keep the connection alive.request header list larger than peer's advertised limitdns: svcbmandatory: value length is not a multiple of 2times are expected to have the format HH:MM:SS[.NNNNNN]number must have at least one digit between underscoresmap merge requires map or sequence of maps as the valuealias value must contain alphanumerical characters only %s &wire.MaxStreamsFrame{Type: bidi, MaxStreamNum: %d}expected preferred_address to be %d long, read %d bytesedwards25519: invalid SetBytesWithClamping input lengthDecodeSEG6Srh: error parsing Segment List (buf len: %d)extension number %d is already registered on message %vindent may only be composed of space and tab characterstls: TLS 1.3 client supports illegal compression methodstls: handshake buffer not empty before HelloRetryRequesttls: SendSessionTicket called before handshake completedstrings: illegal use of non-zero Builder copied by valuex509: subject key identifier incorrectly marked criticalx509: internal error: empty chain when appending CA certx509: invalid MaxPathLen, must be greater or equal to -1range function continued iteration after loop body panicrange function continued iteration after whole loop exitprofilealloc called without a P or outside bootstrappingdetected possible issues with cleanups and/or finalizersin gcMark expecting to see gcphase as _GCmarkterminationruntime: netpoll: eventfd ready for something unexpectedsemaphore wake of synctest goroutine from outside bubblefile URLs must leave host empty or use localhost: got %vptrEncoder.encode should have emptied ptrSeen via defershttp2: request body larger than specified content lengthhttp2: response header list larger than advertised limithttp: Request.RequestURI can't be set in client requestsnet/http: Transport.DialContext hook returned (nil, nil)b4050a850c04b3abf54132565044b0b7d7bfd8ba270b39432355ffb4b70e0cbd6bb4bf7f321390b94a03c1d356c21122343280d6115c1d21bd376388b5f723fb4c22dfe6cd4375a05a07476444d5819985007e34crypto/cipher: internal error: generic CBC used with AEScrypto/cipher: internal error: generic CTR used with AESnon-empty pointer map passed for non-pointer-size valuesrecord on line %d; parse error on line %d, column %d: %v<- Reading packet %d (%d bytes) for connection %s, 1-RTTexpected initial_source_connection_id to equal %s, is %sSTREAM frames are handled with their respective streams.Rejecting new connection due to ConnContext callback: %sConn has send buffer of %d kiB (wanted: at least %d kiB)cannot decode TOML %s into struct field %s.%s of type %sattempted to go past the end of stream; corrupted value?anchor value must contain alphanumerical characters onlyoption ,inline may only be used on a struct or map field %s &wire.StreamsBlockedFrame{Type: uni, MaxStreams: %d}StreamFrame: attempting to write empty frame without FINremaining length (%d) smaller than parameter length (%d)wrong length for stateless_reset_token: %d (expected 16)TransportParameter BUG: transport parameter %d not foundhttps://protobuf.dev/reference/go/faq#namespace-conflicta powerful, lightning fast and censorship resistant proxyAperture Internet Laboratory Data size in bytes (switches to size-based mode when set)tls: client sent invalid encrypted_client_hello extensiontls: Ed25519 public keys are not supported before TLS 1.2received record with version %x when expecting version %xtls: server sent an unnecessary HelloRetryRequest messagetls: server selected an invalid PSK and cipher suite pairtls: no key exchanges supported by both client and servertls: client sent invalid encrypted client hello extensionx509: failed to parse EC private key embedded in PKCS#8: runtime: checkmarks found unexpected unmarked object obj=runtime: failed to disable profiling timer; timer_delete(non-Go code set up signal handler without SA_ONSTACK flaghttp2: TLS conn unexpectedly found in unencrypted handoffbackend tried to switch protocol %q when %q was requestedloading existing private key for reuse with issuer %s: %vsync: WaitGroup misuse: Add called concurrently with Waitsync: WaitGroup.Add called from multiple synctest bubblescrypto/cipher: invalid buffer overlap of output and inputcannot run executable found relative to current directory (set GODEBUG=execwait=2 to capture stacks for debugging)crypto/drbg: internal error: request size exceeds maximumlwt bpf encode: bpf obj definitions returned empty buffercongestion BUG: decreased max datagram size from %d to %d %s &wire.StreamsBlockedFrame{Type: bidi, MaxStreams: %d}invalid value for max_udp_payload_size: %d (minimum 1200)ACK contains more ECN counts than ECN-marked packets sentMax outstanding limited: tracking %d packets, maximum: %dDecodeSEG6Encap: error parsing Segment List (buf len: %d)unkown field number %d while unmarshalling EditionDefaulttls: FIPS 140-3 requires the use of Extended Master Secrettls: server changed cipher suite after a HelloRetryRequestcalled CompareAndSwap when value is not of comparable typex509: authority key identifier incorrectly marked criticalx509: certificate contains duplicate extension with OID %qx509: failed to parse RSA private key embedded in PKCS#8: x509: provided PrivateKey doesn't match parent's PublicKey"help" flag declared as non-bool. Please correct your codeGenerate the autocompletion script for the specified shellmin hop interval must not be greater than max hop intervaljson: cannot set embedded pointer to unexported struct: %vhttp2: client connection force closed via ClientConn.Closecache must be initialized with a GetConfigForCert callbackno information found to solve challenge for identifier: %sno matching certificate; will choose from all certificatescrypto/elliptic: ScalarMult was called on an invalid pointcrypto/ecdh: bad X25519 remote ECDH input: low order pointreceived conflicting connection IDs for sequence number %dreceived CRYPTO frame with unexpected encryption level: %sdns: svcbnodefaultalpn: no-default-alpn must have no valueGODEBUG=execwait=2 detected a leaked exec.Cmd created by: failed to ParseRouteAttr for IFLA_MACVLAN_MACADDR_DATA: %vIncreasing receive flow control window for stream %d to %dreceived ACK for key phase %d, but peer didn't update keysgob: cannot encode nil pointer of type %s inside interfacetls: server resumed a session with a different cipher suitetls: server selected TLS 1.3 using the legacy version fieldtls: server sent an unnecessary HelloRetryRequest key_sharetls: client didn't send one key share in second ClientHellotls: client sent unexpected key share in second ClientHelloruntime: mmap: too much locked memory (check 'ulimit -l'). tried to trace goroutine with invalid or unsupported statushttp2: Transport received Server's graceful shutdown GOAWAYRoundTripper returned a response & error; ignoring responsehttp: superfluous response.WriteHeader call from %s (%s:%d)http: response.Write on hijacked connection from %s (%s:%d)unsupported scheme for HTTP proxy (use http:// or https://)ecdsa: internal error: ordInverse produced an invalid valuesync: WaitGroup is reused before previous Wait has returnedcrypto/rc4: use of RC4 is not allowed in FIPS 140-only modesync/atomic: store of inconsistently typed value into Valuecrypto/ecdh: private key and public key curves do not matchcrypto/md5: use of MD5 is not allowed in FIPS 140-only modereflect: reflect.Value.Elem on an invalid notinheap pointerreflect: indirection through nil pointer to embedded structbufio.Scanner: SplitFunc returns advance count beyond inputneed one more IPv4 address in first prefix for system stackneed one more IPv6 address in first prefix for system stackRejecting new connection due to GetConfigForClient callbackConn has receive buffer of %d kiB (wanted: at least %d kiB)tried to send an ECN-marked packet although ECN is disabledhpke: mandatory-to-implement cipher suite not supported: %stoml: decoding can only be performed into a pointer, not %stoml: cannot convert map key of type %s to expected type %sRetire Prior To value (%d) larger than Sequence Number (%d)Generate a hysteria2:// URI from a client config for sharingtls: no supported versions satisfy MinVersion and MaxVersiontls: initial handshake had non-empty renegotiation extensiontls: server resumed a session with a different EMS extensiontls: client requested unsupported application protocols (%q)called CompareAndDelete when value is not of comparable typex509: certificate is valid for %d names, but none matched %smanual span allocation called with non-manually-managed typeaddr range base and limit are not in the same memory segmentruntime: failed to configure profiling timer; timer_settime(runtime: malformed profBuf buffer - tag and data out of syncineffective call to function: custom finder takes precedencecannot decode configuration: unable to determine config type (Client.Timeout or context cancellation while reading body)internal error: attempt to send frame on a closed stream: %vmalformed response from server: missing status pseudo headernet/http: server response headers exceeded %d bytes; abortedfailed storage check: %v - storage is probably misconfiguredexternal certificate manager: %s: filling cert from leaf: %vsync/atomic: compare and swap of inconsistently typed valuesreflect: call of reflect.Value.Len on ptr to non-array ValueBUG: readPosInFrame (%d) > frame.DataLen (%d) in stream.Readhttp3: invalid use of RequestStream.Read before ReadResponsetoml: error parsing key of type %s from unsigned integer: %wfound a tab character where an indentation space is expectedinvalid value for active_connection_id_limit: %d (minimum 2) Queuing ACK because there's a new missing packet to report.Loss detection alarm fired in loss timer mode. Loss time: %sLoss detection alarm for %s fired in PTO mode. PTO count: %dCryptoSetup: keys at this encryption level not yet availablechacha20poly1305: invalid buffer overlap of output and inputstart pointer address (%d) is after end pointer address (%d)failed getting ZeroSSL EAB credentials: HTTP %d: %s (code %d)tls: unsupported certificate: private key is %T, expected *%Ttls: EncryptedClientHelloConfigList contains no valid configstls: server sent a ServerHello extension forbidden in TLS 1.3tls: received a session ticket with empty opaque ticket labeltls: client certificate used with invalid signature algorithmx509: failed to parse URI constraint %q: cannot be IP address is in a tiny block with other (possibly long-lived) values runtime: may need to increase max user processes (ulimit -u) "version" flag declared as non-bool. Please correct your codeto request completion choices for the specified command-line.net/http: invalid Cookie.Domain %q; dropping domain attributeReverseProxy must have exactly one of Director or Rewrite setreflect: wrong return count from function created by MakeFuncReceived a Version Negotiation packet. Supported Versions: %sSending stateless reset to %s (connection ID: %s). Token: %#xexec: Cmd started a Process but leaked without a call to Waitbigmod: internal error: u and v are not in the expected stateinvalid base '%c', should have been checked by scanIntOrFloatinternal error: unexpected tail comment event (please report)lwt bpf decode: received unknown attribute: type: %d, len: %dtls: server echoed TLS 1.3 compatibility session ID in TLS 1.2tls: server did not send a quic_transport_parameters extensiontls: client used the legacy version field to negotiate TLS 1.3tls: client did not send a quic_transport_parameters extensiontls: certificate cannot be used with the selected cipher suitex509: failed to marshal EC private key while building PKCS#8: x509: certificate is not authorized to sign other certificatesx509: certificate is valid for %d IP SANs, but none matched %sURI with empty host (%q) cannot be matched against constraintsx509: certificate private key does not implement crypto.Signerfound bad pointer in Go heap (incorrect use of unsafe or cgo?)limiterEvent.stop: found wrong event in p's limiter event slotslice length too short to convert to array or pointer to arrayruntime: internal error: misuse of lockOSThread/unlockOSThreadtrying to put back buffer of the wrong size in the copyBufPoolno configuration associated with certificate; unable to managecrypto/sha1: use of SHA-1 is not allowed in FIPS 140-only mode0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZreflect.ArrayOf: array size would exceed virtual address spacereflect: reflect.Value.Pointer on an invalid notinheap pointerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789expected original_destination_connection_id to equal %s, is %sDropping packet from %s (%d bytes). Server receive queue full.Received a stateless reset with token %#x. Closing connection.cannot have key %q in inlined map: conflicts with struct fieldgateway, source, and destination ip are not the same IP familywrong length for disable_active_migration: %d (expected empty)tls: unexpected encrypted client hello extension in serverHellotls: unexpected switch in encrypted client hello extension typeinternal/sync.HashTrieMap: ran out of hash bits while iteratinginternal/sync.HashTrieMap: ran out of hash bits while insertingruntime.AddCleanup: ptr is equal to arg, cleanup will never runcrypto/ecdh: use of X25519 is not allowed in FIPS 140-only mode may be in the same tiny block as cleanup or cleanup argument malformed GOMEMLIMIT; see `go doc runtime/debug.SetMemoryLimit`Request shell completion choices for the specified command-linehttp2: push would exceed peer's SETTINGS_MAX_CONCURRENT_STREAMSrequest declared a Content-Length of %d but only wrote %d bytes

HTTP Error 431

Request Header Field(s) Too Large

internal error: exactly one of res or err should be set; nil=%vcryptobyte: BuilderContinuation reallocated a fixed-size buffercrypto/ecdh: internal error: public key is the identity elementexpected source data to have length less or equal to %d, got %dreceived invalid offset %d on crypto stream, maximum allowed %dPacketPacker BUG: packet too large (%d bytes, allowed %d bytes)http3: invalid duplicate use of RequestStream.SendRequestHeaderdns: internal error: unpack should never be called on RR_Headergave up after %d attempts, last error unavailable (resp == nil)parser should not permit expression of kind %s at document rootnew destination and destination are not the same address familytls: certificate private key does not implement crypto.Decrypterruntime.SetFinalizer: first argument was allocated into an arenaattempted to trace stack of a goroutine this thread does not own0000000000000000000000000000000000000000000000000000000000000000 json: invalid number literal, trying to unmarshal %q into Numberhttp: request method or response status code does not allow bodyhttp2: too many control frames in send queue, closing connection Content-Type: text/plain; charset=utf-8 Connection: close suppressing panic for copyResponse error in test; copy error: %vcan't switch protocols using non-Hijacker ResponseWriter type %Terror while checking if stored certificate is also expiring soon5ac635d8aa3a93e7b3ebbd55769886bc651d06b0cc53b0f63bce3c3e27d2604b6b17d1f2e12c4247f8bce6e563a440f277037d812deb33a0f4a13945d898c2964fe342e2fe1a7f9b8ee7eb4a7c0f9e162bce33576b315ececbb6406837bf51f5reflect.StructOf: struct size would exceed virtual address spaceABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_shouldn't queue undecryptable packets after handshake completionClient sent an invalid retry token. Sending INVALID_TOKEN to %s.failed to increase send buffer size (wanted: %d kiB, got %d kiB)Restoring of transport parameters from session ticket failed: %sunmarshaling transport parameters from session ticket failed: %sDropping key phase %d ahead of scheduled time. Drop time was: %sextension %v has mismatching containing message: got %v, want %vtls: internal error: attempted to read record with QUIC transporttls: server selected an invalid version after a HelloRetryRequesttls: session supported extended_master_secret but client does nottls: second client hello missing encrypted client hello extensionx509: policy constraints inhibitPolicyMapping field overflows intx509: inner and outer signature algorithm identifiers don't matchx509: issuer name does not match subject from issuing certificatex509: certificate request contains duplicate requested extensionsuser arena chunk size is not a multiple of the physical page sizeruntime.SetFinalizer: pointer not at beginning of allocated block Use "%s [command] --help" for more information about a command.http: response.WriteHeader on hijacked connection from %s (%s:%d)net/http: Transport.DialTLS or DialTLSContext returned (nil, nil)crypto/des: use of TripleDES is not allowed in FIPS 140-only modecryptobyte: high-tag number identifier octets not supported: 0x%xcryptobyte: pending child length %d exceeds %d-byte length prefixreflect: StructOf does not support methods of embedded interfacesReceived first packet. Switching destination connection ID to: %sencryption level changed, but crypto stream has more data to readextended CONNECT: :scheme, :path and :authority must not be emptynistec: internal error: p224Table called with out-of-bounds valuenistec: internal error: p256Table called with out-of-bounds valuenistec: internal error: p384Table called with out-of-bounds valuenistec: internal error: p521Table called with out-of-bounds value %s &wire.MaxStreamDataFrame{StreamID: %d, MaximumStreamData: %d}cryptoSetup BUG: unexpected QUICStoreSession event for the servertls: certificate private key (%T) does not implement crypto.Signerclient doesn't support ECDHE, can only use legacy RSA key exchangetls: handshake buffer not empty before setting read traffic secrettls: server sent an unexpected quic_transport_parameters extensiontls: client sent an unexpected quic_transport_parameters extensionx509: policy constraints requireExplicitPolicy field overflows intx509: certificate is not valid for any names, but wanted to match x509: requested SignatureAlgorithm does not match private key typeruntime: unexpected error while checking standard file descriptor casGToWaitingForSuspendG with non-isWaitingForSuspendG wait reasonsender tried to send more than declared Content-Length of %d bytesunable to get configuration to manage certificate; unable to renewsync: WaitGroup.Add called from inside and outside synctest bubbleGot Datagram. data: %#v %#v %#v %#v %#v %#v datagram address: %#v received conflicting stateless reset tokens for sequence number %dParsed a coalesced packet. Part %d: %d bytes. Remaining: %d bytes.Dropping %s packet (%d bytes) because we already dropped the keys.-> Sending packet %d (%d bytes) for connection %s, 1-RTT (ECN: %s)-> Sending coalesced packet (%d parts, %d bytes) for connection %sreceived packet for path %s that was already probed, validated: %tfailed to parse version for sending version negotiation packet: %shttp3: invalid use of RequestStream.Write before SendRequestHeadercan only use a single QUIC version for dialing a HTTP/3 connectionskipping challenge initiation because authorization is not pendinginternal error: attempted to parse unknown event (please report): Increasing receive flow control window for the connection to %d kBtoml: key %s already exists as a %s, but should be an array tableDescriptor.Options called without importing the descriptor packagetls: server sent certificate containing RSA key larger than %d bitstls: client sent certificate containing RSA key larger than %d bitsx509: internal error: supported public key does not implement EqualHelp provides help for any command in the application. Simply type cannot make valid ACMEIssuer without an associated CertMagic configcannot make a valid config without a pointer to a certificate cachecrypto/cipher: invalid buffer overlap of output and additional dataReceived %d packets after sending CONNECTION_CLOSE. Retransmitting.Dropping %s packet (%d bytes) that could not be unpacked. Error: %sfailed to increase receive buffer size (wanted: %d kiB, got %d kiB)no compatible QUIC version found (we support %s, server offered %s)inconsistent transport parameter length for transport parameter %#xinvalid logger type passed, must be Logger or LeveledLogger, was %Tfield %v with invalid Mutable call on field with non-composite typeif non-empty, httptest.NewServer serves on this address and blocks.tls: internal error: sending non-handshake message to QUIC transportcrypto/hmac: hash generation function does not produce unique valuesembedded IPv4 address must replace the final 2 fields of the addressAllThreadsSyscall6 results differ between threads; runtime corruptedpadding bytes must all be zeros unless AllowIllegalWrites is enabledhttp2: Transport conn %p received error from processing frame %v: %vhttp2: Transport received unsolicited DATA frame; closing connectionhttp: message cannot contain multiple Content-Length headers; got %qcertificate does not need to be renewed, but renewal is being forced[ERROR] TLS-ALPN challenge server: expected tls.Conn but got %T: %#v2695994666715063979466701508701963067355791626002630814351006629888126959946667150639794667015087019625940457807714424391721682722368061crypto/rsa: only crypto/rand.Reader is allowed in FIPS 140-only modereflect: reflect.Value.UnsafePointer on an invalid notinheap pointercan not look up shorthand which is more than one ASCII character: %qreceived retry_source_connection_id, although no Retry was performedDropping a packet that is too small to be a valid Initial (%d bytes)Replacing connection for connection IDs %s with a closed connection.strict mode: fields in the document are missing in the target structexpected SCALAR, SEQUENCE-START, MAPPING-START, or ALIAS, but got %vVersion Negotiation packet has a version list with an invalid lengthinvalid descriptor: using edition features in a proto with syntax %sextension %v does not implement protoreflect.ExtensionTypeDescriptortls: peer doesn't support the certificate custom signature algorithmstls: handshake message of length %d bytes exceeds maximum of %d bytestls: client certificate contains an unsupported public key of type %Ttoo many hex fields to fit an embedded IPv4 at the end of the addresshttp2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)in case of issues. You can leave it blank, but we don't recommend it.invalid: OCSP response for %v valid after certificate expiration (%s)response Content-Type is %s but target container is not io.Writer: %Tcrypto/ecdh: only crypto/rand.Reader is allowed in FIPS 140-only modereflect: embedded interface with unexported method(s) not implementedOnLost callback called although there's no MTU probe packet in flightpacket too small, expected at least 20 bytes after the header, got %d %s &wire.StreamDataBlockedFrame{StreamID: %d, MaximumStreamData: %d}edwards25519: internal error: setShortBytes called with a long stringx509: PKCS#8 wrapping contained private key with unknown algorithm: %vx509: certificate relies on legacy Common Name field, use SANs insteadgot %s for stream %d; expected CONTINUATION following %s for stream %dbytes.Buffer: UnreadByte: previous operation was not a successful readcrypto/ecdsa: only crypto/rand.Reader is allowed in FIPS 140-only modecrypto/ed25519: use of Ed25519ctx is not allowed in FIPS 140-only modesync/atomic: compare and swap of inconsistently typed value into ValueOnAcked callback called although there's no MTU probe packet in flightskipping validation of new path %s since no connection ID is availabledns: svcbipv6hint: ipv6 address byte array length not a multiple of 16 %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, DelayTime: %s%s}ACK contains fewer new ECN counts than acknowledged ECN-marked packetschacha20poly1305: invalid buffer overlap of output and additional datatls: peer doesn't support any of the certificate's signature algorithmsx509: issuer has name constraints but leaf doesn't have a SAN extensionrange function recovered a loop body panic and did not resume panickingif any flags in the group [%v] are set they must all be set; missing %vjson: invalid use of ,string struct tag, trying to unmarshal %q into %vinternal error: attempt to send frame on a half-closed-local stream: %vinternal error: 101 switching protocols response with non-writable bodyPlease enter your email address to signify agreement and to be notifiedthere is only one chain offered; selecting it regardless of preferencesall external certificate managers yielded no certificates and no errorsDuckDNS request failed, expected (OK) but got (%s), url: [%s], body: %scrypto/ecdsa: use of custom curves is not allowed in FIPS 140-only modetoo many concurrent operations on a single file or socket (max 1048575)PacketPacker BUG: payload size inconsistent (expected %d, got %d bytes)Not adding connection ID %s for a new connection, as it already exists.dynamic table size update MUST occur at the beginning of a header blockexec: command with a non-nil Cancel was not created with CommandContextpacket length (%d bytes) is smaller than the expected length (%d bytes) %s &wire.ResetStreamFrame{StreamID: %d, ErrorCode: %#x, FinalSize: %d}toml: cannot redefine table %s that has already been explicitly definedclient doesn't support any cipher suites compatible with the certificatetls: server's certificate contains an unsupported type of public key: %Ttls: second client hello encrypted client hello extension does not matchtls: certificate private key of type %T does not implement crypto.Signerruntime.Goexit called in a thread that was not created by the Go runtimecrypto/rsa: use of multi-prime keys is not allowed in FIPS 140-only modecrypto/fips140: FIPS 140-3 mode enabled, but integrity check didn't passreflect: embedded type with methods not implemented for non-pointer typeIgnoring Retry, since the server didn't change the Source Connection ID.received packet for previously unseen path %s, but already have %d pathsdns: svcbipv4hint: ipv4 address byte array length is not a multiple of 4hopInterval cannot be used together with minHopInterval or maxHopIntervaltls: received unexpected handshake message of type %T when waiting for %Ttls: internal error: handshake returned an error but is marked successfultls: found a certificate rather than a key in the PEM for the private keygo package net: GODEBUG=netdns contains an invalid dns mode, ignoring it coalesced packet has different destination connection ID: %s, expected %sconnection doesn't allow setting of send buffer size. Not a *net.UDPConn?http3: invalid use of RequestStream.ReadResponse before SendRequestHeaderRESET_STREAM_AT: reliable size can't be larger than final size (%d vs %d)Limited by the number of tracked packets: tracking %d packets, maximum %dreceived inconsistent final offset for stream %d (old: %d, new: %d bytes)tls: certificate RSA key size too small for supported signature algorithmshttps://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geoip.datmalformed response from server: malformed non-numeric status pseudo headernet/http: server replied with more than declared Content-Length; truncatedcrypto/rsa: use of keys with odd size is not allowed in FIPS 140-only modecrypto/rand: failed to read random data (see https://go.dev/issue/66821): received NEW_CONNECTION_ID frame but zero-length connection IDs are in useDropping undecryptable packet (%d bytes). Undecryptable packet queue full.Amplification window limited. Received %d bytes, already sent out %d bytestls: internal error: attempted to read record with pending application datatls: client sent encrypted_client_hello extension with unsupported versionstls: client sent encrypted_client_hello extension but did not offer TLS 1.3%[2]s is a special command that is used by the shell completion logic %[1]sUnsolicited response received on idle HTTP channel starting with %q; err=%vno configuration associated with certificate; unable to manage OCSP staplesACK rate too low: %.2f, clamped to %.2f (total=%d, ack=%d, loss=%d, rtt=%d)Disabling ECN. Received less ECT(0) + ECN-CE than packets sent with ECT(0).Disabling ECN. Received less ECT(1) + ECN-CE than packets sent with ECT(1).tls: failed to send closeNotify alert (but connection was closed anyway): %wtls: no cipher suite supported by both client and server; client offered: %xtls: server certificate contains incorrect key type for selected ciphersuitehttps://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geosite.datHTTP/1.0 400 Bad Request Client sent an HTTP request to an HTTPS server. on-demand certificate's OCSP status is REVOKED; will try to forcefully renewcrypto/rsa: use of even public exponent is not allowed in FIPS 140-only modeunable to redefine %q shorthand in %q flagset: it's already used for %q flagconnection doesn't allow setting of receive buffer size. Not a *net.UDPConn? %s &wire.CryptoFrame{Offset: %d, Data length: %d, Offset + Data length: %d}crypto/tls: ExportKeyingMaterial is unavailable when renegotiation is enabledgithub.com/apernet/quic-go/internal/utils/ringbuffer: pop from an empty queueinvalid Body.Read call. After hijacked, the original Request must not be usedMapIter.Next called on an iterator that does not have an associated map Valuegithub.com/quic-go/quic-go/internal/utils/ringbuffer: pop from an empty queueRemoving connection IDs %s for a closed connection after it has been retired.received offset %d for stream %d, but final offset was already received at %dreceived final offset %d for stream %d, but already received offset %d beforex509: signature check attempts limit reached while verifying certificate chainrange function continued iteration after function for loop body returned falseThis is a command line tool. You need to open cmd.exe and run it from there. github.com/apernet/quic-go/internal/utils/ringbuffer: peek from an empty queueinvalid configuration: maxEvents = 0 and window != 0 does not allow any events115792089210356248762697446949407573530086143415290314195533631308867097853951115792089210356248762697446949407573529996955224135760342422259061068512044369crypto/rsa: use of PKCS#1 v1.5 encryption is not allowed in FIPS 140-only modereflect: embedded type with methods not implemented if type is not first fieldgithub.com/quic-go/quic-go/internal/utils/ringbuffer: back from an empty queuenistec: internal error: p256AffineTable.Select called with out-of-bounds valueinvalid quic-go log level, see https://github.com/apernet/quic-go/wiki/LoggingDisabling ECN. ECN-marked packet acknowledged, but no ECN counts on ACK frame.receivedPacketTracker BUG: ReceivedPacket called for old / duplicate packet %dtls: client certificate private key of type %T does not implement crypto.Signercannot convert slice with length %y to array or pointer to array with length %xhttp2: server closing client connection; error reading frame from client %s: %vinvalid configuration: maxEvents = 0 and window != 0 would not allow any eventscould not append records: Domain: %s; Record: %s, Status: %v; Body: %s; PUT: %sgithub.com/quic-go/quic-go/internal/utils/ringbuffer: offset from invalid indexgithub.com/quic-go/quic-go/internal/utils/ringbuffer: front from an empty queuename %v does not contain enough fields; expected format: '_service._proto.name'local datetimes are expected to have the format YYYY-MM-DDTHH:MM:SS[.NNNNNNNNN]tls: either ServerName or InsecureSkipVerify must be specified in the tls.Configx509: invalid signature: parent certificate cannot sign this kind of certificatehttp: RoundTripper implementation (%T) returned a nil *Response with a nil errorcrypto/ecdh: internal error: nistec ScalarBaseMult failed for a fixed-size inputDropping %s packet (%d bytes) for which we couldn't unpack the header. Error: %scrypto/rand: blocked for 60 seconds waiting to read random data from the kernel Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sVersion: %s}Disabling ECN. Received more ECT(0) / ECT(1) acknowledgements than packets sent.received packet number %d on a 0-RTT packet after receiving %d on a 1-RTT packet (bad use of unsafe.Pointer or having race conditions? try -d=checkptr or -race) if any flags in the group [%v] are set none of the others can be; %v were all set[ERROR] Keeping lock file fresh: %v - terminating lock maintenance (lockfile: %s)could not delete requested records: Domain: %s; Records: %v, Status: %v; Body: %scrypto/rsa: use of public exponent <= 2¹⁶ is not allowed in FIPS 140-only modecrypto/rsa: use of primes of different sizes is not allowed in FIPS 140-only modeBUG: ackhandler would have acked wrong packet %d, while evaluating range %d -> %dx509: a root or intermediate certificate is not authorized to sign for this name: certificate expires soon but is already being renewed; serving current certificateno memory of presenting a DNS record for %q (usually OK if presenting also failed)refusing to use HTTP_PROXY value in CGI environment; see golang.org/s/cgihttpproxytls: failed to decrypt second client hello encrypted client hello extension payloadcrypto/hkdf: use of keys shorter than 112 bits is not allowed in FIPS 140-only modex509: issuer has name constraints but leaf contains unknown or unconstrained name: (possibly because of %q while trying to verify candidate authority certificate %q)expected all size classes up to min size for malloc header to fit in one-page spansjson: invalid use of ,string struct tag, trying to unmarshal unquoted value into %vno issuers configured; impossible to renew or check existing certificate in storagecrypto/rsa: use of keys smaller than 2048 bits is not allowed in FIPS 140-only modecrypto/cipher: use of CBC with non-AES ciphers is not allowed in FIPS 140-only modecrypto/cipher: use of CTR with non-AES ciphers is not allowed in FIPS 140-only modecrypto/cipher: use of GCM with non-AES ciphers is not allowed in FIPS 140-only modecrypto/hmac: use of keys shorter than 112 bits is not allowed in FIPS 140-only modereflect: embedded type with methods not implemented if there is more than one fieldgave up after %d attempts, last error unavailable (error reading response body: %v)BandwidthEstimate: %s, CongestionWindowGain: %.2f, PacingGain: %.2f, PacingRate: %stls: downgrade attempt detected, possibly due to a MitM attack or a broken middleboxx509: signature algorithm specifies an %s public key, but have public key of type %TpacketPacker BUG: Peeked and Popped packet numbers do not match: expected %d, got %dDropping a packet with an unsupported version number %d that is too small (%d bytes)x509: failed to parse private key (use ParseECPrivateKey instead for this key format)http: WriteHeader called with both Transfer-Encoding of %q and a Content-Length of %dunable to obtain new to certificate after OCSP status of REVOKED; removing from cachecrypto/rsa: use of PSS salt longer than the hash is not allowed in FIPS 140-only modereflect.Value.Interface: cannot return value obtained from unexported field or methodDropping a packet with an unknown version for which we failed to parse connection IDsPacketConn is not a net.UDPConn. Disabling optimizations possible on UDP connections.tls: MinVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedtls: MaxVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedx509: a root or intermediate certificate is not authorized for an extended key usage: certificate has expired, but is already being renewed; waiting for renewal to completereflect: New of type that may not be allocated in heap (possibly undefined cgo C type) %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, AckRanges: {%s}, DelayTime: %s%s}Sent %d packets with current key phase. Initiating key update to the next key phase: %dx509: failed to parse private key (use ParsePKCS8PrivateKey instead for this key format)x509: failed to parse private key (use ParsePKCS1PrivateKey instead for this key format)no issuers configured; impossible to obtain or check for existing certificate in storage Short Header{DestConnectionID: %s, PacketNumber: %d, PacketNumberLen: %d, KeyPhase: %s}certificate expires soon, but is already renewed in storage; reloading stored certificateDropping Initial packet (%d bytes) with unexpected source connection ID: %s (expected %s)%s: no solvers available for remaining challenges (configured=%v offered=%v remaining=%v)http2: server sent GOAWAY and closed the connection; LastStreamID=%v, ErrCode=%v, debug=%qOCSP status for managed certificate is REVOKED; attempting to replace with new certificatetls: unexpected encrypted client hello extension in server hello despite ECH being acceptedfailed to sufficiently increase send buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)Received %d packets with current key phase. Initiating key update to the next key phase: %dtls: server sent encrypted client hello retry configs after accepting encrypted client hellotls: handshake hash for a client certificate requested after discarding the handshake bufferIPv6 is not supported or enabled on this system, TUN device is created without IPv6 support.[INFO][%s] Lock for '%s' is stale (created: %s, last update: %s); removing then retrying: %stls: unsupported certificate: private key is *ed25519.PrivateKey, expected ed25519.PrivateKeycrypto/rsa: %d-bit keys are insecure (see https://go.dev/pkg/crypto/rsa#hdr-Minimum_key_size)retired connection ID %d (%s), which was used as the Destination Connection ID on this packetfailed to sufficiently increase receive buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)deprecated: golang.org/x/oauth2: Transport.CancelRequest no longer does anything; use contexts&wire.TransportParameters{OriginalDestinationConnectionID: %s, InitialSourceConnectionID: %s, size mismatch (see https://github.com/golang/protobuf/issues/1609): calculated=%d, measured=%dPerform a speed test through the proxy server. The server must have speed test support enabled.b3312fa7e23ee7e4988e056be3f82d19181d9c6efe8141120314088f5013875ac656398d8a2ed19d2a85c8edd3ec2aefaa87ca22be8b05378eb1c71ef320ad746e1d3b628ba79b9859f741e082542a385502f25dbf55296c3a545e3872760ab73617de4a96262c6f5d9e98bf9292dc29f8f41dbd289a147ce9da3113b5f0b8c00a60b1ce1d7e819d7a431d7c90ea0e5fcrypto/rsa: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modecrypto/hkdf: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modehttp: RoundTripper implementation (%T) returned a *Response with content length %d but a nil Bodyname.com will not allow an update to a record that has identical values to an existing record: %wcrypto/hmac: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modeNoClientCertRequestClientCertRequireAnyClientCertVerifyClientCertIfGivenRequireAndVerifyClientCertunable to get automation config for certificate; maintenance for this certificate will likely failcrypto/ecdsa: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modeload yielded different value than was stored; expected %d bytes, got %d bytes of differing elements %s &wire.StreamFrame{StreamID: %d, Fin: %t, Offset: %d, Data length: %d, Offset + Data length: %d}ed25519: expected opts.Hash zero (unhashed message, for standard Ed25519) or SHA-512 (for Ed25519ph)sentPacketHandler BUG: PTO fired, but bytes_in_flight is 0 and Initial and Handshake already droppedcgocheck > 1 mode is no longer supported at runtime. Use GOEXPERIMENT=cgocheck2 at build time instead.http2: failed reading the frame payload: %w, note that the frame header looked like an HTTP/1.1 header\A\s*(?:export\s+)?([\w\.]+)(?:\s*=\s*|:\s+?)('(?:\'|[^'])*'|"(?:\"|[^"])*"|[^#\n]+)?\s*(?:\s*\#.*)?\zHTTP/1.1 400 Bad Request Content-Type: text/plain; charset=utf-8 Connection: close 400 Bad Request Queueing ACK because packet %d packets were received after the last ACK (using initial threshold: %d).ed25519: expected opts.HashFunc() zero (unhashed message, for standard Ed25519) or SHA-512 (for Ed25519ph)asn1: time did not serialize back to the original value and may be invalid: given %q, but serialized as %qconfig returned for certificate %v is not nil and points to different cache; got %p, expected %p (this one)Starting new connection to %s (%s -> %s), source connection ID %s, destination connection ID %s, version %sgo package net: ignoring GODEBUG=netdns=cgo as the binary was compiled without support for the cgo resolver crypto/cipher: use of GCM with arbitrary IVs is not allowed in FIPS 140-only mode, use NewGCMWithRandomNonceinvalid nil message info; this suggests memory corruption due to a race or shallow copy on the message structtimed out waiting for record to fully propagate; verify DNS provider configuration is correct - last error: %v[INFO][%s] %s: Empty lockfile (%v) - likely previous process crashed or storage medium failure; treating as stale %s &wire.NewConnectionIDFrame{SequenceNumber: %d, RetirePriorTo: %d, ConnectionID: %s, StatelessResetToken: %#x}http2: Transport: cannot retry err [%v] after Request.Body was written; define Request.GetBody to avoid this errorhttp3: Transport: cannot retry err [%w] after Request.Body was written; define Request.GetBody to avoid this errorIncreasing receive flow control window for the connection to %d, in response to stream flow control window increase3940200619639447921227904010014361380507973927046544666794829340424572177149687032904726608825893800186160697311231939402006196394479212279040100143613805079739270465446667946905279627659399113263569398956308152294913554433653942643Perform a TCP ping to a specified remote address through the proxy server. Can be used as a simple connectivity test.tls: failed to find "CERTIFICATE" PEM block in certificate input after skipping PEM blocks of the following types: %vVersion: %s BuildDate: %s BuildType: %s Toolchain: %s CommitHash: %s Platform: %s Architecture: %s Libraries: quic-go=%stls: failed to find certificate PEM data in certificate input, but did find a private key; PEM inputs may have been switched--qr flag is deprecated and will be removed in future release, please use `share` subcommand to generate share URI and QR codeYour sites will be served over HTTPS automatically using an automated CA. By continuing, you agree to the CA's terms of service --------------------------------------------------------------------------------------------------------------------------------================================================================================================================================\000\001\002\003\004\005\006\007\008\009\010\011\012\013\014\015\016\017\018\019\020\021\022\023\024\025\026\027\028\029\030\031tls: failed to find PEM block with type ending in "PRIVATE KEY" in key input after skipping PEM blocks of the following types: %v Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sPacketNumber: %d, PacketNumberLen: %d, Length: %d, Version: %s}0051953eb9618e1c9a1f929a21a0b68540eea2da725b99b315f3b8b489918ef109e156193951ec7e937b1652c0bd3bb1bf073573df883d2c34f1ef451fd46b503f0000c6858e06b70404e9cd9e3ecb662395b4429c648139053fb521f828af606b4d3dbaa14b5e77efe75928fe1dc127a2ffa8de3348b3c1856a429bf97e7e31c2e5bd66011839296a789a3bc0045c8a5fb42c7d1bd998f54449579b446817afbd17273e662c97ee72995ef42640c550b9013fad0761353c7086a272c24088be94769fd16650HTTP/1.1 431 Request Header Fields Too Large Content-Type: text/plain; charset=utf-8 Connection: close 431 Request Header Fields Too LargeGenerate the autocompletion script for %[1]s for the specified shell. See each sub-command's help for details on how to use the generated script. crypto/tls: ExportKeyingMaterial is unavailable when neither TLS 1.3 nor Extended Master Secret are negotiated; override with GODEBUG=tlsunsafeekm=1Received invalid IPv6 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.Received invalid IPv4 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.68647976601306097149819007990813932172694353001433054093944634591855431833976560521225596406614545549772963113914808580371219879997166438125740282911150571516864797660130609714981900799081393217269435300143305409394463459185543183397655394245057746333217197532963996371363321113864768612440380340372808892707005449netlink socket in Android is banned by Google, use the root or system (ADB) user to run sing-box, or switch to the sing-box Adnroid graphical interface client[WARNING] OS reports a contradiction: %v - but we cannot connect to it, with this error: %v; continuing anyway 🤞 (I don't know what causes this... if you do, please help?)http2: TLSConfig.CipherSuites is missing an HTTP/2-required AES_128_GCM_SHA256 cipher (need at least one of TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 or TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256)00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899duplicate registration of %q The generated definition for this file has moved: from: %q to: %q A dependency on the %q module must be at version %v or higher. Upgrade the dependency by running: go get -u %v InitialMaxStreamDataBidiLocal: %d, InitialMaxStreamDataBidiRemote: %d, InitialMaxStreamDataUni: %d, InitialMaxData: %d, MaxBidiStreamNum: %d, MaxUniStreamNum: %d, MaxIdleTimeout: %s, AckDelayExponent: %d, MaxAckDelay: %s, ActiveConnectionIDLimit: %d  @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?Generate the autocompletion script for powershell. To load completions in your current shell session: %[1]s completion powershell | Out-String | Invoke-Expression To load completions for every new session, add the output of the above command to your powershell profile. Generate the autocompletion script for the fish shell. To load completions in your current shell session: %[1]s completion fish | source To load completions for every new session, execute once: %[1]s completion fish > ~/.config/fish/completions/%[1]s.fish You will need to start a new shell for this setup to take effect. ░█░█░█░█░█▀▀░▀█▀░█▀▀░█▀▄░▀█▀░█▀█░░░▀▀▄ ░█▀█░░█░░▀▀█░░█░░█▀▀░█▀▄░░█░░█▀█░░░▄▀░ ░▀░▀░░▀░░▀▀▀░░▀░░▀▀▀░▀░▀░▀▀▀░▀░▀░░░▀▀▀ \127\128\129\130\131\132\133\134\135\136\137\138\139\140\141\142\143\144\145\146\147\148\149\150\151\152\153\154\155\156\157\158\159\160\161\162\163\164\165\166\167\168\169\170\171\172\173\174\175\176\177\178\179\180\181\182\183\184\185\186\187\188\189\190\191\192\193\194\195\196\197\198\199\200\201\202\203\204\205\206\207\208\209\210\211\212\213\214\215\216\217\218\219\220\221\222\223\224\225\226\227\228\229\230\231\232\233\234\235\236\237\238\239\240\241\242\243\244\245\246\247\248\249\250\251\252\253\254\255Generate the autocompletion script for the bash shell. This script depends on the 'bash-completion' package. If it is not installed already, you can install it via your OS's package manager. To load completions in your current shell session: source <(%[1]s completion bash) To load completions for every new session, execute once: #### Linux: %[1]s completion bash > /etc/bash_completion.d/%[1]s #### macOS: %[1]s completion bash > $(brew --prefix)/etc/bash_completion.d/%[1]s You will need to start a new shell for this setup to take effect. Generate the autocompletion script for the zsh shell. If shell completion is not already enabled in your environment you will need to enable it. You can execute the following once: echo "autoload -U compinit; compinit" >> ~/.zshrc To load completions in your current shell session: source <(%[1]s completion zsh) To load completions for every new session, execute once: #### Linux: %[1]s completion zsh > "${fpath[1]}/_%[1]s" #### macOS: %[1]s completion zsh > $(brew --prefix)/share/zsh/site-functions/_%[1]s You will need to start a new shell for this setup to take effect. Hysteria Traffic Stats API Server

This is a Hysteria Traffic Stats API server.

Check the documentation for usage.

firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHRESETHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTOPEXTTMETSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID-----BEGIN RSA TESTING KEY----- MIIEvgIBADANBgkqhkiG9w0BAQEFAASCBKgwggSkAgEAAoIBAQDFyXr1E4l3GM34 wlmdsWtjHJCigAMKwnpUOS4zI1AiLH8eTXk2T+4XIFfUx775oSkaZjdEhjh9S8Qu pP+yu8AexNfBVVK20xxjylwAWZdKqjfHgy5RMb+MJfdV+2PSvcQzkzwiZjWvMD+O pNMsmDTSsP4Oa4MAFypC+hfD9FXzDXJNGLkE+gcMUP8BZO39iAy+TWXZir/EjxVs xQimMGgZfFaxJ69DmLazWaT3/JnO7RiynW1OXMOo49rjKwWMGK11eLB/GPG2/mde o4I/muF4o7SxYuTR960ynU5XklIkwAnDpzZkySVTZYyoASlGN0T+8d8i42D7IZpF GojTs1lFAgMBAAECggEAIYthUi1lFBDd5gG4Rzlu+BlBIn5JhcqkCqLEBiJIFfOr /4yuMRrvS3bNzqWt6xJ9MSAC4ZlN/VobRLnxL/QNymoiGYUKCT3Ww8nvPpPzR9OE sE68TUL9tJw/zZJcRMKwgvrGqSLimfq53MxxkE+kLdOc0v9C8YH8Re26mB5ZcWYa 7YFyZQpKsQYnsmu/05cMbpOQrQWhtmIqRoyn8mG/par2s3NzjtpSE9NINyz26uFc k/3ovFJQIHkUmTS7KHD3BgY5vuCqP98HramYnOysJ0WoYgvSDNCWw3037s5CCwJT gCKuM+Ow6liFrj83RrdKBpm5QUGjfNpYP31o+QNP4QKBgQDSrUQ2XdgtAnibAV7u 7kbxOxro0EhIKso0Y/6LbDQgcXgxLqltkmeqZgG8nC3Z793lhlSasz2snhzzooV5 5fTy1y8ikXqjhG0nNkInFyOhsI0auE28CFoDowaQd+5cmCatpN4Grqo5PNRXxm1w HktfPEgoP11NNCFHvvN5fEKbbQKBgQDwVlOaV20IvW3IPq7cXZyiyabouFF9eTRo VJka1Uv+JtyvL2P0NKkjYHOdN8gRblWqxQtJoTNk020rVA4UP1heiXALy50gvj/p hMcybPTLYSPOhAGx838KIcvGR5oskP1aUCmFbFQzGELxhJ9diVVjxUtbG2DuwPKd tD9TLxT2OQKBgQCcdlHSjp+dzdgERmBa0ludjGfPv9/uuNizUBAbO6D690psPFtY JQMYaemgSd1DngEOFVWADt4e9M5Lose+YCoqr+UxpxmNlyv5kzJOFcFAs/4XeglB PHKdgNW/NVKxMc6H54l9LPr+x05sYdGlEtqnP/3W5jhEvhJ5Vjc8YiyVgQKBgQCl zwjyrGo+42GACy7cPYE5FeIfIDqoVByB9guC5bD98JXEDu/opQQjsgFRcBCJZhOY M0UsURiB8ROaFu13rpQq9KrmmF0ZH+g8FSzQbzcbsTLg4VXCDXmR5esOKowFPypr Sm667BfTAGP++D5ya7MLmCv6+RKQ5XD8uEQQAaV2kQKBgAD8qeJuWIXZT0VKkQrn nIhgtzGERF/6sZdQGW2LxTbUDWG74AfFkkEbeBfwEkCZXY/xmnYqYABhvlSex8jU supU6Eea21esIxIub2zv/Np0ojUb6rlqTPS4Ox1E27D787EJ3VOXpriSD10vyNnZ jel6uj2FOP9g54s+GzlSVg/T -----END RSA TESTING KEY-----  37?/* & * ; 9 %#>'  1<   0 ")  7  +19$p$: r.r,r:>,s<s*L$L; )  4 4  ! #ʠʣʢʥʤʧʦʩʨؓߔ0 ,)4< '2869/9 :::%;/;%46 7*000.111022-33>'   #(66' &     5     <+)?45454)/)5+++ +<*&*"&8!!"+.4=    <>5<5!5#5&4447133.<.):)<) )+-+5$$''&"6" "   ?  (0 == =1 =, =  ?? < 9! 9) 97 99 6  6 6 7' 78 73 ' '&   3 /    "      > + / 6     <3 ;* 9" 9) 97 + (( &5 $ $ % #< #0 #  # !: ! ! 5  - ( .     $ "   2 =  & 1 : # <     2 1   / +     5 9 = ?1364<  % .2>13 %$8;422/,?  /><>>>:>+?>"4.<% 09'  # ! & " / , $ ' % ; = ? 9. 7 .:9' 1&90  96#20 2 0(2,3 :8% 5*;.-, 87/ ,--/( 57.97 *%60 ;'2.2=$=' 6,;., 2 5 4 ; > 8 * / , % & # !%$+.*&8>460 -2-2-2-2-2-2-2@ @ (3  )1;* # 0 ! !0 ?5   7 +# # 2   #;='  1  3. /,#>8 " 8> /'" + " /1 74 ","?$5<3=*8  7+7(;?  $$;,$  >>  )    '< .' " )*)<,  . # ' 8 %2+&0 )4   * $ 0 *( 29,4'  : . . +0   "0 ;,/"1 .  7 2 . 1 :/0+- , =  ;/ :  . 4  1#4"'8>57&9+ .  ,> 4#%"  +  +  +   =   &0(75'6.=;;, > < % < %!   0' = >4>&? ?( - :3 8:   72% "< /<>+ '?   <=  "  )= /4 7 : ?3 :/   7"0(  %< +  70 >570 =%, 9# >  < +,:%" $ =+ /  ' #   22< 1  -  ?   1& / $<3 $  ?5 ##02(+   +02  + -? #: # %$ >+ 01 1 9    *) - .1 .2 < >  3  2  %,&!"9(  2    #().1 $ '8 07#7-)2 6  (!5  / , 3 ,1 /5 "1 "  ?% <, ?# > &  : + " )   - ( ) /  . , /* -9 "8 %  : ; ? 3% 6 6 7 , ,    8*/24:"+ 0& ;>$>292:1,1<17#7* '-4*7'!%7  1 .0=  :*1-"32:0$6445  7  +  +- 8 8 8 8% 8! 8- 8/ 8+ 87 85 9  9  9 9 u uuu  9 9 `;`>`9`8`7`*`-`,  & =. =% > > ? ?  ?  ?  ? > > >  >, >  ? ? ? ? ? ? ? ? ? ?  ? ? ?  =2 =6 < <:!:#8 :&8 :$:,88:*:7:5:;::<:4:':-:%:?:=:):/s' = +* 99 9; 9? )  (%(')+/ " " "' "/ "3 "$$!8745' 2=;: $ ) $ , .  .# (/ % 90 4  # , 2  :3      0> -> <+ 8 3  % "&   %9 &2 &0 ! !7 5 =4 ? >  : 9  % - - ,4 ., )  6! 1 3 + 8  8= ( ( +   3)!  %#>"%*;70 ; /-715+>79+, "0 ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전)(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)212223242526272829303132333435참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパートアルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキログラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポイントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlklfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhahpinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日18日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմխיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּוֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئمئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحطمظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمينجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترتزتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيسىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميحمىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمىفخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنمينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمينحيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليهوسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\$%@ـًـَـُـِـّـْءآأؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا"'/^|~¢£¬¦¥ːˑʙɓʣꭦʥʤɖɗᶑɘɞʩɤɢɠʛʜɧʄʪʫꞎɮʎøɶɷɺɾʀʨʦꭧʧʈⱱʏʡʢʘǀǁǂ𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκλμνξοστυψ∇∂ϝабгежзиклмпруфхцчшыэюꚉәіјөүӏґѕџҫꙑұٮڡٯ0,1,2,3,4,5,6,7,8,9,(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)〔s〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申割営配〔本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉卑博即卽卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢㠯巽帨帽幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最暜肭䏙朗望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸瑇瑜瑱璅瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦若茝荣莭茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷䧦雃嶲霣䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻AAAAAA C'EEEEIIIINOOOOOUUUUYaaaaaa c'eeeeiiiinooooouuuuyyAaAaA(a(CcCc C c C  c  D d EeEeEeE(e(E e GgGgG g!G'"g'#H$h%I(i)I*i+I,i-I(.i(/I0J4j5K'6k'7L9l:L';l'<L =l >NCnDN'En'FN Gn HOLoMONoOO Po QRTrUR'Vr'WR Xr YSZs[S\s]S'^s'_S `s aT'bt'cT dt eUhuiUjukUlumU nu oU pu qU(ru(sWtwuYvywYxZyzzZ{z|Z }z ~OoUuA a I i O o U u   &'G g K k O(o(  j GgNnAaAaEeEeIi I i O o OoRrRrUuUuS&s&T&t&H h A&a'E'(e')*+,-O.o/.0/1Y2y3  #895P5Q3SVW:\8]C^tvuw60056788>-M#C#C# C 'G+K'S"'T#HT$'U%JT&TTT ( < ) 0 < 1 3 < 4 G V H G > K G W L F V H F > J G > K F W L %.&55 5  5  55:5;<5=>5@?5AB5CA%a%BbB#b#B1b1 D d D# d# D1d1D'd'D-d-E-e-E0e0()FfG g!H"h#H#$h#%H&h'H'(h')H.*h.+I0,i0-./K0k1K#2k#3K14k15L#6l#76879L1:l1;L-<l-=M>m?M@mAM#Bm#CNDnEN#Fn#GN1Hn1IN-Jn-KLMNOLPMQLRMSPTpUPVpWRXrYR#Zr#[Z\[]R1^r1_S`saS#bs#cZd[e`fagbhciTjtkT#lt#mT1nt1oT-pt-qU$ru$sU0tu0uU-vu-whxiyjzk{V|v}V#~v#WwWwWwWwW#w#XxXxYyZzZ#z#Z1z1h1tw y A#a#A a     E#e#E e Ee  I i I#i#O#o#O o     ##U#u#U u   ##YyY#y#Y y YyBB       B B ! "!# $!% B&!B'()(*)+(,)-(B.)B/01021304150B61B7898:9;8<9=8B>9B?@A@BAC@DAEHIHJIKHLIMPQPRQSPTQUPBVQBWYY[Y]YB_`a`bac`dae`BfaBghihjikhlimhBniBoprtvxz|EEEEEEEEE E E E E EEE E!E"E#E$E%E&E'E(E)E*E+E,E-E.E/E`EaEbEcEdEeEfEgEhEiEjEkElEmEnEoEpEEEBEEBtEEEBEEBBBBBB|EEEBEE!8!!8!!8!!8!!8!!8!"8""8" " 8" "#8"$"%8"&"<8"A"C8"D"E8"G"H8"I=8"`"a8"b"M8"m<8"n>8"o"d8"p"e8"q"r8"t"s8"u"v8"x"w8"y"z8""{8""8""8""8""8""8""8""8""8""|8""}8""8""8""8""8""8""8"0K00L0M00N0O00P0Q00R0S00T0U00V0W00X0Y00Z0[00\0]00^0_00`0a00b0d00e0f00g0h00i0o00p0o00q0r00s0r00t0u00v0u00w0x00y0x00z0{00|0{00}0F000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001'.2'/G>KGWL508#compdef %[1]s compdef _%[1]s %[1]s # zsh completion for %-36[1]s -*- shell-script -*- __%[1]s_debug() { local file="$BASH_COMP_DEBUG_FILE" if [[ -n ${file} ]]; then echo "$*" >> "${file}" fi } _%[1]s() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d local lastParam lastChar flagPrefix requestComp out directive comp lastComp noSpace keepOrder local -a completions __%[1]s_debug "\n========= starting completion logic ==========" __%[1]s_debug "CURRENT: ${CURRENT}, words[*]: ${words[*]}" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CURRENT location, so we need # to truncate the command-line ($words) up to the $CURRENT location. # (We cannot use $CURSOR as its value does not work when a command is an alias.) words=("${=words[1,CURRENT]}") __%[1]s_debug "Truncated words[*]: ${words[*]}," lastParam=${words[-1]} lastChar=${lastParam[-1]} __%[1]s_debug "lastParam: ${lastParam}, lastChar: ${lastChar}" # For zsh, when completing a flag with an = (e.g., %[1]s -n=) # completions must be prefixed with the flag setopt local_options BASH_REMATCH if [[ "${lastParam}" =~ '-.*=' ]]; then # We are dealing with a flag with an = flagPrefix="-P ${BASH_REMATCH}" fi # Prepare the command to obtain completions requestComp="${words[1]} %[2]s ${words[2,-1]}" if [ "${lastChar}" = "" ]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go completion code. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} \"\"" fi __%[1]s_debug "About to call: eval ${requestComp}" # Use eval to handle any environment variables and such out=$(eval ${requestComp} 2>/dev/null) __%[1]s_debug "completion output: ${out}" # Extract the directive integer following a : from the last line local lastLine while IFS='\n' read -r line; do lastLine=${line} done < <(printf "%%s\n" "${out[@]}") __%[1]s_debug "last line: ${lastLine}" if [ "${lastLine[1]}" = : ]; then directive=${lastLine[2,-1]} # Remove the directive including the : and the newline local suffix (( suffix=${#lastLine}+2)) out=${out[1,-$suffix]} else # There is no directive specified. Leave $out as is. __%[1]s_debug "No directive found. Setting do default" directive=0 fi __%[1]s_debug "directive: ${directive}" __%[1]s_debug "completions: ${out}" __%[1]s_debug "flagPrefix: ${flagPrefix}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then __%[1]s_debug "Completion received error. Ignoring completions." return fi local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} local startIndex=$((${#activeHelpMarker}+1)) local hasActiveHelp=0 while IFS='\n' read -r comp; do # Check if this is an activeHelp statement (i.e., prefixed with $activeHelpMarker) if [ "${comp[1,$endIndex]}" = "$activeHelpMarker" ];then __%[1]s_debug "ActiveHelp found: $comp" comp="${comp[$startIndex,-1]}" if [ -n "$comp" ]; then compadd -x "${comp}" __%[1]s_debug "ActiveHelp will need delimiter" hasActiveHelp=1 fi continue fi if [ -n "$comp" ]; then # If requested, completions are returned with a description. # The description is preceded by a TAB character. # For zsh's _describe, we need to use a : instead of a TAB. # We first need to escape any : as part of the completion itself. comp=${comp//:/\\:} local tab="$(printf '\t')" comp=${comp//$tab/:} __%[1]s_debug "Adding completion: ${comp}" completions+=${comp} lastComp=$comp fi done < <(printf "%%s\n" "${out[@]}") # Add a delimiter after the activeHelp statements, but only if: # - there are completions following the activeHelp statements, or # - file completion will be performed (so there will be choices after the activeHelp) if [ $hasActiveHelp -eq 1 ]; then if [ ${#completions} -ne 0 ] || [ $((directive & shellCompDirectiveNoFileComp)) -eq 0 ]; then __%[1]s_debug "Adding activeHelp delimiter" compadd -x "--" hasActiveHelp=0 fi fi if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then __%[1]s_debug "Activating nospace." noSpace="-S ''" fi if [ $((directive & shellCompDirectiveKeepOrder)) -ne 0 ]; then __%[1]s_debug "Activating keep order." keepOrder="-V" fi if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local filteringCmd filteringCmd='_files' for filter in ${completions[@]}; do if [ ${filter[1]} != '*' ]; then # zsh requires a glob pattern to do file filtering filter="\*.$filter" fi filteringCmd+=" -g $filter" done filteringCmd+=" ${flagPrefix}" __%[1]s_debug "File filtering command: $filteringCmd" _arguments '*:filename:'"$filteringCmd" elif [ $((directive & shellCompDirectiveFilterDirs)) -ne 0 ]; then # File completion for directories only local subdir subdir="${completions[1]}" if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" pushd "${subdir}" >/dev/null 2>&1 else __%[1]s_debug "Listing directories in ." fi local result _arguments '*:dirname:_files -/'" ${flagPrefix}" result=$? if [ -n "$subdir" ]; then popd >/dev/null 2>&1 fi return $result else __%[1]s_debug "Calling _describe" if eval _describe $keepOrder "completions" completions $flagPrefix $noSpace; then __%[1]s_debug "_describe found some completions" # Return the success of having called _describe return 0 else __%[1]s_debug "_describe did not find completions." __%[1]s_debug "Checking if we should do file completion." if [ $((directive & shellCompDirectiveNoFileComp)) -ne 0 ]; then __%[1]s_debug "deactivating file completion" # We must return an error code here to let zsh know that there were no # completions found by _describe; this is what will trigger other # matching algorithms to attempt to find completions. # For example zsh can match letters in the middle of words. return 1 else # Perform file completion __%[1]s_debug "Activating file completion" # We must return the result of this command, so it must be the # last command, or else we must store its result to return it. _arguments '*:filename:_files'" ${flagPrefix}" fi fi fi } # don't run the completion function when being source-ed or eval-ed if [ "$funcstack[1]" = "_%[1]s" ]; then _%[1]s fi function __%[1]s_debug set -l file "$BASH_COMP_DEBUG_FILE" if test -n "$file" echo "$argv" >> $file end end function __%[1]s_perform_completion __%[1]s_debug "Starting __%[1]s_perform_completion" # Extract all args except the last one set -l args (commandline -opc) # Extract the last arg and escape it in case it is a space set -l lastArg (string escape -- (commandline -ct)) __%[1]s_debug "args: $args" __%[1]s_debug "last arg: $lastArg" # Disable ActiveHelp which is not supported for fish shell set -l requestComp "%[10]s=0 $args[1] %[3]s $args[2..-1] $lastArg" __%[1]s_debug "Calling $requestComp" set -l results (eval $requestComp 2> /dev/null) # Some programs may output extra empty lines after the directive. # Let's ignore them or else it will break completion. # Ref: https://github.com/spf13/cobra/issues/1279 for line in $results[-1..1] if test (string trim -- $line) = "" # Found an empty line, remove it set results $results[1..-2] else # Found non-empty line, we have our proper output break end end set -l comps $results[1..-2] set -l directiveLine $results[-1] # For Fish, when completing a flag with an = (e.g., -n=) # completions must be prefixed with the flag set -l flagPrefix (string match -r -- '-.*=' "$lastArg") __%[1]s_debug "Comps: $comps" __%[1]s_debug "DirectiveLine: $directiveLine" __%[1]s_debug "flagPrefix: $flagPrefix" for comp in $comps printf "%%s%%s\n" "$flagPrefix" "$comp" end printf "%%s\n" "$directiveLine" end # this function limits calls to __%[1]s_perform_completion, by caching the result behind $__%[1]s_perform_completion_once_result function __%[1]s_perform_completion_once __%[1]s_debug "Starting __%[1]s_perform_completion_once" if test -n "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Seems like a valid result already exists, skipping __%[1]s_perform_completion" return 0 end set --global __%[1]s_perform_completion_once_result (__%[1]s_perform_completion) if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completions, probably due to a failure" return 1 end __%[1]s_debug "Performed completions and set __%[1]s_perform_completion_once_result" return 0 end # this function is used to clear the $__%[1]s_perform_completion_once_result variable after completions are run function __%[1]s_clear_perform_completion_once_result __%[1]s_debug "" __%[1]s_debug "========= clearing previously set __%[1]s_perform_completion_once_result variable ==========" set --erase __%[1]s_perform_completion_once_result __%[1]s_debug "Successfully erased the variable __%[1]s_perform_completion_once_result" end function __%[1]s_requires_order_preservation __%[1]s_debug "" __%[1]s_debug "========= checking if order preservation is required ==========" __%[1]s_perform_completion_once if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Error determining if order preservation is required" return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveKeepOrder %[9]d set -l keeporder (math (math --scale 0 $directive / $shellCompDirectiveKeepOrder) %% 2) __%[1]s_debug "Keeporder is: $keeporder" if test $keeporder -ne 0 __%[1]s_debug "This does require order preservation" return 0 end __%[1]s_debug "This doesn't require order preservation" return 1 end # This function does two things: # - Obtain the completions and store them in the global __%[1]s_comp_results # - Return false if file completion should be performed function __%[1]s_prepare_completions __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" # Start fresh set --erase __%[1]s_comp_results __%[1]s_perform_completion_once __%[1]s_debug "Completion results: $__%[1]s_perform_completion_once_result" if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completion, probably due to a failure" # Might as well do file completion, in case it helps return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) set --global __%[1]s_comp_results $__%[1]s_perform_completion_once_result[1..-2] __%[1]s_debug "Completions are: $__%[1]s_comp_results" __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveError %[4]d set -l shellCompDirectiveNoSpace %[5]d set -l shellCompDirectiveNoFileComp %[6]d set -l shellCompDirectiveFilterFileExt %[7]d set -l shellCompDirectiveFilterDirs %[8]d if test -z "$directive" set directive 0 end set -l compErr (math (math --scale 0 $directive / $shellCompDirectiveError) %% 2) if test $compErr -eq 1 __%[1]s_debug "Received error directive: aborting." # Might as well do file completion, in case it helps return 1 end set -l filefilter (math (math --scale 0 $directive / $shellCompDirectiveFilterFileExt) %% 2) set -l dirfilter (math (math --scale 0 $directive / $shellCompDirectiveFilterDirs) %% 2) if test $filefilter -eq 1; or test $dirfilter -eq 1 __%[1]s_debug "File extension filtering or directory filtering not supported" # Do full file completion instead return 1 end set -l nospace (math (math --scale 0 $directive / $shellCompDirectiveNoSpace) %% 2) set -l nofiles (math (math --scale 0 $directive / $shellCompDirectiveNoFileComp) %% 2) __%[1]s_debug "nospace: $nospace, nofiles: $nofiles" # If we want to prevent a space, or if file completion is NOT disabled, # we need to count the number of valid completions. # To do so, we will filter on prefix as the completions we have received # may not already be filtered so as to allow fish to match on different # criteria than the prefix. if test $nospace -ne 0; or test $nofiles -eq 0 set -l prefix (commandline -t | string escape --style=regex) __%[1]s_debug "prefix: $prefix" set -l completions (string match -r -- "^$prefix.*" $__%[1]s_comp_results) set --global __%[1]s_comp_results $completions __%[1]s_debug "Filtered completions are: $__%[1]s_comp_results" # Important not to quote the variable for count to work set -l numComps (count $__%[1]s_comp_results) __%[1]s_debug "numComps: $numComps" if test $numComps -eq 1; and test $nospace -ne 0 # We must first split on \t to get rid of the descriptions to be # able to check what the actual completion will be. # We don't need descriptions anyway since there is only a single # real completion which the shell will expand immediately. set -l split (string split --max 1 \t $__%[1]s_comp_results[1]) # Fish won't add a space if the completion ends with any # of the following characters: @=/:., set -l lastChar (string sub -s -1 -- $split) if not string match -r -q "[@=/:.,]" -- "$lastChar" # In other cases, to support the "nospace" directive we trick the shell # by outputting an extra, longer completion. __%[1]s_debug "Adding second completion to perform nospace directive" set --global __%[1]s_comp_results $split[1] $split[1]. __%[1]s_debug "Completions are now: $__%[1]s_comp_results" end end if test $numComps -eq 0; and test $nofiles -eq 0 # To be consistent with bash and zsh, we only trigger file # completion when there are no other completions __%[1]s_debug "Requesting file completion" return 1 end end return 0 end # Since Fish completions are only loaded once the user triggers them, we trigger them ourselves # so we can properly delete any completions provided by another script. # Only do this if the program can be found, or else fish may print some errors; besides, # the existing completions will only be loaded if the program can be found. if type -q "%[2]s" # The space after the program name is essential to trigger completion for the program # and not completion of the program name itself. # Also, we use '> /dev/null 2>&1' since '&>' is not supported in older versions of fish. complete --do-complete "%[2]s " > /dev/null 2>&1 end # Remove any pre-existing completions for the program since we will be handling all of them. complete -c %[2]s -e # this will get called after the two calls below and clear the $__%[1]s_perform_completion_once_result global complete -c %[2]s -n '__%[1]s_clear_perform_completion_once_result' # The call to __%[1]s_prepare_completions will setup __%[1]s_comp_results # which provides the program's completion choices. # If this doesn't require order preservation, we don't use the -k flag complete -c %[2]s -n 'not __%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # otherwise we use the -k flag complete -k -c %[2]s -n '__%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # powershell completion for %-36[1]s -*- shell-script -*- function __%[1]s_debug { if ($env:BASH_COMP_DEBUG_FILE) { "$args" | Out-File -Append -FilePath "$env:BASH_COMP_DEBUG_FILE" } } filter __%[1]s_escapeStringWithSpecialChars { $_ -replace '\s|#|@|\$|;|,|''|\{|\}|\(|\)|"|`|\||<|>|&','`$&' } [scriptblock]${__%[2]sCompleterBlock} = { param( $WordToComplete, $CommandAst, $CursorPosition ) # Get the current command line and convert into a string $Command = $CommandAst.CommandElements $Command = "$Command" __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "WordToComplete: $WordToComplete Command: $Command CursorPosition: $CursorPosition" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CursorPosition location, so we need # to truncate the command-line ($Command) up to the $CursorPosition location. # Make sure the $Command is longer then the $CursorPosition before we truncate. # This happens because the $Command does not include the last space. if ($Command.Length -gt $CursorPosition) { $Command=$Command.Substring(0,$CursorPosition) } __%[1]s_debug "Truncated command: $Command" $ShellCompDirectiveError=%[4]d $ShellCompDirectiveNoSpace=%[5]d $ShellCompDirectiveNoFileComp=%[6]d $ShellCompDirectiveFilterFileExt=%[7]d $ShellCompDirectiveFilterDirs=%[8]d $ShellCompDirectiveKeepOrder=%[9]d # Prepare the command to request completions for the program. # Split the command at the first space to separate the program and arguments. $Program,$Arguments = $Command.Split(" ",2) $RequestComp="$Program %[3]s $Arguments" __%[1]s_debug "RequestComp: $RequestComp" # we cannot use $WordToComplete because it # has the wrong values if the cursor was moved # so use the last argument if ($WordToComplete -ne "" ) { $WordToComplete = $Arguments.Split(" ")[-1] } __%[1]s_debug "New WordToComplete: $WordToComplete" # Check for flag with equal sign $IsEqualFlag = ($WordToComplete -Like "--*=*" ) if ( $IsEqualFlag ) { __%[1]s_debug "Completing equal sign flag" # Remove the flag part $Flag,$WordToComplete = $WordToComplete.Split("=",2) } if ( $WordToComplete -eq "" -And ( -Not $IsEqualFlag )) { # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" # PowerShell 7.2+ changed the way how the arguments are passed to executables, # so for pre-7.2 or when Legacy argument passing is enabled we need to use # `"`" to pass an empty argument, a "" or '' does not work!!! if ($PSVersionTable.PsVersion -lt [version]'7.2.0' -or ($PSVersionTable.PsVersion -lt [version]'7.3.0' -and -not [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -or (($PSVersionTable.PsVersion -ge [version]'7.3.0' -or [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -and $PSNativeCommandArgumentPassing -eq 'Legacy')) { $RequestComp="$RequestComp" + ' `"`"' } else { $RequestComp="$RequestComp" + ' ""' } } __%[1]s_debug "Calling $RequestComp" # First disable ActiveHelp which is not supported for Powershell ${env:%[10]s}=0 #call the command store the output in $out and redirect stderr and stdout to null # $Out is an array contains each line per element Invoke-Expression -OutVariable out "$RequestComp" 2>&1 | Out-Null # get directive from last line [int]$Directive = $Out[-1].TrimStart(':') if ($Directive -eq "") { # There is no directive specified $Directive = 0 } __%[1]s_debug "The completion directive is: $Directive" # remove directive (last element) from out $Out = $Out | Where-Object { $_ -ne $Out[-1] } __%[1]s_debug "The completions are: $Out" if (($Directive -band $ShellCompDirectiveError) -ne 0 ) { # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return } $Longest = 0 [Array]$Values = $Out | ForEach-Object { #Split the output in name and description $Name, $Description = $_.Split("`t",2) __%[1]s_debug "Name: $Name Description: $Description" # Look for the longest completion so that we can format things nicely if ($Longest -lt $Name.Length) { $Longest = $Name.Length } # Set the description to a one space string if there is none set. # This is needed because the CompletionResult does not accept an empty string as argument if (-Not $Description) { $Description = " " } New-Object -TypeName PSCustomObject -Property @{ Name = "$Name" Description = "$Description" } } $Space = " " if (($Directive -band $ShellCompDirectiveNoSpace) -ne 0 ) { # remove the space here __%[1]s_debug "ShellCompDirectiveNoSpace is called" $Space = "" } if ((($Directive -band $ShellCompDirectiveFilterFileExt) -ne 0 ) -or (($Directive -band $ShellCompDirectiveFilterDirs) -ne 0 )) { __%[1]s_debug "ShellCompDirectiveFilterFileExt ShellCompDirectiveFilterDirs are not supported" # return here to prevent the completion of the extensions return } $Values = $Values | Where-Object { # filter the result $_.Name -like "$WordToComplete*" # Join the flag back if we have an equal sign flag if ( $IsEqualFlag ) { __%[1]s_debug "Join the equal sign flag back to the completion value" $_.Name = $Flag + "=" + $_.Name } } # we sort the values in ascending order by name if keep order isn't passed if (($Directive -band $ShellCompDirectiveKeepOrder) -eq 0 ) { $Values = $Values | Sort-Object -Property Name } if (($Directive -band $ShellCompDirectiveNoFileComp) -ne 0 ) { __%[1]s_debug "ShellCompDirectiveNoFileComp is called" if ($Values.Length -eq 0) { # Just print an empty string here so the # shell does not start to complete paths. # We cannot use CompletionResult here because # it does not accept an empty string as argument. "" return } } # Get the current mode $Mode = (Get-PSReadLineKeyHandler | Where-Object {$_.Key -eq "Tab" }).Function __%[1]s_debug "Mode: $Mode" $Values | ForEach-Object { # store temporary because switch will overwrite $_ $comp = $_ # PowerShell supports three different completion modes # - TabCompleteNext (default windows style - on each key press the next option is displayed) # - Complete (works like bash) # - MenuComplete (works like zsh) # You set the mode with Set-PSReadLineKeyHandler -Key Tab -Function # CompletionResult Arguments: # 1) CompletionText text to be used as the auto completion result # 2) ListItemText text to be displayed in the suggestion list # 3) ResultType type of completion result # 4) ToolTip text for the tooltip with details about the object switch ($Mode) { # bash like "Complete" { if ($Values.Length -eq 1) { __%[1]s_debug "Only one completion left" # insert space after value $CompletionText = $($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space if ($ExecutionContext.SessionState.LanguageMode -eq "FullLanguage"){ [System.Management.Automation.CompletionResult]::new($CompletionText, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } else { $CompletionText } } else { # Add the proper number of spaces to align the descriptions while($comp.Name.Length -lt $Longest) { $comp.Name = $comp.Name + " " } # Check for empty description and only add parentheses if needed if ($($comp.Description) -eq " " ) { $Description = "" } else { $Description = " ($($comp.Description))" } $CompletionText = "$($comp.Name)$Description" if ($ExecutionContext.SessionState.LanguageMode -eq "FullLanguage"){ [System.Management.Automation.CompletionResult]::new($CompletionText, "$($comp.Name)$Description", 'ParameterValue', "$($comp.Description)") } else { $CompletionText } } } # zsh like "MenuComplete" { # insert space after value # MenuComplete will automatically show the ToolTip of # the highlighted value at the bottom of the suggestions. $CompletionText = $($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space if ($ExecutionContext.SessionState.LanguageMode -eq "FullLanguage"){ [System.Management.Automation.CompletionResult]::new($CompletionText, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } else { $CompletionText } } # TabCompleteNext and in case we get something unknown Default { # Like MenuComplete but we don't want to add a space here because # the user need to press space anyway to get the completion. # Description will not be shown because that's not possible with TabCompleteNext $CompletionText = $($comp.Name | __%[1]s_escapeStringWithSpecialChars) if ($ExecutionContext.SessionState.LanguageMode -eq "FullLanguage"){ [System.Management.Automation.CompletionResult]::new($CompletionText, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } else { $CompletionText } } } } } Register-ArgumentCompleter -CommandName '%[1]s' -ScriptBlock ${__%[2]sCompleterBlock} # bash completion V2 for %-36[1]s -*- shell-script -*- __%[1]s_debug() { if [[ -n ${BASH_COMP_DEBUG_FILE-} ]]; then echo "$*" >> "${BASH_COMP_DEBUG_FILE}" fi } # Macs have bash3 for which the bash-completion package doesn't include # _init_completion. This is a minimal version of that function. __%[1]s_init_completion() { COMPREPLY=() _get_comp_words_by_ref "$@" cur prev words cword } # This function calls the %[1]s program to obtain the completion # results and the directive. It fills the 'out' and 'directive' vars. __%[1]s_get_completion_results() { local requestComp lastParam lastChar args # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows handling aliases args=("${words[@]:1}") requestComp="${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} __%[1]s_debug "lastParam ${lastParam}, lastChar ${lastChar}" if [[ -z ${cur} && ${lastChar} != = ]]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} ''" fi # When completing a flag with an = (e.g., %[1]s -n=) # bash focuses on the part after the =, so we need to remove # the flag part from $cur if [[ ${cur} == -*=* ]]; then cur="${cur#*=}" fi __%[1]s_debug "Calling ${requestComp}" # Use eval to handle any environment variables and such out=$(eval "${requestComp}" 2>/dev/null) # Extract the directive integer at the very end of the output following a colon (:) directive=${out##*:} # Remove the directive out=${out%%:*} if [[ ${directive} == "${out}" ]]; then # There is not directive specified directive=0 fi __%[1]s_debug "The completion directive is: ${directive}" __%[1]s_debug "The completions are: ${out}" } __%[1]s_process_completion_results() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d if (((directive & shellCompDirectiveError) != 0)); then # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return else if (((directive & shellCompDirectiveNoSpace) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no space" compopt -o nospace else __%[1]s_debug "No space directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveKeepOrder) != 0)); then if [[ $(type -t compopt) == builtin ]]; then # no sort isn't supported for bash less than < 4.4 if [[ ${BASH_VERSINFO[0]} -lt 4 || ( ${BASH_VERSINFO[0]} -eq 4 && ${BASH_VERSINFO[1]} -lt 4 ) ]]; then __%[1]s_debug "No sort directive not supported in this version of bash" else __%[1]s_debug "Activating keep order" compopt -o nosort fi else __%[1]s_debug "No sort directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveNoFileComp) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no file completion" compopt +o default else __%[1]s_debug "No file completion directive not supported in this version of bash" fi fi fi # Separate activeHelp from normal completions local completions=() local activeHelp=() __%[1]s_extract_activeHelp if (((directive & shellCompDirectiveFilterFileExt) != 0)); then # File extension filtering local fullFilter="" filter filteringCmd # Do not use quotes around the $completions variable or else newline # characters will be kept. for filter in ${completions[*]}; do fullFilter+="$filter|" done filteringCmd="_filedir $fullFilter" __%[1]s_debug "File filtering command: $filteringCmd" $filteringCmd elif (((directive & shellCompDirectiveFilterDirs) != 0)); then # File completion for directories only local subdir subdir=${completions[0]} if [[ -n $subdir ]]; then __%[1]s_debug "Listing directories in $subdir" pushd "$subdir" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return else __%[1]s_debug "Listing directories in ." _filedir -d fi else __%[1]s_handle_completion_types fi __%[1]s_handle_special_char "$cur" : __%[1]s_handle_special_char "$cur" = # Print the activeHelp statements before we finish __%[1]s_handle_activeHelp } __%[1]s_handle_activeHelp() { # Print the activeHelp statements if ((${#activeHelp[*]} != 0)); then if [ -z $COMP_TYPE ]; then # Bash v3 does not set the COMP_TYPE variable. printf "\n"; printf "%%s\n" "${activeHelp[@]}" printf "\n" __%[1]s_reprint_commandLine return fi # Only print ActiveHelp on the second TAB press if [ $COMP_TYPE -eq 63 ]; then printf "\n" printf "%%s\n" "${activeHelp[@]}" if ((${#COMPREPLY[*]} == 0)); then # When there are no completion choices from the program, file completion # may kick in if the program has not disabled it; in such a case, we want # to know if any files will match what the user typed, so that we know if # there will be completions presented, so that we know how to handle ActiveHelp. # To find out, we actually trigger the file completion ourselves; # the call to _filedir will fill COMPREPLY if files match. if (((directive & shellCompDirectiveNoFileComp) == 0)); then __%[1]s_debug "Listing files" _filedir fi fi if ((${#COMPREPLY[*]} != 0)); then # If there are completion choices to be shown, print a delimiter. # Re-printing the command-line will automatically be done # by the shell when it prints the completion choices. printf -- "--" else # When there are no completion choices at all, we need # to re-print the command-line since the shell will # not be doing it itself. __%[1]s_reprint_commandLine fi elif [ $COMP_TYPE -eq 37 ] || [ $COMP_TYPE -eq 42 ]; then # For completion type: menu-complete/menu-complete-backward and insert-completions # the completions are immediately inserted into the command-line, so we first # print the activeHelp message and reprint the command-line since the shell won't. printf "\n" printf "%%s\n" "${activeHelp[@]}" __%[1]s_reprint_commandLine fi fi } __%[1]s_reprint_commandLine() { # The prompt format is only available from bash 4.4. # We test if it is available before using it. if (x=${PS1@P}) 2> /dev/null; then printf "%%s" "${PS1@P}${COMP_LINE[@]}" else # Can't print the prompt. Just print the # text the user had typed, it is workable enough. printf "%%s" "${COMP_LINE[@]}" fi } # Separate activeHelp lines from real completions. # Fills the $activeHelp and $completions arrays. __%[1]s_extract_activeHelp() { local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} while IFS='' read -r comp; do [[ -z $comp ]] && continue if [[ ${comp:0:endIndex} == $activeHelpMarker ]]; then comp=${comp:endIndex} __%[1]s_debug "ActiveHelp found: $comp" if [[ -n $comp ]]; then activeHelp+=("$comp") fi else # Not an activeHelp line but a normal completion completions+=("$comp") fi done <<<"${out}" } __%[1]s_handle_completion_types() { __%[1]s_debug "__%[1]s_handle_completion_types: COMP_TYPE is $COMP_TYPE" case $COMP_TYPE in 37|42) # Type: menu-complete/menu-complete-backward and insert-completions # If the user requested inserting one completion at a time, or all # completions at once on the command-line we must remove the descriptions. # https://github.com/spf13/cobra/issues/1508 # If there are no completions, we don't need to do anything (( ${#completions[@]} == 0 )) && return 0 local tab=$'\t' # Strip any description and escape the completion to handled special characters IFS=$'\n' read -ra completions -d '' < <(printf "%%q\n" "${completions[@]%%%%$tab*}") # Only consider the completions that match IFS=$'\n' read -ra COMPREPLY -d '' < <(IFS=$'\n'; compgen -W "${completions[*]}" -- "${cur}") # compgen looses the escaping so we need to escape all completions again since they will # all be inserted on the command-line. IFS=$'\n' read -ra COMPREPLY -d '' < <(printf "%%q\n" "${COMPREPLY[@]}") ;; *) # Type: complete (normal completion) __%[1]s_handle_standard_completion_case ;; esac } __%[1]s_handle_standard_completion_case() { local tab=$'\t' # If there are no completions, we don't need to do anything (( ${#completions[@]} == 0 )) && return 0 # Short circuit to optimize if we don't have descriptions if [[ "${completions[*]}" != *$tab* ]]; then # First, escape the completions to handle special characters IFS=$'\n' read -ra completions -d '' < <(printf "%%q\n" "${completions[@]}") # Only consider the completions that match what the user typed IFS=$'\n' read -ra COMPREPLY -d '' < <(IFS=$'\n'; compgen -W "${completions[*]}" -- "${cur}") # compgen looses the escaping so, if there is only a single completion, we need to # escape it again because it will be inserted on the command-line. If there are multiple # completions, we don't want to escape them because they will be printed in a list # and we don't want to show escape characters in that list. if (( ${#COMPREPLY[@]} == 1 )); then COMPREPLY[0]=$(printf "%%q" "${COMPREPLY[0]}") fi return 0 fi local longest=0 local compline # Look for the longest completion so that we can format things nicely while IFS='' read -r compline; do [[ -z $compline ]] && continue # Before checking if the completion matches what the user typed, # we need to strip any description and escape the completion to handle special # characters because those escape characters are part of what the user typed. # Don't call "printf" in a sub-shell because it will be much slower # since we are in a loop. printf -v comp "%%q" "${compline%%%%$tab*}" &>/dev/null || comp=$(printf "%%q" "${compline%%%%$tab*}") # Only consider the completions that match [[ $comp == "$cur"* ]] || continue # The completions matches. Add it to the list of full completions including # its description. We don't escape the completion because it may get printed # in a list if there are more than one and we don't want show escape characters # in that list. COMPREPLY+=("$compline") # Strip any description before checking the length, and again, don't escape # the completion because this length is only used when printing the completions # in a list and we don't want show escape characters in that list. comp=${compline%%%%$tab*} if ((${#comp}>longest)); then longest=${#comp} fi done < <(printf "%%s\n" "${completions[@]}") # If there is a single completion left, remove the description text and escape any special characters if ((${#COMPREPLY[*]} == 1)); then __%[1]s_debug "COMPREPLY[0]: ${COMPREPLY[0]}" COMPREPLY[0]=$(printf "%%q" "${COMPREPLY[0]%%%%$tab*}") __%[1]s_debug "Removed description from single completion, which is now: ${COMPREPLY[0]}" else # Format the descriptions __%[1]s_format_comp_descriptions $longest fi } __%[1]s_handle_special_char() { local comp="$1" local char=$2 if [[ "$comp" == *${char}* && "$COMP_WORDBREAKS" == *${char}* ]]; then local word=${comp%%"${comp##*${char}}"} local idx=${#COMPREPLY[*]} while ((--idx >= 0)); do COMPREPLY[idx]=${COMPREPLY[idx]#"$word"} done fi } __%[1]s_format_comp_descriptions() { local tab=$'\t' local comp desc maxdesclength local longest=$1 local i ci for ci in ${!COMPREPLY[*]}; do comp=${COMPREPLY[ci]} # Properly format the description string which follows a tab character if there is one if [[ "$comp" == *$tab* ]]; then __%[1]s_debug "Original comp: $comp" desc=${comp#*$tab} comp=${comp%%%%$tab*} # $COLUMNS stores the current shell width. # Remove an extra 4 because we add 2 spaces and 2 parentheses. maxdesclength=$(( COLUMNS - longest - 4 )) # Make sure we can fit a description of at least 8 characters # if we are to align the descriptions. if ((maxdesclength > 8)); then # Add the proper number of spaces to align the descriptions for ((i = ${#comp} ; i < longest ; i++)); do comp+=" " done else # Don't pad the descriptions so we can fit more text after the completion maxdesclength=$(( COLUMNS - ${#comp} - 4 )) fi # If there is enough space for any description text, # truncate the descriptions that are too long for the shell width if ((maxdesclength > 0)); then if ((${#desc} > maxdesclength)); then desc=${desc:0:$(( maxdesclength - 1 ))} desc+="…" fi comp+=" ($desc)" fi COMPREPLY[ci]=$comp __%[1]s_debug "Final comp: $comp" fi done } __start_%[1]s() { local cur prev words cword split COMPREPLY=() # Call _init_completion from the bash-completion package # to prepare the arguments properly if declare -F _init_completion >/dev/null 2>&1; then _init_completion -n =: || return else __%[1]s_init_completion -n =: || return fi __%[1]s_debug __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "cur is ${cur}, words[*] is ${words[*]}, #words[@] is ${#words[@]}, cword is $cword" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $cword location, so we need # to truncate the command-line ($words) up to the $cword location. words=("${words[@]:0:$cword+1}") __%[1]s_debug "Truncated words[*]: ${words[*]}," local out directive __%[1]s_get_completion_results __%[1]s_process_completion_results } if [[ $(type -t compopt) = "builtin" ]]; then complete -o default -F __start_%[1]s %[1]s else complete -o default -o nospace -F __start_%[1]s %[1]s fi # ex: ts=4 sw=4 et filetype=sh a!Y9)+5q*=Y]9^}UfIi-Mu%a5semU !} E6m ] ueE1Aj-QqAyw%% 1:&    ,-`` qx| x> >A- B<>B>ܢ OPË̋0v,vLLLL M8FFLbG+`,` ?( Դ T>0>7T $8<-  $# $tuhy.x.q.r.G(y.I(<(=((<(0p.HO(O('0P(>(@(--(O($r.,- &̼&,%$̌ (. F{ ,"""|Z "$"ĥ"ԥ""""""|eQlR|RRRRr\!D!!!"4"D"! 1" n"̔"""мX@D!|,<C4k\..@@4???S @5 5 6 8 S T 4,0, 0 \ pS h( 1 \s <8 `; 8 $9 ; 8$8 < l tȿH<1 L< A xB C C D (D PD xD D D < D (G PG xG I I J (J J J X= J $K LK |K K K lL L L L = $M dM M M M 4N \N N N |O > O LP P Q `Q Q R D? ? @ 0A h/ T1 Ha4rplmm d: ,,  2 % ,d <Zd, ȟS R 4 x3 "To< % & @3 / tD MN 8̒P (1330333 3H12l22H2f/ĩLKMN@NANTBNBNLLLlLDM M`#____+a<=`|:`D`k`!,U (Iؒa,aaa4cb|OeX7vxv__`\vv8OwOwtLMM@L M MLMLLdLLMu3444dG4t3!434P 4|4 444t44d444L4<4,4444ԓ4|4$4 444444ܥ44440444l4T4<4-4H4,44<4X4|44#4d54) @ ķ l9()ATWA8\AZA]AYAPByA CB$B8CDDDhDHEwEEkFG7GlG<yHzH zHzHzH0zHxHu@ @wH$ClAAAAHAxA@08@8@9@h9@9@:@l;@PH@x@uvԢvvZ} `ԫ~`YX^WU(\Lwm4,P*މnc(\H-jȨ<̌s| Ȩ# *wltt'd't'4V|/789`0L182,34456,D(((vKHF TC=>V(:H@GMQOLNT;BI4 ?@?t;<h \|0<4 <%/Ha/HĶIp6l 65555545p55\555\5585-664666|66d6Q6@>6dv6p64^/ L LH<.H..;<@<L,L3/J JJJnf}fff,&xyyyyPc}xc}y"yP#y#y $y$y$yX%y%y(&y&yy&y`'y'y0(y(y)yh)y)y8*y*y y+yp+y+y@,y,y-yx-y-yH.y.yx y/y/y/yP0y0y 1y1y1yX2y2y y(3y3y3y`4y4y05y5y6yh6y6yH!y87y7y8yp8y8y@9y9y:yx:y:y!yH;y;yy>y>y"y"y,e?4??\@GHH@7,P%531*"̰4xڔڔ@|@h0$ތD4E0<0W388d;P&8Xa9<$<49,59Icx< b$tfPi jD4jPipDj,=j7jtjjjiji4Vjjj,j)jHj8j &jjTiRjX}jDsjDjObOxQȸQQERShS T`T@T$TTT4T T >t=/>P>>?>L@>@>L>L>>>>H>>>>>>l>?p ,ڂH ޅĮ nnolpd77x77 5u>u?ud>ux>u4=uD;u>~I3$pG @";("$                                     A     0  ! BB @  DD !                      ,,           * C C@@@P@'    )P  00-)=!!!   (@ +% U           '# "  II     %$!  )   ED !!&Q!!%%#1KKK QP! #   )     " T A1!11  31   3 &  II II  II   J LH,(  U      C@A0     ) &   -ɵ ki      ;7       .  #2&     - ( ! !!     B     *    0    %     N        m                  0          **   " $      $3# C # K@ ((   C G #!`@@0 ) !  @  B)b    k &""=?  0CA@  (!! A@A --, ZD    *j*  B5    `a`    KafF I K  K  @`@   O  O     ~  >  IA I '%%         )!"    ! C@C``a CC@ KK@   W  kUQ ! T e" %    #AA@Z c    91 2B  &' *j    )IHH*+  @@%  1'& c  111     =  DH@0  & C!!d ((    !   D@1EA      oma//# $30  !?)   ga 0  322 7 J    !!UT         (  @   #!               i( @                 4*                   !# 7[ #  0 !    !       )  !      0000  ##     sSQ@  +) +   ! @DH@ ++++##!! 50   $       "! ! !  %  "FF&   @Pp     ?3           !1   ^wW   CC@C"" "!! !  (( GGGG   !!    #""          !  CC px|       UTT        $! CA@@ O '7 %%%!    '% !      UUT $,  &T**     ?   H02      bc~r!!! (    @    SQAA  $  )(  TT  !      - *(  |&% ? `x``  @CF@   LH ! !  (  F %!  1   " %!  '' '# '$0           -CCAA@     @  0 0 PP"%!   @AJ@H  I       @   KIKKK      "   B   b " 0 EEEED@  0 '!  @  A T )))(( $&!     2     $ " ! 0 $   bE3 FDDDD@B         !      I 0 0 !]]]]    %$ J  AAA@@" '"     $ BCh@ &'& $$   q@ACBEJ @@AI@   UZ Z --  "94 RPbjj* &4<  ED          73 - IH L@   9   cCS   ?/ IH  + +  >8    ! " '# ! '#      KI   )      @     **     UUUPP@AB@A---(- ##!!!!! AAP K   QP K@K@ 0 *   I   &$ I  "CAA@@  :%5= c#WSSQP  K@ Z1** ** mmm A  ) j**j*  qq    )(    PP      ) FGf   c   (( QP18<6 2        M  I '#3    #"   + B  "330 *****3300 !   PQAA@@@Ѐ  @  ?      ]]M    SRPPP $!SPPPP  f$      )    0    8                                $                          %$%$$$@    NL          "#:" $1(  82! () ;       L @ L L &EGd\l  + )( 1!    @  $$$$ $$$$   aaaa    @   B@ ~xz        %!!          2  ++*"    0        AAAAAQPR  @DLBA@@DLAB@  "!$  #               0   %$$$ QP            "c       @0("      (       @H@DBAB%5  $ #!!^^V^      (! .2205]]]]X@     `&&&&&&            6%=%!$<8;       0    @  P)((((  VUTP@  !R|C@AAAAA    c  FF H 1@AA@A@@   + +ONL       33 A   D    #    #  `    #!  ) -   s2        WWWSPP@ IH4$ 0 "*&'"   -----,@ !       DDDDDDD     0 0  008 $"    *(   U    B( 0 "   BB " 0     `É  !5%  10 0   0  JJ5555      UT +)+ U  --   -    " $   1d  5%%%      )    ``` U   - UU  TT   ?  &&&&     @@AIMC@   # HH         Հ IH!! !! @H@LNOH$4&,-@DFFGB@     + @    CC@CCC@@A@ECGH      8            r`e"ee )))))! ****     P  * P %%%**   C@@ C@CCAB@ ccK@K@(8 $4Z***"     aa 3IA   F  c!!      0          K  ''%%%%!    D    P        B  !     @@  " "'?073333 PZ      !           )       '''''! @EaACB@ "*" 133 !   @ )((      3NNcbR   (g :Tgggg 0Y 9gHg 000T0#,T;!X !P !T #a'<>(l)P.,@.8"0#0"r" 3B B 3550VR<r"t 04"(W"0W"0W"0WA0x" 0' $DLD`%\ hD7_0hdkTqqL8˘8888*8$7L G@['x_$0 qI<l,,iH' lP,:(R(z=p#P kT#t><> @<@xW0T%0:LP0Pܽ0z0'MHH;0}P4OLz:D:Ti O 30:0:$70 0:0:0:)\Ph O+0E1{,kkkk|1H{Ik<<<<<<<<<<<*8*8(XI' : <!T z+ *BTBT3T@)`GKxB[0B N0B8B0.Xj0c&0&0\50{=,X+Lo+LoD0S>("_$@ 1Lh>_$l Wh_$` /TTv(T[(TfyT0<\0~D:pHTgg | 0c| 0c| 0c 0g 0=* 0@*2 t,H:D0^D0^Dp^4P* T* T* T* T*T\*T(T,---.0G0G1O.Z3X3;3;3;3;i40"0"6Tt6DEc7c77hy7hy7`y4:xW;;;;q@<0#^=04?L K@AbC0]C=C= TNF0 NF0 NF0 q@G`HpB9|JLHLHHT>MT'N4 R GRHV WTU` vU`VVVVxVVVxVV|VVV|VVV|VV|VVV|VVVVVVVVVVVVVVq@VVVTx WT|\h#_HH_pYP0]d]d\0z]0gbb$c0q@q@q@d8\z`T'`T'ldw^0gw^0H_|$cTcTbPbTGeT)1JjT kTs|r8(Q\Cu.,0:w "THHXSq@ʓDV'0ʓDV'0dFL"TT"YP8ʓDʓD|j kHH_T_TВCʓ0ʓ0ʓ0t"TlN0D0'T"`"T}?}? T T#T#T>T>T˔?˔T?T"`"T}?}? T T#T#T>T>T˔?˔T? t"`Tq`D5T3,TC\]ήJql@ ~հTG9Xq`شWشWشWشWVfVfVfVfԵwԵwԵwԵwq@ $0J$0Jo80"0"g8P0ZDDmo8o<ɼ Uɼ8U<o8ɼ8U{DgpDY`YDY020yX[yX[yX[y<[y<[`L`L<LT8TٽT^ggXG40g 0kdT`T7\t[Hl]ld8ST&jT9ST&LjT9ST&jT9jT9jT9jT9ST&ST&jT9jT9jT9T, y y y ys0>Q````_%x$QxPQ 4qD@ 0 T8cf T%T+?T2 T/ T; TCL TUTTTM*<*`q\z00L#=q@$@)q@q@(T20W>0a?j|CT20>T<Mq@jM"jM"MT/:0aOhRP<S<NJSTH* T* TLc\tcVLc`\cLc0hj0cTiT) jT.ރ0ރ00Pb\0q-T+TTd†T`+T܏5LF%0%Zc0dLL4.AA"`Tq#{xd9T8V0=TI^h^Th{0{0{0{{TВtC}?0aqd>q >hq>ͱ<H NG6G6<UUǮ0h@@@@@0 V'0V'0>T["0la0)@)@)@)ВC N\?@@CJ~ N>>>c(c$ N\?,@@q@IPIrrb`Hr^DTkT :TFTZZZZT[MTZZyT ZZzYdGq4@ 0u0T0P"@M0P"q@8H3q@Xl78WHeW>8W|e*@*tDq@1T@q@(M0"0"1T^ <1Tp6t6LtJ 0TcTs0P"q@'D2TK,T`wTzTETZSTs TNTTT-TrTq@}   @>$[q@q@.0 0tPt:+TP+T0"P<10d10dW>|6$qKHig<0D^0hJ\NwKDiLXTL<L444L44LT444L4L44NwL444X4L4L444L44X44q0@RX*d4q\@q@60t60tԆDq\@qETqD@70U% X% Xh/d9;XW>|p0kd,0k˘0k0.Tm.TQATF \ptq@UPUU0Ḷ|̣T30w*<Pb0Hw0 N04/D`xָ8400|h J\Et.Et.tT7+TTDT0IGghxh0IhIYKA0J0d 0)dDD7HD|jJDD<[8=.J"TKi0&WT0nT<tT4T:pTFTYP<7hprP p=8UETgETgc8chV$QppV0QVQVQVQVQVQV,QVQVQVQVQVQVQVQVQVQVQVQVQP<qL@ 0 h8`T(T7U7p7TH#90TBx7HDLD0B0D0E0VE0C0E0E0@F0F0F0HDHDHDHDHDHDOSS|{TT_Uh(P<#gLBeT(lD$+m`w0P"oo0+r(+r(+sHUg8'0 oTpTH{qTjT8:-R6R460:uh x88n<8nH8I\k0kdkՒ<|ՒX|"\~0tl:rP 8d8\jM0"ww}d:d:.TT~VT0$4̣:\aLSK4϶T.0M"T"T>l 0%tSV'0LaLq@;__,'$'@T?^TCTNTUT#T*H9\V Mh98V9TV=K@iHTCvTJH3h0q@H3T T202= ggq<@_TVT_jPjPPql@fDCCݵ Ki10?ex*LT` 77H!0X<`0dL< F8|-l0`d-t-0`d0`dT&pn&`n -/0Sl00 10$l00 l00 50 /S50 l00 l00 l00 l00 l00 :@Xl00 0=0&nl00 l00 1<$50 50 l00 |B@]BD"F<;`EDl00 q0@04"L468NT+(q@NPR "`TqSTq0@q0@L06ݵ@h]hݵ02fL\0erY0ݵ@6 +.n+n+n+϶H.ypr0\%uT0?d?@?Ey<Ey0 0~THP:*0F\^*0Kz<'G?͒X*)4q@0"!G~HD~THq@X~V'0Pt?$ "`Tq"`Tqm<w0vF^F@^F^F0^v0kT1!TXTa  &T f&T T  9TE&T T iT)       &T6BTMT$T T TBT^TTs[TyTTTT   ]T HT"`tq"`Tq*\T$TgT)hT)eiT) jT)YjT)jT)lT*lT*7pTToTs,TaT6̡TTTf'T4ETITNTTT@T 04TfTV%CC!0@[|0gq<@<ymSWSWSWSWSWSTWkTKTfuxLl&l&lx&l&l|&l&l&l&l&l&l&l&l&l&l&l&0r0 BRKiK<iq\@q@\ 0HZ#DKiTDTN<*;u*\)0*D.,0/q+\c -@,k-Q -0,-L,#.Q-8,.L,.Q.8,3`u4p*u4p*Pb8`Q9h:t;@2}>PQ>PP?PR?PSq+@c+hB1P),H0)K0$K0$U)/T*JTJT8TQEIETIDHDTHGEJGETJEMETMvELvETLENETNFOFTO}>Q}>TQ>P>TP?|S?TS?|R?TR:FtT:FTTFtVFTVkFtUkFTUFtWFTWGpXGTXiGpZiGTZ5GpY5GTYGp\GT\0TBeLTENTf6UTbOp4:phQuuzq@o<o0o<Tpq@ ?pTqTCqTnqTqTqTqTrT6rT]rTrTrTrTrT"sTJsT rsT)sT;(T%0P"pTTeT.T7TIrpy)yL)TZ9TTSTT3ݜ0XUP؛`NչHdLcPLcLiXk87G<Tal>؛DNݵ\-|0r0r0T+ /0/DL0/0/0/0:_/0#,Xkp9Z9 X@@#@<@\$JORRHR,t$v0ZZLt|0ke~@<I~0/e~0<~/e~< 4 4Ԏ P q@p{0Op&R0L !t0.;T |7pq@0$64tLTV:LnВDCq@T66xD0D0D0D0x38fX#4Zm0=mp= $p%3D3DLl'Z0: y4 yp yl q@TQXT6B74~0 XPGAXr"`Tq"`TqcL"$ /'<(<)(04)0:=)@=):{,%"`Tq50I{50^50^TXGXDG@BL<5-V@B8<q@q@xxu|uuݵ<ݵ<^diMEt,Cvdx0kvCv`dH{LM}LMLMd   ~yx T x T Z TZ T#QTLT=QyT 0Z L|C0t,D0F0C0C0CF0T9\VJK@iTC09@sT<<4^T0 ^T^Tq@\2fL\q@7p=IA=:x+0f\`]0]^T^TU T^TrBC0|C0tq@0q@-+0 0 ]TlU CT}CT}FTFTCFTCFTDTDTDTDTDTDTETET6ET6ETTJT T>' TDE7 4G  83~  hn x` ` `  D H   M`  P \p! kp! 0kp! dk 4| X|# \/$ 0t l3rP 8d8\C+ / jM0"1 w1 w2;  T: TB 0_ 0<F K K V'PV'PR 0R 8`T4V'PV'Pb c c $ m T8m T<V'DV'DDhUpm~ DF2~ 2~ 2~ ~ l8\8\8\8\8\8\8\8\8\8\8\C 8Os T`C dOs T`s T`d=݊ 9x=2~ pӓ |Q Q Q Q Q ݵHݵPݵݵݵݵݵV'PV'PV'< t 0t"T"T"TZZV'PV'P-"00z < Dz <z <K0i0"0"% )9 z <PL<0"G 0z < Tc T T T TL' Ti^ T T T T, T T*h | 0T LrT Lr @n @nC XR h,d X["`Dqs T=LRi)i)( p 0Uq@  TU TZ.  p=`T4, P , 0u'. \<p* @r1 9G ?H 0 O ?O 0O TH T | Lx\V'PV'Pq4@ 0Wb 0"T~g \ph g T j 0(no Dgno g=z T{ N=z @T=z @T=z @Ty nl Tk T+l Tjm Tk T*k Tik T1| TKy T} Ts} T} Tl TEj sf f f f f  LEj @s 8 Px D. XZrP y 08` G 0808080? <C? <C,@ @D,@ D,@ @D,@ DA @ lA y @ ,@ PD  ,@ PD >S S S 8S 5 \ 80פ xz2G 0? T@ T< TYO T T1 TL TI Tv T T  T= 0 = 0 = T B \?rB T?A T5C TLhB TCK0i>94>94O T-nO T0X"Z !Z h!Z !Z h!Z !Z h![Z G] y] 0Z Tt([ T[ THZHZHZ~,!l q@pn 0Yn 0U>o 0Qs DEp xYp TY_p x]_p T]p Tap Tap Tep Teux T DT`01] &D`V'0V'01P<81<10d0M1 T T0" TH 0^ d.~  ! T)T )<aa D"T ǻ \B0"0" 0`j 0]j ]0\"j 0]j ]0\"j 0]j ]0\"N-dj 0]j ] d\j 0]j ] dpt p " 0 ` lQ t 4rHH D0 Dk  Y 3q@qh@ T0 0j 0]j ]j 0]j ]0X"00"00"00"00"00"0"0T"00"00"00"00"00"Y 03 0 4 0 0~ 0 0 0) 0) 4P 0w 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` 0` TWJ0J> / 5 <B]9 $9d? 0np .B Lo$$q@ݵ"T"TKli]9 $P @JR RݵA^ 4bA^ Hba 07ݵݵݵݵݵݵ c X` X!1 TaP> < < 80"=LRJ Ja\>) T=CdqX@; ݵ0X]l]/ 6?-0/ 6H 0;~ \h H TF AV'PV'P (2 4'x6 @ @ 0 `T4 TZZ00"]0M 8Q  0e LY 8$ 0 h$ 0$ 0 o X .|W W  <@"Tf"`tq"`Tqq | dВC`T4Nl Nl aw0 0L#hhMhMhM$$ 0(pLqh@(pL-_-_V'0O \-F0`$J0AqT5"T?q#TUZZ)T+TATTЄ0  C C.8 CMFT-6Xt6Tt6Tt6Tt6Tt6Tt6Tt6Tt0ad~l4~4~44~4\4~4~44~4~44~4~4~d~4440alX$~L!01q4@$S|,x0x0x0x0V0.qh@G@&D8xPaD>V00.j 09T 0<',1XL T' 0eG d l.0hH8r xx0P"% &&2,q\@#0<#0<h7}'<}@}E}q\@:qN bHApGAp4GAp4GApGAp4GApGApGAp4GApG66p6,6.014)q @!LN xG,q@0%q@ApDGApG#0<#0<ql@4ql@8  !CB            TUt  ?          `      HD         @$       5%%%%    @           @x|[KCA                A         $%5 .,     !10    *(,)9   "227'   )    "                   H@bDPBA EEEE@ADE           *(,)9    ) Z Z V ZVU*b       $!!#        CCCCC@CB !   ! 13s  "    F            ee  DNO ~  ` `A  *(                @   @@EMGBB@           F&  @A         ``    I                (0     I  2#+/ $(   D@BB@CG@         3111  !!!   2  FGE   D4  " {             0<,>. !!      !   (!C            $$ @"  @    IAAA & 2:2    + '       ####I " (   H20   n         @"*    @  0 0 @ 0    |<   ?@  P !$(  ""      ) *(         ##   @   @ "E*  @  @MIOKE@BD&D-%* 3 ' OKBkCS   IAA 0A1A!A)    !     C#   *:. )08<   ++))))( X\      /.,  #" UTT  FBFBoVO     TT        `  f@  -  ]YY#-R   `  )   @           oOOK   %%$   &  $`"b#2  LL  '&$$ ''''       IA R&R&%        !! ! ####  EE   n%%4      L ,  CCCCCCC    @CC@@@ CB* @@  rrr   --   T   ! u t t    @     %$$     &6> @   %%% 4   ,,(        $      10@@`@@@@     -%   JNKI  EfFf     " ., &         @             @  bFV^       @     Q          -,,-),(((  H  #      )((  )!!!   NNb""                    $(        $(            ### ---------      `PH $                         $( D&$d,4%  $ OOOOOONHJN    $4    QQQ@@QQPPQ      !a       @ P@  Q@  ]PP]\PXXXP         A! `0 (  (     !)+L     prRQ      0 4$!+)  @BRC #!   )()())))()  7333        $ <>       @      *$*$* p*  UUU(*!C*$*($* @8*BB(*ԅ* ,(( ,,**B**  $44 * (*(*IIHI(*$X * (*(*(*1 ** *(*(* ̅* (* *@@*@@*(*8``|* *$* ))**d`*(*(*(* ' '  |*   |* *0(܆** (*, 8* %%   * (** :888 )   @@$%d ` (*|*l*84L*(*@<*$$t*0*0*0*l0* $@@D*)` (*(*(**xxH*80* " P  @4*84** 0 P@*@  +++++ ####  (* (** (** |* ̅* %%%! $$*,,* |* ̅*(*(* **0,*HD**@8* ̅*D** |***\***$$*40*m @` 40*D*  p* ܅* 0*($* * ̅**Ĥ*$*D***(**l* * ***0,***@<***  *  HH8*``  $*   0*004**0@8*PP0*$* ؅*x\T<*  ؅* T T U T 0,T** 555555551!!**  LLd*4,l* HD* !  (* +  [QQP[QQPYXP  ԅ* "`**l* BB @  0,* 0,*Ć*    CCP* K   ( Aԅ* 88 * ** (*(,**    .**** E P**y ܅** (*4*   (* ̅* (00d*<4* *   ԅ*|} 5-!!    (*l*l* @8*c1d lh*Xlh***|*   (*  h(*lh*(*lh*(**  l*P*UUUU -    HD؉*HD؉*   ̅* H@$*\**4,l** ̅* QQQ@@QQQPPQ  * '!     (*$*  * *t*Ȇ*** 1! ` *(* IHHH  (* *LD* *   (*  *  *X*`\(*  CC@CC  *$<* (* +*(  MM*  * *H*0,T*P* ԅ*+ ԅ*   s`s``  (* * * QH* IH@**p*J  * @* `* (*    4,*|p* (*tpL*tpL*K@K@TL*  0 xP*DL*A ** *K@J@K@K@  1 K@K@K@J@K@  ,(*x* `@R@@ AA@@* ` @8**84*@` Bc BX[4* (*   0%  8**@8*HD*!   31110 ** $`*plԋ*xt*x*PL*p*  h*(*  SSC  (* @*   64(,   ܅** ) *YI *pH<*H<*  *@ (*    ̅*$*-  B*((І*((І*((І*ԅ*     " :0 (2!    *  @8*8*   %(*4,،*PL* D  , (* *VB@*  $ ( PL* //,,,  (*  18   44<*H**$*$* !!! (*)))  LD* ؅* *   3%!!$* **,$*  #(*LDȍ*                                           $(     +++++())()((  (  ------(-))))              L$              @H                 +++++(++++)( %%!!    Z:z:;     (08          $!(20   11!!!       33333330000 UUUUUU  @@  +))   eE@ 3aaAA@ R 3111   *@    40::; !! @AA6666  T (;$   0     ( (     Y %  @ttuA -%%%%!! !! D"5     ED@       :800  @!  @@ QQAAA IHH IHH    k# ( & (,)+*(( MM  $%&$       srrrr ssssr  ;:>    !!!!!   qqq!px  @    ! K@K@K@K@K@K@       %$6  -%%  -%    RP BFCA     Q(,- UQAA @  `@               )@'B B!C $ihhhFFF             &  $    !$  $UUTU## !! #!!!!!! <>? xy0  p  (& 00         => .      EJEEJ # !I&$!!C&U  >?   $%% $   [[[[[X@XX[ >  **!<#@  ( K@K@  (      #     (   $(    &          I!  EEEEEEEEEEEEE @U@B!C     KIA  F @ a3 # I UUUQU@Q   -$      UUUE   t     "2 LMM          0  "#fjUUPUUSP  U IIEAEAEAEAEDD ++++*9=800 ** $,(   VRR(    ,*" (!%64   "ccY VUU @ @@Z  << (  %%$$        )( BA@ I  !($0 ee  #""" & PRQY]U  fFFFFF  !$"( aaAAAA  CC C C  * * * \]h ^d@       @ UE     CAE  10    0  $       ] $($   @@!  ((VURUPUSSPRRPRRRRRPRPP RP$$QAA )( (*@0                 $    $             $                   $,                    $   $     $,0  ,      /  H )D ,  -$ - @ @@ N O O N   " T  $= >  @BAf       * * ?xxy~  00A!A!xy    H H   @@@ (@ @  @@@@@ A ( (4*    IAAII !%$       $>> GFCD  +*(       @B TTWUUQU CC C A A A . P- yxz  OOLP K@K@K@K@K@  ( $%``` MIIIII@@ 6222```` 08<    F     #@`$  FFF   :     Q4p"`  +I#IIIID B B ""   $, I   $(,0 9 @ $,  H@( @( OG   @@@/   EE E E E E E FFEFEF@    $      $  $(  $(    $    $  $   $    $          $  $  $     $(, $  $        $       $  $  $  $  $(    $  $   $   $B(B 'B (!C   $ ##! !!     $&&&        $  K  $  @   $     $$" `  @"""" @ & 5  #@@ & & # wwww7777   `pdbbjBjbbBcB!"   $( !(B4@@@*E$   -%%%!!! UU&H '-R(R'-R-R-R))( """""""""  $  $   QP   $  @@  khh` (  $  $ @  QPPP    $ CCCCC $,458  !@P(   $       $ ----%      $(  $ 0 %% P @@ 0<<??<<       $  $ mmRmRmRmRmRP P PP 08<<> %$$#A   0 (   $ ** $(     @  @      08X  SSQQQQAA@NN  $ 8 /@  $      $      (((+)   B&IIH@@     @  H@@AI2  $ &.&. @A (   @<**xz x y }   6  $(K@K@K@  $  $K@K@K@K@K@  ( 7  (3     $  $ 0p  $  III  $ `   $, +++ + !+)!  A  $ MMMM  $  % Bbfv~  $(, @  ``hdpb`a` $(, @   ``hdpb`a`  $  @@!}|z  $ -   $  $ $(, JJJJJJJJJJ  DEA0  $(       $   $        S A A A A A A A B scccccc   A! @ @     $    CCCCAAAA K@K@K@K@K@K@  $(  AAAAA@@ VDTDD@ $( $,0    $  $     GFB ` @QA@       A@    @`B       '  FCE"" "`  $  $ CCBB@  $ EEE @  $ $(,     $ $,  $  $(  $(  $  $      $  $(  $ $(  $  $  $  $  $  Hh! !      *   7  $  $ 5!#!) $   $   H  < 0 0 I"I"I"I"I"I"I"I"H"I"H"  `80%!   `   8  00 H*     WUUUUUQUUPUUx|}{y+_   ```````````  PP $(,4  $ $4    BB`p  $      -  $  $  $(9d2 P5%% $ "!"   (    UTT #1:PPPP<> >      {;98 :$$$$    @AEEAA@IE III  @ TTP  `  @  $  H  b `a```@!p(pp0p  $-)K@/CC@A  +         ((((  $ -mmi```@`@@`   10   eTeT@@   !  T T  " @ @          BRbCAJ   $`    PXb@ 0"00b0r0v0T0P 0@@@@@@   EEEEEEEEEEEg8LXXP 0Y DYx 6x d6 0<7 l 0<7 ` 89+0|UMX+\ # >qI,5 ~?7xUh1r"` "W?# N# k#0#<"#0#<"$ ['`_)4rp)4?+ #<?+ #@--u-}u-}-D?-H.dC*.h_$| _$ /#,j135@00m@0hm50[50L\85 y65V"W5V"DW:0['[:A9M04<`D"<W0d@0@m[3Dt:D$D_$H DHE0qH2F8KFHKIh,$0L:LD:Pr"0 5X["W"W044(XIP0P 4<dD04<|D04<xD@Fl@Fl04Z0[0,0;N#DkN#k^\$`r"P <XFg*#gd@2Iz2Izkzk XXXp=@>nY1`t|1D{_$L JLlY1<t|1{?q"Qq(0ItSPY(0ItSYw<S>@"%YLfyl%*z fFzP[{4+{{({x6{$_)0r8|0##;}S>""\"`#P#T" OT \dhDTY1t|1{z?0:/0w| (LI(XI#0#4"n(|wt Gp$%L:0['P0t՝x|:T%YfFz\[k&!`""##"N$_$ Z{$թ7թ7zzTի8"zp }X8t$h11d--6X@0m_)Drp)D;};}t#`t#`x#d;h}#hMh7`(0I(PIP0DPP0hP(0ItSYL:i0lr"` ܽ00Z[8zH0s8||‚x&?q"@@XP+Ph,X;`043$|1P{$70 WL$70 T:W$7 WTT:Wxx:F0'L0['843043Lt:p=dphp=@Lh(' # #|97 $7 B5L?# N# k%YDf%Ylf(z4$zH zD,0,0Jx!`|B|#4#M"\|g8<g8<g8g<g<H\\~ T@* X T@* X 0v 0 | 0 |G'0V'q 8- = T@* Xq @- D= T@* X x4q h- l= T@* X x4q - T= @* Tl,0"w,0.,0,Q,@ -ll,0"w,0.'/3:/d/4/:/8/4}/h.H.0X0@G1T)1X%1T1T%2N20"2N2"Z3X2,44;&5Li4<'7?707DU7p7ty48DQ7Lp8@Q7p8@Q7p9H9q@qh@<D<HAlbBj T@* XNF0 4q@qh@ 04THL8|1JHVJ4J`JlJ`JLKw L0lN<lNdCD^TrDX^XCD^TrDX^YP0fPtYPfPt T@* Xq 8- <= T@* XRRS$SUTuT`(Q\CV(Q\CV(Q\CV(Q\CV(Q\CV(Q\CV(Q\CV(Q\CV(Q\CVVT Wd\<\^^\@^@@^(`qx@^^^\=]\^d^^d^b]b]=]O]m^^^P^=]4^ P4hf#` ]TR]]Ti]lH?l ?qxUqrlrq <- @= T@* XDtX)\t0:DtX)\t0:DtX)\t0:*(vH wp!0{|trw*Xylrwt*Xylrwt*F}00f}T}P9rw*Xylrwt*D*Xyxrw*TrDX^Xytrw|* T@* X|tVhx8TrDX^ʓDʓDF:ʓDq-ʓDh{|ʓD{|ʓD{|04"T@$\(0@$\(Lٛ`L`,nT1Jj 04H?7?7PxPx2,2,T 03q@f$X4,bP,g8'P"9T\P-qTq|@aqd@q$@y2g,akS0I0 q D- H= T@* X T@* Xg8{T T@* Xl0"=PR)tPo8H0ɼhUɼ<UXɼ<UX0od0ɼdU0ɼdU0ɼhU0od0ɼhU0odɼ8UrT 0od"|gh0o`o8H`lXmthghghgDYD'y<[IH yH[g@y<[L8LI8 ɼ`UT0"TɼhUTɼlUۼTn ɼlUt \ 0q@YKA98V&E l<6o khh|e`_oho8A(?qxUqp``pdP0cX`90qH`0l`@:+ 1(lD8|0ll8 0lT8808.xBLh\vPL^t&&aD,aD,aX,aX,&&h&&aD,aD,0.8nhsh ?xRh}h?P1QTY (u o6 0 L0t__H? ?qxUq&Th*<*<f*<*M<}*<*<fXq@>$70q@0q@0q@0q@0qT@0qT@0qT@0qT@0aa$Laq @jM"yNN0N4MPdg?qxUqg@gdxx ~ t~d\cLc\q@d`cdc_ii:/ }/\ j0.id)lT:m|:"nL:ivhUhTc 84` 4 T@* Xp\~ T@* XT|7T78!` Xmɓl& Xmq <- @= T@* X* {8d[T"XdL1J8P`#"`qqDaa,5 ][T"XВxCВCВC ВC ВC<ВC<ВCВCВC ВC ВC4ВCВCВC[T"X T@* XdLdLY0ddL(Plcd(P0 xl5ѵTR^pѵTR^hDǮ[T"X T@* Xq <- @= T@* X T@* X0I0I0I0I0I0I 04X* {8h[T"X 04HВC*{8[T"Xt|В|Ct|В|CВCВCВC8ВCВxCВ(C@i@\@hP0ВC ВChc8>>P0@i 04X 04H,H?Xt ?qxUqt \ Tq>| NT N| NT N/ }/\/ }/\H8|DT0"0x ~Lyl Lyl DT0";P8>JP  @Q9 84XHH!q@q@q4@TrDX^Dp'[1J;Pd>J0((40h" %#l= F0&TDdTyltT0".0 ϭtL<yl T0"2,2, 0L Lw0z L\\D ~ ~q@q\@=,MQ,F=,MQ,F20^W>4u(qP@LCDp^TrDX^TCDX^TCDX^TrDX^8u8 `9u9 `90u9`8u8x`q<@9Hg<0<`aq@A70UBTA@A0q @- = T@* Xq D- = T@* Xq @- = T@* X7UDOAA T@* X T@* Xq@A T@* X T@* X T@* X T@* X T@* Xq X- = T@* XI0q@70Uq@P#=S\SdFq@6iq@]0YT]|8lR *8SS(9u9`{\{6Piqp@s4sWTeq@q@ T@* X70Uq@ @@* tq T- X=9u9`8u8`ו8A(?qxUqpq - T= @* T{TNq`@ T@* X T@* Xp0pppPpӢ0DH0nU0Gp0 Hb%0zN4%0zN40 \J7H0xby0@bָP)ָ8)ָ8ntX 4 %ll/H}/H08|@O0V9@;Pd>J0DZD-<g8A)))(?qxUq)p)=TE.&8ADDdDd=Dd%0zN4H8|t8h\d&8A=8==3%8zNL%0zNH[@[%8zNLh|DP|8%hzNlT`T`O$V9hաpաLpEɼ<UrP 3P\hɼTU L1C\B*4pVlQpV,QpVQ/L}/ffӢ0D@7P?  ?qUq|4P?4 ?qUq=P> (]d=]$ۼPn ɼ8UMhɼ8U`dɼ<U`dɼ<U`dɼ<U`dɼ<U`hɼ<Urd ɼ<Urd ɼ<Urd ɼ<Urd ɼ<Urh ɼ<U9`Xɼ8U9`Xɼ8U;Pd>J0_U8(_U(WL,WXGX1 \[4[ [@voPoPrL oTo0@xB:Xx:t:0" 0>.9\8 =4n L= =TwhMA΅hNA8BLۑ0u@ΘXfpqMhɼ8U`hɼ<Urh ɼ<U֜`ooto\op`o0vu0vupʣswԤwԤwԤxwԤ|wԤ@|wԤ<xw`v wۑ0wpwHwvXTK~XtCT ~V T@* X T@* X̣̣yN0N8 T@* X T@* X"t}d?2$WG@4l 04HptD,8,G*0SDy,8TAhAO0GDD-- aDP<f8^`J|w5lb`lYH8|P-$:<P-@=H03r|rp|0S:a0;l6 < @f}rHId 0^ JL1W 0L#'7)T*\01717P#D'7Hx8|< T@* Xq 8- |= T@* X<a-\t*DF|0L< 8-t0L< F8|Z--*DF|M" |"0q 8- <= T@* Xq <- @= T@* Xq D- H= T@* Xq H- L= T@* X T@* Xq @- D= T@* X T@* X+4(+(,h+,k/LO-8D ݵ:1<n/Sl00 D10$1q H- P= T@* Xha9l00 7)l00 .-l04 ?xp 04X 0+x(G@B+@(+(q 8- = T@* X 04hq D- = T@* Xq 8- |= T@* X T@* X T@* Xq <- = T@* X T@* X T@* XH`T|!Q R T@* X T@* X T@* X T@* Xq <- = T@* X T@* X T@* X T@* Xh]h:,X T@* X T@* X T@* XM0gD`SDS<q@7TpP<o0+.nT+01qt@t0.pHh8|0H8|]Ht 0 hw q@X1leyiy<+JwyHiy<+TrDX^q <- = T@* X }U,tY#L'7` 0@* d#0'7H T@* X T@* Xq 8- |= T@* XH8|;Pd>J0#H'7TrDX^TrDX^ T@* X T@* X T@* Xq 8- |= T@* X*<*d@ ݵqX/qX5 04XO0V98x0aЖd Pz6 @x`q D- = T@* XO`[9l T@* Xq <- = T@* Xq <- = T@* Xq 8- |= T@* X< T@* X 04H T@* X T@* Xq <- @= T@* Xq@q@q <- = T@* Xq @- = T@* Xq <- = T@* X@ht T@* Xq X- = T@* X T@* X/4 Œ<qE"`q#@'7Dq @- = T@* Xq 8- |= T@* Xq D- H= T@* XLSSq 8- |= T@* X T@* X T@* XӢ0D@f0J$WP? ?qUq pT:϶x./T X/T \a" `da" `dT)D4LP0<l0pVq L- = T@* Xq 8- |= T@* XL0r@SWWSWTmdgD=JTw0N` t-  \0l& 04Xf\% e="ln"@Kli @Ki&@x x7pp7HJw2,T(q+c2,T(q+c+8,</E3@t1e66;xs;t+D,@/@1X$+0N$+|N1HX+HhlJXlJXu4*u4*0*V|-RV4 A0B1t) ATB1|)q - T= @* TTrDX^:w0"Pw<-wt2w@E~!q@o}Dt -0,}yk-Q+T,X/ T@* Xtm~~*T$0"F9 = T@* Xx\],t0{\u{|u\ .d@,//000P X ,d(F-L|-//00Z:_/qT@q@qT@//00//00qx@z$H?$ ?qxUq7tF6Pc6T`8K@JOZZLtrm+^D&6ux@cy T@* X T@* Xq @- = T@* X T@* X T@* XlXs/x~'e~<<q T- = T@* X~'e~<<2,2,ď0LďLw0zďL(qP@^PQ T@* X<aaDLoT mxmxy09)mL=NmL=`Zm0=DZ T@* X T@* X)4D y T6Xrj 0O|B0rsCB0rsCD o q@q@3y )4 T@* X T@* X T@* Xq 8- |= T@* X T@* X T@* XXBQ8Z dArq l- = T@* X T@* Xq @- = T@* X T@* X0"$ q P- T= T@* XcT=)= T@* Xq P- T= T@* XK6364BB T@* XtG&tG<&J@7J7J7J7q 8- |= T@* XXLG|Lcp\pZd<c|yT? T@* X 04`q 8- |= T@* X T@* X4Bq <- = T@* Xq D- = T@* Xq <- = T@* XH?Ą ?qxUqS@$m\F<( J(71X y\ 1T y`  y T y h y hT y nPBnTB78~78~4T y PPQ0TP0X\11t2aPPM LP<Bl5-V,D0\DP7|p7@H|p|J|wH8| @4`B<l5-HVq 8- |= T@* XT``G'B0l5-8V T@* Xq <- = T@* X42D, T@* X,DTCx"`@qBDl5-HVmH<m T@* X T@* Xq\@\D| T@* X00> T@* X tq 8- |= T@* XBl5-VBl5-VT*hn @x :n Xx 3 t30"] 0> 9\`  hM  hNd  d `  L 0 @& Xf& pqMhɼ8U`hɼ<Urh ɼ<U* `* o* o+ * toC+ * \oC+ p* `oC+ N 0v N 0v p1 s1 w2 1 w2 1 w2 x1 w2 |1 w2 @1 |w2 <1 xwN `v1 w 01 w1 pw1 HwN v6  $ TK/$ Xt? Aա00#F808CF8q @- = T@* X8CDd^TrDX^TrDX^#'7,H$q - =q <- = T@* X T@* Xq - = T@* Xq <- @= T@* Xq @- D= T@* X T@* X T@* Xt} N~ l2~ ~ l2~ ~ l2~  08 $8\ق ;EɼU~ 2~ = 4 :~ 2~ | P:2~  T@* X T@* X   L  Ph T@* XaݵaݵJ y d| NT N" p.W hJ F Dhz h< pD D T@* X T"X | 0|  D lD Dz 0<q0@z <<q@ K W$$$  \x @  61 D (6X 0 NX 0 N K W K W T0"h 8q@T @r djT lr Lj 8i84 0 0u pu 00 0 0+ +V 0qH@/4}/hV'8"pd 8[d [PD<qh@ 0 B$P<X? jx| ˔?˔|?Jlwpclcl 4Ud 0 0 0 0 0 0 0 0 8 rrLc\V q@v H{i:^! <q D- = T@* Xq @- =/ :/ _0 . 1 .  | DВC | @ВC-l4 < 7 \/qL@s7 < d8 8 ; 0u< \k T@* X/ }/\/ }/\e P PZq <- = T@* X ? ? 0? @ A |A dA 0,@ @Dr ,@ @Dr ,@ @Dr ,@ @Dr @  L 0 L 0 L 0 L 0 L 0? @S @S @? DC?  > = TZQ= h TW> hZ T:8l 04HMMKiJ] ^ SZ T0h"Z TZ x!c[ TZ x![ TZ x!s\ -q@q @q@ T@* X T@* XQl ` Ql  Ql ` wz0} hNDCDp^TrDX^@CDl^TrDX^ } [ } [h} eh} eTrDX^H?\?  q X- \= T@* X@ ݵq D- = T@* Xq 8- |= T@* X T@* X0e1q @- = T@* Xq `- d= T@* Xq D- = T@* Xq @- = T@* X<1Jp T@* Xf 0`f 0`֨ 0V  = = m 4T `) NNd-H- s= xf;Px>J|l B FyN0N8X 8 4 0] q@q@q8@ql@j `]qL@0(4$  0 T0X"0|"\ 0`k 00"0x"0"0$" 0`k x 0"0p"00"0x"0@"0$" 0`k d  f 0 P: 0: 0NP 0) ) 0 P 0) ) 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P: 0: 0 P 0NP 4j H] 4,j H]Q 4H 4  4  4-HQ 4HQ 4HQ 4HQ 4HQ 4HQ 4HQ 4HQ 4H 4 Q 4H 4-H6  & .& `2& @29& ,.& T2<q @- H= T@* Xq <- D= T@* Xq 8- = T@* XvxbIx DCDp^TrDX^HCDt^TrDX^vxPbIx\ c8 SP: P: X: : xx'4"986 | 0 T@* XB pyB ;P>J,uE 0uE 0uE 0uE <@uE L!dxx T@* X T@* X T@* X T@* X T@* Xq `- = T@* Xq <- = T@* X>t "e J T@* Xq D- = T@* X T@* X T@* Xq `- = T@* Xj  8 T@* X T@* X~L! 0$q @- D= T@* Xq 8- <= T@* X T@* X#0'7 04H7U;P<] 04XG'hV'h X d T@* Xq \- = T@* Xq 8- = T@* X 04Xq @- D= T@* XppGTT~{T- X'v X'v@L 4, T@* X 0 |} NT} N#0'7h d h d h d h d y y  |J h 0 T  h d h d | dВClsc0O| 8|aa|aaNXNTrDX^@CDl^TrDX^TrDX^TrDX^TrDX^00"$0X} dNA0Œ<y dJ Ph=>lMyOl45>f|} NT} NшDM`,`XLHLH(qP@$0YW|~8~lh<AZ]0;a-;0 a016 TrDX^Pb$Pb$P? ?qUqq@q@x@q@xq@x,q@xq@xq@xq@աPաx0x0x0x0x0x0x0x0x0x0x0x0x0x0lccoq@q`@#'7:w"Pw-xPVx0x0:w"Pw@-011:w"Pw0-pC\]C`Cq@C`Cq@0C`]LM{ LDM{H LM{ HGe# ~"  " #P<#<%T90"|@<@<-052,D#<a#<a9 qX@q@q(@3/&e# ~@x@x7L8h748< 04H:lqq@ 04H:dq:0<H<L 04H?lqq@=LegNw=LegNw?Tq?`q[ALAhY[A`AhY 04HODlqq@ 04HODdqD0FLQFh FxQF 04HIpqq@ 04HIhqH0ITqI`q``` ```X`T2,2,q|@9q@q|@9q@q|@9q@,m0^XmwBdhvPd^nH,m0^gp,m|^gp,m\^TO$@P#pKq@p q@ q@(} q@v q@p q@p q@|p q@Mp q@l q@l q@|l q@Ml q@q4@ 04H 04H|UĪ4k4UĪ8k0"q@Q4tAplGAp<GL#<L#<ApDGApGAphGApG9q@<(L|llD q@+>$[9q<@  $  $    $$@@@%(  $  $    $  $  $  $  !  $  $""  $  $(  $    $!````%J@% !%    $    $% $L$  $# (  $  $  $( !1!##3    @`BJCPPB@ D@ B B0@0A0a @H @@  @  $  $  $( $(,  $(, 24 ! ! !  "" HL  $  $  @@@DDDDDDDDD  $          $ K II   KAA   srrrrrsss`` @  ss``rrrrrr  ss``rrrrrr       IIIIIIIIIII %%%%%%%%!    (0  $ FFFBBBBBBBB   ))))))))))))))))))))))))(       $  $ f  @@@/@`@` P        $  &!$'&A$$ $$$$  F C'   $  $ #))")) )B9B9F8F9@8( @@ $  $   5!!#!)  @@@@@@@@ $ $    *  000  $ +//  $ 0$6450      A0&L1d   $  $  $  $  !  $  D  08( 0U0 "4  $,0 K@K@K@K@ @`d$   $(, @@fff  @  @KPKDKAKHK`KbK  G`   @$(,0$(08         @@ IIIIIIII  L  $    ```$$*@8*(*$* 0*$* ̅* ̅*** @ 0   $(*$*2 !C (* ̅***$** (*(*(****** * |*(*(*(**l*(*,,*p**(*(*(*(*(*,,*(*DD*(* * *(**(*(*$*(*  $(*(*(*(*(*(** * * *(**|@8*(*  !#((**@8*@8*(**,,*p*(*(*hh`* *0,8*00,8*l***(*(*(* E$*(*  @ *(**(* ܅* ***(* (*(** @@a!@B  RJ(*@8*(*(***(* |* ̅*(* |*(**(* ̅**th`* * * * !!#!#$* |*(**Ĥ**4******(*@8**(* |*(*(* 0*(*(*PP0*(**@8* ,  (*(**(*4*(* **88@*(*(*(*l*(*@ (**LLd*(*(* *(**(*(*(*@8*(**@8*(**(****l*  $(, !  *l* 0`($ " !  $(, Ȉ*(* @ @8**(*(* *l* 0*@8***(* ̅**ԅ*l*D*(*D*D**(**T****P*(*l***(***@8*(*X**P*(***(*ԅ**(*(* |*(***(*ԅ*(*(**<<< 0*(*P @**(*(*** ((* |*` ` ` @*@8*(*(* *(*\*(*  00AA* |*H*(*8܍* ** |*( d*<<ȉ*,$ĉ*(* (*ԅ*$*(*  $  $ **(**Ȇ*(*xD@Љ*D@Љ*ԅ** (* (***R0,T*(* (*4*tl*(*  $(*l*4lh** !C *ԅ*(* D@̉*  $  $PL* (***T**@ @*@@@@%```@tT` ̅**00*ԅ*  $(*(* @ @ @ @ @@l*(**(*6-RV-R ̅*(*l*(**ԅ*  $ 0* 0*(****\*\* Ĥ*(*j *$X*ԅ*l*(* ̅*(* **D*H* *ԅ*(*(* 33330003 |* (* (*(*$$*$$*LD**0h\d*h\d* * * |* |* ܅*(* |* |*,\X\* *\X\*8\X\*  ` *******(**(** * * |* **(*ԅ**(*  $(,(*(* |* (*(***(*  **ԅ* ؅*@8*ԅ*(*(*(*(* s``rrrrrrrr 0402(*(*  $ h``p``p0`H@(*(*ԅ**((**004**004**88h**<** **4**$ *TT؊*xh`* *`(*h`\T*  $(\XH* <8*\XH*<8**( 8*l**\XH*<8*(**(*<8***l*l* ̅** ؅*(**(*(***(*HHh* ̅*QP(*l** |**(*@8*(*L*(*L*(* (**@  (*$*D(*T*(***(*p*@8*(*@8*(* ؅*(*HD**p***UUUU*ԅ* |*@8* -   l* (*xh`*(**(**(* *(**(*(*(**(* *(* !@  *$* @* @* |*(** (*$ *** ؅*(*(*(*(*(* *T*\ *ԅ*(*hH<*(*$H<*lH<* * *ԅ*(*ԅ***(*ph`* *,,*,,* # (* 0*,,* ,,*$ *l****((І*"  * 0*(***PP0*ԅ***80**80* (**  $*(*(** 0,***(* |* |*$*$* caC 4I"4I"4I"4I"4I"4I"LLML*@8*hLD*LD**ԅ**@8* (***@8**(*$*$**(***   $  $  $  $  $  (,  $(,0  $(  $(B    L 0`D`D2"184 @@@@@ E    1  @    ---)))))))$ @@     @   W  H2H"H"0%  !     @ @@b`   0000#@D &0 A-pB )     &  Z ZZ ZZ%    & U UU!0   $ '''''''' !!!! 240    $! )I$$$/$@0%H ssccccc  @  $" @   !!1399'73 B',(,,((((((((((#1.`D`D &# * H@ @    @@   '  *!````  ! @B@D @@2r@ $,  $   !C     %% @@<< ,  UEEAAAA @   @  @     (q(q(q(q(q(qAu@t    //////?@(@ jjjjjbbb@@j "              @-RT-R:   ` OKKK     A!     (    @ @ ssrrr``rrrrrr@@:%  == ==0   "DH  !  !    # C @@  "H"H H H H"H"H H H               8  c! 0(     )))))   @|\@ @@   UUUUUUUUUU   @@@TPpP P UTT B@  @@" 08   "22$, `@!!  333033  @@@$&""    U    ! !  D 4 B #" 3 !!I&SI&SI&SI&SI&S#8 %$(!C!C"$!C"$5( 8`D`D  $ (*++Q)(* & "  IHHH@ dDfDfDdD`DhDhD`DaDaD  B` PPDT@P P2X UUUUUUQUUPUU (*<+<.< ``` H@+_2_2_2 * @@ @@`A@0@ @ 5(( DFFDD 0 ( J   @** cccccccCI  @@@@@)U@U @@@`@ @!@@ NNNNNNNNNNNNNN @AH$ UUTUPU@UUE  )  "      #### @DDD@G  K@*0HHHHY%% J@K@ K@K@K@K@K@K@K@K@K@K@K@uuuuuuuuuuuuuu AyyAAA AAAAAA  @@@  (  P       EbX,Z    H 0   ,  ?/@_@@@ 0<````   HJHH"0  ((,((((  -mmeeeddD@@DDD@@@@@  GGG G    $&AAAAAAAAAA 08<>????? @ A    !  ! @&' Q Q0'  ----   PRVVVPEPPX   1 00 ('&@$  `ph $eb     II  ZH` mmmm  $$$     8  TPPPR$%@X@!C^@\@L( B  @@ %i$ "@&  5((5((   ''    @ @ @ @@@@@@ bU@b@b@bQ`P``@ ;@  "***"$$$$$$ ssscs`ccccccc%!!a  @  & ( @*@*"$ 'H(X(! 0000 AAaA@( Aap         @@ ` P    <qVh%p1%`1%P1%P1xx x6x 6x 6<NU 94B8Be@$4,P;N$l_$X T%|(0I(pI(I"lW"W"0Wd+#z+d*,,,8B,0,|,B[/N$_$ /#,45 [68X'6P66{r" : ?<p:p#0#4"AHQL'P(0I/#,4"0"8y>d7XT ZxP0hP|::\$RDdfDD:\"j0"j;j@0m0#g|j@0mX;j|;j/h#,d_$ Lh:PJlr4hi7XS> "#X#d":$X:`ydyt*y%['%YLf*.TzPzz#` #@F`K#t#x"S>"""0#|zX:X:X$`hY1th\Y1ht$lY1<t|1{|1{3L43t|1{DXM%PG`z?#@0{=UF ht7h0Y1HtN$\_$H T%h:R:-j\ ,&z4X=0AdDD\Kr"P \HKy6x#_)r6PbO<y6,N"4Wz+*ɴ<pb;}ɴ<p^Db@HHs_)Lrh00N0:0['8:LL:0L_$0 _$x Jl0444M$ZK=6{0)3D'\S>" 3''lsx!`|K_)dr_)r_)0r Yl#Lg8dhVg$xTMlghTUlghq <- =2 ,2 ,2 ,q H- L=2 ,D=Dh=D=D0^ @* /X:{:0H_d:l,T"w,T.w,.l,T"w,T., p.p..`..|.4:/D0D"qD@:/D0D"qD@I1n0G.1w'7H?7?747<U7Tp7pyX9 o9\ 9':::W:?x )<P? 04\v|Hl8|I4[9I`JFSl XS=SS|S0S6(Q\C(QCVL_Eqx@q@=]^T^X^P^bX] 4ldddddf8ff8 q@`T^=]0o;0o;0o\;8p0*8p`*8p* 04Hz0{|trw*qP@LCDx^,4gXylrwt*tXylrwt*܆ G*U1ߎT8ߎ48A44PPYϏ psQ0]ʓDq@|%ʓDbl-s rq@PscOPM\ВC\ВpCZʓhq-ZTʓlq-Zʓhq-ZTʓlq-HtW_^q@3p3 3Ly lLy| Lq@q@q@ 0~ H~|UwPB"h+q@qh@q@q(@gPrx Nҿ@XYgX$@XYgX"\|g8{y@[XJy@[XJ 816g<B{40ɼU`DY`DɼXUDYrD ɼXUDY9DXɼXUDY9DXɼXUDY`Dɼ\UDYrD ɼ\UDY#DɼTU`hɼ<U0Yrh ɼ<UPYDYۼDn ɼXUDYۼDn ɼXUɼpU(lɼXULEɼ<UY?TɼlUYTɼlUpIIIXGLqP7oglɼhUlE==L=``P`*|:N<CPPFlp8l8004.0h|Ka`,a,Dq`@q@ tXɼ\Uw T;;\;70*7*74* &q|@q@0&q@q@0&q@q,@0&q@q8@X&q@q @P&q<@q@|&qd@q@U0wB?%8 u%h&hUwd\Bq|@&&p0$PL&h?*U`wLB<a5@>$<q@4L?#0`"hEU0wB$@Lq@INp$L&R=&R=&RL=VQd"?"?T0 U.ULg8gd@cPgPtg ~ $~dpcgh0cdh0cd  i4q@e0ci)q 0- l=xSH\H~hS\~cdcP`L^=]{xdP|1JUcrВCВCВClx5th0N 44L! 04\Cp 04H@h{H@Ԭ{H@{H00ITIxItPt В Cͱ<H$$@h{Ht|xВCt|xВCͱ<H$$cdi,:i4Lc \i4@h{H;;;;;\;0*@**WpIWIWI]0;}<2,0"PHM$lLHM\M\lzq@q@q@qq@HIQ3`q|@g 1Tq@}df U.U1TL6tq @UwB+#PB#X*\DD5%F>$[q@5%F>$[q@%0Z%U2,.0 Z'!qp@},;},;},$;,l*,*,*-hI-|I-I-;-;-$;-t*-*-(*.lI.I.I/0 uY0`S9hS8>{`>tk>0%44PTY803#8@a#8aJL5dq@eVhq0@q@FTZ\fQdLl$iK @\t3ȇTZ|IIȇXZIIqd@>$7% U<w 4Bqp@d%q@Ӗ=Ӗ=ӖL=q D- H=Ş#rDIh 8`SSU<S:TaUdG :aХYХTYĩ d//:/ĩ d//:/@$(g<g<pgVg@VE.)))==L=|x:D\hD=\hD\hD\hD\whD\hFpNF E.8\|Dd<~=3)=3)=3)=3)7U7U7H(d$<&$Al|Dlա4ա:ա4ա:H|8|tM$lIl x <ɼ8UɼU ELHZz\z<\z\c00Eɼ<U88Url 8@Ӣ0D@h(););)\;,4*,p*,*6;6;6\;70*7l*7*8D8hQ7pp8Tj8dQ7lpP <\\\l%`.``#%`.aa,X1ePVRNV=ePVRNV=j4kt>k (lP$(l$(l$eVXRNVd=eVXRNVd=Eɼ<Ur PJw|H`H8|wM-X8x8 =LnwMnn8OV98$L3ɼU$ElohPoDjH8|I0Ւ|uWbvp wԤ@|wͦxPwԤdwPwԤdwʣHswwgՒl|Ւl|ۑ`0wwۑ0(TwTGhxB:TGhxB:q 8- <=*K, `4xPEV'@9xLBV'0;W@8`WpH*h>@2$W9tV9V9|V-@_08U&8U&v09.$|0::D 08H`3=70U7Hpq@7<UP<70pqh@q@7pp7H7<pH83H3H30J 44L0J 44L0J 44LSaq@:xaq<@q@q@qh@q@(0c(c(cm<$|Tm6  "`q*"`,qCC6 , ;P>J UL8H Pz6`0^=]q 8- |=nh<`|d F8|Dq@F|l*DFl| &h] 04"q4@q H- L=)$}q <- @=)(}l00 6 +6 +l00 67`50 4l00 t9x/Sl00 9 `dl00 .- .-l00 [3@I/Sl00 BB `<^=]`x^=]`x^=]UFP{Chqh@l0< F0-[3I|M 04Xq <- =Q `0^=]q 8- |=RT!70pP,<=|M4 84\q \- =_<aLX6q - =7XpP<k)q8)q/q,5o]#'7vuvpy,iy+Kz'z@={{y{ y{ y{ S&n|xKq 0- t=HO0~T X@* ~T X@* ~l p@* ~T X@* [~Ox$[~@OxDž\Lq - =q <- =|#'7q@5A\uAt`F0D` ݵ<-l99L0<"$$q @- =V'\`q L- =~@S/ ݵ<޲`y $q @- = HO&njP&0nO;;\;0*l**8D.x3x3q@x3x 3A0d\0i0==RT:y=xR)PEt.rX 8XrX n"="d%`rdI,*.*.I,* .+hs4t0:q@q@CD^J,o},t -,o}ht -0,JhotUo<(~|8q @- D=qP@= R=R)PO~T~o}tt -d,GT~cT@'{T-eD0N-q D- H=`0^=]5L,5$ ,8#0@X~0(HT`d{`u{u{uoT& .///00Yp1000Z0Z NNXm / 7 ;XF220Fq|@ 000Z044qP@q@-h%;%;%\;%0*%`*%*G=dG=?lqD.q.LTrU,A!X3qXXKYFYYLGv0\p.\.3h?3\nL\n`\.z0zzq 8- |=lhsUwBӗ,/K˟?ճ2 L Է"\ C udq@ 0k`9)D0q X- = 9y -!L|q= q =  M46<6Xo*[eS1<|aĩH d//:/4 \  q @ 03b LQ8ZX,Gh<$9<)8`L-LBq T- X=:_*|[eSedS*|[eSeTS*|[eSeTSĩD d//:/ĩ0 d//:/q@q4@ RyyT?,`q p- =q@&;&;&\;0**X*ˑ0ˑ(ˑ 0,(|a20a0gI09p.$|f8: X!`HyM<Ar rL25-Vq 8- |=^ HMH?\? d1#'7(m($7/(:$@B0l5-8VCB0l5-8V,Dq 8- |= H`H8| M~  & X` x` ` OV98$ $$ 3ɼU$E* loC+ C+ C+ h* PoC+ ( jH8|0 0 |  2 bN v1 p w2 @1 |w4 x1 Pw2 d1 w1 Pw2 d1 w1 Hs1 w1 w" g l| l| `01 w1 w 0o8 (1 TwI TGn hx :A ,!A <0A T0tm$HP8|b "q H- L=@k @q H- L=@k @ 8 $2~ 8UXɼDU8UXɼDU8UXɼDU8UXɼDU8\΀  $8UXɼDU8\΀  $8UXɼDU8UXɼDU8UXɼDU8UXɼDU8UXɼDU8UXɼDU8UXɼDU8UXɼDU8UXɼDU8UXɼDU8UXɼDUM8ɼ<U= `hɼ<U= rh ɼ<U= 0T'=  6ɼU4EC 8O~ 82~ <@EɼlU= ,= HɼU 01qH@CBrdS0I0 0EɼdU= $a aݵ$$Z 4B \:J 4>Z0ʓHq|-t p> P*s s  K W_ ,  K W  K W} %4XP ` `R 0cX 0, 0 = V'<! "P<qL@q@% Pix) jD. -. .  -. P. p* hri)cO2 0ВC. d-v t{i:p" 8%n ^n T%n no gno gno gno gno gno gno gno dgno gno gno 0gno gn T1JhhCD^f  H=4 LHm |z Az Qf | Lm R D . |f ר @ j K dP 8m Rm Ri  j |Ej xsi j Ej sn 01J<Y h+ 0 hY h+ 0D hn 01J<~g 0p  0 ,m ~g Tpy |z Az |Qy 4|z hAz Q 8 \~g xp 0~g 8p n 1J0n 1J0n 1J0 .6 Uf rSI rSI rS\I\ @ A y  <1q - = <16 j T j Ej (sr "E $0,@ $Dc@ 0vk 0Ej dsc@ 0vc@ vK \cDL 0L PL TDL L L S 8}k PEj sDL 4L DL HDL L L  t(]  Ej Psk dEj lsz $Ej $sz Ej s1| K1| KEj 4sk Ej sEj sg g | td |  Ej s g \ \Ej \s Ej sg Ej Psk dEj lsEj ,s ," "Ej lsk Ej sEj Dsg Dg | tEs (| @ (Ej (s g  Ej s Ej sg Ej lsk Ej sEj Ds D" "9@O<Oq@q @- =a =f 0f pJQl Ql < wz8HCDt^q|@q 8- |="`q J | ; Tf d`f d` <1Tq@j 9Kiv ?GT`~cT8'{T-GT`~cT8'{T-GT0~cT\'{T -GTD~cTx'{T-q@q@\0^^ 0 0T"0x"0"0x"0"0D"0"0"0"00"0x"0"00"0x"0"00"0x"0"0"0"0,"00"0x"0"0T"0x"0"0T"0x"0": 0 )$ ( 0) ) ): 0: : 4: 0: : 4: 0: : 4 4   4   4   0`yNdNl 0`yNdNl 0`yNdNl 0`yNpN| 0`yNN 0`yNdNl 0`yNdNl 0`yNN% bOp:t<:"L  4$`0^=]c8 TSH`8|dx; 2x x:w"Pw-6 ` d%6 | 0gD -uE 04!YH 0`X^=]HZG'LJ hphNQ tHH8|vT HݵP <q - =V Dq @- D=bW KGX ; \X ݵ@q @- D=bW Kq @- D=bW K| A^ b| ]T#'7En En pEn q `- =En 0o]P T؅ fq D- =  <{ `0^=] Oqp@، @F X X @ X @  ; 0< 'h 4 X$  h  `h 4 X$ H ВCu0ВCВC`L^=]6  0M@CDl^CD^pCD^pCD^pA4,,60MlyOlS>,8N9Aq:#1L N8N<"x 04HI0&q@q8@IP&q<@q@I|&qd@q@"x  04H\HZא;;\;4*p**GT~{T-q@\1ĩ d//:/(:q@S,CC0"$x0:w"Pw`-x4x4+z4x4x4x40111  \ @ 99qt@Q9q\@L( y L) y 6L6wB{;L6wB:@L6wBDP6wB ;k66q@IJ0wIJ|wIJw?k{;6q@gN0wgNwgNwBgN`wgNwDk:@6q@T0wT|wTwHIkD6q@0Y0w0Y|w0YwشW9xq@q4@q@q@`x2,2,`02, 2,q4@q@q@g0q@4q4@q@q@g0q@4g0q@4nH,m0^q@Pd^l#Nr1zrqP@mMn0CnxAp4GlqtqlMAp4GlqtqlMh/ KcTncTbߥ0c\JG!P_U10h"qh@Q<0\"q\@q@#D<0"q@#D<0"q@xGX,9q @m0Mn8Cn|m0Mn8Cn|#@<# K#@<# K8(L(L#<#(<#D<#<#P<#l<$(08<2B  4 B 22 2.`@*@BH`DP @ I!  &"")1 00b0*ZZ%            IIIIIIIIIIIII NNNNNNNNNNNNNNNNN@@@AAA@$@  ! 0a aaaaa B@ 8 ``P$4 @2LLlnMLLB@%    DDD]]E A@@QQ@@@@@@@P@@@@@@@%%%%%%%%  @@(* ؅*@@*HD*8܍* *(*(*(* *$*$* 0* 0**(*(*(**(** $   * * * *p*(*,,*(*(* * * * * * *l*l*(* ܅* ܅* ܅**(*(* *0(̆* * *\* *l,,*(*p*(*(*(***$(*T$*l** ܅*(* *(*(*@8* |* |*(*(*(* ̅** * * ̅********* *(*(*@8**(***(* *(* |* 0*(*@8** (*(*4**(*4h`* *@8**(*(*P 0*p 0*@8*(*(**(*(*@8*l*(*(* ܅*(*(* ̅* ̅*(* (* ̅*(* ̅*(*004* Ȉ*(*(**(*$$*(*(*(*(* |* (*(*(*@8*(*(**(*(*(*l*(* *pPL* 0* 0*(*ԅ*(**** ̅* ̅* ̅*(** ؅*ԅ*(* |***(*(*(*(*l*l**P*(*(**(**(*(*(* @`   <><!<> (*@8* (*@8*(*ԅ**(*@8* xP`x$x,x(*(***\*(*\*(*4**(**|@* * |*l<<ȉ**(*,<4*(*40* * (*$*(* (**((І*0,T*(*P**(*<*x(** ̅*(* ̅*(*(*****܍* *ԅ*x(0*(*ԅ*(**ԅ* ̅**(*x88܉*(*D@* *PP**l*ԅ*(*(*ԅ***(* 0* (*$*(***(*(*(*(*(*(* (*(*(* *t 0* 0*@8*(* |* |*l *(*h\d**d`X**\X\*\ȇ*0,*(**(*ԅ*(** * *D*(**(****(*(**(*(*ԅ*ԅ* ؅**(*D*(* * |*(**ԅ*(*(*(* |*(*(* |*(*(*004* *(*84Ԋ*@8*(*(*0(*D(*L* |*\XH*<8*ld@@*,tpL*\XH*h |*`\T*$*p`F`Bh@dd&`"h bb` ha`h``@@@PTHD*\XH*<8*l*(**(*(*l*(*<8*l**P**<8*(\XH*@8* @@ *L\XH*<8*P*P**(*\XH*@@ *ԅ**(*h<8*\XH*<8**(****(*($**(* **(*|H*@8* 0*܍* *@8* |**(***@8**(*@8*****@8*(* (* (* (*|(*\\**x(* ؅*@8* BBB0*0,ȋ* (* 0**0,*((*0XTЋ*xt*(*(*( P*,,*(* (* * * * * * * @H** |*Ȇ* (* * ** ** *(*(*@8*(*(*(*(*(*ԅ*(**ԅ*(*`(*h(*(* * * * 0* 0*(* 0*(** 0*(* 0*ԅ* 0* 0*p*p*0,H*(*0,H* 0*$*,,*,,****((І**(*t((І**(*((*004* ؅* 0**ԅ* ̅* ̅*((܌*(*(*((܌*,D܍* *@8** * *(*(**(**(***(*(*(*(*(*(*(*(*(*(*HD* *(*(*(**H*(*(* 8Q9;;8X*t*@8*(*(* *X**@8* |*(* (*  ( FFFFFFFFFIHHHH@@@@H(  $B@ @ B !I&SI&SI&SI&SI&SI&S@ "H@!C FU( 4U( U( U( $0   @   G `HUUUUUUUUU #@`px|~  G@$ %   @@@@`pP 5XXXXXXXXXXXPPPPPPPPXXX- $ $ $ D"@@D@@ @     @, 6 2 7 6` >` T ccccccccc;I&I&I&<BH1d  ))))))))))))))) (   ()),b \00 C @`xQUUUQSR @NBNRNR NRNRHI+-RT-R-R-R-R. 08<>?   @" @@EU@@@0 8($##Q          ((5W69V6@@ @6cL&cL&L&L&8bccb3!C$$76    4D% % % 1  "  B !C B 2  $ B@ @ B %B<B> & (,<,-(KUU %S)II ssssssb`ccccccc " @K $ @@H@`PD@BB @m ` 0 0844tD 082044455%%%   @@@ D #D@@B`@@@` Goknm   ---)                 @ @ @ @ @ @@@@@@@ (hjz*X*@+   $ $ $      @ZZ@Z @E***JI )HHHHAFFFF -------%%% $$$ *! *Y<9<< -00B400 )"""E""""""""K@K@K@K@K@K@K@K@K@K@K@K@K@K@K@K@ )@ @ @  @G000% 0 ) *B /@`hl|~ ) Nn~   @@@ . 0   ( $U!@BB! $  (  !DD@ "   **@j &@PH`!Cd`@@!CSBATBATBATSp@@"""""""""7***|{y$y@HxZxHzz``````Y`x`<DuDuDuDuDu=LL&L&L&L&L&: B1@ D?  +(((((( 6%$I$%$I$%$I$%$I$1>> ` @@@G@$$,(PPT&Ag(4(0%t11 0Y DYx (6x 6g tT l9t B+$p`I \ &\ &\ &"8"<#p#t"B#$$@$D#X#\"$0'_$ ['l( ((K(K*84444/@N$`_$T 1/o00@0m00K58Vr" d5 ~56Xy6'66?#`N#Lk$7< O7r" 7:y6,y606PX$7l y6971{\8 5 y6$Tzo;D;kN#`k[3t$0$4$$;kN#xk[3tr" 04:0:0 ?0p"0"4#|#":0':4Y1Xt|1{Y1<t|1{(XIP0P9J1z?Ih,$09J1z?04AK0_Kq,;JXlJlJlJl"0"8#T#X""0"8#\#`":L$|44\h:\:;:G"P"T##"p=ep=7f\ "0"4#h#l""0"4##"#p#t"""zz`zz"|"##"rp4hi7X7XS> ""X"d:t:LF|K##""0"4##"$0$4$$""##"%PGX"Wh7S>">H S>L"2IxzG >, S>0"2I\z"0"4#t#x"Ld:X#l#p"N %@N0Nt04<hD,;,;"0"4##"0 p=4Jd p=Lz4?#Xz?#Z{iDDB#}6b6Xb6b6b.1h{1{#P.T1{1{#l"0"8#X#\"_$| I"""0"4##""0"@#t#x""0"@##"i0l}0U6l6{MOP|tX['['L :‚x&…$8|"8"X#t#x""X"\##"p="Wetp=|"8"P##""@"D#x#|""@"D#t#x"4)HAgT+Ey6y6Dy6Py6"8"<#x#|"Y1<tLT:L|1{1`:0$0$|BD8:0BDt:0|}< .1p{1{} t;|}…,Vx|_$0 sW"l"?p|?t|<DXAgdLLLgLgL0:x:CD=q 0- 4=D^D^0H=p%<T\2=w,.l,",X8,, d/p/:/d/`/:/1O.1wI1n0G4 B4X4i4T4d544i4L9V:Pa:`a:':;8W:^;8>':|r;EW:q 0- @= `@* d 04XAx:uB 01BTC\=CBq <- @=D sDsL(J|oLJBL$J|XL+JO|:OD PPTvT@T4n U<~PVx|hV8PV|~VPVx|hV8PV|~V\z]dg(]X=]^h^=]=]^h^=]=]^^=](=](^h^h=]h=]hO]0mqd@^=](teEe:teEep:g gT^.g@Xylrwt*syTHyXylrwt*syhH{|1Xylrwt*sy`Hwtrw|*%~H~|XTwprwx*L!x\Xylrwt*syxH wR)wR3Twrw*4L!\('.86\ʓ@ВCLy DPpLdyH y 07 h+q|@B|<hI| g,ak+aLLgLgL 816I AHP'A[ `[ o8"t|gPgtgttEɼUXY/@D/5DPXAgdL2y<[BI /0D/9 dk k k 0ks48 k 0ks48 krSI 4oDPLc``Pc`*D:NC*:q 0- 4= @* q 0- 4= @* q 0- 4= @* q 0- 4= @* H:+TPX80G_[[l8PlT80[[l8lh8`0[[l8l\80[h[l8l084tb0L8L8,DFlL8DFlx8lh880[t[l8lH808FlX8D48(8(xPQ&& (4|$ <gX`1TNX&q@qH@*<*&t&X ?#Uw$B>T0Uw$BINt$|Lq@L@L@L`L `*Q8AVQ"$?"$?1T8GT~cTp'{T -HfL:2,dafgPtPt0Dw:/0pL&Oxd=!xgq - = @* q - = ,@* 0<q - $=hƖ)lp:]H*{lǮX l fq`>lNtN 44L`Cp 04Hq D- H= @* XD>X>(>>>>Lyl x ~Lyl x ~W>L4  q@q@qL@q@qT@q@q@ <4T|CD^\Q\;P>J%D1To]K0i( 5\47\9h794ml&q@q4@4ml&q@q4@\x#<=4mx&q@q@@4mx&q@q@@4mx&q@q@@ D5 5. ?1T`dhl"lW W SsSsSsSsB_<gX`B_<gX`q@n<q@q,@S88u8`;:9;l;eq 8- <= @* S8H00HuY0``S8H0=q<@PT<A0A$Z7<Uq @- =??,J0*L,$J85P$4mh&q@q0@8m&q@qP@4mh&q@q0@4mh&q@q0@4mh&q@q0@0mh&q@q0@0mh&q@q0@m&q@q@Lm|&q@qD@]KT]KP4ml&q@q4@4mh&q@q0@,dS\&q@qd@@mt&q@q<@4ml&q@q4@4ml&q@q4@,`SX&q@q`@4mh&q@q0@4ml&q@q4@4mh&q@q0@,dS\&q@qd@4mx&q@q@@,dS\&q@qd@,dS\&q@qd@,dS\&q@qd@4mh&q@q0@4mh&q@q0@4mh&q@q0@4mh&q@q0@4mh&q@q0@4mx&q@q@@4ml&q@q4@4mh&q@q0@4mh&q@q0@4mh&q@q0@,4S8&q@q0@4mh&q@q0@,4S8&q@q0@4mh&q@q0@,4S8&q@q0@4ml&q@q4@4mx&q@q@@4mh&q@q0@4mh&q@q0@4mh&q@q0@4mx&q@q@@$\J*4mh&q@q0@4mh&q@q0@4ml&q@q4@,dS\&q@qd@,dS\&q@qd@4mh&q@q0@4mh&q@q0@4mh&q@q0@Z\hԂ,uF8`6ia6iq@hȇZII$hȇZII8q@qh@q@4mx&q@q@@4mh&q@q0@4ml&q@q4@4mh&q@q0@60q\0^^6iaq@q@HHx8|p;P>J4Pָ\ָ`c  x(1U80=xX`T0wh@I))))D%@zNX=kNH08|DHL8| %8zNL%8zN%8zNT%8zN%0zNH%zN,P|8|0L /  pgEɼ<U 'HB`O?Wf0BdĩP d/\ /:/p 0"*lbH1b 1 g gɼUEr ΅N-|`H$8|r  gɼUEr 8UHɼLUrt =Hn\n$8ۑX0u8<lpludՒ|llutՒ(|HlՒH|Ւ|Ւd|_XRɼU^JDwx @ɼ<U9|Xb|1DjH8|_@DoPo֜(4oȩ`5:wwqՒ8|l<wvՒ|h`=?SS'y'y228Y4(rbO0V989O0V989WL^l;WN p\$N< Dp_m,,e@t_M5|b`|YH  $/0X\XXPq@KiH8|0^#'7 J$a\FqP@F8|pZp`hd 4 -x%tO V9:xaq <- @= @* q <- @= @* q <- @= @* l00 :1n/dS/Sl00 :$ `d<< l00 #; /S/HSl08 :X_<a:@X`<^=]EIq L- P= @* q <- =Q q 0- @= 4@* 8q L- =:$ `dq L- =:$ `d#; vP(MT( .-q - = .-]lJ'q 0- @= H@* LD$s)FP^F`^6s2yiy+y4iy+G~HDG'[~Ox=xR)PH8|\^^dLCDx^6   q 0- @= t@* x{,:2 :#0'7P.<V'"`qIDII1qSq0Sq0e e dPzh6 44\F|^l2q 0- <= @* /0\q 8- |=qx2q - = @* q d- t= @* q 0- @= @* "`@q`< Ţlq 0- @= p@* t1>l2$Wq 0- <= @* q 0- <= @* q p- |= @* q 0- <= @* q 0- x= @* [D8t.xt38.80.x3xl3@txD3xh388.SWSTW\8LP<)OX<O<O<O<~SWmL]]r0 rSI AuA `q|@Pt<1X+,/3<p0^^=]0^^=]0^^=]q 0- 4= @* q 0- 4= @* =l]op(aZ~8+~ToJo}ht -l,rHrL(TGT~cTt'{T- pK4*#P0Xչչ4Dx|ݜX\xtKKĩ0 d//:/xD{Tu{tu{u{u0o &` .x2(jjuX X:$////00//2q@////,,,068r9$?03Lp@@@P@L39L)3LH0CD\^rD^uP_ O^"1vuH_O^"1v46rL@lsq @- =ls/<xq <- =XEIq @- =3qD@q 0- <= @* `dhl'lU U SsSsSsSs5Œ <Kb$Y{HtH+;P>JpHZאt}:0_}06Pt6t4394)<ql@ |#RlBu`39)$BQD8Zq= 6oqt= q= q= q= MBBBBQ$<Qd8lZP.l6@lQ6D@h@q 8- <=3q - = D@* Hq 0- 4= `@* dq 0- @= <@* @q 0- 4= @* rr(XG8D$xX$G\0;Q8ZXG\;Q8Zq <- =uh`q 0- 4= @* /4.0/<0XP00 P0$q 0- 4= @* q h- l= @* :9<L:0$<<Hg<l<<8<\4 BAtr|Bq 0- <= @* q 0- <= @* q 0- <= @* q 0- <= @* q 0- <= @* |SHS ,q <- H= @* q 0- @= @* q 0- @= @* q 0- @= @* q 8- \= @* vv$Et<Eth mh,AZ ggHHa];0r2h a$( P<$`S$Ghpp4pq 8- |=Bl5-V11q<@q H- =<|4 ]( N~   `  X0 ` <2 l2 pl d |2 l2 l t (|2 Hl H| | d|(' XRɼU`' ^JDwx @ɼ<U9|Xb|1( jH8|( @D* o* Po* (* 4o}7 `57 :1 w1 w9 q 8|2 l1 <wN v6  |6 <CDh^U !70U8D8XQ7`pq @- D= @*  08 $ 8 $Ą T2p1l% 6ۼPn ɼ8U= ق ;TU= ~ 2~ q - = :ˉ = <gX` @ h  @ h    \rdS0I0 ʌ aaaݵ7DH0"$7DH0"$7DH0"$; .; H.l el e0X  tHtt|thz < ,D D D K W& , pl5  , Lh   t -t - Tf8 f 0 L h ( 04cX00"$0 T0R c ,V Pq@c<  pJ L xYd [ H   0CD`^rD^0CD`^rD^=, <=,  @* Q2 Tp2 ВC2 ZF6 t6 5 l7q @q 0- @= @* B 0RFC L6D dD Y7I 0I XNJ lJ :[W d w @C R~g 0pi ( j 0Ej ,sno gno 0gno gno Dgno gno 0gno gno g=z PT|z Az tQz  . 1J0hCD^> Lf |z Az PQƥ  8F9X99Tl,T"w,4.w,.q$7q 0- @= @*  T,m ~g p~g p~g 0p  0 T T/n \1J` T/n \1J` T/n \1J` T/n \1J` T/n \1J` T/n \1J` T/n \1J` T/n \1J`9 T;n h1Jl TMn h1Jl1 T\n h1Jl7 la6 U7 a7 arS\I\ W> Zq <- =f f <2G 02G jG <G c@ v"E 0K c@ 0vDL LL PL TK cc@ Lv"E T0K Tc@ vM M ("E 0T DL L L K cS H}DL DL LL PS 8}DL tL lL pM M ("E 0T ( פ z פ zz Ej sk Ej LsEj s1| Kk Ej LsEj sg k Ej `s 4Ej 4sk Ej s| # | # Ej s "k Ej DsEj sg k Ej `s Ej sk Ej s|  |  Ej s "k Ej `sJpKi6 0 |H8|6  0HD8|| ,x8:w"Pw-0^^=]; Lk0; k6tLYxb4r ]l\0"0" # ! ! !  8 <Q Q ( 8j ] x,j ]/<0 "0 "5[ <UwB\X^^ X0H"0|"0" G0D"0x"0" G0"0"0"0,"0X"0|"0"z n 0 P: : h 0 P: : h 0NP  0 P: : h 0 P: : h 0 P: : h: 0: 4 8 0 P: : h 0 P: : h 0 P: : h 0NP: : tQ 4H 8 Q 4H 8  4-HQ xQ 4H 8 Q 4H 8 Q 4H 8  4 Q <Q 4H 8 Q 4H j ]Q 4HQ `Q 4H 8 Q 4H 8  4-H P ( T>2$HW0^^=];P0>J<;P0>J:w"Pwt-vxbIx 9 ld: L: 0: xk; Xx; 2x6  Hq - =vxbIx :w"Pw4-q D- H= @* xvxbIx xTEqEݵݵq 0- @= @* q P- T= P@* Tq 4- 8= @* q 0- 4= @* q - = P@* Tq - =  @* #\'7 J~ ! po]tX po]tXN50{58^00CD`^rD8^ .9  <9 8lP5ǻ tB L Zǻ tBl(5LZ0CD\^rD^0CD\^rD^00"$0H?\? 70U8D8XQ7`pV0I^XL2$Z[[PJpwtJHwL"|  04H|yףLmI|&q@qD@ף4mIl&q@q4@ף4mIh&q@q0@JdSI\&q@qd@ף4mIh&q@q0@ף4mIh&q@q0@ף4mIh&q@q0@ף4mIh&q@q0@ף4mIh&q@q0@ף4mIh&q@q0@ף4mIh&q@q0@JdSI\&q@qd@ף4mIx&q@q@@ף4mIh&q@q0@JdSI\&q@qd@JdSI\&q@qd@ף4mIh&q@q0@ף4mIh&q@q0@JdSI\&q@qd@ף4mIx&q@q@@ף4mIl&q@q4@ף4mIh&q@q0@ף4mIh&q@q0@J4SI8&q@q0@ף4mIh&q@q0@J4SI8&q@q0@ף4mIh&q@q0@J4SI8&q@q0@ף4mIh&q@q0@ף4mIx&q@q@@ף4mIh&q@q0@S0q@Shף4mIl&q@q4@8CDd^#'7Aq@q(@q @x,x,q4@q@xXxXq@q@;Pd>J0;Pd>Jy w4>+z+y<x@:w@"Pw-x<x@:w@"Pw-x<x@:w@"Pw-x<xD:wD"Pw-xx4x4:w4"Pw-x4x4_x4x4x4xxxLy Ly H HD9Hq|@#K#0K9Tq@#0<Ly &#0<Ly &`8xh<x3/0&@d/lGd/G3/&wB3/&x3/&,4<b,P@ge0# ~eH# ~htx x@-6[6q@6066p6w$B88G8G8G8G{;06{;p6w$Be=8Ge=Ge=Ge=G:@06:@p6w$BD46Dt6w(B ;k ;k6d6606?k?k{;`6{;,67N/Y?T0Y?t0Y?0DkDk:@d6:@06HIkHIkDd6D060pw$Bm<HmMn0Cn|0oTl4pbq@p4RAp8Ggpp,m|^#K#K#$K#KApGAp<Glq<qDMApGAp<Glq<qDMApGAp<Glq<qDMApGAp<Glq<qDMcbPcHc<0"q@0"q@0"q@0"q@:a#<qP@9#K#K#K#K#K#Kllll9Z\9q@#xK#0K#K#K#xK#0K#K#Kccccccccc@""-R         @@@@  ;   l*(* ̅** &  (*(*(*(* |*(*(*(*d |*p*TTt* (*(*(*(* ̅* & 0  l    A>>>H>><@ >P>6>D>.?: * *(* * (* |*(* (*@(  @@@ @``` @@@@@ @,,* |* (*(*****l*(*(**Y *40*p (**(@@D*(*******\*(*(*(*(*(*(*(*hd܇*8 *Xl* *   @PTP@ H l*(**(* 0*l* *@8*`*p 0* 0*@8**l*(* |* +Te"""""""""*(*(*(***(**tHD** ̅*(*4*L |*X(*`(*(*l* ̅*(**(*(**P*P*P* ܅*P*(*(*(*$4uPePeeEGGCCCBMM(*(**(*h*xLLd** ؅* !@B ` |*lh`* *(* |*(* ̅**x*D* x*$(*D**(* (*\*4*(*(*(*(*l*(*p܍* *8܍* *(*@8**(**$ **(*T40***(**$ **(*P40***(*(***(* "PTT "<&L<&L<&L*hh*4 *@8*(*Ȇ***(** ̅**l*l*(**Dԍ* *(*(* ̅*ԅ*@8*(*tԅ*((*84*(*h(*ԅ* ؅*84*x0,T*(*(**@(*l ܅* ܅*@8*(*(*(*(*tt,*0,T*,(*4@8* * * * *(*(*(*(*(*(*(*(* 08@((*0(*8* *L ؅*l ؅* ؅* ؅*X h*xHD* ** * 0*ԅ* |*(* ؅* *(*(*(* ؅**(*(*(*004* ؅**l*|* @* |*(**((\*(* |*(*<8*\<8*\XH*<8*`$*|$*\XH*<8*(*(* |* * +T<8*l*\XH*<8*d@@*t(*|xP* *t(*|$*\XH*<8*l*((\*(*(*T,(*P*<8*,(*(*d<8*\XH*<8*h 0* 0*H*@8* -<<<(**@8*(*!F@0000000000 0x(*@8* 0* 0* $$dd$$** |* ̅*h$$t*0** ̅*   @  l*(*(* (*(*(*(*(*      P  * * *(*(*(*(*(*(***(****(*(*(*(*(*@ @  !  @  ܅* ܅* ̅*(*  h *t * * *4(P*(** (*(*(*(*(*!!!!!!!!!!!!!!!|(*PHx* *(* )))                   7@@@   6-RV0-R-R-R-R-R 5@ 1 1@ 08<>? 50A00 08!042100 00 0000`7`6x6f6`6`>`a0`@`IIIIIIIIIIIICC3s@ C 0Y Q q a! @(!  : }% (@A '     I %//  '@`t`a` `K`@`@` '@`@ '@`Aq ( ) P PQ  -    @`@BBLbLRBLr@LrBLRLR@LrPLQLALDL@LHLRFVPPf``@NIIX4 I&I&I&I&I&I&I&I&I&I&I&I&I&I&I&I&"     0007!00@ @ %@@`P @ 1AAA#p(0(P" 0  7 @ I P$ `& 3UUUUPP!@ O @# k'@  @& /@@p@Y@P@Y@DD@A@ @ @ @&$@@$  R R R R R  R R R R @@DZB$IZB$IZB$IC D@PQqQ ;000 .-RT-R-R-R-R-R-R-R-RB ,@ <qVlVU].Yx].Y0NU88DMMxU1U1U1U1qI %#N$_$ T%)0)0)))!*;/*G*,!*;!*;"0"4,p##"0p$0@0Tm$0P0P5[5 L5<V6X'6x$7 y6y6O7974"8"<['t##"1tQ 2x"(W9$Mr" "@"D##"A4"D"H#x#|"<4['$$$$P4AKlKy_K q<,D"0"4PNt##"MhZK=6{PJl444@F0(xI@Fh@FFK##"%Xr7X 7XP ZlP0XP?# N# k6d6p{r"d "X"\0h##""0"4PNt##"z8?#H#`{d-{-(~T p=X'89=p_)r;}FK##"2 3t343|1{2H 383|43|1{2H 383|43|1{'H_)r8|:x't0@h""##"2l 3\343|1{2H 38343|1{$70 _$X nlh704T444<D"0"45##"4K=\6D{$L$PtPDN#Hk6x6{\K"0"p\K##""\"\K##"#D#H""x"\K"z46b##""0"T#h#"T%<P0LPP0dP['['"8"<2ITz#p#t"%Yf""#,#0"0LPa['t:_)pr;<};X;8};l}L@:xL4:P?q":K=,6{_)r8|h:_$ 3,$3$R`K=6{$$ 38@!`D`!`d@0@mK=T6l{p=43h//t@gtB@t:0"`:##"I<n?l|n?|<  Ag,4,4::$:P:#P=x::::#=w,.l,",`8,4 , 3`2N2"24 "2\ "i4`JwJw\z]g(],=]hO]m\0z`a0sah<daXbL^P^P=]P=]Pddd@dd^^^^h^h`@^=]Xyrw*Twtrw|*Li~g!X\Twtrw|*Li~g!X\Twtrw|*Li~g!`\Twxrw*Li~ g!\wrw*%~Hi~g~XDC\S4PY|0HL?В8CEÖ`.Ӗd:d0F4]<l8ВTC|lВlC`2Dt)\t:}H?!HwnPT!@wnP= =$#I 5 PAg,4,4g,akg"(|gdo8H oB0od(|LI| 0od"|g|ggPU6U6rP Y\Y9\XɼlUy<[BdCLId rT ɼU½@%X9`g9pgg<or k$o kq 0- 4= @*  Tb[[l8`4\;(Fl8l8l8d 0 ,, 0Fl8[[l8Y0000. $( $( $( $(aD,$0$<L&4kFWK_NF NF E. lHH8|@H8|$@|.h m/! ϭqT@.h 1! ϭqT@.h 3! ϭqT@.h 5! ϭqT@qt@>"?q@G?@Dq@@q@0"<g8x)Vgd`cfjffXddccPdVgCducddhugxo cd1J0q4@q@q8@q@e0ch0cdq - = l@* p"`qq - =^ @*  q`^=] q P- T= Ǯ(xTTII{td{`d~XMHIlIIq - =gogogog o?7     l0#8|4@7hq@q@q@\qt@q@q@q@Tq@ U|.Uq@L!q@q@q@0@HZKtiH$ZI0Fq@nq@{P,mX&q@q @64t U.U6tq@68tql@ U.UkD/0uY0`q@q@ 0161UCpB61,U1[83#8La#8(aS8p7Al7A|7A@x  aCq@7A6iB9@q@RR  *LH,S&qP@q@14N8&q@q(@,4S8&q@q8@1LNT&q@% <#=1LNT&q@% <#=1LNT&q@% <#=,@SD&q@qD@1LNT&q@% <#=14N8&q@q(@1LNT&q@% <#=1LNT&q@% <#=14N8&q@q,@% 1LNT&q@% <#=$TvC^vx1LNT&q@% <#=,@SD&q@qD@G[[@FfQ$SF<6t6iG*pq@l%) 0 4Ş#q - =%l%LSUU U UkF WNF kFWNF E.0E.UB\8=;_KiKi%hzNKiZ@t_%YK,A9V0= X= ( 0BLTHT`ɼU0BLThTr ɼUEɼHU4r 3\EɼDU80r 3\Z_@%9XV9 V9<VPY0YPYlYpYEk^8ePYhYlZpAYErP Ur 8xzO0ɼhUU~8}0"iXV|^NV=2~,* <gX`r <ootoPxvvwvwLwۑ0dhwX @gDLrX Se0ldl l 44L t1 1 1z6>2$8WfJ$Wh>@2$Wa\Z`Z(p 04H7U7UE*l\*p\*\*0\*04H,8|6 4 @o]q - =\ @* q \- x=, @* *0F| d*<q P- =7DpP8<W)q P- =qZZ !qZ(L86q - = @* 7Xpuk0"P<k\)$ %T_(/0<\<qZlZ!qZZ!qZio<+6L +io+o"+io+qqP1qSqSq@1q@G'8uhq@0111qSq Sq 4CDd^'|XXrD^} s8|0H?l\? q 0- <=* @* HCDt^6  X4 44\/ GZfaq`/q`/q)q)q <- =,F^4?xa x `P@xxxG'<Hx`x(``dP?nLj̮h S2fL\q - X= @* fhJ$ W>2$0Wxd3x38.8<.DSW\\8/}/8.SWSWW\8H=Tq]u\|ɼPU|ɼTU8|8@ pg0 Hg`h*P Pɼ8U0"80<ɼ8UHɼlUr x x LAuA`Ki"!#>#T D@$>2$W 0AuA`]B<$+0NB1)B1X)B:3B<$+0NB1)B1X)D>^ ^=] O]m0Z:d_GTd~cT'{T(-uwȧK (h D <Pl\\d,LKEK0P$3(g0hmhEg0((s;J:49;`a <h+ b<2bbLh$ail\i9)LeZZLtof[_O^"P?*?H BH˟PB*˟PB6tscO422q,@q@Tq@mxN, dE+3 X7<3<PK T;|=q @q <- @=GDx?4j O$dq - =#!$l @* q 0- 4=#!l H@* Lq 0- 4=#!l H@* Lq 0- 4= @* "$  q 0- 4= @* "$  h/`ah/`aPq 0- 4= @* / q 0- 4= @* /49)39)8HL-0Fq - = <@* @1ĩ d//:/1M8N p 04H7U7UKih h\7U7UP<7Uq 8- |=Bl5-VD   q@q@* <o* oC+ * to, N xvN v1 wN v1 wo8 1 Lw 0o8 d1 hwX @gDLrX M8M<Laq - = 0@* 4X dNq@8\΀  $΀  $8\΀  $΀  $9`Xɼ8U΀ \ d$= `A dɼ`U~ 2~ C 0Os `ɼlU½ɼ,UHɼpU= A ɼUɼU݊ 9 <g@H} P%O j 2A T 0 5  p1Q ) 0Bcdc`duq@q@ / <qt@JpwJ0q@Jd b A < xh- D2 ` c8$c($l(-pQ5 5 \d^^= B= Bf f f f f no gno @gno gno gno ghCD^ 1J  @L  ( | .ܡ |@f ~g `pf T~g p|z Az xQf |} Lsר j K Pר  j i x j Ej |sk <Ej s@ y@ y;P>JKi t\ 1J t  ,m ~g p   ,m ~g lp |z XAz Q9 7 4a;:  DL LL DL Hk LEj xsS H}DL DL LL PK tcDL 4L DL Hk Ej Ls Ej sg k Ej |s Ej sg  $g $ Ej sg k Ej |s `Ej `sg ` @g @Pɼ<U@ ½L rP M ɼUפ zr\ z dd grP `ɼU# r g \\ tgxrP `ɼU r g \\ |grP r ɼU` r \"\ tgxrP r ɼU r0 \"\ |grP 9XɼUi r y \,\ grP 9XɼU* r y \,\ |grP `ɼU@ r 1| HKH `gdl@ f LA Xy @ d gKi8`ɼUEr S <}T "E 0G 4"E 0,@ PDEɼUr r8 S D? HC? ?   s\ <-\ K\ \ hR\ Kc] y] Ly] ] #y] q P- `= @* s EC܉ % <Pz@6JP Pz6`1J 8 p| d1 Hظ Xe Xq `^ `qu D0D" 000" T l ND\pr-  # ! ! ! x' # ! ! ! t'Q XQ   ] h d ` Q l  0Oj `]qL@q\@0"0"0"0<"0p" # ! ! ! ' 0 P : : 0: 4 8:  0 P $ Q 4HQ d  4 Q 8 dQ 4HQ ` xtxx:w"Pw8-xtxx:w"Pw8-c8 @S`xh:w"Pw-xp:w"Pwh-`4`4q - = @* "`q;P>J;PX>Jݵo]|6  q D- =#L'7X] x}?tpq<@q `- =/}/a> T T DT T T   h  XDrHW  p\Ll5j.kq@m:^X 2~HJSI&q,@q@4NI8&q@q(@~J4SI8&q@q8@~Hh8|0%xd%d0("P?"p?<((x4xxxw\>+zxx+zx q@q@q@@q@q@0P1L`y@ y 0h`1HLXy< y _U@1B,<_UD1Kc0nc0%c0bPL^TPP^XlD#nH,m0^CnCnq0@AphGApGApxG,mx^XmwApTGgp,m^r`r)4)Kc\nh h0Kc@nql@\JG\JGa.d1.D1L)Bq\@ql@q@qD@N4 mMnq@Cn88(L( L(L(,LP0|^99q@q@;h;q@q@"@@  uTUUUUUUUUUUUUU ̅*p**l*(*(*܍* *ԅ*(*l*(*(**(*(*(*D** (*(*(* |*(*(* * * * **` *l *xh`* * * * * * *(*(*(**ԅ* (***,$*Tl`ԑ*(*<*$*h`* *$4*x * * * ** ** (* ̅* ̅**(*(** ܅*pl* *l* *@8*(* ̅** ̅*(*(* ̅** ̅*(*(* ̅**(*(*(* ̅** ̅*(*(* ̅** ̅*(*(*l* ̅*4*(*(*l* ̅**(*\LL܈* *LL܈* (*hd\** *$$l* *(*P((\*xP*P*00* ̅*h(*(*(*@8* ̅* |*(**(* (*Pl*`((`**@8* *(*(*(*,$ĉ*(*l*((*ԅ**(*܍* *(** *%!J@%!JV R R R R R   R R  @@@ @@l***ԅ*(*  @@@@@ * * * * * * * * * |*\(*d(*lh`* *(*l*| *LD*(**(*(*,(Њ* *(* |*@8*\XH*|$*<8* @ @ @ @ @ @ @ @ @ @ @ @@@ *<8*X((\*@@ *@@ *(*<8*4(*<\XH*<8*(*d@@*d@@*|xP*@@ * * ****t*\*(*@8*(*P |*\(*d*(***Ȇ*Ȇ*(*(*(* |* @*(*(*(*l* |*(**@HHHx x||~^^NNLD * * * * ***8 *Xl* *(*(*(*(* (*X 0*x 0*@<**(*(**ԅ* * *4(P*P(*phht* *(*(*(*(*(*(*(*(***ԅ*@*X*x( * *@8*((*\ ؅*|PHx* *(*(*(*(*(* (* /xx@  80800' 32 +  d *aaaaaaaaaaaaaaaa 000000000@0000 ;P0 PP  PP  &      # !00((  3__S >      @$%   N @  00 @}EE  7@ TTT 6Q13 @Y   "" "!(!  ")0)2!2!0)**DDDDDD+@D@\L&L& L&L&*``dem}{zjhhhh``` ```K@K@J@K@K@K@K@K@K@K@K@K@K@K@K@K@K@ 1 @@ 8kkk kkFkFkk-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R 60 p ` @ P h aZ%cZ%h .PPPPPPPPP 7 @ B @@ @ B@  @ @ B("  eXe, 8 9 #0x xxp0xxxx#@   'UEUE`UE UE0UE"UUEUEUEPUEP PUEd+ pp``@@ ooooooOOOIIIIIIIIII   @ ;I$I$M$I$K$I$I$I$I$I$ I$I$H$I$H$I$ >@` TIIHII@I8<<<9*:88828 X `; |> # 8#M ; # >XtM+0Bz4\"H"` %###"r" 7 17:r"8 7817P:6$X'6$r" ###@;_)4r;};D_)r;p},dLL@1{LL@1{mLx,,p=HL:Jl_$ M4_$ $7 Jl4, ;,;,\;,;,;X8XP8X8X8X 8X\8@0mXXPX@0m[3t@0Tm@08m@0m@F4@F4@F4"0"4##"Y1t|1{"0"4#h#l"Y1t|1,{"0"4#h#l"Y1t|1{"0"4##"##"hi44i4hi44i7X7Xtn:x"@"T##"tnl:0""##"z4?#Xz?#8|0@H%Y(fS>d"b"\"`##"ގ1NNd%N(%%_$ ##$_$p (K(K0t"p8t"p=p=0t"p8t"p=p=$@$\##"##"_)$r;d};}_)tr_)$r;$}ɴDp^Lbp)d_)rp)tt…;};H}"8"<##"##"$0$P$$p=`""  ##"0"4"8| ##""" ##"0"4"8 ##"g_g08tV8R0\t~B_gt%#=%2(=2\=2=0H_:/: CL:d/ /:/$'/3:/d//:/d/,/:/0'/3:/d//:/'/3:/'/ 3:/:/hd/$/`a\sa`<ha\aDad`a\saTa\<`aaXzbzbx]]]$] Tw|rw*wrw *whRw?Xy\rwd* R5 U~wrw*%~Hi~ g~X~(wxrw*%~Hi~g~hX~wxrw*%~Hi~g~hX~wrw*%~H~Li~Hg~Xwrw*%~H~Li~Hg~XXyprwx*K~i~g~Xwxrw*%~H`i~Hg~PXTwtrw|*L|i~g!\0R4jb8Hqp>Zʓq-ВC_@ҿT poxBxҿy2+a4$U,6I$ ppgpgp#p#pB8 @ D  8 ɼ8Ugp+tag,akx{x X{lEɼ<UdEɼUTEɼU0,8,, xn|`n`n`q 0- 4=d @*  dz8[[l8l80dz8[[l8l80aL, xG_[[l8a<,j`,$T$hLDa$LL&?%d Udw0$d)u%(B?%d Udw0$d)u%(B?%d Udw0$d)u%(B?%d Udw0$d)u%(BaD,@F$La&6ltq@0ϭ0Gq@x$Lx$Lq@q@VQ"?"?VQ"?"?VQ\"?"?VQ"?"?Vt%V=V%2(=2\=2=X0HX:/:ZC[,:/@}/p/@}/l/,}/\ee~cecq@pL&Aq=pt&o=o0=o=4|Tq4 q qP q qP q Td7APql s-q Ɩ)H7Aq st-q iAqL q T- X=  @* $ @* |88,8d`L^=]`P^=]4$e$e0 <4`:Ϩ:V=cdX8c@cO8\  NXMВC<(ȭ$ޭ(0 4! 4gogogog ogop ~PgPgP gP,gPLgII8LPI8P$Iq@q<@qqp@q@q@h$L4dq@1Td4p|1T@ @mp&q@q8@qT@>$7!H!0G!HY!2H"0Fq 0- l=*q@q@TXSFUwXqx@B1<N@&q@q(@sd% $\J*v8C^v@TXSFUwXqx@BFP5[<UwqL@BP`GPq@q@Aq P- =7$UPp<`^P=]PdqŒ<qE'0,8',', ~,M~~~t  F0,)8F,)F,) %LzNd=lIkNk|N=0LtK;PL>J`0E%tzN%zN=3P)|[;P>J;P>JPH8||XFQ|\|XD*|}Eɼ`U80Br 3\0BTTMɼUV\^NVh=V^NV=VRNV=X01PYYZLAPYYX01PYYZHAPY|YiXVD^NVP=eVRNV=FpFpNF MnANF E.ePVtRNV=eVRNV=t0tHt%u(`uu vBv v.v8 wLvP.t0tt%u(`uyXɼ\Ux gpɼtU gɼU0ErT U8(0luvTPՒ@|u\gPՒ|llul<oo$oP0oooPPo<ɼ8UM``r 9X<a_4~dC 04HK\.\},,ePmM,,,eDmM<`', ,eP0{h|qJ\J\PjD^Xu,lt%l4%\H3lHh3H3H3$)$)))01?0 lT^^^#l'7H8|PC %q\@J(q 0- @=  @*  @* `ld `Ld8 - ;P>J\;P>J;P(>Jl00 a:23|M[3$I:X&X6l.H8|6  D$8vP(M(vP (M8(vP(M(9^2)]4J'<& `dq@]J'<H& `PdM"h |"0F> |"0|M< @4dvP(M(h]Lhq - = ,@* 0 @* 9P `Ddq d- =q - =s041#|'7#'7 PPzT6#'7#h'7lr%y{ y{ r%y{ r%D 4Fhdzqp/2:q){,:q@0p"qp@aq@q,@gh \)t4HHh`,I`^p=]pq \- =y0yP$y\m@Hm sd^c`O^^dH8|`H8|q0@q@x$>2$W *X.B1<)B:3I+D]+t,l/B<$+0NB1)B1X)B1)B1)B<$+0NB1)B1X)*C B<$+0NB1)B1X)B1)B1)B<$+0NB1)B1X)B1)B1)$+0N$+N^8^(=]8HtKdt[~tbt8ttl*t>TcZ:_GT~cT'{T|-#XP  ]#XT,L@,00P324D2<L26LrO;\r@r///qD@Lc(\i(4i04h2\327h$Lh<7Zz7bPJOQPLJOQP(JOQ,3,3q,.33q.3q@3ZZt]XZZtq D- H=Z: _P|<P<d^^ =]I/1TpBBBPBBB6T{{\u0< Dp7~&\;c&X;c&T;cq D- X= @*  @* q <- @=q - =,Z(03HB l6prl$q 0- @= @*   @* 4ZBq|@: aZ:Xa^L4^q P- `= @* ftg|gfggftg|gfgg0CD`^rD^ rDH^#0'74#,'7\#T'7@Z,Z LqJ\J\rPjD^Xua,t#4\q - =Bl5- V @* q p- t= @* h#'7qL@q@q0@q@q L- P=T7U7HUP<pd.H8|6  h$\H8|i 8|V q@V 4|aq@S S L_ p( te_ Y2 0l N vj TP @| \" gj P |2 l2 l l* <o* oC+ $+ * o, * 0o* o* o, P+ * o<ɼ8UM``r 9X0CD`^rD^V R P@ll5 ](l5 G]L 0G08"0T|l5 K W& , dM m  K W&  ,M m  K W&  M m v {i: d0R c , 0 h ` => 5)4PFpNF F(pNF( E.dle\e~cedcv {ih:dV dq@Lc\ 11 x.  H11 . 5 7 P  $5 <7 THx8|p^_ ,^_ q<@Jl `;P>J ba ,ba no gno 0gno gno gno gno 4 gno gno 0gno gno Tgno gno D gno gno 0gno gno gno gno gno gno <gno gno xgno gno X gix8|Lo] hCD^t1J> xLf xؚ ؚ ؚ ؚ ؚ ؚ jm @ x p<1J p ,m ,~g p `8 p> DS H}DL DL LL Pk xEj srP r ۼn ɼU Q PC|z Az PQ g,@ PD,EɼUr, ,Eɼ|U,@ `D,EɼUr, ,EɼxU,@ PDEɼUr EɼhU,@ hDɼUEɼ$U,@ DDEɼUEɼpUr8  ;P0>J\6  T T @T T q@] ] |] ] (] |] 0q 0- @= D@* H @* B xmB xmZ Yu\Z Yu1T"H 4 M|K GT~cTd'{T- , 4scXO 4T^^^: 0: 4 8: :  0 P    4 Q 8 d xQ 4HQ `Q (4>x2$Wj 9j 9( $P;PX>J$;P>Jxp4." 4"  p4ih ]U KG' vT G'i8|it8|HEn En En   J9x xKHiq D- =ap>]L#'7q - =| A @0A \0 q 0- @= @*  (@* ,4CDd^rD^p 9 49 9 9 |9 9 T 4  P  P t 2  t@  T Lh '  C T $ <5<5`L^=]`P^=]`L0l"$l0"$`$$mp0CD\^rD^45>" 04H" 4<pBqd@<B<B;TaJXSIL&q@TD0Fq`@g6t"]qX@A4uA`x<aL>x q @x@x@:w@"Pw-xxx@x@:w@"Pw-xxx@x@:w@"Pw-xxx@x@:w@"Pw-xxx@x@:w@"Pw-xxx@x@:w@"Pw-xxxDxD:wD"Pw-xxq@q|@q<@qT@q @q@q@q8@q@qX@:w"Pw-:w"Pw-:w"Pw-V4:wh"Pw-xLxw>*80808:80/:P4b'3'L (L (X3/&3/`&d3/&$B8G$BG$BG$BG$B@G$BxG:@q ;TkJt_J_C8eJ_?@q?TkNt_N_=eN_OD@qDTkfUt_fU_AefU_I@qHITkYt_Y_FeY_Ap0GlqqMmMnCn,Ap4Ggpx,ml^l#r`r)ApDGgp,m|^Yugp,m^ w. w. wP. w .N N ApGApLGApGApLGqH@q@ApGApLGApGApLGqH@q@ApGApLGApGApLGqH@q@ApGApLGApGApLGqH@q@0/h H/ `/ $/P ,/p 4/ $/L l/p 0/ /@4$9q@)#X<mlMntCn9X%ξ4 ξx L@ * IIIII ""22"#@@@@@ 0 @B@@@ @0! L&L&L&L&L&L&L&L&L&L&L&L&L&L&L&L&L&@@)   @   G @@  20  40       p4*4*4*4*(** * * *(* *H@0* * * * * * * * * * * * * * *\* *(* * 0* * (*(*(*D8****(*(*(*(* ̅*(** ̅*(*T*h*|*(*((*(*. (*(*(* |***ԅ*(*(*(*ԅ**D* |*(*(**(** |*,88h*dԅ*|D** |*l*(*(*(* @*8*X*lh*$*| *@8*0*@ԅ*X84*(*(*(* 0*@ 0*` (*pPL* 0*(*(*(*(*(*(*(* *(*(**th`* *|* *$* $* $**h$*$*(**(**|****(**\ 0*| 0*(*(*(*@8*4܍* *ԅ**|(*l*l*l*(*(*$* |*@8* @8*`@8*@8*** 08  @ $      $ ($" D (**(*(*(**@@@@@DDDE @%---/  b`((@(P(P(X(@(P(T(X)@)P)P)X9@9P9T9X=@5@5# @@'@@H@L@N@O@@U@U`PU`PUp@U @U(@U,@U@U   %$4`V``PP '@@L@H@j@X@H@H@@H@@@@@@H``@`@0 555555555 50  @,@ @!@! ;B 0 -@ 1@PU-/1`! '`J'`J' `B' `B'9`' ` ` S@HB 2dH F @ @0( $ B 2$ T   P Y P & $ K! LH@(D"  @P,#   @ K*``hl   @`` ><&1BB!C!C2$ ;    0 @ ; J 8( HT    @ !*;/*XG*,!*;/*G*!*;"H"L#x#"##"0[22 3343@|1l{[3t[3ht[3t6X'668Xy68'686<6D{""##"R<l?#LN#8kr" 6 6 {6 6{2\ 3L"W343|10{"|W"0"8['\%x%##"RDPfD0:Hp44%Yf,;"0"4=aD_Za6##"Za6MY\mMY`mX`X`X`gX`MY8mY\xWtX`%X$r7XYxxrL*7X<rDr|rxr*r(dI(|I(I(I(|I(I(tI:D"L"P:|['##""0"8##"V4|#V|Y1<t$7H "p"|1{##"Y1t$7 |1({""##"Y1 t|10{|1{L:|1{|1T{LH:<L:L:Y1t$7$ "<"T|1{#x#|"Y1pt$7 |1|{"l"p## "H1e@ p=pLH:0"P"Tz+|*##"2$ 3K=6{w| K=6{s_$ :n\w h7"0"4_$\ N$|_$h ##"S>P"S>"S>T":$$(S>d",t…p)ltxu@u""# #<"T%HHs%P%s,;$}_)8r‚x&L:_$ u$l3$3$3P$3$3 $Y1t%Yf43<%Y`f43|1{%Yfn $|L['L:"0"4$L$P2Ilz##"-j\ \&zdz-Tjի"\ T&""##"##"+E?#(N#k66x{r" d5P~58"0=L2N$_$ y>#h#l" hlBl $hB8R %D$v / 0 X7 87 / 8=!g(=%-!:a9(9H:|a:da9,F4pNF@ FpFpNF NF EP.YK|AFDpNFX nK8KH_NFL E@.FpNF K_NF FhpNF Et.FpNF K_NF FhpNF Et.BL$J|XLh+JoLhJ8L(QC(QC(Q Cq@q@Ol BQTwtrw|*LK~xi~$g!\fPlޚdВ$CHВ<C ВChpLXy< y UpwB<g<b%b(%bx%o8`Yg` oBҿ T1{CB!rCBoH$ɼ U"$|g4g$Eɼ8U``[ Y[ (Yg@ɼ<U@E{{8ɼ<Ur| r$ r 4ErT yX[5hP|A4ltx242 t1U<6CB!rCHB GT_[h[l8G_[[l8L84;Y [,[lP888l8Y0,.0`.+<<+<<___x_8___ϭϭq@GG6ltq@@ϭ@GGqt@I\NP$XLdI@IdGID&IN&&$&ql@q @qd @q @;P>Jq@LPgPhP gP 8=!g]=V%-!c0c0cc dXc d"nD:iv`U"n:"n:ivUAq="n:TD79$Dv02D 9H$D$v2D`їIq `^|=]|q~ sG4P.˥) 9L^hВC,$(ȭl$ȭl$ޭl(hVT8В,C8ȭ$ȭ$8(ޭ@( <4`Rq - = 4@* 8q 8- ="`q$I`<^=] NXMВCВC(ȭ0$ޭ0(&q@;PX>J, `$66q4@q@Jdpq@q@ ;Pl>J@ 41J06HP8|h6 P  U.U9T9 U$.U49(o]Ki(KTiG!HY"d!H!D!2)"U$48>$[>$[>$[68tqd@q@6\t6t6t6t6 t6Lt6|t:J[J?U`w@B@pAKQ09;S8S8Hq@$Lq@6q@6@qP@$XJ5J$= KDx$=Q4Da6Di{|{q@q,@,$LLq@|`kq@6q@F,CZoYtifQ8{ {< UB8L= @|g4|HH8|#H,8|#JH8|JH$8|Eɼ`U80BtBr, 3,\<ɼ8U<E8Br@ 3@\<ɼ8U8xۼn E`r VQ/`V0Q/VQVQEɼ<Uɼ,UEɼxU8hBHաq@CCCpաq@X01PYYPYYYEZA#gdBiHV4^NV@=eTVRNV=88 8`ۑ0ut88(Ւ4|vllu`Ւ|u((oo@oPpo|`H8||`H8|:\vՒ\|vՒ|p vqwDY4$rKDiCC $1bLeK$iJ`wh4`4^=]@`qN| pq} , Pz6P#'7Fq@Fqp@`d@Fq@l00 <@& `Hd=* `d0=Z=Yl0@ <& `dM"` |"0F> |"|0H$8|i|8|X  GDq 8- H= p@* tNvP\(M(fl~x8F^?  Pz,6*@q d- h= @* q T- X=q @- =r@^ 8\l^^4txaxaxta x  xa0hG'x`a }U,tYi r0I\  g8{@,D:%\2:82<:q D- T= @* q - =H h>@6ٴU6@g=D\ xgɼUE~S<W~lSW < @g\dɼUE gɼUE gɼUEB<$+0NB1)B1X)B1))D8B1H)l0#8|4q - = t@* xB1@)*.B1)B1p)*.B1$)B:3ĩ0 d//:/xsK<Dh-lq@2l2RBu`XuX PbX  u  Pb J:9:8<=jz7bG=XZZtZL&[ L[H[L\4[8ZZTt:0r6r$jLq 0- @=XE @* IHא0mH\ 24''t/t/+EbY99:d_:_^^=]1T<lѾH^9PT=Xmxl5$\7q D- =XH3X3$;<$ )Q<pB @ 3 6Bq <- @=b  @* q  - T=\;Q8ZX GD0 q 0- 4=#"$X #!l @* 8/0P0q H- L=h/a @*  x@* |q 4- @= @* BBl5-Vq 4- @= @* BBl5-VfggDh\g`g`e4qq - = `@* d @* Hhf8: <<L  tTHtH_(|P ,DCB$l5-V<< 5-V` ` ` ` 0 t` ` ( ,|N v2 l2 l X | * (o* o* @oC+ , p+ * o `H8| `H8| 3N \v \|N v |N p v9 q1 wC     C C } 0=} J} p6~ 2~ 2~ 2~ #hɼ8U΀ \ h$΀ ` l$= d888\C O L6s (`2~ a(aaaa$aݵ<a(aaaa$aݵ<GRlt (Ltt o 4 P (z (<,z ,< #+ F\pNF` FpK_NF NF Eh. jL.dil)dPdd4cXt^ q@;P@>J H^ p^ ~Gd D\Ud :wzdd @xdd 8x|d ano gno @gno gno gp no  gno g (W 7 =4 Hm ~g dp 7 ag a tJy, 0p"$p0X"$X \T^^^TvxbIx y~#'7@#8'7D J~8!~!q `- =Lo]PD~$!H?d\? H?\? H?\? DJ - LV 7 & 0E &$ ,$ 4  ( P x h 4 Xh L Th x $ $1 >2$XWS a0CD`^rD^,8N9Aq:#q@z4NPz Nz$Nd)$q@qX@q@qH @q @q<@#<K#Ket# x~#K8C(]@ήP9@HJ94q@q@7`8C8De6`6h7}q@q@<`<=De{;`6'<}q@q(@[A`AYADe:@`6@}q@q8@F`QF FDeD`6E}q@q @ApGgp,m^Yut tt@HĪkĪ@khhhpRApGgpP,mX^m MnCnTm4Mn<CnApGq@Ap(Gq<@~P}HH%%ξξu6K1ξ%ξ  ξ,r PxHH`t  `  PH| `P<< ξ|~}xHHw BIN$@`@ @ P TTT@BH@\3```hP``a`a` & &00000 00840@00@0@J2@3000@2@@2u@0 H0 (*(*(*(*(*(*(*(**,,*Ȇ** *$(*T*hhh* *hh*X *xhh* *TLD****(*(*(** (* (*(*(*(* (*l*(**(*(*(*(**(***l*(* ̅*L*l*D* *(**$(*) @  %540/@B@`@pH@ @BB@H@@HD C-RT-R-R-R-R-R-R-R-R-R(*(* (*(*(*(*(*t|t4*ll8*\40<****(*L *X@8*(**ԅ*(*0 ؅* * *004*4*D*Xp**` *l ***(*** * * * * * * * * * * * * * *,TUTU ( ( D    $\*` 0*PL* * (**(*&  !        00  (,(Л(Л Л( U@(_R@ T0I$I%I0I$I%I $I$I%I8I$I%I(I$I%I"I$I%I@ I$I%I Il    <L&L&L&L&L&L&L&L&L&L&L&L&L&+``T`TT``T`T9 ]] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] Y Y Y Y      ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ,x(8H H@@@H !""@"`"p"x"d"t"v"w"*""""""V*<*<*<*<*<*<*<*<*<*<*< < < 00000        G@  B*(@@)0 hI3{{,@ ^ [        PB ! &L$&LB$&LB$&L! &L!<L&L&L&L&L&L&L&L&L&L&L&L&L&L&-@@@P@lPPpP@PP @@=                  N` `$@`$@ b$@ R$@ $@ ZlxLBM ; # >        Y1<tj1@1{1{1Q1r" |1{:`z?"0"P ?pS>"##"%@%Ly>l"":##"$7H PhK=86{J@lJlK=T6{y6\Pxd5<r", ~5,PP; \8X5 y6T%YfMYm`YYY4%XrtSYY\x"0"4ZaL6#l#p"Za6##"LcHY`xMYPmX `i aiCX`7X04;}##8D#t#H_$ "h"K=6{$$y>K=H6D{h7""_$ ## " s"L"P##"##""0"4K=d6`{$l$p##"2@ 30343|1 {343|1D{"0"4K=d6{$$##"%"d"huHHH##"hT4tt"Xt՝|+0 p=<d` p=d,9= +@ p=D"8"P#`#d"G##"1h07h7""##"3)|1{HdEթ74632[d#<#@""h"""##"LqV|q!\`Vh"0"4%YLf%Ylf43d43##"$7@ 2 33|43|1{PBDB`_Hgdlg$R_0::lM h=8/:* T/:4:T5P b5T5 b5HT5 b5HT5 4=LR=`U=@]>tM=]G>:>C?HF<p>IfF0pNFl NFD FpNF Eh.\\\\\\\@\Vj!Vj!Vj!Vj !Vj`!mj.Vjd!jwxrw*%~HK~L`i~g~tX~Fh:Cq - =*:H<ZHZdCD^| rq@q@q@n\nxGIl] <l$1L8g8LL"L|g\"L|gɼ8U"|g\g"X|g4gXUɼ8Ulg@@gxY<ɼ@UTor k @k koH$D'[x,,,,,.`Fl$8[ [l48Fl80\.+<<0+<4<81XN\&q@Dml&qL@q@q4@aq,@[&a,Xa,a,&&at,at,a,a,OT[9OV9O[9hyNNd0cXddcdcdid0cXddcdcdid0i g05d0i g05di g5di g5l:om:hm:o`o=o=q l- |= @*  @* ,HPsJ  iߕ(%ccccX9ӟ</778/77p0:t ,   tͩT {ВC$!\ВCВ C<  44LtxMx2M47X78*8@*q@8*q\@ID;Px>JL6 x H8|6  X U.U Ul.Ut U.U UD.ULO|V9rD0^OV96pipaFXq@AATq - =AFPhm&q@q@LL F5[<UwBq@G[[t,8S<&q@qh@L L1@ND&q@q0@1N&qp@q@F{L {{{8{{Lq`@9p9999999$PSl}<DI6xi $$ L6 tq @<dd pH08|4$~(~\~ĩ0 d//:/Hd8|$MMP|8|4H8|#x 01B .CB 9 486X<ɼ8U<E8BTBr 3\X0GX|1PY,Y0PYYZAY EXGX1_7PYLYPYYX(Gg8'HɼLUw\tr r 8ɼ<UzXOrX  gMo֜h֜Mx99֜99wwvՒ|0 v|D`H8||L`HT8| P" K\_NF` K_NFL ET.,(!dL7HATP <P <}( ?7x U" d:k:=: :)H 3H3H3H3px**0F | h /  l00 >h1 .-&.a:3l0 23(MFLF-F^C0 Pz6 0Pzp6q 0- <= @*  (@* ,vPp(M(HCDt^{{H8|H8|9T%2x><L>q@rS|I|  g`h'SWSW<W<ql7Pbl\ 8dsc<Odd^^ ^T  sc OBH$+@NB1)B1p)B1)B1)1B1)B<$+0NB1)B1X)B1)B1)B1d)B1@)0o}t -,`1}yk-Qo}t -,L^\LL\չչ@LD]J:\90:p0trp*r9p:T8rDL s[O^h"cs\sLeKYdFmH\h'L'Hא  23U4B&pTFjLD8F ; $HBBB) B) B BBdul`BJ8Bu`q 0- 4= @* -$ @* 0CD`^rD^rD^rD^/ * o* h* / x99* 991 w1 wN v6  |6 0 ? 0^H8|? 0^#@ t2@ H8|q - = t@* xq - = p@* t | PI/'| T^'| |^| | | | } XJ} 6m~ F~ X2~ r ~ 2~  <CS dG5 ?S G 6݊ 9qd@݊ 9i ' ? DU l2 h   XZ <Z <Z <Z <Z H<Z d<Z <Z <z <M m& $M Hmv C& M mM 8m LS hp- t`5pp|d [qP@q@d FB, ,/ `FB,\c`dc0c|c|cldcld lV 0qH@V lq@V q@V dq|@% i)-i)O-NLc\- \`   , Nf @ 1Jf ( H1J l%W 7 =4 ,Hm  ,m ~g lp <W 7 =4 Hm  ~g p  hW  7 d =4 Hm  X~g `p  P/n  1J /n 1J P/n  1J /n 1J P/n  1J /n 1J P/n  1J /n 1J P/n  1J /n 1J? LC@ ½ɼU@  ½ ɼU"E 80j c h? j c `? c@ Hv"E P0K Pc@ vc@ v8EɼUG 4| gɼUErD d H:e 6e TLq - =d :a =d T:ih }4?V'X"x}?}?vh "q@q@l 8rl rl r,z 4kq@qL@q@z l"ĩ d/H/:/$ 4]Ҫ 2 \]Ҫ h2 ]Ҫ 2 <]Ҫ t2Tl5q8@q@lP5qh@q@   < TN $  f  : |  p: P~!"ݵ$HHZݵ| : x:w"PwX-:w"Pwx-:w"PwX-R 4Xc8 SH?\? w>x4xx 8T^^^`vxbIx$ y~: hCD^rD ^CD^ rDL^E$E$q\@q@0,D 8,`lh5q@q@ى8-ى-ىT- J8SI<&q@q\@~~ף<mIx&q@ףmI&q4@q@q\@////x/8DM^ ^ $~$V}yN='k-QTH^#'7#'7 J~@!x@x@x@:w@"Pw,-xpxpxpx@x@_x@:w@"Pw,-xpxp_xp:w"PwX-:w "Pw-:wd"Pw-j h9 ;P >JcLeLe~cece# H~&*2,2,e# ~ID7d8JD-:0:0:0BM <d<h7N/Y?0Y?0Y?0BQQM <$<(QQQTh[AdAYTh-D0D0D@0BfX<FdQF Y<-H0H0H0B-b'?7-b'?7-b '?$7-bP'?T7|x)5#e| 5# e(}  9\9\q,@ApGApXGApGAp<GApLGq@q@q@ApGApXGApGAp<GApLGq@q@q@ApGApXGApGAp<GApLGq@q@q@ApGApXGApGAp<GApLGq@q@q@0/p H/ `/ h/ 0/h H/ X5O `/ / / / </@ $/X ,/x 4/ H/ $/T t/x 0/ D/ 5O 5O 5O D5OH Q4:Q0Pt :L:t!u6K1ξ D=ξ<K1ξt UL55p5 R02dH0 2dH0 dH2dH` *l *x * * * *$*,,* * * * * * * * * * * * * * * * *<,,*p$*(*(*@@*$*(*(*X *d *p *| * * *<<* * * 0* |* |*(**(**H4*`*t*(*(**(**| (*(* (*(*ȇ* @*((\*(*(*4*H *T*((*(** |*$*$*$*$* * * * *" !A @99D .   x@xx8    )@@D D DDTTD  @@ E@@D: @@BJH$I"JH$I" JH$I" I R) R) R) R) R) R) R) R) R) R) R) R)(((,,.>**))>x>nnNnjJhh.  (8(P((($D@$ .$ttTdlt S% %%% %% %% % -   x!@`@@@ 3@@@@@ @@`P   C & 0 8 LAgX#D+E+o+E+o+E+aY1<tj11|{1Q 21dr" 2 |1{Y1<t> =>0|1{>$d"W$h$tz+*""#\#`""x"|# #"(0I(IP0PJl(LIJxlY1t|1t{J,lIh,$0['$$$T$X9Jl1z?ptPDN#Hk5[r" 65Vr" r" PRDHfD0:T2 3343|10{(ISB'Y1tr" "x"<F#\#`"|1{_<~1d{@0m X z+\* z+*""z+*##">U,U,,lzp2X 3Hh73430|1\{Y1<twx ""G #X#\"|1t{|1{N8sa:ّ:(IwS>"%%%%xlNT%t%%NP%%l%"0"4lpplp##" \~5lpp1[ç<I03[,ݧ8=[<L;[Pթ746342[89 8463 2[ H8_XL:?q "_) r;4 }?q"LT:DNK=6{ 3L: O6{I""_$ 4$8#L#P"I@"<"Dh7$##"t%Y,f%Y,fK=,6L{@X p=\1eT:_$t L3D$3P$3$;a0:8n0$L['$+$h\3$3$3$3$3$3L$p="L"\3$3$\G##"3 $3$03,$3$3x$Gp=l2H 38a`:h+h3(43L|1x{Y1`t"h"t##"|1{#$#("|1L{Y1<t|1`{%Yf|1{SB'%Y\f|1{|1{|1{w4x:x$7x<\x<x|2Iz2Iz:0"`:##"##"##"x X "<&#?#N#k  "`LqV|*fqV`Vh:0;:#=:0; :#=#=x:0;(:#8=:0;x:#=#=cXcccccO^`^^T3<<v$3`3<<vLqV|*fqV`VhBBp{{$BCt{ɼ<U o oBNB<B gɼU`<r _q - = @* [[l8L[[l8h.P:+l808l8\0h0$PL $Lq@q@q<@q@q@qt@q@q@ G$_[P[lp8qx @VQ\"?"?VQ"?"?VQx"?"?j40 j.dcd d4cXi4) g45hCD^rD^CD^ rDL^lNhCD^rD ^CD^ rDL^8,1J˳T˳X˳˳˳8˳˳`˳0Ƽ4Ƽ0Ƽ@ƼpƼƼ4q@1TPq@6t1T$ 1T` 1T@  U .U B,B,B,??2,2,(wzwz" T4l"  4" 44LPlYTEqEq - <=AA $\ K0qx@q@J58 Kq@6lilaq@P VF0F =QDq @fQd q@q@YiF ZTofQq @q @PG6(iDqp@q@6iq@q4 @ (A;gg gX 0"FpNF q "q"FDpNFH FpNF `p#|AuaDfpjH8|H8|;P>J$;P>JO?O,A A hD=h$ȶ8I8 $<I $BhIh rlS<I< AtuA` g <ɼ8UP\x\,eVRNV=y$r , g\ gHɼLUr $r (ɼ$U:8 : : : |: gɼUۼ(n ɼUۼn HX:@M4P)HPT@q - =0Oa4V_UHd~C(8\8\8<\b`\b\b\b\8\0\7H7UO%a7p7Uh%<@h%04;P >JKhipvP(M$(vP(Md(](] J'vP(M (] (D`SDq - = @* `^ =] tTL X\q@78UPL<;tF0Tq - = X@* \*8*Dq P- T=,~`^<=]<< Ţ ,lX<ɼ@UM`hr< 9XE444t<<DscO`sc(OoUo(oloxpD@ݜPX\ס`)tdtdtdLt\d4Z|ZN|`Z:_dZ:$_dZ Z9)btO^|"lk0O^"[@O^" 3 $B,B,B,2,2,(wzwz\CD^rD^CD^rD@^0"@7!l$}, gr X0Gq= q - =X @* 4n P3q 0- 4=d @* q - = <@* @Q8lZ\t;Q\ 8, ZX G,D 4q H- L=h/a @* -hp 8@* <8L- 8lL-8L-$$39)q p- t= @* I T@* Xg<<4 *H#H'7d#h'7l#H'7x#@'7`<d4  `lY`<<3El7qL@m\/`H?\? #` '7h  ) D`S  . "X``t`` gɼUۼ(n ɼUۼn  4dh 8Z e" 4.W J xdh |Z̾ e8 q -  =o  |  '| z p<  @ D K W&  ,M m v CM `m  xU tQ10% Q1% T<- L2H L7 L/q$ DY$ Da$ ] (=L B Yc  _c \s7 L Ps7  s7  <s7  > m x xZ\ _ %> m ` `ѵ Pw? <C? |,@ D,@ D <Wf c@ v Wf rP rT ɼU4'ƥ 4 Fƥ  F? <C? `,@ D,@ Dc@ v?  \,@ XD,@ dDq T- X=" tqf xz @*   J |ɞ q D- H=x* (6 (Ja (H hPà (L Po T qH8|6  o]Q $Q \ -Q h? KP_NFT K,_NFD = fFpNF K_NF \0^^|scO |T^^^hq - = p@* t , Tq - = @* vx4bIx xXx, }vxpbIx xxvxbIx w>x,xty+yyH+yLH8|6  ;Pd>J4Hd8|CLC7 6   6   $;P>JH8|yx+y(:w$"Pw-x,vxxbIx xlq `- =Lo]PD;P>J~!n D44^#'7$XXEn En  H4p, J````"` q$ `q 0- @= @* q@ @*  \@* ``^x=]xqD l)`\F<-ox\ʺR]F$-q@@q@q@&4(q@.6qX@&.D6ĩ0 d//:/CD^$rDL^#l'7ba z zz,zĩ, d//:/hzxtxxx\:w"Pw|-xxw@>B,B,B,(B,88G2, 2,2,2,B,B,B,(B,8e=G2,2,2,2, F8GFGFGFGF@GFxGFGFGF G?k?k? k?Lk?k?k?k?@qY?0|D)5#@e5#e| 5#e(} 99qp@m0HmMn8CnmMnpCn|m0HmMn8CnmtMn@Cndm0HmMn8CnmtMn@Cndm0HmMn8CnmtMn@Cnd4)/ / c%4)D;).1.1zz_\_!D!DK81u6K1ξK01ξξ* 0 0101212161410 `0<`0<`0< h0<`>`0<`0<`8<d0<b0< `8<(0 (*(*(*(*(*(*(*(* ܅* * *$ *<*L (*p ܅*܍*8 *X܍* hh*8 *Xhh* *hh*H *h@8*@8** l (*| (* (** (* (** (** @l* *l*p *l* *8h`* *@8* T*h*l * |***** (* \ ؅*|ԅ**(*(*(*(*l*(* ] / @ ` ``````@`@ `6 WGxG`GdGbGbGb$Gb Gb$OxGxN0 $08 $80 $00 $002$00@000)  -(  D F D!D(   D)J  PPPHH H @H rH rH HH HIIHH 9J$I$J$I$ J$I$IJ$I$ K$I$ I$I$ H$I$)H$I$ =B    B   H<<<c?p ;l1t9 # >"0"4#p#t"""##"#t#x"/l#,x/1/Ho/H1/o////Y1<tj1@0m@0m@0m@0m|14{1 r"l |1{Y1<tj1Btr" |1{2Y1`tBlj1|1{?#TN#@k,66{r" $70 97DO7,S>|"4"L"lS>"##"%(%4y>|%Y1tGY18tGD$7P _$| _$\ |1{G,\;4,;'44,T;44,;j\P?:G\Y:;\ Cj\$?\HCj\L?j\d?j\?Q^r^,*P ; \8(5 ^r"t o;o;To;^`x""## ""`"d##"r" 282X 3H343|1{""$#T#X"Y1<tN4%Ty>tY1t""|1{%T%htnL:0"x"|""##"##"LH:0"pp :tY1tNp$p[' |1P{"Q P\; \8d5 y6`o;\Qr" wQN#k5[MwOMwO%%%%%YfbL%Yfb_Hs|t0…|8|8|H8|X;h}ގ1L:HppL:Lp:T""#8#<"##"##"#8#<"$78 h7M4Jdlѓxߓ%G%I|""h7,$##""X"\4@ p=#|#"$\$`p=|"@"\43##"2Iz`##"a:0n$L['@+@hWh3$:_$ @3t$3$3$3$B_<gX`CBgDRq 8- = @* PCD|^rD^q - = Lghp gr  r  1{T{TCB!rtCB{r,rrr $1q - = 1!0 DoɼU  oBNTBBG_[[l8G(_[<[lT8@PF@dF@\F@pF0 @g\drpɼUES|I| d0cXddcddidicdudLctddc8dZeYLc\Lc\tcVq@ee ehe~cehcq@q8@q - =8 @* q D- H= @* D^*{$8| 8t 8| 8 8| 8| $q<@qP@ q4@q @ t4( $q\ @q( @q@9VLU w\<Bqh@q@V *l 0@H8v00Hv0LH@v0Hvg H8|H8|;P>J;P>J H8|H`8|X;P`>JtHT8|@H8|;PT>Jd','<LwX9PD`hdhL dEɼHUP½<Br 3\r 3\g[etVRNV=g'5hwg[95hw9` g[etVRNV=g'5hwg[95hw9 gt[e`VRNV=5hwg$'iV^NV=9|r  hglt{\ g\rL  g ::ۼTn ɼ<UJ:;P>Jp|`H|8|h:L:|8  4  |  T(Hx8|@q@q8@h(ql@q@O[9OP[9pOt[9|OV9OV9T,,e h,,ePlkGxzq@q@qT@i8|lS`q 4- D=` \@* ` @*  8@* <#p</0x\xH8|$d =#L%_|B0]q - =B @* q  - $= @* 0%w+  lxl`2xYxx`x`x`,q4@q@P0"(0"q(@d0"`4^=]^^x=]HscOO]m <gX`A ɼUr r <1JD1J*.B1)B:03I+]+,/:%:%:p%h|x T^^^ ~I+ ]t2t(tj HHH2h22q @qp @qT@q@q@C q@q 4- D= @* F(.hB d@* hq 0- 4= @* h/a @*   @* /lq`@q@q@q@q - = @*  @* q P- T= @* 2 M \$4  dpۼTn ɼ<U' :;P>Jp `H|8|h 3 L3/ / / |/ / 8 / / 4 / / | / 4>l2$W1Hh8|`M,S\aq D- H=    x Ŕ 2rtS@I@ rSI CBCB N g 6;P>Jd n Ki<#8|i)V q@iT)V <qT@cXcXV q@.- 4U- LR. U- R- t. - .  - -  /n Tx1J\ </n  1J  ,Lɼ8U@ ½k Ej s} ts"E 0k Ej sɼU@ ` ½dEɼHU "E 0"E 0G @ Z @Z Z hZ Zܰ @  Z Z Z PZrP rp Ur 9L=8 8 |? 0,@ XD,@ Dc@ v?  l,@ hD,@ tD? ,@ DrSTIT 8 . rHSTIT W> Z,@ \D8EɼUr8 8EɼUɼUE 4@ɼ<U E`Mr 9X# \Pz6#'7#'7#'7#'7 8J:w"PwP-x8x dJ:w"Pw|-xdx4K_NF KH_NF K_NFP = `fF`pNF E.: 0: : 4:  DNH N  N @N N hNl ,N0 N 4   0 -h -H -( -@ - h- H- (- x' X' ' p'  t' 4'v  6\t6t6t6t6 t6Lt6|t ׼`p6t:w"Pwd-:w,"Pw-:wt"Pw(-:w"Pw-w>+zpppt,xB,(HxB,xxCn Cn Cn Cn Cn HCn HCn HCn Cn Cn hxXlx2,\2,`ed# p~e# ~<d<BphvBhvBhvBhvm0HmlMn8CnPmMnCnAp0Gm0HmlMn8CnPmMnCntAp4Gm0HmlMn8CnPmMnCntAp4Gm0HmlMn8CnPmMnCntAp4Gq@Q`::t9q@qh@0"q@Lk#<#$<m8Mn@CnmHMnCn8 j< < < <<Q !! !!B BB!B! < 0*\(*d ̅*p 0*(*(*(* ̅*@8*(* `  ɐ@ `(*p(*(* (*(*(*(*(*(*(* ` _pppppppxxxpp: -  ߐ 9(`!?(`!@=(`!`?(`!`>(`!`?(`a@?(`!@8(`!(`!8` (`O(`O(`F (`F(`K(`IL cT"b  '&&&$$*22G @ P@@HLP*@*D@d``B`@`.  QAAAA@A@.00@0@000 0 000000000000000@0000W-)aTJ% -)aTJ% -)aTJ% -)aTJ% -)aTJ% -)aTJ%-)aTJ%-)aTJ% s@@FD  jA0A0A0A0A0A0A00$ a@@0Lm0LhN#kN#k0[0bN#k00PN#|kN#kY1<tj1L1{1{1Q 21r"( V2#|1{Y1t""@0m|1{q4## "@0 m#T#X":0BD:BD:RDfDT:XY1t:|1{D0DDE4BD_$ DLD$K=l6h{DH_.HoRHe"$"(uH@HDH\##"RHe04AK8<DKyJLlKJllLJlKJl"Q P0; \8P5 d5r"@ ~5@\Qy68r" wQN#k,h;(I,;(I,;(I2 3 3`43|1{"h"ly>""RD0fD:(y>D##"|::D$l6,6{43O]`:$(r]['Y1dtr" "P"<LFdr" N#k## "|1@{Y1dtr" "P"<F<lr" N#pk##"|1({@08m[3ptzg*%YfMYm2IzMYm7XHX|`0 [0@bm0:4$x""""##"#,#0"bb%Yfwx:x 7x \x xXxY1Pt""|1,{: 3+K=60{##"Pp8:":S> "#H#\":D##\#`"7‚&HhMOt\…h;};}o8ɼHUH oB o|B|Yg gh 1{{{L!CXB{d{lt8+<<08l480Y 00GT_[l[l8 g g (q @q\@&&`&&&(&&Xq @ j0.wj0ccdi)j%ee afi8)  ,TMMDMDMDMM@ M8q3<tq@;P>Jql @ qD@  g<DrA ɼUS\I\ q@" 4"  l4|" 4,$LF q@9Tq@F S8q@q @R 6i9Qql@q@q0@q@q@qP@F q@q@FFP/0uY0`q@/0(uY0,`q|@q|@q(@FPq@q@q@6t68q\8^ ^p\8|8:9;S8S8,=Qq@9;pF$TSFF/T0xuY0|`/0uY0`q(@q(@ȇZIIstsW$estsWe@tt3@ttL3 <gX`rɼUEcSxIx 9dXɼ<Uw,.l,"@BTT, ql7b13\rSI T g$,xɼdU8rSI T g$,xɼdU8rSI T g$,xɼdU8rSI T g$,xɼdU8rSI T g$,xɼdU8rSI T g$,xɼdU8]a[XXG\X1a[X<G\X1aK?Kh?eDeDu|wXw4w˭hT<)\10PN ,gHPɼUEH8|6<t6q - = 16-]UH0~Ch;UxH# l\lll,llD l l00 h%t9:X;;@H;H;z`xdt9q@Bq x- =B D@* Hq - =`8` @g\dr 4 Xg\dr r  |gr  gr 8$0 Dg\dɼUUq`@q@@ɼDUE@Ur r r ~r 88 0H8|SvH2x8#8|<$77y0L%0@*<.0)10$+<N*D.*$.B1h)*.*.11,B1`)$+ N1$+(N*0.B1$)1X+hB1)///Dqx@//d / mP / / /ZZtv\v]O^<"^E^&R_=^&_O^"ZZ\tc{q@uP pdlLd<e|LeL O^"e/J d?Y1Y\ 1,,J 0HP0Lq - =h/a ,@* 0- @* J( ;P >J  } 0 [h} ,e`d^=]`|^=]`^ =]   _ C 8n # l! l! l! ' _    ` d        Q dQ ,Q t$Q <Q xx,y+y:w\"Pw-yx+yy x( +y DCDt^rD^CD,^(rD^ a0- :>2$W$ aT a$ 08 0; $; l  0@I\78I78 Jp-:h0:0:0q4@T\[AAYT[A(ADYT-D0D0D0qx@fX\FQF fXFQF Y`-HX0H0H0q$@ql@_U 1_XU1_U01_xU1_UP1Ap4Gn|,ml^lt#r)r`r)BhhdvPL^Lk#<#4<mMnq@CnpmMnCnLM@``  `*"L0""00 0  L P(*`(*p(*(*(*(*(*(*(*(*(*-V V V V P P P P P P P P       0>     @  0    x! x! P @  @T @ @ $ $$? wu@ue EEA@@@@@@`@@ @@@ +  0  K      w@H2dH@HB 2dHd2 dHd22dHd2D@> @ ` @(@,@"@   0    P P @  P "0"4#t#x"%H'M""=M#l#p""0"8#4#8"_$| Wy>_$0 "T"X##")\))) )\[)8))))8[606H{43r" wQN#kr" ^$dd0|hr" "0"4#h#l"Y1`t5h[|1{" "$0Ph#t#x""\"`##"2IzY1Xt|1{""0h#<#@"fY ""fY fY fY #<#@"##"##"MYpmMYtmYxxY|xX`X\`h9hL^X`Vh\uh6X$`K=\6X{$l$p$$/#,*zfFz[*z$fFzP[T‚T&?q"Qq?qD"##"S>@""H"L"d"h/wDM%G_$ [8[:H:jcBD:42H 38$7h 343|1{ѓPxߓD%GT\%d#<#@"%X%X""&H%%&&"4"<uHHH# #$"#0#4"#T#X"'VL0:d4632[M71f8I3S>"['$4#(ʿD(U1#$ 38%Y\f43h%Yf:_$ 43$8 p=P['43'DeD$Y1t""h7##"|1@{#|#"|1{q@H_|_)q@q@q@q @q @q` @q0 @q @q@g8SB,'&#$?#N#k;?3:X ?p:H8BDwYHdpT\tޑL5<g\SB8'&#0?#N#k;?3:d ?p:Dy\[H2U6BC~:BCBad,ad,8$(L8$Lq@q@phϭxq@TG0q@@xGp,GGGq(@q@VQ" ?" ?VQ"$?"$?VQ4"?"?VQ" ?" ?zR0,VQ8"p?"p?zR\,VQd"?"?zR,VQ"?"?1JcD/}/L/}/c`e\e~ceTclH:|mpUm:m:"n<:opo=o=*(o=1p*m:@X@@l5@@@l5H+i^<i l 5c d  ~ <NXM0(ȭ$ȭ$ޭ(ȭp$ȭ $ȭ $ޭ (В Cޭp(q@gg4bDg4@btg4pb4b'c<xq@6t&$`LqD@q@6@t6tq@q@q@@q@"x 04H" 4"T  X4h" 4a g (rhɼlUS@I@ qh@aIN$L" 4"8  H4X" 4TEtqEDq - =;';DO;7UP4<D\O7U90W{1Xkq @ql@q@q0@5Y`FqT@q@q@$ K$JP5 K KhiKfdftscO60q;:9;|(k6q6qq @S88 10N4&,0S4&q@q@@q@q(@,S &q@q @gdSB@'&#8?#N#k;?3:l ?p:̙La[(XGX1]a[\XGX1XGXt1X GXh 1W@bwwՒ |8w,vՒ,|pvK`?e4 D !w'wO<;O`;O; 6H6<q - P=X6 L1OV9Da'O0V9OV99a8'O4V9`p)H8|pA1#1#a -)A)A0?,?d,i 8|i8|\4l04 ./S.Xv23M23M/ S[3 I3l0 /S/SH`T|!SUpr?UpjU(!U!T|!jU0 !U !T |!UD !q - = @* v\ $q - =|M8 D4h @* 0d"0"ix8|P]4xxax,x|ax|4IшHSh9шDSDh9Œ<1J#'7#$'7( J06   6 ( ( gt|r( r( ~8$q/q5ݵ0 @g\dA ɼUɼU#4rP @EɼU 8 HgdlA ɼU0B<$+0NB1)B1X)B1)'CIq7B1l)'CIq07B1)B1D)B<$+0NB1)B1X)l,("*.w,H.*P.w,h.*p.'CXIqd7B1h)B1H)B1)B1)B1<)B1)B1)B1)B1$)*.B1P)B1l)0^^=]-,.QT$GTLTp;UH1T;U1Pr{u{@u6rO;r{u{u{$u{uHH2H(Hjj=( 9\J:5>HJ::8:8`*5>dr>dt:p8{$L@6tr4 yd 4 y 4h y p)H8|6pA^#^# -)6A)6A T^ ^^h#'71`7/d:$| ,Pz860"\0,"H<8|47U7UP<t7tUp4Ki 2 @b1 w1 w  |1 8wN ,v ,|N pv9 `?9 4 D1 !w1 'wq 0- @= @*  D@* H @* q t- x= x@* |  t -Lt x- 4P   t -Lt x- 4P L B 5  1 h9Q )X 9Q ) 9Q D)a El.FtpFpE3K_NF  a PNF K_NF NF ɼU@ ` ½dEɼHU ' grI rHS`I` 89= 1JD8$ D1q DSqSq D] & D D `D D#L'7x} 9 JxxLwEwEy8+y@1V' Jxx Jxx Jxx| Jx x@ 0 P    L P    Q Q  Q HQ Q @Q | 0 P: : lN N N T X 0 P: : lN N N T X N @ND     t x  Q 4H  < - - -Q dQ 4H  < - - -Q d ,- -hQ HQ Q dQ \o]|o]o]o]q P- T=  @* $:w"Pw-q - = <@* @ @* k; 5 Bxxxx x8 :w "Pw -5 Bx 5 B5 4BxLx:wl"Pw -x :w"PwX-w>x x\xq - = (@* ,q x- |=bW KnZ |Z +Z ^^ h.G|Z@X@@l5@@@l50NI4&J0SI4&q@q@@q@q(@JSI &q@q @ee 4e\e 4ee$ 4ee( 4ee, 4`,`0 ee4ee4ee4ee4e(e 4`p`-@`!!!@I@@@  00RX0RX ),0 RX0 RX L(*X(*` |*l |*x (*(*(*ȇ*P*l*l*l* L,,*x,,* |*(*(*(*(*(*(*(*(*(*C  ```````h````p^x  $&! Aiiiiii'% ``p`@``@ `@ a4 DPPPPY1<t$7L K=d6|{$$p==$|1({=@=>d"W"8W?QY1t$$S>"|1{ @lZY1pt$$S>"|1{"0"4N%%%(I%X#`#d"y>##"_$T Sh(I(I~:4U86ɼ8UhlYg[ Ygl[ pYɼ@UE(`Mrl 9<X#rX ɼ<U olBl $oB"|ghg"$|$grSI X g08~T8  g <00.j@9| 00.0x000 0 0Lϭq@TG0G@qH@G2H;GG@q@Gq@/}//}/q@d/}/(q@c/p}/qp@B0E.FpFpE83K@_NFD tNF K_NF NF 8ɼ<Urx 1 6 tr 16rP q@q@9Hq$@1Tq@q@FT4~9qH@q@q@q @FT1Tq@qx@Z8Wq@q@q$@q@qd@q@q @q 0- 4= @* %b4 @* q L- P=z @* rT ۼtn ɼ\Uۼn ɼUPBTTB`Bۼ`n ɼU3D\rlS<I<  gLɼHULɼU(E8X<1]XZA]pYE]pZAYEZAYE](ZhAYEoooooP h o P`9pPҮp(iMX gyE)10N48lɼ8Ur ۼtn `@Mr 9XE$E 4Kw Ld LF;FlpNFp F pNF F pNF E .q @P{7 ,,edl a`mUH&8hAU&x $ Px8 ?`d^=]7$`1`\(^T^\(^^P 04Xq |- = @*  q - =dH @* 8q - =FXpD 3 MŢ,DlP yt ` y y w+tL x`x`H@8|2x?Yxtl x `8T.8)tL8 .7<@ZRp^p^x 3x3S|WglSW}|mSW8 <  @P x` 3 t4 <h|8X~d<X(TX R p<LqtY|3O^"xqLqcO^4"L6 rO;(r 30Nq= 6Hn d367q - =X |@* $N|3|_@Q@Q3DK,0|Lc\i4hcld5i4hXc|pHpi4hpcHl5Lc\i4hxcq @- D=!t3tFtNFN H@* L<q |- =* o* o* o* o+ * o+ P * h o+ + , `9p, ; p(; i; < X g,< EQ< < )< 1< N48lɼ8Ur ۼtn `@Mr 9XE$EZeYLch\ee ~ectc0Ve0ex~ec0. .  g dgLT r 9 =r ? @Cר D j ,@ D,@ D~g p? M X(? Xj $,@ D,@ ,D ,@ PDEɼUɼU`Mr8 9X9X2-Tr 7lp| D]#'7x:w"Pw4-P<V' 7H7X HP < Xq@Oq@q(@q@q@|q$@|O} 0  (N,}  ` t x , 0  { H{ Xo]\P J^H?p\? #'79x 9x `L8$8 HL`$` pL$ L$ H  4CDd^rD^<1;P>Jl#'7#'7 P(x$,x4tE)5tL4\E4\ER5\Re# L~et# ~2,02,H2,X2,hB,DB,HB,LB,PB,T8XG8dG8pG8G2,02,H2,X2,hB,4B,8B,<B,@B,De=HGe=TGe=`Ge=tGB,B,B,(B,8B,HB,X$BG2,2,2,2,2,2,ql@xxtxxB,hdxB,B,pB,xQRGBM <$<(SI<<BQRGR<GfXFQF Y-fXFQF Hl0H0H0fXpFQF T [AAYT-T[AAYD0D0D0T[AAYI78J-I78:t0:0:0IP782,02,H2,X2,hB,B,B,B,B,ƨGƨGƨGƨGpRApGgp,m^Nr1pRAp0Ggpd,ml^9q@q8@4;7x ξH ξ ξ(  ξ 1@DeDe DeDDH@@ @@`@`DHPDHpDH@@!de@ @@ D,,*p,,* |*(*(*(*(*(*(*(*(*(*(* 8 ܅*X*\܍* *$ |*0*4h`* *h`*$ *D$*x@8*@8* |(*(*(*(*(*(**(*(*(*(* ̅*(* P ", @ @ @ D@@@A@@@@@H@@@ @H@ @ H@@@D@@@A@@@@@H@@@ @H@ @ H@@@E$* $* $* 4$* $* $* $* $* $* $* $* $* $* @$* $$* $$* _$$* $* $*  $*  $* @H@H@H@H@H<L&L&L&L&L&L&L&L&L& L&L&L&L&L&L&L&L&L&  PRJJ : @     @TT @H @H @H @H dH @H  @HH dHH H @H *(@ @ O/N-----)()))))))))))i O , , @,@ @@A!! -)aTJ% -)aTJ%D @ P@ *<<<c?t ;p1x9 ;BD # >MP00PP0PP0PP0PP0PP0PP0PP08P4P0 PM4Fl42| 3l343|1{P4h4p4424 3$3h43|1{L<:0Y1`t2 33430|1\{|1{L:L:$70 ,~K=6{ђ t Hlђ $74 "8"@2p 3`343<|1h{_$ 343$|1P{#x#|":D#P8N$X_$\ :|#S>H"N$_$ "8y>:#S>p"##"w`x<:0xP7xh\xhxwHx: x87xP\xPxFdpNFh FpFpNFD NF  FpNF E.FhpJF`pNF NFl \z]DG] R]$g(]=] ]d ]R]<]Di]]0G]0i]Xq@^8^<^^,^8^|^^^D^|^qX@q@ Hks4DorS\I\ ko4orL Lko \k Lk o koh goo lko:+<p<BthvBhv<<P^P^aD,aD,a,a,$L$0LqX@q@dq@#\#\4b#D\4@b#t\4pb#\4b4b=Xlxq@xD h DR}4f U.UFpNF0 E3E.FpE83F@pNFD NF8 q@OXZZZZZ ZZZZZZq@@<q - =(q 4- p=4q@Gq - = X@* \J*J5(J5J*0J= KJ= K,8S<&q@q\@L,S&q,@q@1dN&q@q@^v`vC^v KJ5P KJ*<vC^v KHJ= K7<Uq@CLF q@q @q @q @qh @q @q @qh @q @q8 @F pNF FpաtNF E@3F@pNFP FHpNFL FpNF p0 E0 .a4bi4La4bi4y$YKXA:pa:p ay $`|xp|X$1| 1p |X  1 | 18ɼ<UhEr  iXVD^NVP=zpOx| e`V|RNV=|`H8|DPt Hh 8| H 8|P HX 8| Ht8|<<ɼ8UM`M`ɼ|U``ɼhUrt rt ɼU9(X9(XɼTU <T^h^l^X]] ]p ]]h]](]=]h]Kw L0HT8|Kw L(Kw LH08|K\w LdO-y- J--, -x- .-&.C.Pp\t. . vt 1 ,Pz86{C 0"H1{C| T^^^tCt@ 1C$ q@pXZZZZZ ZZZZZZq@@4ZdcZ:_GT~cT'{T-O-{< U -! $8 @,q 4- D=q  - = (ll d x , @* 0  @*  44\ L0qt@q@q@m0/d)d &_ `H8|DE0 Pt Hh 8| H 8|P HX 8| Ht8|<<ɼ8UM`M`ɼ|U``ɼhUrt rt ɼU9(X9(XɼTUy t,w,.w,.l,@"b1b1z z (|z Az Q "1| Kg Pf | <W L7 =W 7 t=4 Hm 4 Hm ~g ( p x 8 > D^ ,J5` k5` Pk5` Pk5` lk5` lk5` k5` dk5` k5` k5` k5` k5` k_` Q_` Q|  Jxy@ }@ x +yd y +yd Jxy+yx(= fkFWNF FpNF  K_kF0WNF Kp_NFt NF kF0WNF` ED .:w("Pw-yL+yTyT~y,~y~:wd"Pw-y+yy~yp ~"` qxhy~yP~x5 Bx< y ~x x@:w "Pw-5 Bx,5 BJ8SI<&q@q\@JSI&q,@q@dNI&~q@q@# q@q@qL@q@  LqD @q @pq4@Hq@q@#K#K#8K#pK#XK#K#K#K#(K#`K#8K#K#K#hK#K#K#8K#pK#XK#K#K#K#(K#`K#8K#K#K#hK5O /, KcnchLbph<.D1H/ q,@q|@Lk#<m\MnCnLwtBpB[J@?[Jt?[J,?BBp4RAp<Ggpt,m|^pRApGgp<,mD^pxRApGgp,m^ R@H@H`H  `H      `  RH %!J%!J%!J %!J@ %!J@%!J@%!JD%!J@%!J  (* (* 0*0 (*@*H (*X*` (*p*x* 0* 0* 0* 0*g@@0&L``9&LB@0&L@ &L@ &L B@ &L@@p@ @ @ B@@=  @@@ @ @ 12323333s3332232s29s2s2 32Ys233s@sXs@sFC@b 2dbb@b 2dbbH(             " N0@0  (, (, @0 0 ."@@ `  ((((  @@@@@@ @@@A@A BABCJCJC BA  *  !0    $$  @PP @<<<c?`\1d9 #{`1h9d #<<<c?pl1t9 #{t1|9x #<<<c?`\1d9 #{\1d9` #@/@R|,B{Dd ;19 p# |>M$9X19C9$9,$9$9$94$9<19l$9$9D$9d$9$9$9`4:"0"P ?p:S>T"&S>h"##"%%#$#(""4"8##""8"##"""##"BAt-B "QX P@; \8L5 y6HDQxP; \85 y6o;\Qr"  wQN#$k5[P('444(I(I(I44(4Fl@4iR,;iR,;b^$r" 5V5D[5DL^@$Dc r" r" wQN#k43%YXf"0"H2Ipzw:%Yf:$#0#4""H"P#t#x""0"4#h#l"1##"""""/ #0#L"/T2P 3@343(|1T{ѓxߓ%G%2L 3<343|1,{""##""h"K= 6{$($,y>@""##"Y1Ht|1{;8}:X;};D}Y1t/0#,P|1{:_)<r;};}|1{Y1dtr" "P"<F""##"d,r"@ N#0k##"|1{%Ypf"L"`%Yf%Yf2Iz2I(z2IPzwt:%Yf:$##"0H 2=2=* * $* ) ,=** 2=* \/:0H 2t=2=* * * ) ,=** 2=* \/:r'r@r8r r\r'r,'r@'r'r'#s9rr 'Ks r1Tq@q4@1TDk[k`[`6,\1Tq@Rl}IFX F S8  q @F/0 uY0 `q@Rql@9u9`qx@PG6i D/0uY0`q(@qt@q4 @q @%`$j0I0 $I 0$BI $hIh !$WI ȩ5t:wȩ5:wv Ւ| wW0 b vP v >4 schO> @scO>  scp OrIP rIH hl Dxq@hq@q@qP@q@"u#C#$ "(un#PzXq@<7U7$pݵݵ@ݵTݵP q@q@|M 44M!M(H`M(`|M, 04TM(Mx( Pz6 Pz6$ Pz6H?\? < $8DD`,d8  fLg\gt]\.]h0s8$33q.P3t3P3qP.Zd: 464oy` p6poyp *@84 y q =  M n  3!!!!!3FN 4@* 8FhNq p- =Rt0 4 4ddtclZZR0q@q@X( Geeqe(qfggDhg g DhggDhggixq@ Yix8|P`SH=m /L )L }7 57 t:1 w}7 57 :1 wN v6 6  |1 w 2 0 bN vN P v6 Lɼ@UTErT q - =S G 86C O P+̇  4+s l`q|@r  Lc0\ h d> 5 = d> |5 |= Xd> $5( $=} \y z y z   "  ", g , g } } M & L d & . , . \  / @scOP , &w  /&vxlbIxx vxbIx vxbIx x,:w"Pwx-: : vx bIx :w "Pw - ?p JG'9x 1u`x@8 qt@q@@q@q@q@< q@qx@q@q@q@qt@q @pRApDGgp|,m^Nr1mMnq@qH@CnmMnCnq@q@X(*`(*h(*p(*x(*(*(*(*(*(*(*(*(*(*880*_@U```@`@ @AL|%HxUHU@U@U@@UrAQI @ @ @ @@ @ @ 0@@ @@ @(@$@$@A @ @ @ @@`@ @$ @$ @$(S         <<<c?hd1l9 <#MX{Xx1$9  #!*;/*G*\!*;/*G*##X/*PG*/*XG*`#p#!*;!*;Y1xtr" "d"<F<r" N#k#0#4"|1T{""0h##"|::8$`2 3#8#<"3p43|1{""#$#(""x"|Y1dtr" "P"<F<tr" N#xk# #"|10{"d"h0h##":d:lz#P#T"(h`7w ##"# #$"##"##"_$0 "x"|'z':K=x6T{K=x6P{#@ #D "$7 # # "'0I"p"t"T"h7'`$##"##"HH`_:C D=/:* /:C08;20=2 =p::  BX`B CͻmHͻmZtZɼ8U`ɼU"|gg"0|g t"|gIP IP  `g|ɼUE k 6 Pks4\ k k koXD\X:ZC =/:* /t:ZZC5[;2=2=[ :[:66TBTBTBBBK_NF K_NF K|_NF K _NFD E .6Lta,a,a,a,a,a,aL,q@q@6$t6tq,@q|@a,q@ @g\dɼUp8l g08ɼ|UH89d`@^=]q@}fR( } f<  U8 .UD  U .U  U .U              $]K]KL7iKJ= K]K K|JX5 K$iK0 KJP5 K K K KJ= KJ 5$J5q(@scO6dqFT|k6Lq6qRT P5[d <U| w qP @q @PVBP 8g<DD$hI @$ȶI $<xIx y$I [ [dXxGX1 \[hX|GX1]\ [\ X81\ [ \ X 10 @g\dɼUEɼUET 8g<Dt@t@@ɼ<Ur x,DEr  tɼpUUr xP|@ x<,r( r @ɼ<Ur x,DE g 'rl rD x$| x,r| r| `Ur rT r4 xEɼp UrP `|`H8|ۼn ɼUۼ n r P ۼn r Pa,ZxscHO`((aET(a |E, (a D (JXw0JXwtt0pxp<<ppqP@1h v1#'7}       D P $P`^T=]TP`SPzq@shq@UObj,Ptd8H1,t( Y` P04;P >J(C<%J@1L1Tٽ4^r  gɼUr r A, r| r hUr g0`PghmTEgmEgƷ3gƷ3gЋ Ћ Ћ Ћ Ћ Ћ Ћ Ћ Ћ ЋЋ Ћ Ћ ЋЋ Ћc\ 4c\ 4\ T@\ @\ @\ L@\ L@KL_NF@ K _NF$ K_NF K` _NF E .i *  xפ zƥ  F DQ @C` |@ @ d#  |z Az PQ9ƥ  FW |7 =4 HHm  |E ~g p  %W 7 0= 4 Hm `6Pt U.U6t|  U.U6t |6tt     U .U K`_NF E.KT_NFX K_NF K|_NF FhpNF FTpNFp = fFpNF q \- `= @* q - = h@* lq  - $= @* q - <= @* vxbIx yL+yTx:w"Pwd-vxbIx yt+y|M qvx bIx y +y 6  D l    ((^#'7 xJ$ 1 1q @G'  :w"Pw`-:w("Pw-:w"Pw8-:w"Pw-xx:w "Pw -:w "Pw8 -:w "Pw -4$b4(b 4,b40bxP|gPgPgPg4$b4(b 4,b40b|PgPgPgPg#D<ApG#<Ap8GApGApGApGlqqLMpRApGgp,m^lqqMAppGk`@  0 8$@ *L *X *d *p *| * * * * * * * * * * *I@** 0 0  (      PPPP"!P*P*]0/0RpBdd<MvcH? ;19 P# \>0NU/R(B<M@v@c? 1$90NU/R(B<(MTvTc?40189N$_$ "D"p$Dv##" %##d#h"##"$8h$$$N8M@D4""JlNNN%(%4%DM4Jl#<#@"FL(I4(I(I(I(I444(I(I(I4FL K#` #d "L0:DL:::_$x p$_$ _$ _$t L:L:LH:0%%&4%@%Tt%%""=M=M#l#p"Lt""=1t=D|h4:՝|՝(|""=?x6l{6{I""$#4#8"Il"p"th7\$X#p#t""0"@w%Yf::$MwO%Y@fbMwXO%Yfb,##"w S>,"|!B.T1{1d{.1P{1{L^.p1{1 {.1T{1{# Lg8gxA`+aH+a88Fl8[[l88YTl8[[lt8ko:+hFl,804 ;(ƼƼq8@Ƽ8ƼҼƼƼq@q@Ƽ Ƽd " @4X" 4"p  |4" 4,q@qp@qd@qX@q@TCDx^rD^hrDT^rD^CD^6qrDD^6q6LiLa6q6  xq@q@6  T>$ <9$ q\ @q @q @q4 @qd @q @q< @q@q@ɼUr /\ xg|r /@VT~ r @CfCrxscHOscOscOpscOscdOlsc<OC sc O4CD`^rD^JKirqX @q @q @q @ 9 =q @q(@q@q X- h= @* Nq - =:|X d@* h:Xq P- T= @* O[!q@q T- `= @* st11s#'7s0#'7l    |  Z:4_PZhc ! i :h c ! i :X Z:_Z:_Z:_$p(%$N/s  b < $ $  :H d   "4CD`^rD^JKirqX @q @q @q @ 9 =q @q(@q@XɼTUr, 8EɼU\ɼlUM`rl XEۼn 88p/}/i *  פ zפ zפ Tzפ zƥ  F Q C` @ @@ #  h f  %W $7 T=4 Hm  ,m   %W 07 `=4 Hm ~g p d      ( PKi 9= 9 =r S I  K i8H 4В,C|  В C l0ВCZʓhq- H $ВC Lv-!PW :w"Pwd-:w,"Pw-:wt"Pw(-:w"Pw-w>+zxh:w$ "Pw-Pb$ x$ Pb| x| k$I$ $I$ '$I$ '$I$ $I$ $I$ $I$ $I$ $I$ $I$I$I$I$I$I$I$$I$ @$I$ 0$I$   * * * * *0*@ *P * * * * * *h`*\ *|L@Ԇ*(*$,,*P,,*| |*(*(*(*(*(*(*(*(*(*(*(*(*(*(*\*X 0*x*PL***PL*T****|x0*L*`($**($*<8*B @ @ ` @ @ @ P P @ H @ @ H @ D @ @ @ @HH@U@@U@@U@@U@U D @A$tN$_$ "4"Hp$v$p##"$th$$ %D#L##"##""h"pWdXH`%XXrX`##"""7XX `PX$fX`##"##"t0m@4%YfKs3r"p=#s p=::nsm,uI['2I`zgu@,D;Y1<t"X"\|1{/## "Hs#t#x"""|1{#L#P"|1t{w K=6${"0"4"L"P""N,%P%\%l##"##"L<:0ѓxߓ%G%2 33h43|1{_)$rL:L:Y1dt$7t L:$$h 7|1{p[',P2 3"W3430|1\{'\I""""h7(I$h',$$#<#@"##"Y1<tO""I""(,p@$fl['d#P#T"##"|1{a0:@n0$L['8h+hha:n$tL[',+,h\Agh`Agl+E+EBBaX kaX kBCBCH1@K@K@e@K@1@K@dK@y@HK@1@K@pe@( K@x K@ K@ 1@ y@h \gXBxͻmͻ,mX\>p S I@N$HLJ$J0q,@J`B:Jp[J?:J[J?,BDBJ,J\:J[J ?Kx_NF dE.1JK_NF FpNF K_NF El.F;K_NF FpNF$ qH@q$@q@" H4`"  4" 4:`:;`9;q @q @1LNT&q@,XSL&q@q(@,S&q<@q@1LNP&q@q @#\=Au#|A0ua8#|A ua #t |A ua #l |A ua #|ALuaT  rT ɼUEEɼUۼn ɼ|UA  8ɼ4U88 A0 ɼUp  ZZPt@r3q.L6rO;r[ ya 8h@ rh$ $q 4- D=X @*  @* H3X|q - =F. X@* \XPQq 0- 4=h/Da0P0$- @*  @*  d@* h/0XP0DD $q@q@a(?lm!1 Pz6  Pz 6p   0Pz46 pPzt6 Pz6 Pz6 0Pz46 pPzt6 Pz6 Pz6 0Pz46 |$ LIL J $ I 4$8 I $ `I` J $ I S H$Ð I q D- =\^^? @o@ xu\^^`? `o@ u\^@^\^D^ ,m ƥ | pFW $7 (=4 Hm L $E ~g p  d %W 7 = 84 ( Hm פ zi *  Q Cƥ  Ff f f   g `  g /n (x1J0 0  w G8  G8 / 0n 1J W> Z:w"Pwd-:w,"Pw-:w"Pw-xH@ |P| | |4 | |||:w"Pw-/go/g oT/go/goL/go/goD/gxo/go3e# ~PgPg Pg0P@gTPdgxPgPgPg383 p3D333\303  3H e# $~e#  ~e0# h~e# ~e#  ~eD# |~e# ~e # D~eh# ~td BhHvt ,m`^tBhvt8,m^tt B( hX vt ,mp ^B( hP v,m^<<t* @* @*L @*X @*d @*p @*| @* @* @* @* @* @* @* @* @* @* @*( *4 *@ *L *X *d *p *| * * * * * * * * * * *W@@@B@@ ل@P@`@@@BBB B!C ɄB@BB@V (00084$&$4<$4<%5= ( 8  9 0) 1W            0    lH@  "     h(X`%Xr%X rhWii,hWi@hi$Wi4i$h W i 7X@MYmMYmYxYxX`PXfX``PX`fMYmX`YxiaiCX``ik9h^X`PXfΎ\""['L(I##"Jl"0"4##"['" "$#p#t"ގ1"0"4<s##"'<'<##"2 3343|1{3L43p|1{""l,"l,"2-2-\w,4., w,.w,.w,.?-0,h -d,QH-,,H Q-0 ]Q- ],\ <P<TH8|LHD8|H88|@H8|H88| FpNF FlpEX3El.NFx E,.o8H @ohɼU oBB oB  oB9T6q6qQ6hqhscDOFFH Q 6$ q$ sc O6 tR PFD9;S8@ɼ<Uwr ɼUrD ^<V<~ɼU rx x( | r r <ɼ@UpEr r\ iV^NV=r ɼUr |^V~leV4RNV@=lɼpUH | r | 0EɼU|<`H<8|48  ɼ U ɼ U8:\ DgHP gr  r EɼUEɼdU8 `gxAlO(Gpm,,eL7| ,,e  mOLGmlPaOHGlamla;*pDYhlzՂHf Ղ f /0 \ Ղ@fՂf @g\dA ɼUr ɼUr  r` A ɼUA$ A lq 0- @= @* q - =_0h Bxl @* 5-DVBl5-VB l5-V,DpCS4ɼ\UM|M|ɼU` ` ɼUr r ɼTU9HX9HXɼUۼHn ۼHn ɼxU,0"<K|i ɼ U`L ɼ U` ɼP U4p0 0 8`rSI q  - $= @* vxHbIxT y~w>vxbIx "`qeN  8 @* < w >x vx` bIxl y ~2,02,H2,X2,h2,x2,B,TB,XB,\B,`B,dB,hB,l$BpG$B|G$BG$BG$BG$BGB,0B,HB,XB,hB,xB,B,B,B,FG2,2,2,2,2,2,2,2,2,,,*,,*`*x(*(*(*(*(*(*(*(*(*(*(*(*(*(*(*(**(* (*(* ̅*((*0(*8*P(*X*`*t*D**(*((\* ̅* ̅* ̅*(* 0* 0* ؅*ȇ*( 0*H 0**<8*hd\*T *thd\* ** *@8*(* *(*X`    l@  H  H  @d  @  @@@"  H  H  L@  Ni` i`pW`` `@` ((`` ``(`(`(p(h``  (("[@`@@ @@@ @`@@@@DBAHP[*S*@*@@@@@*@`@x@`@eHeLeBeeeBeB*eBeBIH&#\?#xN#dkSB'50[50L50VB|BB$\A\AgBBC8@0m@0mY1@t$7H "P"d##"2| 3l3843\|1{343|1H{1"d"h##"|1{2H 38h7343|1H{ 3+K=6{""##"ΎDߏ S>"z"0"4"L"P#t#x"##"K=6{" "$4$8%\%h##"##"H@0m"L"PZah6##"r", 282\ 3L343|1{""## "\@K\dKh7' ht7$|##"f['##"""h7#`#d"O""X1fq8@;ft1fx1f|q@1f;fP1f;f;f@;f1fq@;fh 1f;f;fqt @q @ngXngX^^ngXngXngXngXgngXngX^T^D^^^ ^@ ^t ^ g hXhX^^hXhXhXhX^thXhX^,^^x^^^ ^L ^ ^  k6 4kt ole kep 6  k  kr Sh Ih  ko |ko_ k _4GD_[\[lx8G_[[l8G|_[[l8 G_G8_[[l8[P [lp 8 " h4y" 4y"`  (48`y" 4y"#w5#0eX#S" l4y" 4y"d  ,4<dy" 4y"#w5#eX#,S" T4ly" 4y"L  4$Ly" p4y"#w5#4eX#S0Hq@q@6   H8| ;P>JpH8|H8|8JH(8|q@q(@ U4.UD U.U6Pt6t9 UP.U U.U49 U .U U.U U(.U0 U.U  U0.UL U.U" 4 U`.Uh" 4 U$.U,"  P4h"P 4 @ɼ<U|D2D<2rD DL2'D2' '0=XT  ' ^ f4afafa#8afafxafafa<a<af$ af\ a#8 af a*gafhaga,haf8afpal04 ? |"0? |"00? |"0? |" 0? |"0F>T P1|" 0H? \? #x'7|<\ & `dD1q - = x@* |RT4!CV$ .-oV,&.X @*  VeVl&)"`$ qV ,)V ,)V ,)W n!B1L)$+,N$+hN$+0N$+N$+N$+\N8Q1L$+pNB$+NB1)B1)1X+h1B1()B1 )* .=`Lv*pr*r6r(6,r:\0hr:0rO;rO@;Dr``$`88P^9dh=l^9=^9=(^9DH=L:8P^9dh=l:^9=:^9=: ^9<@=Dq H- L=h/a0P0 0@* 4h/ah/a0DP0H- @* h/ah/ta @* @39@)&TFB0F8PL-RBu`BBB85B, B BX BB] 0q@q@6   H8| ;P>JpH8|H8|8JH(8|q@q(@no gno Tgno gno 4gno gno  gno gno gno h gno gno hgno gno Hgno gno (gno gno gno gno gno g g dgLT r  EɼU9@=r r r rX X9d=vx\bIxh w>xx(vx|bIx w>xxD y +y y +y vx bIx xTvxbIx x4{ H| ! o] { o] ^H?P\? H?\?  J9x 9x  o]D IP7p8JP-:0:0:(0:0:078C8`e66IJw:H0:07p8tq@qT@M( <p<t7N(/Y?0Y?0Y?0Y?t0Y?0<<=Pe{;6gNwY?<0Y?0<h<lq@qT@Tt[ApAYTt-D0D$0DL0D0D0[AAYAe:@6TwD0DL0[AAYq0@q@fXHFpQF YH-H0H0H 0H0H0FQF FeD60YwHh0H40FQF q,@q@_U1_U1_U1_U1_U1B,_U1B,_U1B,_U1B,pRAp4Ggpl,mx^pRApGgp,m^94X;d94;ApGNr|1nLq@Cn<`q@q8@ * * * * *,*< *H *T *`(*p *| * * * * * * * * * * * * * * * * * *( *4 *D *P *\ *h * * * * ** PPUPUPUPUT`@  0NU/88R4B<LMtvtc?x ;t1|9 >0NU/88R4B<\Mvc? ;19 >"t"%%p$vN$_$ $|%%p$8vN$P_$< $8#|#"T%%&##"MYTmMYmMYmX`YLxVkLrtk[3Xttk(X`YxVk\rtk%X<r[3<ttk$Yxkxk>kd|zp=0"P"Tp=lm##"p=m`p=""m`p=Hp=Xm\ml#|#"##"N$_$ / #,,p$Lvp$dv$ h$h[' $ $ s0 s$` %#$ %|#!!2p2 3343|1${tPN#k66{"t"x##"r" ""##"\dKBdlCͻmg(Bt(ͻmtSPp >x { 4a,G_[[l8|0K|Ka,xa,a<,|KaP,|Ka,LɼHUrL rp 8`w 4rt 88ۼ<n r` 8`r ۼ0n 8 kr 8 lq@446dH1Tq@q@q@%1T1Tq$@q @q @E N1T 1T a&a,qP@q@909qX@q@  T^$ ^( ^x  T^ ^ ^D 1T 1T q$@q|@L$7iKJ|= KTL7iK Kq,@q@ %1 N&q@% #=9dq@q @q@<~n7~4[)K (NX/\K$ ($$pD ~4P = G(GtG<ɼ8Ur< <UɼxUEɼUEɼDU\^ɼUEr r ~88H48Kip \( pt l  T^ ^ ^l (XPT?q - =  @* q - =p] @* \11q\P ?  @*   Pz 6  Pz 6Sq,Sq,$ <gX`ɼUr  ,g08 gr  8rx t @g\dAt ɼUɼUM`r 9Xb1r h8dۼn  8tZ$ZcHZ:x_GTx~cT'{Td-cZ:_GT~cT '{T-O-{<l U -!l 8, \JwH8||H8|Hx8|pH 8|H n p1JH 8| tit8|H  E=  rPSI =  rS,I,   = VrHSI l /n  1J r\S|I| q - = L@* P <J:w"PwX-x<x Jxx}j , jf z J Jxxd Jxxyx+y:w"Pw-x<vxbIx w>xXx:w "PwX -x vxP bIx\ w >x$ xl q - = t@* x"`DqM  `@* d]M q - = @* x: T]M q - = 4@* 8M d  @  @@@@@@@&F@<<<c?| ;x19"5 # ,>MP{Pp ;19 # >MNBU/pRH<{\`19c?lh1p9 # #N<BU/RH<{ l1p9tc?1 9 <#p #NB U/RX<0{tx19c?19 # #"@"DIp['t,;,;2I$z#<#@"[IXQ""##"""#4#8"[FtsF:$H04Y1t2 3|1{343|1@{%Yfb"pW""43,\;#4#"2 3343 |1L{  g(0 YɼUHg`h< lg ?<ɼUg6t U.U6t6,tq@q0@ U.Uq@ U.U@6tq@ U.U 6dt5@$q@6 tt q @ ZZZZZ Z$Z(Z,Z0Z4Z8Zq@q@,`,``,\`,X`,`,T`,P`,L`w2,2,2,2,2,2, 2,wwSs2,Ss2,2,@2,0S@sS0swwwɼUɼUɼUEɼUɼUEɼTUۼn ɼUۼn ɼUXZZ0 W#d'7",*C$#'7eL #L '7 # '7  1#'7Tr,#<'7`aL6M(HOX0 .-UObj,P>2$xW\tteO a. vC.  eO a. vO(&.O`[!qd@q H- =#YD# @* q - =q - =WYx#q - = @@* D `@* drY q l - p =  @*  rY  t~ @* ~ @* 0~ @* ~H L@* P~L P@* T~ @* ~ @* 0q5qp)<F *L=? =Ã, B8 8 FX }p 4Dž,  qqE X<l <gX`Al ɼUɼUr ` Mtr 9Xۼn rT RC0  d <gX`Ad ɼUɼUM`r 9Xۼn ۼn ĩ d/0/:/DR\  l <gX`Al ɼUɼUr ` Mr 9Xۼ,n rl ,R,   Ht8|lH08|(H8|H8||H48|, X(@bCCo(`t(gCCKiKi(d KD i( f0g@gXgp3pg$g3pg$33q.P3pg$$$33q.pg$ ZZZZZ Z$Z(Z,Z0Z4Z8Zq@q@,`,``,\`,X`,`,T`,P`,L`Sw2,2,2,2,2,2, 2,SwSwSs2,Ss2,2,@2,0S@sS0sSwSwSwh3$$$39)$$q$.Pu|3q.3q.<3q<.FNFDNPFNrT hglt gP pgt|? P? P? P0 g$? P? PɼUɼUɼUEɼUɼUEɼTUۼn ɼUۼn ɼUXZZ0! h9^! 4 ` =! i4L \B! \Xi\4." p#^! l tp" 8. Fv {i|:v {id:V q@ d/n 41J 4/n 1J K  LD  LK $ XLD 0 E 0K  (LD  $E? @C,@ Dc@ v,@ D,@ DD? ,@ @D?  ,@ D,@ Dj ,@ HD,@ D@ @ @ A y A @  T*h`*4 *Th`* *h`*D *dh`* *h`*T *th`* *h`*d *h`* * h`*t **(*@8*26@`(@!0 @ @       @ @   (    (H0 0 0$0$0 0 @0 0 0 00800 0 2rr000000I0I0H0@@@@0%@0%@ !@ @$@$@0zl|N8U(/(Rd\Btt<vDHcp?19<b @iKXUrh\0zl|N8U(/(RddB||<vLPcx?19Pb TiKlUr|\0zl|NDU4/4RphB<vTXc?19Tb XiKpUr\0zl|NDU4/4RppB<v\`c?1 9hb liKUr\NB(U/R`<8Md{d19c?19 # #LL:4Lh:XN$K=X6T{ 3tLt:| Ot4OzL :MOgO`.OKOO<L:L:4|`H8|X$DjH@8|8_RD jHP 8|H Θ f֛ ;;P4>J<$:::qd^L3i) 4Y%  `H8|X$ $( jH@8|8(' R( jHP 8|H & f)  ;;P4>J< $3 3 3& q`' d^$ 3hɼdUhEC OdEɼUr X1ق ; +̇ ( |0 6 5S Gs `2~ 2~ < ~ 2~ r ~ 2~ @  P   ( l   d   @  3 HcK |5 ` q @e ʌ  \ l g 4g8@8  g gr L Dg,4rL E3KD_NF  sE3F@pNFD Kl_K_NF  NF E3K@_NF EX3FpNF = fFpNF E 3EH3Eh.P5Ol / / 5O /$ H/| 5O / Kcn|/ cb|/$ @@@@@H @H@@@@@@@@@@@@D@"Q      @  T TT8 P&P&0/0RpBdd<MvcH? ;19 |;B # >Mlvl50V2 3343|1{[:A|:2 33430|1\{:l$:0;:G9M2 3 3T43||1{:8t0m@4%Ypftm4tr<DKsd3rL"p=P#@sh p=l u<p= up=S>"tmnsm,uI['"0"@w%Yf:#(#,"w%Yf:## "wXS>d":$MwhO%Yfb<:$MwpO%YfbD"0"@_$ w%Yf:##": $0tMwO#0#4"wS>"MwPO%Yfb$%YxfbET?ВlCq $- (=E @* 4ET E" ( В C"( В CE q  -  =  @*  .1h.01/ @/D d5Oh 5O / $5O( d5Oh / / l/p 6t" 4y"\ $44\y"  4y" 4y"Hq@#0w5#eX#PSq@qL@K_NF @DFF@pNFD kFWNF8 kFWNF K_NF kF0WNF kFWNF |TKTMF pNF x M( kFh WNFl E.Jt5J5J*J(5@J= K K$J5J\5tJ *4 iK K J 5  K( \q@l1,L#'7`^=]ݵ  q4 @d q @` ^` =]` `^=]q0@Taq@0"q@   qd @8 a00"q0@q@q@0"q@a aXl5q@p @g\dAp ɼUɼUr `M r 9tXHۼn r  R  R<  <gX`A ɼUɼU4E EɼUr  ^rP ^EɼUA8 ɼUAx ɼU @g\dA ɼUr 8r 8ɼUP0  0 "8X^9lp=t^9=l$50hl5h^9tx=|^9 $=(Dp$h@I@ - P$r I  $ I C $ I ڗ $! XIX $I %X$j(I( m $ I KP_NFT Kl_NF K(_NF K4_NF8 PFpNF  K_NF  f0"F pNF, E.FdpNFh F0pNF\ #<q@pRApGgp0,m8^lqq@MpRApXGgp,m^m4Mn Cn$ApGA,m^ApGq8@lq| q MqL @q @************************#V I@ IH @ I@ I@ I@0IB0I@I@4I@4I@4I@< < 8 @ @ 8  < @< `@DD@DD@DDDDDDD%Yhf##"""%Yfr"p=s)mKs3#nsm2Iz##8"Ks`3rH"p=L#@sd p=ht4mY1<tad:LwS>"""$<$@K=t6p{$|$##"$7 w _$\ 2 33D43l|1{|1{ex:e$:teEe:e:e:e:e:e:e:et:e:ebte$ EeP :e Xe :eXeh :eite Ee :edtehEe:g8g\A|}2@yD2U(64UT6+a}28y<2x}2U 64UH6+aM$I $X$D(I( i$I ($I $L`I` $I `$0I0 $I q@W Uwq@Bqt@9Lu9 `qd @F F 68q8scOWd{1Xpkq@X=PG6hiDq@ql@ H4p`S(# x`t$L 48P,q|@q@$qt@`g(  8 q D- H=3- (4.HL3q.F|NlFN @* 3q $ - | =q  -  =-$ , SPsCn <Cn @Cn Cn 8Cn Cn `Cn  Cn Cn Cn Cn p Cn t Cn  Cn  Cn Cn  Cn Cn h Cn Cn Cn Cn Cn XCn \pRAp4Ggpl,mx^ApGpRAp\Ggp,m^ApPGpRApGgp,m^pRNr1Ap8GgpD,mt^Ap Gp RAphGgp,m^q\ @Y1Ht|1{|10{DDLD2 33043X|1{D:84_$ DlS>"E#EqY1Lt_$d DdDH|1t{BDDi0<i@<2IpzU @Ɗp֊{,z<v ,>UU("h"l_$ P0PUF#l#p"8|lJ,5 K`,S|&hq@q@iKq@>$7qd@>$7`Jl5,S&q|@q@q @>$<7q@>$7q\ @>$ 7`j\IOV9HYOdV9lOV9pFYpFYYh  b40 rJh J  b4 rCD^M qvxbIx :w"Pwl- rD< ^vx bIx :w "PwT -` ^ =] vx bIx M q5 Bvx|bIx vxbIx :w"Pw-Ly *2,2,* *2,2,+*t2,x2,|*2,2,=+4d+4 *2, 2,*D *2,2,* @ɼ<UɼUɼUɼUr r 9Xr ۼn ۼn ``r r M4M49X#<#<r< ٽL^ٽ ^ap,q@9qP@q @q, @q| @q @q8@q@q@qD@q@q @q@q@qL@q@q@q<@q@q@q,@q|@q@q\@q@gD<9x(bT[ &J k f 27(9TM%&TUIwj7979J@kfkf%UIU#I#%p g=8L dghp g g  g 8   g   K W&  ,} |% (1 j. j$.d c< Lc \e e ~c e c dcLcD\e eP~cPe(cl J ? ?@@@x@x@x( x"x$ x`x x xxx2H 38Ll:`3343<|1h{ѓxߓ%G%""ON%%%#8#<"L:Lt:X'0h472x 3hCh7343<|1h{ѓxߓ%G%""K=L6H{$T$XON%%%##" @g\dA ɼUr ɼUEh ۼn Eɼ,U  P h 800 "<ɼU2,42,L2,\2,l2,|2,2,2,2,B,B,B,B,B,B,B,B,B,B,FGFGFGFGF(GF4GF@GFLGFXG&]@@@``@ @@@@@@@ @`@@@@@$78 Lch"t"##"gctq""#p#t"## "(xIMxZK=\6t{4 4_$ 43|_$ Jl242T 3D343|1{2 3x343|1{"`"d_$| $$2, 3_$  3|43|1{_$ _$4 #x#|"_$ K=6{""""1? |"0F>P q@qh@|"0<& `d^[^8)eOa.` vq @<( & `0 d< & `< d 1^ C_$P_$P Pz6 Pz6_ )L=ݵq|@"`\qXBl5-VBl5-V 8aB@l5-HV@ X(Bl5-VxH~$ Y X ! 3 ? p  mBCQ#H'7<q@jsjxsp4tbjs4bjs4bjs 4bjHs@4Dbj|st4xbjs4bD4bo|xq@Y?40?q?k?q?k?Dq?Pq?|k?q?q?k?q?Hk?hq?k?q?q?k?$q?pk?|q?k?q? k?,q?xk?q?kY?0ApPGApGApGApGAp$GApXGApGApGApGAp(GAp\GApGApGApGAp,Ggp,m^Yun,m^YuApGlq8q0Mr `l #r )r `r` )*U`@@````@h@hPhHhHhXhؐhHhLhLh̐Bl̐hL  R R@ P P@ P h`&1`&1 &1 !&1!&1!&1@ &1 &1@  @vP PTT@TTTXPP0@@@ @@0@@U@@@A``@ @@@NBU/19RH<MDvD{19cH? ;19"T5 > ; \>MMZK= 6${M484M`d4(IJl2x 3h343|10{BD2P 3@343|1{2t 3d343|1{2 3343 |1< {rT ɼUۼ n  Qۼhn hGۼn [ۼn r4 r $x'M`88/8 8  @ kA ɼtU'l'@A ||p|(|4T>>9lD;P>Jl|6   | L 4 4P CDX ^ rD ^HT8|H8|pH8|(#pp))H)H)))4`)`)))Lx)x)))p))4 )4 )J0 w< HT8| /x< P  f @\hl5 M Lm lL5 M \mM m x M p m p M l m v CM xm g ,Ej ,s "Ej sg Ej sz Ej sk Ej sj i ` j hEj dsk Ej s "Ej s|z XAz Qk XEj Ts1| KEj sg T TEj Tsg P PEj Psvx0bIx< w>xL (?pCD^,rD$^K( iwX>vx| bIx w >x x:w`"Pw-w>vxbIx  w>xxxDxy{Ix zyw>CD^vxHbIxT :w0"Pw-vx|bIx vx bIx :w "Pw -x8 HrDx^ T^^^vxbIx yL~vxbIx :wp"Pw-vxbIx :w"PwD-!P! x!|x!x!tlpx!x!d\`x!xLx!|xqH@q@q@,S@$$$$$$$$@$@$$$`8$`8$h8$h$hB$h$hH$H$H$@$$@JJ@J$8$8$($($($@ $ $@$$@DD@P0QBz M4v4tB{nzB{c(?M,$1490c8?< \;41@9/RLB{,Pk8  U .U q @qH @q @q, @q @q @q@@q@q@q$@q@q @ U.U U(.U0q@q@q@q@q@q@q@@q@,DSH&q@qD@,pSt&q@qp@,S&q @q@,S&q@q|@,S&q@q| @$ , S &, S &q0 @q @q @q @,DSH&q@qD@,0S4&q@q$@,(S,&q@q$@,S&qt@q@,S&qh@q@,( S, &q @q$ @ ,T SX &q @qP @ 5xָ5`ָS ָ SD ָS ָtsH ָP s< ָH  4S ָHSl ָS ָ5`ָp< T`T||`H8|x8ɼPU8E8,UrX Pb g$` gTɼU˗ h ( g@ H  R( 6r R$ 6SLۨ%PqEpۨ   F^!q45qD)Œ<q@@9hAh2$W^:jP  qp!@q!@#%'7% |`H8|x8ɼPU8E8Pb gHUrt Y% Y% ` gTɼU|% h ( g@ H Y% % ( /r % $ / Xp Vd! 9^!   yLc\! i4 LLcX\! LHiL4." T#^! P Xp" 8. Fv {i`:v {iH:V Xqp@V q$ @V q @. DF|%  aT rC XR aT r. FC <R' xU  t= t_c Yc x9Q |)! 1&  ~& 0 <& H L ' 0 +% 0YC hR:40:q ;k:q ;,k:hq:tq ;k:q:q ;4k:@q ;lk:q:q ;k:q:(q ;Tk:q:q ;k:q:q ;<k:xq:q ;k:q ;k:P0r /r (ɼDU/$p=E / g\p\ /P r /=//ɼU<EL^rp r` r /{ H{ `o]dH| !o]${   o]$ o]x^H?(\?| H?\?  J9x t 9x |  ! o]L  o]< , @D04 $pt`dPT'c0@@x L@@@@   @@x@xsN 3+K=6{%Yf%YfK=60{@< p=@''e$['("h"lK=6{NH'd(dI##"#0#4"#t#x"_$ ##"2h 3X343|1{_$8 ","0#d#h"z+<*$7 2 33$3h43|1{2 3343|1 {""#L #P " s( D Gp wx E g8ghgggdgg"|#gP"|gdg"P|gP"P|g|"P|g"|g"|g"|#" |gg ggDDg q@q0@6ia6PiPaS86 i6 i aO\ P |`P@   D9tu9|`PG6XiDq\@q@q@q@q@q@q@q@Pq@q@q@=QTq@qt@6iaq@qD@|q0@S8QFq@q @P4 G6 i  D0 ~ r Mqh@q@q@@q@qH@q8@Zq@9;F =Q i4L `B `  i`4i\:i<: Yci:'   _c8 5 0i: $ DiL:V Lq@ Yc'    _c  $  . DF|%  aT rC XR aT r. FC <R% p9 |  yLc\o d d =% Y> 5 }d! 1& @  ~& h t&   ' 0 +C RFTpNFX K_NF FpNF FpNF FpNF K_NF FpNF K_NF FpE3 ;P>JFpNF  NF K _NF FL pNFp KH _NFL F pNF E .g * @BMzDD(K19$ 0;c(?|19c ? # > 1 9MP P \  x ; 0 # \ > # >FpNF K_NF F|pNF FpNF FpNF K_NF FxpNF K_NF F pEl3 ;P>JFpNF NF K _NF F8 pNF\ K4 _NF8 F pNF E .}lf}f}f}f1T}0f1T}f1T} f}D f} f#L=}f1Th UD.UH U.U U.U U.U  U.U U.U U.U U\.U` U.U U.U  DyLc4\Q DiD4   Lc\Li4i:i: }dpi(:' ( `o $d P 5 @ 0ip: p$ i:V q8@ 0 }d` ' (  , o  d`   $ $ rT Y  D,~ + 8 # q@Y 8 ,ɼ(U *~# @qH@  g$ 8r| r A#P% %g%%T'A )* *g**A $,t`$ Dq@ De#P'7\#<'7H#'7( 0Pz<6 xPz6 Pz6  Pz 6# '7x # '7 `?pq - = @*  D] 4&H?\? H?\?H   I I I I I I I I I H$  H$  IgHgP1818"|"|ll"l|"l|N$N$"$|gP"$|g"|"|g ,g ,akakxBLxBTBt C\ CBD    U.U U.U$9Hq@a,ql@q@q@qh@q@ U.Uq@q@ql@ U.Uq4@q@ U .U(   E$ q @q @q @q @at,at,a,a,q@q @qt@39)$FN8y x8T3ql.9T)l3L$l0390)LtZ: :Bd rs C$ :"` qB rsLCBrsCB8rsCBrs0CBrstCP$~5`6#d~(5*Hd~85dp(6#0dd$#h~58~D 5~ 5 ~H 5 ٱT <dd  6# ٱ <d ٱ <d :4q:pq:q ;kJ0_ ;LkJ_ ;kC8eJ_JP_C8peJ_ ;k ;kJ_J_ ;4kC8\eC8|eJ_J_J_J_C8e ;<kJ\_ ;|kJ_ ;kC8e ;kJ(_JD_:`0:0:0?|q?q?4q?kN _?<kNx_?k=eN_N4_=TeNx_?k?kN_N_?k=@e=`eN_N_N_N_=e? kN@_?`kN_?k=e?kN_N _Y?p0Y?0Y?H0OD4qODpqODqDkfU0_DLkfU_DkAefU_fUP_ApefU_DkDkfU_fU_D4kA\eA|efU_fU_fU_fU_AeD<kfU\_D|kfU_DkAeDkfU(_fUD_D`0D0D0I4qIpqIqHIkY0_HILkY_HIkFeY_YP_FpeY_HIkHIkY_Y_HI4kF\eF|eY_Y_Y_Y_FeHI<kY\_HI|kY_HIkFeHIkY(_YD_H`0H0H0*o @ @ 0@ @ H H H H"``A` `    `$      (#@@@  ## ` `%82X 3HHt343@|1l{'""uH HH(#x#|"N %NN%<%PN\$7 "p"tuHHH##"N4"X"\uHtHxH##"J 5J*HJD5L7iK^vJ*,J*qh@vC^vq@q@q$@qt@q0 @^v q0 @^v q8 @q @L 7iK ]h K q@J5q@q@vC^vq@D40ODqDkOD(qD@kODqODqDkODqODqD,kODhqODtqDkODqDkODqD4kODXqDtkODqODqDkOD$qOD0qD\kODqODqDkODqDHkODTqDkODqDkODqD0kDx0 44L:q ;k:q ;k:Dq:Pq ;|k:q ;k:q ;k:Pq:\q ;k:q:q ;k:(q ;Tk:q:q ;k:q ; k:@q ;tk ;k78C8eIJlw ;lk ;kIJw:\0:q@ɼ<U|>8#>8r( r@ >@89pX`p-9X>8#`-`-M`$$?`CP"`X&XG`-` G K>8r` ` r  "r ` - ^h8 $J5L`7iKdJ(5J*H KJ85 KpLL7iKT K KLiKJ5dJp 5J 5 J 5 J = K J = K LT 7iK\ f  J= Kh%\`](]J'q x- =; 4@* 8BB <@* @;z]J'q - = @* `d](]J'](]J'q 8- H= @* t9p q , - 0 = H @* L B q  -  = 4 @* 8 ] (?k?kgNw?4kN_N_?PkNp_=eN_?kN4_?Tk=eN_N_=eN<_?\kN_N_=e=eN _N@_N`_N_=e?k?k?kN,_?Lk=le?k?kN_gN4wgNhwNr1Nr1q@AptGgpt,m^qtMqMApGgp,m`^Nr 1ApG,m^ApG,m^Nr41ApdG,md^ApG,m^q@ @Nr 1NrD 1NrD 1Nr 1v v Nr 1Nr 1v v,vXvXNr41vv( v, v8ɼ<UT htX td xp g4 HT  gp g@ X d z Or @ X d r r r rT 88r r  M` g^88  ɼ, Ud L g8L8D ɼ U ɼ8!U!ɼ!U"ɼ"U"E%r' L(Er( rP* l J @RR@@@@@ @R @R @pR(%,*%`B*%`B*%`J*%`J*%bZ*%bZ*%bB*%R@*%R*%R*%R(%R*%a(%R*%b*%R""0h# #"""0Dh##h"2Iz""0h##""0"40`h##"""0h#<#$""h"l0h##"""0 h#H#0""l"p0h##"D4%Y`fLDY1(tL`2I`z|1{2 33043X|1{2 33843`|1{D"" DL##"a:hY1t['PLL|1{D( D E BD D Y1 tD |1L {;VA@@@@@@@@@@@@@@@ @@@@@@@@@@@ @xxx @x @x @xx@@@(@(@ (@\A\A\A\A\A\A \A( \A0 \A8 \A@ \AH \AP\AX\A`\Ah\Ap\Ax\A\A\A\A\A\A\A\A\Ax\A|\A\A!\A"\A#\A$\A%\A&\A'\A(\A)\A*\A,\A -\A.\A/gTgH18"|"|1l8gX1l8g|"l|"l|"|"|NN"|g"|g"t|"t|g,g,akak B T  B   l B C C\ l B  8 Vtn0"FpNF FpNF FpNF kF@WNFl F@pNF\ F0pNF4 kFWNF kFWNF kFWNF F pNF F pNF Ft pNF Fx pNF F pNF F<pNF@ FTpNFp FDpNFH FpNF kFWNF E.2,2,2,2,2,2,2,(2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,L2,2,2, 2,p 2,t 2,x 2,| 2, 2,XB, B, B, B, B, 8 G8 G8 G8 G)@@@`@`@Hp@Hx@`(```````@```I@I@H`@HD`@H`@H@Hp@@Hp@@Hx,PSX&q@1hNl&q@q,@1N&q$@q@,S(&q@q@L% 1,N0&q@q@1N&q@qT@1N&qP @q @1L NP &q @q @` s %  % LL,,S0&q@q@#=v|H`H8|X g r r ,U84HɼDUr` r ?T x ?x  ? ?XYdxYpYY,g`h8 gr8 r8 R<6: 4@FpNF FpNF FpNF > FpNF FTpNFX FpNF4 ݵ Z FPpNFT ( T^T ^X ^ kF( WNF0 F pNF kF WNF( F pNF F pNF FpNF FpNF FpNF FpNF FpNF E. 0 @0@@ B@ B@ B@ B@ $ B@ R@B )R@ $ B@ B@  $ @  $ $ BPPE44_$ Y1t2 33 434|1`{@F_$ DP0DPP0dPP0P""# #"[F`tsFd:h$|:D:$EH BF4 K(I($I($I(HI44FXFlK##"""#<#@"FDD|14{"0"4#h#"##"_$@ K=T6x{'T""K=6{'$$##"""$$1##""$"(_$@ (Ia:tSYwS>":K=64{"@"D$\$`%%##"H;Aq@AqD@AD7UA86P<AHPl<AAHPT <AA HPD <A A HP< <A AZ7 U7UA@AAPAAA(AA7dUBDA8AAtAAAxAA0AAAP2 ;4k ;k ;kJ_J`_ ;kJ_C8eJ _J8_ ;kJ_C8eJ_J_ ;XkJx_C8e ;kC8eJ(_JH_C8heJ_ ;kJ_J_C8eC84eJT_Jt_J_J_C8e ;k ;k ;<kJ`_ ;kC8e ;k ;kJ_:$0:X0:0?k?k?4kN_NL_?kN_=eN_N_?LkNl_=eN_N_?kN0_=Te?tk=eN_N_= eND_?dkN_N_=e=eN _N,_NL_Nl_=e?k?k?kN_?8k=Xe?xk?kN_Y?0Y?<0Y?0D4kDkDkfU_fU`_DkfU_AefU _fU8_DkfU_AefU_fU_DXkfUx_AeDkAefU(_fUH_AhefU_DkfU_fU_AeA4efUT_fUt_fU_fU_AeDkDkD<kfU`_DkAeDkDkfU_D$0DX0D0HI4kHIkHIkY_Y`_HIkY_FeY _Y8_HIkY_FeY_Y_HIXkYx_FeHIkFeY(_YH_FheY_HIkY_Y_FeF4eYT_Yt_Y_Y_FeHIkHIkHI<kY`_HIkFeHIkHIkY_H$0HX0H0_ 4   j<.i) /%@Lcl\M m j.i) 8/%Lc<\M m M m  M T m M (m M m M m TM m (M m M Tm M m M lm lM tm M Dm M m X!M `"m "M #m x$dgBXɼUPBrP H$BB(LI  C<X<4 BP ͻm B$ C L  ͻ mg  g>l{SHr@ {@rT 8ɼ4UrT ۼn ɼ|UMpɼ|UMl`L`LɼUtL(r r ɼU(9X9Xɼ$U(??##ɼDUD (??d ( ? ?r   g\ d r  \ g4 < (ۼn ("?"?($a,G_[[l8G_G8_[P[lp8[[l8a\,G_[[l8G_G_[[l<8[[l8 h   a ,a ,|, K    `  a,a,|KG_[[l8,G_[[l8<`|K0$A$I%I%I$I"I$ $A$I%I%I$I"I$  d^4S:/3\ w^< ^w^^^d^S:/^d^ d^D!S:/P d^"S:/!^#^`#d^$S:/#^%^%^H&^l&^&:/'^(^T(^(^*^*:/,^+^+^,^|+^@-^-d^.S:/J\;P>J;PT>JɼUɼUɼXU;P>JpɼU½;P >J`ɼ$UrT r  V ~ A< , ɼ( U8 A A  ɼ U  g    g r, r  r Al <ɼ8U8A A|  g$r r  dr U6x6{2 366{3D43l|1{"W]$ r"< "Qp PH; \8P5 y6Lo;x] ^ 50V-^<dr"x N#hk2Q^0r^H*P<; \8D5 \8x5 \8x5 y6|y6 389HM43^$"W9M[:|A^`9, M" Wr"8 ^T `1{\8 5 \8 5 y6 y6 ^o; o; r" 2 2  3^@3x43|1{^<#r"8 ^@ ]t ] r" ] ^ ED[@s[[ [|[ˤL[H[[ t[p#[9@[<P[g [~|[x[H [Då![ڥ"[p#[l$[<%[86&[M '[ dx ([t { )[ D *[@  +[  ,[ צl -[h  .[ 8 /[4  0[ 3 2[ It 3[p a 4[ w@5[< fKX L NM Lm -M LmM ,mM mM m t /D \ /@p M mM ` mM (mM mM mM mM (mM mM HmM mM hmM mM mM  mM !mM 8#mM $mM X&mv 'CM `(mM )mM P+m + .M /m x0 2/<2M 83mM P5mM 6mM 8mM m4?@=p=lx=5M p=mM 4?mBAAlA5M m0FXEElE5M Am H/HHIIHIlPI5M mJlSIp&q@q<@JSI&q8@q@J@SID&q@q@JSI&q @qp@JSI&q@q@~JSI&q,@q@J( SI, &q @q @J SI &q @qd @~ J@ SID &q @q @~ J SI &qX@q@~hJSI&q@ql@~JLSIP&q@q@~JSI&qd@q@~tJSI&q@qt@~ JPSIT&q@q @~ =tNI|&q@#=K4in"Kxi!#`i< 8| L o]  iH 8|$ X o]  i@ 8| P o] i8|o]dXiL8|(\o]Kiix8|To]!#,i8|o]thi8|$o]ti 8|o]xlL i 8|  o]0!$!"i#8|"(#o]#x#K#i$iD%8| %T%o]%%G*G*G*G*G*G*G*G*G*G*G*G*G*G*G*G*dt4d$TDtDt4d$T < h     D p     L | h    ( X     H x   8r` /`r4 /4r /r hɼlUr r( (/(yNT N\ / r  / r\ r0 0/0X gr r /ɼUr /ɼUr /r / grp p/pr ɼUYprx x/x?8r /r Q@!mx!rL" L"/L"r$ r\$ r& &/&/'rd( d(/d() )g))m|MnCnm|Mn(CnlApGlqqMp(RpRApGgp ,m^Ap|GlqqMApGgp$,m^p RApGgp,m^ApGAp GA ,m ^lq q Mp RApd Ggp ,m ^Ap@ GA ,m ^lq q@MApTGpTRApGgp,m^ApGpRApGgp,m^p,RAp(GAp,GApGgp ,m^lqq(MAp(Gp(RApGgp,m^lqq Mn<q@q@q$@qp@q@q@qT@q@q@q8@q@Cnm<MnCn,nXq@CnmXMnCn0q@,`Sd&q@q0@,S&q,@q@,4S8&q@q@,S&q@qd@,S &qt@q@,S&q @q@, S &q @q @, S &q @qX @ ,4 S8 &q @q @ , S &qL@q@\,S&q@q`@ ,@SD&q@q@,S&qX@q@h,S&q@qh@,DSH&q@q@,S&q\@q@l,S&q@qd@,S&q`@q@#x=1N&qT@% #t=Dr"|grg,akggAg<DAg r{ * f/ }/|  r8pr H1q - = @1IT !8I` I8 }2!0U<6P\'kl>~x:.k>~:. Ag !!"}"2"!"U#6P"'k,#>~<#:,#.kd#>~t#:d#.$}$2%!%U(%6PH%'kX%>~d%:%.k%>~%:%.P'y8'2t'.'y'2'!4'U'6P''{0)04*"0*"0@+"Cn Cn Cn Cn Cn pCn tCn xCn |Cn Cn Cn Cn Cn Cn Cn Cn Cn Cn Cn Cn  Cn Cn $ Cn ( Cn , Cn Cn Cn Cn Cn $Cn (Cn ,Cn 0Cn 4Cn Cn Cn Cn Cn Cn <Cn @Cn DCn HCn LCn Cn Cn Cn Cn Cn HCn LCn PCn TCn Cn Cn Cn Cn Cn \Cn `Cn dCn hCn lCn Cn Cn Cn Cn Cn |Cn Cn Cn Cn Cn 4!Cn 8!Cn "2d 3T343|1${w|S>"##"N$Ht2 3343,|1X{&HwS> "2P 3@343|1{NX1`G GGGGGDG8G>G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?GGGGGGGG(*G(ZG(*G(*G(G(*G(*G(*G( *GwHw>wl2wpExH)xp#w2wE3x(gIx _xvxbIx xpxw2w Exx, vIx x y wD 2wH Eyh +y( Ay Xy$ w 2w Eny| iylIxh yHyp+ytw2wEw>y~y:Ix y{Ix +ypyIIx< x$#zy+zBz7[z1w,2w0EszzxwT2wXEzqIx@ zl9z XIx\ z|d?5Ix? w?E}@IxA PwPB-0}0CT2,2,2,2,2,d2,h2,l2,p2,t2,x2,|2,2,2,2,2,2, 2,$ 2,( 2,, 2,0 2,4 2,8 2,< 2,@ 2,D 2,2,2, 2,$2,(2,,2,02,42,82,<2,@2, 2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,!2,!2,!2,!2,!2,!2,!2,!2,!2,!2,!2,t2,<%2,@%2,D%2,H%2,L%2,P%2,T%2,X%2,\%2,`%2,4*2,8*2,<*2,@*2,D*2,H*2,L*2,P*2,T*2,X*2,\*2,(%2,-2,-2,-2,-2,.2,.2,.2, .2,.2,.2,<42,@42,D42,H42,L42,P42,T42,X42,\42,`42,d42,-B,h4B,l4B,p4B,t4B,x4B,|4B,4$B4G$B4G$B4G$B4G$B4G$B4G2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2, 2,2,2,2,2,!2,!2,!2,"2,"2,"2, "2,"2,"2,"2,"2, "2,'2,'2,'2,'2, '2,$'2,('2,,'2,0'2,4'2,8'2,<'2,,2,,2,,2, ,2,$,2,(,2,,,2,0,2,4,2,8,2,<,2,@,2,012,412,812,<12,@12,D12,H12,L12,P12,T12,X12,\12,462,862,<62,@62,D62,H62,L62,P62,T62,X62,\62,`62,<2,<2,<2,<2,<2,<2,<2,<2,<2,<2,<2,<B,<B,<B,<B,<B,<B,<B,<$B<G$B<G$B=G$B=G$B =G$B,=G2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2, 2,2,!2,!2,!2,!2,!2,!2,"2,"2,"2, "2,"2,"2,'2,'2, '2,'2,'2,'2,'2, '2,$'2,('2,,'2,0'2,,2, ,2,,2,,2,,2,,2, ,2,$,2,(,2,,,2,0,2,4,2,$12,(12,,12,012,412,812,<12,@12,D12,H12,L12,P12,(62,,62,062,462,862,<62,@62,D62,H62,L62,P62,T62,<2,<2,<2,<2,<2,<2,<2,<2,<2,<2,<2,<B,<B,<B,<B,<B,<B,<B,<$B<G$B<G$B<G$B=G$B=G$B =GC'@ @@@@@0@ @ @@@@0  0@0  00000@$0!!  @ @0@0@@0  @  @@  0  @ @     @ ! @   @ @  U UUUUU5ED"P*Tضmmmm۶UU$II$ :/,f.00!!C!C!*BRU0DH1I)I $H$!!E 8H$$Ij1)%IF&~<b$@F # A I $ATUUUA$U@H>`+(i' Thl۶۶mUU XUU=X53333H%ADDDDUUUv I2%LCMS*:$#; Z 9@ $I% $``Ubb bEIDH2{mj0|`PU [_R I)d @ y7Ke,Jj*2 tKDu1d$ UI )I1d U)rEJUb" RU<UUUZ UUUS*# jj.K@Ob&IIae'H  0eL30)e24M 'I$ $ ra!8EkebJ6es `  AA$EHTd`$%!r  I@u*!@@"" ")A* #^]#^@՗W(+IZZaa$EJAJAA A!D!HjUUUUUU)& IUJ*UU% U >Ud J*UUU eUU<) (U )Ib$%IHL$H$= 2 R !TS$II"G!j  %Z@I&" $ ? 4IAb U0D`O8 $$ V#L(T&T&    |HUMIkk-kH&PrTUUURJ)RJ)!C !C D"H$?)\0HHB!B! """ $ H$AqJRT*RT*Jp 3 TPdfffc11cUUUUES _ *&)Q)?&zN. @((((dYeYYeYex"GpxaTTTTTTTTbҡ_PU 1d eYeYeYeY!C 2$!C 2dH.&LbɴU( A%!J@I$I$ZkkZeL UUUUU00 C$I$I%$I$M &@ @ @P( P( BP HaZkVr,C    mD?)@k8  P(A?   X$ dAdAd 1-lmͫ7d<>[c]@x|z `ZN"Y{} w`\`\\\\\ ] ]ݟݟ`pP`p@ǫq@ `\\\ ]'P@ 0@Plinuxv2.8.1?0Z99q Mͱ3%7'<iװ!`Iñ2϶|\K,?_< :,?i:-?Dc*. |((8(HP(((@` ``L`f"(08; 8'G(ֱ4`@on H(͎ @ڞ@ڞo_߱5߱5૦૦M૦@஦஦@N஦3+&q7Kϱ3-2o-ǰ s rV)ہ ݞ ݞ ݞ ݞ ݞ ݞ ݞ ݞOs#%o~ T8/L ߰!kM3@0N5"C%Cv.H-h  (8@`;@;@;@;@;@;@;@;@GYG[QEد>"GC/W:HGCVy "rOnN$6wy ,@b[[[[[[[[\)N"$\)cZG ;s7,1Wڱ4t0`\`\`\`\Pk\\\(\\8\@\H\p ]X ] ]h ]`\x`\,`\ `\\\4\@\8\\<\`\X ]ذ ]D ] ]`\ \@\` ]5]1ȱ2:ѱ3g%-Wΰ 9H;7}Sj$/M(%8w7}SY.8 9GCkȱ2>'%ΰ !"~S!a")>hi 11j*M(ȱ2$^Hj*;5<lUF %0yfq/?uP/?Pk@a@aaPapaa4;0>> ٯd%"fϰ fM($k*$5w!ʯ#%V>V -j %!WVϰ M(x+v/f i i i . %ʯy 5i ٯ8$$ U]),7M('а Nk*9lM~])!V<""y+`5d-.O7"oRE*pN~S^H5@7<Axk**>i ])H!%m!%/!%GN(Fy+ԩ/$0k*qy+oN(/gN(0k*/#=-!%%Z$/&o;!;=!"U</&N*>N(N(b,15m.ZMDGа *"w#7O?'\ٯ섲V^!of$e`e`ZGV$!а f! Y.CYj @ ("&@@@@@``n``n``n``n``n``n``n``n`GѰ y+56憱,,0& 6)#%گ ;[;Wn - گFg#&x8WQW|FJl* { j E y FFXxpNsOsOlM&&&A_!16gѰ g6@'UFRETG8n!r5@/ ;```````` Ȼ ػ k mw+fhhHym*3k !7`)!f(ɟ.&-|(iH?U! 0?#@ ) 4 L ̯k ZZx 6LI#Ұ Uj5T%%0><! 8{Ұ K##Z$:%=,jB;   Ij tAq5&԰ D'e!ί_ða)!̱2K!&+F Bh ; <WFİ߯Ჰ8l]l S=/6&EB+L}$Mm!!0¯ '¯`T |Rְ releasego1.25.8mipsle-sfզզ$_ $_ զXP ݞݞཪ x@ڞ ݞ( ݞ8 ݞ ݞOG ڥ@G`7`7@`7 7@07@p7@kuް! ӻ#H@x;@;@;@ x x xf Bh[x[`[$(t`\ 0\@P\`p ]$_ _`\;`\\@X \|ޑ\<@\T ]`:` ]`\\\ ]`\0\аP\p ]<F0͌<>`5,W0>,W@> @@bH X e`x#`0(`n`(`n``n`````c`` c`cb" `#l( `ʝ@>x ț@țțG@G@k೩@ ƛx. w޷ nixJy`.Jж8$IeėHr9Lfw`n*tBF`V4AP ` ȜJL kQ߄ -ׄ M\{g`KP밎ȣqVF Ġ3H z^ta `Zp]+@:A"h` ~Z.@`ǽ-࿠bwLE)@gFk) ( l4. (r!ޭ8(.Cł̪.[?s|( <.զ #x@` $զ@`$d%w&@m h&@̦0)&wb<&@Ɇ& : &m3|& & 6Qm:Y"d `Z(h(`$HӠ 4`o1 Tj #`Ӡ}Ӡ:O V 9&Ӧycb#OXQ(5 `{C" 0#ycbh# KH#Š5`|! p2=x\8" 8fTz! c!ܸy! "p6|! '{!Vͫ  ?pp@ڞpp@ڞ@ͦ$4h $c `\kL@ln0`oKg\ ݞpT> q{w= Ui ?@ɣKH4@ҠwiҠ!``)`> Ԡ?]b `Z"֠F2 <.`j `j (L*.L}حLs=fS@ϦG/L էaPI Ԭ. A N`,_XM ?)EM@ ͣ:"θhN`E4HN#4N`7Y0MT"%&4ua`{C8#`!xJ4i`+g}xi+{iV^-$Z{鍔:P/#J$ZxO;Z`^Y٣`TO;Z@3(O^BO*`@զ<Ow ^%#xݰ!#JZ)#%#Rtmcc 0 @ Va>ZLPw ۥj,4@ إ;Y<)M@yש|1N sLvzs/?JoL3`ǔ4D-J3`~`03ңLL~P3pv3 `xTx3P@`7@p7@`1`1, ܥh%= wX9Y @S Xq,D&C@3!M<I@`WؓTF@>F@`zyI@zXHI#εIOiH <.`գW-Q{G YrXGG@BP Gzլ@Y`҄dIA+(FYaI@ZoIXKG7\OFG~BcXeF {-zpPP_I@Ҧ?OIm2Er=D.m&64)I ~v8IŧZL:IF$>INd|CH>7xC@&V ELAݥ]HQ `?2XP Ƨg=PH٣D /cJ+I`/6r,I{x*I2DHB ߥ3Uk-B V4QI#`x`IpflE[yDF §fdE`[y쉳TNI</xE@Ӧk *I/R:.I/ε-IguTL9IϬ囧H@XS(H5ɥ iI@rIHeIH>7C[MIF7&ږjI ǧd#kx%# \ НKI`a ^?K6j?|(BtI /h`` ;@d~חM$;/ = w 0{d#`0{0#-b!orndOx U_nj W=z/K%˨~ZHF=>f1x@>85`f@1\Rx >ۢ8Sx@rnDPx |TXȧ% |@5܈ZVi <7 8%8%w \gA] @]g9@]>bd6̄@ԦcuCzEx}>t-9Dxu9f`lp`[D-6{ `E>4D  # `3\#ਡ _nN ਡ)3}M#3(/`4s$&`fod`෡ XJ\P>`5t@a@X|ޑta<T(a`:BP_a$d@Sb 0e`0e`">v˜ f^-E 7b@ITql3,,$b(pm/ ԧrtq/u/ԧs/? hتJ"̞J@##J#LJ$J`$ƹi}8@?] `?UC ? ,f b~fW?fO2df Q Q@`\`Q`Q\QQ@\QQ ] `\<`HW|I:0L#3+JHS8P8JL(<` c O{j @P?RC?E[22&%[2 9[2[2J[2VFF[2[`]:?<(<VH`έ|̒ i fWZvkThNH[3L[ B (I I4vx5>`ILm݄6> Jfy7y@ܩ-\| @h͠ee `iI(SiD)U7a >2HuZ,[>^Mu _.̆t@p rIӋ  \Hvv~2|ԆՆ~Tjd!}O_礙}8Ł}`q@L}ந ҝH} rYP@td8g}aY  `}ۭhO~G~ uեvxvsryJ׊ي`tಣ׿ЊҊt@rɊˊ@sbŊlƊrdn֥"twwn ifM"M" ~ux(NOɧ H36  mVZ\`.PqKLl-{p,,ld,,l`xw4,xR,lib,m,l (w=+8+l\u`^+`+l W+,l,,lรJLV|[,^,l@7w,~,lVou,v,l`"hzt,8,lVk`X,܀,l:],,lൣn2}",.,l̞͡,<,l໣UiKl,,l!,T!,$_ զ n`V̂""nid""n 8 T noJV W vT U v B (tIIv`գW-Q||G{Gvo-饻d>GX2GnգFFv ֣K EXEv֣575E2Ey pD0DyqDЫDvsWg=I=Iv@I^DVDv`أxZlD(Dxq IIx]Y0lI Ix`ܥ@HHxw}(آ@?+kXwdv~@W`5@"gۜef@ J(@@+np@)km@ҎWhhi@@uPjk@|{(g0h@`񠢤pXq@`_abcxnixJyLHxs=fhUdV -љx.t. /  .#   .qh&  -   ,}N  ,N  ۩c93:3 @@@`  ))) `v+]lW W@{@ ZZ' Z%QH'Q'hĄPЁP`@ȬRC `R`ߪb Q`WR Q`ܨUS PQ#Af,Q(Q`۩ Q`#{8 Q, Q$^Q$Q#Y,PܗP $W4@EQpFQ$ae5^Qt`Q&$AQ\?Q&IT"Q#Q@%y}G|QPQ%໭ݬ5Q6Q@( ,PP`ۨ' Q`പ:ϼ Q`@ 0Q`> tR@$ X X@ 9P X` X@ِ X X`IWW | XX`O{!`UXSX` |X`X@#WW!8ڲ>O=O`>{ Q@K$W4W@gXjX@`]XaX``ިGx @Zvڧ6`]a]`ݨg Zv \\vFld|[̜[`@ `Z`R Zr5`oۧ/>(@ Ԭ./ mY;.\Tzhz`E  r5  @7?   O,,3-3@ԩ$: S3 @7>4yJ3K3 9>cc!XcDc E cc@ ք%d%d@>݀%d%d@ 1`%d%d@@'x.dd@J@)AD$dX$d@S!$d($d@`3$d8d@s[Ez#d#d@ >="d0"d@!d"d@~!d!d@@#0!d!d@zh#d#d@%= d d@``2x d d@\dd@ [f8AfLAf@~tdAf@dd@@DdXd@wآdd@Tdhd@`x@dd@dd@ Sdd@{U0dDd@l`dtd@@yugdd`8BhcȬc ~* d@k(⓰vPHxP)!vP`P}$Q`dRdR *aEdR,dR`R R`YE 8R`r  R``X[\X R`7r R`N8 R dѺ T T+T$T` ݨKz @R`@Ӱ\ RvʫTR@>>;O\u13 @ȝ R30R37Yo"p4@3D@3 WxP3 ~F,23 dd@+z@ ΣOODO `Z1<3p Х%CleafaHga@ݤ u#Fi2it%i@l```ԥ5> ```1.p`Ԯ`Ĵ`çj>@gIEH|hI ੨BA |AA௤ȉ'I'Id(I௤X@$I%IH&IE@JCxSCKCƧ!]I^IF</x`EEE G_iC<7I7IǤ`ohB\B|B ˭DŌ4Y$Z ɧAe^Q!| ʧYwLC0<=DT ,}|چ؆؆x @b=0,`\;Px 84\@X @@<\<`HD ]`:¤ |x#8##ǤP'''@Ѥ 7   @Ѥ؀   @Ѥ r///@Ѥ&   @Ѥ >O   @Ѥ|   @Ѥ@hTi   @Ѥ^9-ax/ //@Ѥ    @Ѥ   @Ѥ F   @Ѥry   @Ѥ    @Ѥ !;.s   @Ѥ!ɡ   @Ѥ "pyO   @Ѥ"D   @Ѥ #6b   @Ѥ#Xrntk/ l/k/@Ѥӧ.Hb/Lf/0f/@Ѥ &q$   @\ @k@\kk`Gٞ@G@G  H@@`H`H@H I`I@I I @ J@ ֧!]07c8c,9cpp@Fp pp@Fs yԮ[V@VU ?^.{ UU @gш UUή- qZTrZ٧KZZZ@w%v鰀\\Ā\$ ([[ۧ/>(@Ǥݧh.xXxlx`#  `# P  Ǥ n 0080Ǥm.03>4>Ǥ1>1>l2>`#1Nj  `# <b  `#FMbo  `# Yl  `#U e  `# +#|x  `# !IX  `# c  `#`.X  `# ;j  `#(yT  @ <|KnhKn  NkPkj "uuPu@¢ ~*'k)k<$k_.JtHt(JtP|Uۧ4upuu |-PsУsФs*|16 TLuLu?]e# uuuǤ ^Xr$``\`q0udpފp φ,4Ļ̹@qXMq੊觊ԯ`r ٩[}Hı|@n dT-̫-`--vΧTAjmjk@ns.x..̭.v Χtphfhxffv u3Яu'v'u'$u'@w [sFG(KtM@w"R X=X@ CdEX @ow%sa6`rݨ"""X>!@M` \w|T LLL@zw{T#Ld#L  .Pp09`r`[ϠC< ȧ`r I'<dP~`rة1_8`r (:[Ȝ $`r٩|8`r@ϩqg s໮zW< ]B]B4^BY(` c(` vǧlQ\LԟLx xAKv̧P T`h|v@o@QUTQhQ@zէs۱DII  z^䘰.h<hh p pppp@F{ ٧49ZdXXX{Ԯ[bVbV`bVcV (`Q(`|ߧ@    | j  , @}apS    @};    v෪DQS,S$S4S.-TURSR\RROR`XjT,hTDjT8`Tv@ۨ\.8S`SHSS`~`Ktnn܆n ษW;Sendn|dn ~gv,qnpnpn ` z?Nn8OnNn  HFSnTnSn @2!Ln Ln @h@nnn `3UbMn Mn + $nn  n0nn ` ~* d@k4kP:kԦ /KDզ`5H\WU,WZlWզGʌK(4L(lK(M(L(˦`|C(E(C(XD(HD(˦*S0 A(B(0A(A(A(զj}X $@ $H $@ $h $զ8#\####@ЦT8.N`/N/Nd0N0N@Ц` ۵LMlLxLL@Цrt TMMNM$N@ѦC'`DDDDpDҦ `Z1( tzզF8(͌͌ό8͌զ Opkj\kpjiզ`{$[$t\զ`կ ֦@}1 1111֦]<11L1ܥ1D1֦111,11@nצ`dYYY`YY@ئ`zHAW|WWlWPWզ9[hlvv|vvdv@٦_L.sDyTy pyy@٦@¨_DyTy Hy@y@٦¨u8yy HyXy@٦è24yy Dy y@٦ Ĩtyy yy@٦ĨWyy y|y@٦`ŨZWyy yy@٦ƨGy4y yhy@٦ɨX沬yy yy@ڦ˨񋭒h $d"  ڦ@̨

w@w$5w@; ZZZZZZZ@)r`>'?'?'@'PA'B'B'@9)\8' 9'9':'L;';'<'@ǫ@ThfffИfff̕f@A:Pu;SXS=S,}{  d<}{ \|  ,}\{  <}{ | `U,}`K{  d=}{ h| BŤ-,}{  >}{ | &N,}{  >}0{ <| `P 6,}4z  }${ @| YY,}pd{  ?}P{ | $ -}X{  A}{ \|  -}}  }{ | 74-}$]{  A} { | `U{H-}{  pB}{ | #\-}{  C}{ | Hp-}N{  C}4{ || [MG-}̈{  D},{ | `p-}{  D}{ | {ڬ-}{  E}{ p| ?9 -}4{  dF}{ L| .KG[-}{  0G}X{ (| `R%-}l{  G}({ | p-}x{  I}x{ | !.}{  I}H{ p| ңt$.}A{  J}{ d| `ң8.}{  K}<{ | oL.}{   L}{ \| g`.}{  L}{ H| `R׈.}j{  N}H{ | @.}lX{  Y{| | A.}`k{  n{P| || & .}lo{  N}|  | ].}{  tO} | | `A .}0}  H} | 4| 1q/}L{  P}$ | | uY(/} {  P}| | aT{  X}`0| 8| ४Y0}@{  pY}<1| | <0}$a{  8Z}4| @| ,0}z  Z}6| } `e%@0}8^{  [}9| } 6 T0}`{  \}(<| h} ਪ4Kh0}pq{  ]}p=|  } `C}%|0}y{  t^}D| } a0}Xz  _}xG| } `r\0}{  `}P|  } f0} {  a}`Q| H"} ૪0}w{  a}4R| $#} Ve0}{  4b}T| ,&} ` u1}{  b}U| '} @DjP/}8t{  R}|  | `$luXyhy  pyy y பE 4(D&     Ha   n0nDnXn `n|n شn@5 LG8 4=s Bss?jHAeAMbP?@@ ѩ@>rI0xx Py u w t Ps q  n o  ^ ^ ^ ^`Vݞ"`ҩ{@[  ,W n0nDnXnp.m `n|n .mشnMMM` @@@ ū (  X        @`¬ET "RH"R R  d"R,&R$R\!R `2R` R@PLR,ORKR  LRMRLRxKR NRJR@ɫY2GRJRFR  ,HR$IRHRGR IR$FR R  D         `)!|(Pl PTP  P Px P P <PlPP>8􁼛OO0O  xOOOȚO OHO̙O>X\(\t\  \  N]O]LQ]HR]\f@]X        ۇ      fJa       |ۇ      f       /      `e@T znnX.m$n8n @n\n H.m,mD-mn+md^(,TnpnEmnFmFmn Emnn Fmn`e .Mb`>bb>>bX@V@V` `> c` `> c`` c`>``> cުlu0uuu uu`uuPu uuu|uu ު >2HuuHuuuuuuPu uHu`u,uu ު ݬ_&uxu(u$,u%u$ u-u*uu !u`"ud)u,uu WWW`0 |``` |` |` |`00 |` |WWW 0@ @ @ @ 00@ @@X@X@X 1 1 1zQ                 qm\RRRSRLRR<S(Rm=mAm$AmCmn=m nn Dmxn>mkbHououLpupu\ququdrurupsusuptutupuuuutvuvutwuwuxxuDyuyuHzuzuP{ul|u |ut}u }ut~u~uk@ҁ1'0+lmf 7A-$ijk #h 8/23 =) 9.5c!,@:4edg?FK~         P      N                       @MM & G@MM & Gv@-MM@MM & G`૦@D`૦@D ૦@D૦ ૦@D૦MMPMPMMMཪݞݞཪݞݞཪݞݞཪཪཪ ཪݞݞཪཪཪ ཪݞݞཪ ཪཪݞݞཪ ཪNNNNNN ݞ ݞ ݞ ݞ ݞ ݞ}x}}}}}}}}x}}}}}@b V6`VA@b6A@b V`V@b6A@b6A@b6@b6A@b6A@b6A@b6A@b V`V@b6A@b6A@b V V@b`V`V@b.鍯 xaү9үH'-)ү> Bl>moX ïӯ>ӯճ^>-ff}f}f}ff0f0f}f}f6 xs6A xs x6A xs6s6A xs6 xs6A x6A x V V6 x`V`VA x x xs. ׽ e w T{ _̯ݬX .ZRDBׯ r U^{ 5.Y 90fx DHbr C = گ㮯CBʯگ+/, ʯE Q`o/ʯ I U -گa P [ j ~m j /ʯz ˯  " L  DLH "$&`(*,P.`@@@ ͫǫq ͫ`Cǫyqq ͫ`Cǫyqq ͫǫq ͫy ͫǫ ͫǫyqq yqy $ ͫqyq ͫy qy.P0pp&ppp.9.99.9.99y9..yy..9b9.9yyyybbb@@@&&@nq@nq@nrrq@n@n@n@n@n@n@n@nq@n@n@nq@nq@nq@nq@nq@n@n@n@n@n@nq@n@nq/振 f a  a==+=#ah `R¯IgRjx BA-IAPA%= +,yQ-J W Kȯo̯w̯d ?0f#.AYۯq Y^~ "Yɕ q !DD ;+r{ Xbد6{ ̯ !"#$%&'()*+,-./0123456789:;<=+,%= Ѱ ۊy('EQ-J W Kȯo̯w̯d ?0f#.AYۯq ^~ "Yɕ E0q !DD ;+r{ XeAbد6{ ̯ۯ  !"#$%&'()*+,-./0123456789:;<=LLL%vLL%vPMLLL%vP%vL%vL%vLLL%vLLL%ML__`V_ݞݞ` ?_ݞݞ` ?ཪཪ_ཪ` ?`_ݞݞ_ݞݞ` ?ཪཪཪ_ݞݞ` ?ཪ_ݞݞ` ?ཪ`_ݞ_ݞݞ` ?ཪ`_ݞݞ` ?_מ_מ_`מ ?ཪ_NN@N`&wN@N`&wN@NN@N`&w`&w@N`&w@NȨ`&w@NȨN@N`&wNN@N`&NNaa[a ݞ` ஦Da ݞ` ஦ Da஦D` ஦a ݞa ݞ` ஦ Da ݞ` ஦ Da ݞ` ஦ D஦a a ݞ` ஦ D஦a ݞ஦ Da"۞a۞a஦۞Da`0!;Z9E5!:!?!0bD!I!N!S!CZ dfX!]!hjlnb!p6g!0l!4q!{ n{ d^rtv!vKZ0[a{!x0"&*!00SZ] z)Oѯ '= dL߯0 _ѯ ߯߯I k`* *<* *=* *"*'*,*1* ==Qq ==#= 6* )= ;*Qq Q/=@*s`QQE*5={` `;=` J*O*T*Y*^*``A=c*G=QQ  M=S=R RRRB"8g"8k"8~*8N"8O"8)8j"8}*8*8*8*8)8"8"8" *8"8" _ >"3= a" )"*"fj"i"i"*"h"h""8k"8"8j"8 " p*8K"8N"8O"8m*8P"8B"8g"8g"8~*8~*8f"8f"8}*8}*8"8"8* "8*8*83)8!8*8*8" *8*8*8" *8M" e" > d" < " " <" ="1*"""*"*" " *"*"x BABA--K IAIAPAPAPAPAPAPAPA%   = +, y  Q- J W K ȯ o̯ w ̯ d ?0 f  #. A   Y ۯ q Y ^ ~ " Y ɕ  q ! D D ;+ r{ X bد 6{   ̯   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0w tApath github.com/apernet/hysteria/app/v2 mod github.com/apernet/hysteria/app/v2 (devel) dep github.com/andybalholm/brotli v1.1.0 h1:eLKJA0d02Lf0mVpIDgYnqXcUn0GqVmEFny3VuID1U3M= dep github.com/apernet/go-tproxy v0.0.0-20230809025308-8f4723fd742f h1:uVh0qpEslrWjgzx9vOcyCqsOY3c9kofDZ1n+qaw35ZY= dep github.com/apernet/hysteria/core/v2 (devel) dep github.com/apernet/hysteria/extras/v2 (devel) dep github.com/apernet/quic-go v0.59.1-0.20260330051153-c402ee641eb6 h1:cbF95uMsQwCwAzH2i8+2lNO2TReoELLuqeeMfyBjFbY= dep github.com/apernet/sing-tun v0.2.6-0.20250920121535-299f04629986 h1:w62V0oOO2Do0vXeZkx7mgZ2YFuUaRcO6rNZewI3xzuE= dep github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE= dep github.com/cloudflare/circl v1.3.9 h1:QFrlgFYf2Qpi8bSpVPK1HBvWpx16v/1TZivyo7pGuBE= dep github.com/database64128/netx-go v0.0.0-20240905055117-62795b8b054a h1:t4SDi0pmNkryzKdM4QF3o5vqSP4GRjeZD/6j3nyxNP0= dep github.com/database64128/tfo-go/v2 v2.2.2 h1:BxynF4qGF5ct3DpPLEG62uyJZ3LQhqaf0Ken+kyy7PM= dep github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= dep github.com/fsnotify/fsnotify v1.9.0 h1:2Ml+OJNzbYCTzsxtv8vKSFD9PbJjmhYF14k/jKC7S9k= dep github.com/go-viper/mapstructure/v2 v2.5.0 h1:vM5IJoUAy3d7zRSVtIwQgBj7BiWtMPfmPEgAXnvj1Ro= dep github.com/google/go-querystring v1.1.0 h1:AnCroh3fv4ZBgVIf1Iwtovgjaw/GiKJo8M8yD/fhyJ8= dep github.com/hashicorp/go-cleanhttp v0.5.2 h1:035FKYIWjmULyFRBKPs8TBQoi0x6d9G4xc9neXJWAZQ= dep github.com/hashicorp/go-retryablehttp v0.7.6 h1:TwRYfx2z2C4cLbXmT8I5PgP/xmuqASDyiVuGYfs9GZM= dep github.com/hashicorp/golang-lru/v2 v2.0.5 h1:wW7h1TG88eUIJ2i69gaE3uNVtEPIagzhGvHgwfx2Vm4= dep github.com/klauspost/compress v1.17.9 h1:6KIumPrER1LHsvBVuDa0r5xaG0Es51mhhB9BQB2qeMA= dep github.com/klauspost/cpuid/v2 v2.1.1 h1:t0wUqjowdm8ezddV5k0tLWVklVuvLJpoHeb4WBdydm0= dep github.com/libdns/cloudflare v0.1.1 h1:FVPfWwP8zZCqj268LZjmkDleXlHPlFU9KC4OJ3yn054= dep github.com/libdns/duckdns v0.2.0 h1:vd3pE09G2qTx1Zh1o3LmrivWSByD3Z5FbL7csX5vDgE= dep github.com/libdns/gandi v1.0.3 h1:FIvipWOg/O4zi75fPRmtcolRKqI6MgrbpFy2p5KYdUk= dep github.com/libdns/godaddy v1.0.3 h1:PX1FOYDQ1HGQzz8mVOmtwm3aa6Sv5MwCkNzivUUTA44= dep github.com/libdns/libdns v0.2.2 h1:O6ws7bAfRPaBsgAYt8MDe2HcNBGC29hkZ9MX2eUSX3s= dep github.com/libdns/namedotcom v0.3.3 h1:R10C7+IqQGVeC4opHHMiFNBxdNBg1bi65ZwqLESl+jE= dep github.com/libdns/vultr v1.0.0 h1:W8B4+k2bm9ro3bZLSZV9hMOQI+uO6Svu+GmD+Olz7ZI= dep github.com/mdp/qrterminal/v3 v3.1.1 h1:cIPwg3QU0OIm9+ce/lRfWXhPwEjOSKwk3HBwL3HBTyc= dep github.com/mholt/acmez v1.0.4 h1:N3cE4Pek+dSolbsofIkAYz6H1d3pE+2G0os7QHslf80= dep github.com/miekg/dns v1.1.59 h1:C9EXc/UToRwKLhK5wKU/I4QVsBUc8kE6MkHBkeypWZs= dep github.com/patrickmn/go-cache v2.1.0+incompatible h1:HRMgzkcYKYpi3C8ajMPV8OFXaaRUnok+kx1WdO15EQc= dep github.com/pelletier/go-toml/v2 v2.2.4 h1:mye9XuhQ6gvn5h28+VilKrrPoQVanw5PMw/TB0t5Ec4= dep github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= dep github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= dep github.com/quic-go/qpack v0.6.0 h1:g7W+BMYynC1LbYLSqRt8PBg5Tgwxn214ZZR34VIOjz8= dep github.com/refraction-networking/utls v1.6.6 h1:igFsYBUJPYM8Rno9xUuDoM5GQrVEqY4llzEXOkL43Ig= dep github.com/sagernet/netlink v0.0.0-20220905062125-8043b4a9aa97 h1:iL5gZI3uFp0X6EslacyapiRz7LLSJyr4RajF/BhMVyE= dep github.com/sagernet/sing v0.3.2 h1:CwWcxUBPkMvwgfe2/zUgY5oHG9qOL8Aob/evIFYK9jo= dep github.com/sagikazarmark/locafero v0.12.0 h1:/NQhBAkUb4+fH1jivKHWusDYFjMOOKU88eegjfxfHb4= dep github.com/spf13/afero v1.15.0 h1:b/YBCLWAJdFWJTN9cLhiXXcD7mzKn9Dm86dNnfyQw1I= dep github.com/spf13/cast v1.10.0 h1:h2x0u2shc1QuLHfxi+cTJvs30+ZAHOGRic8uyGTDWxY= dep github.com/spf13/cobra v1.10.2 h1:DMTTonx5m65Ic0GOoRY2c16WCbHxOOw6xxezuLaBpcU= dep github.com/spf13/pflag v1.0.10 h1:4EBh2KAYBwaONj6b2Ye1GiHfwjqyROoF4RwYO+vPwFk= dep github.com/spf13/viper v1.21.0 h1:x5S+0EU27Lbphp4UKm1C+1oQO+rKx36vfCoaVebLFSU= dep github.com/stretchr/objx v0.5.2 h1:xuMeJ0Sdp5ZMRXx/aWO6RZxdr3beISkG5/G/aIRr3pY= dep github.com/stretchr/testify v1.11.1 h1:7s2iGBzp5EwR7/aIZr8ao5+dra3wiQyKjjFuvgVKu7U= dep github.com/subosito/gotenv v1.6.0 h1:9NlTDc1FTs4qu0DDq7AEtTPNw6SVm7uBMsUCUjABIf8= dep github.com/txthinking/runnergroup v0.0.0-20210608031112-152c7c4432bf h1:7PflaKRtU4np/epFxRXlFhlzLXZzKFrH5/I4so5Ove0= dep github.com/txthinking/socks5 v0.0.0-20230325130024-4230056ae301 h1:d/Wr/Vl/wiJHc3AHYbYs5I3PucJvRuw3SvbmlIRf+oM= dep github.com/vishvananda/netns v0.0.0-20211101163701-50045581ed74 h1:gga7acRE695APm9hlsSMoOoE65U4/TcqNj90mc69Rlg= dep github.com/vultr/govultr/v3 v3.6.4 h1:unvY9eXlBw667ECQZDbBDOIaWB8wkk6Bx+yB0IMKXJ4= dep go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE= dep go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= dep go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60= dep go.yaml.in/yaml/v3 v3.0.4 h1:tfq32ie2Jv2UxXFdLJdh3jXuOzWiL1fo0bu/FbuKpbc= dep go4.org/netipx v0.0.0-20231129151722-fdeea329fbba h1:0b9z3AuHCjxk0x/opv64kcgZLBseWJUpBw5I82+2U4M= dep golang.org/x/crypto v0.47.0 h1:V6e3FRj+n4dbpw86FJ8Fv7XVOql7TEwpHapKoMJ/GO8= dep golang.org/x/exp v0.0.0-20240506185415-9bf2ced13842 h1:vr/HnozRka3pE4EsMEg1lgkXJkTFJCVUX+S/ZT6wYzM= dep golang.org/x/net v0.49.0 h1:eeHFmOGUTtaaPSGNmjBKpbng9MulQsJURQUAfUwY++o= dep golang.org/x/oauth2 v0.20.0 h1:4mQdhULixXKP1rwYBW0vAijoXnkTG0BLCDRzfe1idMo= dep golang.org/x/sys v0.41.0 h1:Ivj+2Cp/ylzLiEU89QhWblYnOE9zerudt9Ftecq2C6k= dep golang.org/x/text v0.34.0 h1:oL/Qq0Kdaqxa1KbNeMKwQq0reLCCaFtqu2eNuSeNHbk= dep google.golang.org/protobuf v1.34.1 h1:9ddQBjfCyZPOHPUiPxpYESBLc+T8P3E+Vo4IbKZgFWg= dep gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= dep rsc.io/qr v0.2.0 h1:6vBLea5/NRMVTz8V66gipeLycZMl/+UlFmk8DvqQ6WY= build -buildmode=exe build -compiler=gc build -trimpath=true build DefaultGODEBUG=containermaxprocs=0,decoratemappings=0,tlssha1=1,updatemaxprocs=0,x509sha256skid=0 build CGO_ENABLED=0 build GOARCH=mipsle build GOOS=linux build GOMIPS=softfloat build vcs=git build vcs.revision=25a2530ac786a180dd8e4f3bce0c69a3a7954d83 build vcs.time=2026-03-30T19:21:04Z build vcs.modified=false 2C1 rBA&S*8a T""*#5",!9,!N"'"E!-! 0" -!""""2"  7"t*a"/"."!"3"/*"M"E!)! !*"`"F!; P"/"!!!*'''!"!!%"!)!P)^)!V)_)!W)"!!J-"%%<u*B"!0!s*"G!$ %%="1!1!>"  ">e""g"*w"~*s"k"*^$ ! ! !% !&N"O"20!!*H!!,"+""c b .@!(4 A% 6B <9'!!=;'!!!#'a)!Y) #!N)"!Z)")"Q)`)!X)!R)!!"f"v"*}*r""!?''''''C!!!!Aj")_ 3!"D3! CGE k"j" ` !*b"m"&" "`""o"q"y"u"""n"p"x"t""" """""""""A"D"G"I"$"RPLF  T*7*> ###" !!*z"*|"~"3 "7"""!)T'!)XV ! "!o)!'!!! #'])!U) #"![)")"O)\)!T)!S)!!p)!!!))(,Z*`^\!!!!!"J"%""""""""""{"*}"" """""""! & db"4" <"C"E"H"K f!I)l#pj_###""rL!)!!n)"!!!!!nh"*"*"  #"|X'@" M"t"NO/.v+Pxy}{ (!$!>"?"0a 5!5!?*&'"U*\*X*Z* ") "!"))))))))"")""|#RH"p*o*J"K"'H"J"*H"M"3"**L"5 ="""####L"1 5"5"),!6!l""%"****&%%*"" ))%%%%%#$%%%%#S"""W%T%V%S%P%f%i%d%g%]%Z%\%Y%Q%l%c%`%k%b%_%)U%R%% %%e%h%,%4%"""[%X%%%%j%a%^%<%$%%5 O =""\)'" " N"*O"O")"D*I*K*G*@*A M*  L*P* ) G''%)W"!!$"""W"**)c&c&:T"T",@"""!E"m*."T"!!'****"8)5)""!=)*"H*F*J*"E*!<)""""!!""2"1"-#!e) 8!! ")4F!! !w*))!!!""f&f&"""R# #$UP"Q"8"""#!!!!)# #U)"%%!o))_'w*Q"n*V"U"MG!R""****#!**"""   K V")q*V"U"B"**=_"a"x*)S"q)/!P"B" !"0!G!R"D@&#m&%W""* *S!U!Y![!T!V!W!\!X!Z!]!^!D "#g"**3!e""e"g"~*~******$k""7!Sw"***i"****i""X` !s"**>*z*")|**x)""*w"s"! !J!H)!!%e&e&& "%%)&)!;"!!Y !'C  c 85!&H! *-"))!3+!!!1""!")1+""$!"*<*Q/Z<*""""""b )V59'7[XT7:(8E\\!!))f"*b):)!')'*!!))!!9)s)!*)* )r'{[)))><#{;6)  g)K)!d"!!!!!!!!!""d"f"}*}*******""*v"r"|) #)v"*!!j)%Yj"!#k)%@##h"****h""'!'''''!!)]-*4*"_%%)()!#!m) "9 !r"**[  B<*y*"""v){*)%"%J)f):"B& ' '!!!!!%)*< !"*'!#"**""8"***& ""^">"""!!!"""DI"II"n&n&!C*HFG"B*= `"!$)!!b"()""+q"q"u"o"o"!!* """ "Z!!% p"!!p"n"t"n"""$"_ " """ " """&"&"*"""!!!""""$"&"A"D"D"$"&""""""""""y"x"""""#! ")")))!#)!!')$"">"Q8*")S),))."!))> )M)"`))"("!]*4!4!"V*W*[*4!""6*=#%"%"**"?%.0 "1 -3!&"!!!+#*""*"%*r*&*'**az"**|"*z"*|"***"~"2 !**"".###""~"" . *bW  !*?_""!!))d)U")'))'!u)! )3))!!E)t)!!)6"! )s'}])))YW #}@7)i)  !!!!!%}) #/!!l)!!!!!!!!"S"!! ##*'!')c.*5*))*!: !]  ""%"%)h)![ {"**a}"*_]**"*"A""f*!%)!!;))""6'0"#o&IH#"%"<"j*C"C"****F"$*r)!"3*)#"##**L/)?#d`&`&%"""""""""""%%%%!"##"&&"**"***"*y)""*"****{"*}"***"""j&"***"*'*{)**"*""*"****!&)!!*)##ecB #14"4"H"<" H"<""1*0*-"()"6#*e*))4 "!%%%"\"%"%\":*9*);*#F[gl"!!!c)!^mC!qn)~)2!!%###%ksf!!!!"!###o%"i%%!)!**")""!""2"(""Z""||3"g"")u_*'"Y"!4h!@"@""%"%5'''''"*i**''**%""OwK6WjNz~7|(!76!k &><"&><"2BFF2FJF22N2"2"FG"} "GRS\ "V"2"G""GZW[\G#G2c\"k\} ^b} u _]R+Oϯ2*G} 1G_ϯ"} Gհ 2"f8Gm """?G"2FGjn2rޯ<ޯ)ޯs\"vMGm h+~ oϯϯl x]:ޯ~ Kޯ~ $ ϯ{\ $~ "TGz~[GbG2"iG\2\ޯ2"\2 ""#pG 6~+#wGˊ ##2~GGG2## mޯ~ޯ  Hǥ #G22ԥ $#/)#G᥯ .~ .#23#G28#G3֊ \m  >M 3=#B#G#G3L#3Q#V#G3[#`#!3Ge#j#o#GGt#ኯ y#GGޯ8~  Zl\~B~ kϯ\  ϯޯϯ" ϯ슯 ŲL~ zޯӲ m V~  GᲯ0ﲯC~#ϯ#G `~ j~ ###GGG V+\\ޯ#/ t~  m ~~ ϯϯЯ\< I ɘ +ޯ+=՘ +ޯm  #H'3 H-3HH3393\##H&H-H#\~ ᘯ Яn ~ # n 'i5?3\ V ####E34H##;HBHIH| # C c /Я. n Q._ޯ߯m߯혯 =9 #p # PH#WH^HeHlHK3L[?Я} Q3 ##sH j  ##zH) n {'n "&0n HW3]3c3#*.HH26~ i3~ o3D yO #~ $HH$9n u3H{3:H>H3Bn Z (߯3~ 3 $\e 9߯5 3p \A OЯ$\3$H$3$B3HFH#$M J($-$H33N2$7$R<$A$F$K$P$H3VZU$Z$_$d$HH^i$n$bs$x$HHf33j3nH\3333rvH}$Kn $z$3ITn ]n fn on xn n n n 3\n I3\3$~I$$In 3$4]"I$n 4$n Y ~ ]~ )I0In $n 447I]]4>I$$#]EI+]LI3]n ~ n ;]_Яϳn SIn ZI e ݳ 2#4)4/454;4$$aIhIA4G4M4S4$Y4_4e4k4q4w4}44$444444oI4444$4444n C]n 4444$4455 55vI5}I$5$%5$+5o $I$1575IIIo III=5C5I5IIO5U5K]$[5S]$~ $a5~ $%IoЯJ߯o #o { q } %,o I[]g55o m5Ic]s5I%I ~ %k]I%I%Iy55"%'%5,%55s]{]55I]>o J JJ5J] Go JЯ55Po 5%J1%6%,J3J;%@%5]5:J]5]5]AJ55E%] 5]5HJ볯OJJ%VJ]JdJO%5Yo bo ]   Я[߯ko kJrJT%Y%^%yJ5c%556]h%to 6m%JJJr%6Jw%6JJ}o J6!6o J|%JJ%'6%%J-6%]36J]96 JJ?6]o E6K6%Q6%%%%W6 JJ]6Jc6%i6o6%%J%u6o JK KKK!K(K/K6K=KDKKKRKYK`K{66%gK6nKuK6%%o 6|K]o K6% %o %66%6%%66%66K] KK ]K%K%KK%^6&6K( KKo o 6K&K &KKKKK6"&6&*LL6L6666o o 7& 7L7o L.$Lo o o ^&7!&&&7+L+&0&#7^)72L/79L575&;726A7:&?&@LG7M7GLNL:>ULD&I&N&S&S7X&\LY7B]&cLp jLqLb&_7xLFe7g&k7^LLLL#^LJLl&q7w7LL}7+^3^LL7q&Nv&7L;^ p {&2 Я#ЯD ¯RV&p Z7LC^p L K^< S^[^LL^b77L7&7(p L7LLȋ f&1p j&777771Ӌ ¯?¯7&Mc^ MMnk^&&M7:p 7 Mr7'M&v&77&7.M5M&78'88MNC'H'TN88M'[N9R' 99 _99!9_W'bN\'a''9-93999_f'k'iNp'#_u'pNz'wN~Ngp '?9'pp NE9'NNN'+_'NK9 n N3_N'yp Q9;_NNW9NC_K_p ']9'c9' ݙ N陯 p p S_i9N'o9N'p p p 'Nu9N'N''N' [_{9c_'9'N9'O9p '99 O9'O9k_9OO&O-Os_4O9;O9x 99BOIO9{__POWO9''_9^O''_p 9'eOlO 99sO( K¯}߯Z¯ЯV߯Яѯ(˦ 99zO 99: :: (O_(Op :O((:OOO(#:):p _O/:$(O5:O;:)(A:Op G:".(M:S:Y:O_:_3(8(Op e:=(&Ok:OB(p i*q:OO.OG(w:L(}:Q(::__:wOp V(:2[(O6`(Pe( P j(:::Pq + :P q 6 :"P)Po(:t(0P7P>Py(:ѯ :>~(EP(__::__LPq   A SPZPaP(L hP q $q _B(F((((oP_(__` ``::`vP-q   W }PPP:P:#`P:PJ(PPN(PRP :6q P% ?q P:P:;;PHq P((VPP(+`(P ;Qq ئ 妯 i¯ /ѯP(Zq 3`;;`cq ((;Q;߯h(( Q(%;Q+;Z1;Q7;Q^%Q=;C;I;,Qlq 3QO;U;b[;(C`1 x¯a;(g;K`b :Quq AQm;s;(y;HQ(;;(S`));;OQm ~q x VQ; )]Qq q ?ѯ߯f;jdQ;kQrQ)n;);;)[`;yQ;QQr)Q#)();-);v;; ;;2)7);<)QQ;;A)QQ;F)QQK)<z~P)U)Z)_)d)QQi)Qn)s)c`x)})))# <)<)<<&!<)'<-<)3<9<?<)E<K<Q<))W<)]<c<i<)))o<,)u<{<<)</<<)<2<<<<))<<)<)<v<<)<<<<))58)))<)<;<> ! A NTY_gmrux~        & 4 >EMPW flllnt      '07<>EJM W c pv             #) 3:<=DJS ` i y~       ", 5:A O Y`f q ~        )  %)T o        ! ,T !$()+,         ! 039A Y e t       "$'( 6 H SW^cilow{                      '  3  = @ G N T W Z _ _ a g i k o s                         ( - 6  @  M  ]  h  s t {                 +  ;  D H J M M Q  [  e k p t w }                         ' ( + 3 8 < B  R W [ ] c c c h i m t                               !  ;  J Q V X X X \  i q w x y { ~                    % /7:? IMNTZadhkrxz     $ 0  "T einsv{   "'-18 D ^ lp z            &*/3 H  !#%(+.046  !      "$&*-1233559;@FHMQRVX\`bbdhprttx        " +4;BHLS iqw}       " + 666899:@IOSV]ehor ~        ( ; G VZ^ iowy     '(,/3678= RV[a o }         $ .2 =DEEGGGL Z dhlpu        $'+/048<?CGKOSWZ]`bdlsxz}     !$ -4:=?BHNSXX\`abegkmpssx|    ' 379@ R ]^fmu~       & /3:=?AI RUY]bjnt|          (,15:<? IPT\b n z      % .06=ELNT[ d n xy}       '- 8=EHHM Z^fou          6 T l                1  G I  X  h  }                          ! ! ! *! 6!>!D!F! Z!_!c! {!}!!! ! ! ! ! ! ! " -" ;" R"V" b"b"b"b"b" l" u" ~"" " " "" " " """" # ##### '# 6# B# N# Y# n#p#r#w#}########## ########### ##  "$ $ "$*$ 3$ ?$ W$\$ h$n$u${$}$$$$$$$$$ $$ $$$$$ $$$$$ % %% (%-%4%7% E%M% X%^% n% % %%%% %%%%%%%%%%%%%%%%%%%%%% %%&& &&&!&"&'& 1&4&6&6&:&>&@&B&E& O&T&V&]& f&j&r& }& &&&&& &&&&&&&& & & &' '' '$''' 4'7'@' I'M' X' f' s' }'' ''''' ' ' ' ' (("('( ?(G(G(G(K(O(U([(^(`(g( t(y((( (( ((((((((((( ( ((( ( )) )) ) 2) M) `)g)n)s)y)}))))))))))))))))))))))))))))))))))))))))****** *$* 1* <* K* Z* d*k*q* * * * * * * * ** * *  + +"+*+++1+7+>+C+ U+Z+a+f+l++ +++++++ +++ + + +,, ,, ,",),), !"#$%&)S,  t,w,w,w,w,{,},,,,,,,, ,,,,,,,,,,,,,,,,,,, , ,, ,- - &-,-/-8->-C- Q-T-Z-_-f-l-r- }---------- ---------------- -.. ...#.%.+. 8.<. H.O.Q.T.T.U.U.X.[.]._.`.b.f.i.m. z. . . ........ ............/ ///////// /"/&/+/./1/ R/  !%+-/ !!!!###//////////////// / /  0 0 +000 "+,59:1F1L1 W1 d1l1s1 11 111 11 11 11111 2 2 2 '2/2 <2D2 P2 Y2 d2 m2v2 2 2 22222222222222 2 2 2 22 2 333!3'3*3 J3Q3U3U3X3]3 r3x33 33 3333333333333 4 4 (4 <4 Y4 w4 4 4 444 4 4 445 5 5 *5 75:5<5 K5M5U5[5a5 k5s5y5 5 555 5 5555 5 55 555566 6666 )6*6+6.6061636:6 F6K6R6 \6b6  #%6  "%666666 666 6 7 7777#7'7,7077797?7A7 L7R7 h7 x7~777 777 77 77 7777777 8888!8$8 -848;8B8H8O8 Y8_8e8h8l8p8r8!.;8  "#8 8 9999 9 09 C9 T9 k9p9t9{99999999999999999999999999 9 99999::::: :::::::::#: .:5:<:B: K: W: d: t: ~::::::::::: :: :: ::::: :; ;;; ; (; 1;2;6; @; J; T; `; l; x;; ; ; ; ;;;;;;;;;;; ; < < ,< 9< G<K<Q<U<Z<_<`< i<j<n<u<z< << < <<<<<<< << << << < < ====!='=.=5= B=I= S= d= = = == ==== = = > >>>>'>/> :> D>E>E>F>G>M>V>[>b>f>n>t>y>|>>>>>>>>>>>>>> >>>>>>>> >>>>>>??? ????? (?,?2?9? C? ]? l? ?????? ?????? ?? ?? ??? @ @@@@@@@@@@@!@!@&@*@*@*@*@+@+@+@+@.@.@/@/@/@/@3@9@9@9@9@9@9@9@9@9@:@:@:@:@:@:@:@:@:@<@=@=@=@=@=@>@>@>@>@>@@@D@L@P@S@W@_@b@j@q@y@}@@@@@@@@@@@@@@@ @@@@@@@@ AAAAAA"A)A/A3A;ABAHAQAXAaAgAoAqArAtAtAzAAAAAAAAAAAAAAAAAAAAAAAAAA!"#$%&'()*+, 憖06eb˝ j'^"^z  G2[Yݯ8|A10Z~25+= 7:\1c\e %)+/5;=CGIOSYaegkmq %379=KQ[]agou{  #-39;AKQWY_eikw)+57;=GUY[_mqsw %'-?CEIOU]ci  ')/QW]ew #+/=AGIMSAgnu` b  GH,` `2 /`,@T``# C%D`@!  @Z@m$@$NO*@@ P`n. !  @ @   @ @ K   `Z @@@`.) `)  ~ * }- T8* `* , @8 + + x `Ww V+ @ 78 7@, 8`U @@}@ ` ` `JJ 9 ` L  @    ` @&&&R @ @  @ ` @  @   @`    `         8 ` ! , ` @`f @K@ w @X MN{8@9||h@8xxyz@|@} @ h@I@,yx @ `H @ @ |6 i s@ rd  sv s srt rtq@((@ @~ @  4 @ @ @@ @ @ u  @   @@` @@l @ @r @ e@@ `   ` `0@@@@@@@^@ @ @    `   @ 5o o `o   p  4 @@@@@p `6`@    @`@6     @    (p @  |`} ~~` ?`  E< @`?@N@@ ` ` `< ` `O ` ` ` `< ` ` A` @ T@D` M`NB` %`!"# "; N & %`$`` `CN` ` MM    `5 ` ` i `. 5 6 `0 h 5  4    @h @ i@@@aaa H  `\\\ ]t E E  F @D  g` @`  C@ @6 G@G GG     l W 9   @ `  W b@  @`@@` @@`31#``    0 @@^ 2` @@`D@ 4l @ m @Y `^_`Z @ ++@W+@+ ,,. / -- .d @e @ Ie d @HA@@w ` @@@   3 `@ ` @h^_`g `]^`q@@ ` @u[@l@Gg@z8` W ` X@e`Z`X 2]8 9z{2khGs `] _ %[@@@@  @k   @"@PP> QP? RbRj@lQ @SRuS@RPUUWW@WWV(X o@no@pZ` Y[[\YZ@[\X@XXY@ZZ@\@Y@b@c]]bd@`d`a^@^ec^`_^@a`@daaec\@eb__@f@_f@e[ghggff@]@i hh@hi@i@q@rp@VTT@mml@jjiFlVV@k@ozmq@QPr{rpsr`? dQkss@snnnpSu? ttt)]u@v@u  kmvv k@}@wwwvwlj@ty@yyqx@xx x@g@zzy`qcS{Tzz@T{|@|U}||`@U{@{o}}~@~~~@@@@H [ [ @@\  [  @`@@ ` `i `@ 7 J7 K`I@IJ6     ; `   @ o @ @o `k @ @1 p@ @ @ =`  @ (` `  ` `u w@x y @w@ q H{`      @ @  `  `   @ `Ir@`  `z `  y@    @ @  `  @ @ ` ` @`   v `  @ < @2@`  @ @   ` @    FET@E 9` 1 E@2 D2 D@ {0 3 1 F@F 7 @w`3 1 E`0 `9 7 @8 9 8 @J IHH@I@H   @]` @: n @ @@ @`9 @ ` ` L@n 4  m  c  @ @@@@@@4  x Wzg Xf ; @K g g @ `@@@ @   t LR`~% `  @  ` @ @ ` @: @@ = t @t@n`l  %q3@b Z`"c@ ` )@)))`** *@*  86 x  @ .4 @5 { 4 5 6 r @ @  j @ ` @F `  @@3i`{k i`y@   ` @   `. @cc `[Y @ u@l@ @/GV    @ @S `Q Q R R P Q @P O O R +`  @ `   `    @  `N   @ @T N @`T    qM ` U U U @V  T  @ N  @ S  O     @76 @7;@X<`:F @G F `8 8 @ 9 k j`\f `J@ O (O= @OW= @>  1 : @; : : KK@LLM@M@KLKL@ ` O1  d ] Z ` @ @  s  @ @`  @  `   @  @#  "$#@" # &# #"! !  "  "@   @@   u@ vx! ` Z Y X ! w@Y @ 7 x t@@@@t@`-`W @W @@  u ~@ `l  l  z @{ {@" 2 _ \ @1 @+ ` 3 @@3 1 ] c 3 2 `` `  0 @/ 0 - a @. . - - ^ ^ @/ , + 0 ] @_ a `2 `] a @b `/ * ^ b * `, , @@c `c u@\ l9@:7;@> @;DC `O<  / :C@ @=CB@@>< @ ?@/ :@S@=?<@=A  ` 0 @ @>B`<@C - .1``3  A`z >?3@A9` . Bf;@;8   @D@<?` @  D    @C@B:`` @? ;. . =@= >A<@ @ d   x@FF` HG @so  @`     `  v@ @u@``T@_ a` `+($$@`@%` %@$$% @@ @` @   `  H o`  g  g ` @    `f` j  l  @@ @@  @i@h @@@ @ @C  @`  @@@@ @     @ 2@ m j@@ @  @ @ @ @@   `5`{ F@F@ U Y`Y@ )&@' `w''`p   '( `; @q @q `; @  ( (  o@) ( @ mn  `   N 6`* S@[h`9@M L @@```A  a_@  7  `t    @ @` D  ? @ ` @I I `I @J @ k!@!  @@ ` @ @@ @@@@M #`6 U6  on@ ` @b @ ` `B    ` A ` @A B @@c`h @ @B @ @ @@  ` ` @ C -@ @ @ @ ` f @   @  h d    C @g`  ` @  l `*  @j @  L L @`.`23@45 4@ @45t 4@3@535 * ) 4  `5@@u@@7 6 7 s  ` @D  @222' @1100../-@.@-1' -/@/@0-./12,@& % % " " # ! " ! & `' $ $ % `! @# `$ 0` ,@ j @i @ 1j 8   ` oP|o  y @@  ;! y@- `- :` 9@9 @`@  x @u u @y |( `Z ' # | @( ) # `# $ @% & ' ' `& " % & $ $ }j @ @ ` i @ @@@@@@@ @@ 7 +J @Y` m@ @@@@@n `r K @@@`K r @@@@ s K @`  @` @ @  @ @   @ @  @   m` `] @@@@ `   r@:` `4NO@!``)@  e` `0``` `@@ `@ `   ` %  `=   `` `@`` ` `%0@` 1``! 6@ @L7@643`1@` ``  ?``  `?`^@55 _ ``@` `@Y ``QS-b  `@4_``` `%`@ 0 `F  ``@ ?u_`> >Z``   3@` # ` ` @  `/@F ``  ? >>A6 !``@or'` \`ni ^```_@@; ,B>@5@@D  uq` i`1` ~1 j@@ @`@%  @  @&  `wwvw@w(0   @@5~ '$k p@ @i!`c`~ UW@v V`V`IRR`R @b@` @yyyz{|sH`HI K M 0h@NN``@`T `@@@@e  m@PlYY@{@Q@@@@@QQ@@@@@@@@@@ =>?;@=@H;@?<G @@*99`77`I@k``a@@ `  ``@ 14}`@` `  40pcb cjk@j `$ @@@@) OOP @A<@C@;A<(c d@BU`6`@`f@g@g@mXuD@@@ADE@EEE> x!"l 7@r@q  ` ` `@( ~ @/`03`// 3` @@@@  `@` `4`m@``  8`8 n`d@" J`JJJ@O@n+CC@>@7`,i``e -`- `@FBF``K ```SL IK L`LLK `@<`+A+PF? @x"(@ ` ` V@# `f')) pq@ `-B=?T@#@`jv #d``66F`` @&) +&&  @` @@[@p@@d e o@`.S @@ ``    ````  `` *`55,I`/ '@OO`8 55`54`6`767@ 5 ,   ;`;;FJ@JFH@@P )C@'@7@O`@ 7  : ` &  @]\@  d ^ /`^`/ @``a` d @ **@ `'@(@BM Q`QQQgg2 Kj`diS`  .><@_`C D43B':`* .(eja <ML@MMd(@#@= @1`$@ehIJ 482`3`##)`1@ff +@He@FIcab.VYC[`D@ZD@]ZV^_][\@[@YYU]@`D\X`WTZ]\@V^XX@W@U^c@F`>>> ?eA`AA!`@%&@$0@H@`@ ` C` @u8`@XX@P` d 6@ Q Q683`9 ,`@$`@3G2) @@&`@@T@     `d` `@\ - G``- v C+ + *@#``z @`\ @@@WIU  `=```"""]W` Z Y  @ H| @ d` X@MK h J| ]}  VGc![! "``]&@  @E@[Z`  @u//@aYYeH ea^`a @@@@@@@ @ @@[@TSU@[@U @@NO`@@@` @@@@@@@@a@@S@S` _@___ab @@`@ ` ` ` @b@@@@ab@`bc@c@S``T@@T `  @P @88!   0&``* A@P" _U(@$ ?=="@h 9 8@ 3`@@KK`K Lir@prp@qi j@rp @@@ QS  S XR`NPN`X`O Q U`SOP`W`U` W W`0 `` L0``V `*@ ` @M@cggc`e`@I\`\.`,]~  \_ @@@) FF G`#  $EF?V- 1 ]f`\ f@`G` -/[\~ b. @f`[` @G +-`,++0@j PYQW`R@hZhr@^UUV@ @Xg@ eU`MMM @\hW MR R NN OTO[ W_W`P``Vp V@t`ii TT;EcJ /@`.`@ t Z: V`g@@@Y @@  )``T@@Z`)`<`5 ` `@@LM  H @``Q]`J`L ``V ` `  LL`")` Z```< Hd4 `%% = & ` `   & @` b<=H   `O `[ j h l g j `h `_ `t t ` `X k ] s \ e ` u ` v ` `v ` x t y ` m j `j k `m m m n `n `i `z `] ` ] Z w `V e Z y y \ ` ` _ } | | `|  `c c d b c c `~ ~ ` ` ` ` ` ` ` } `d `} w ` ` `f f ` ` `x t ] R o o p `p x `a l `l i  f a v U ` `R `u a b X ` n l n X p R `Z ` `Y Y s r Y `o q `q q q p `r R h ` `k ` r o i S z ^ _ [  `[ ` ` s `^ Q S ` u _ ` `` ` S `S V x `y V V W `W `b k h i `s ^ ` W } ` v z ^ u Q d d @l t @ A T @ `@ \ { ```T e    ? +@+@@ @   @` @} @$# ? `   *j ` k     @    i q @i p  `| ,<,+0DX(%Ll  \l| P%x%< 4H\X+p$X8L`t ,<L\lt0(LpPp 0@P`ptEq( 0@P<L,P`p%%x,,,,d0$HH 0P`p$8L` 0@NP`ptXbb-.&0 0@PH`pD.`x&`p^\d_YY(]Lh(< pPdx 0@P`p. ,@Th|0@P`p0DXl  0@ P`p48PH\p 0@P`pd///0x <00@P`p'Lh,@P`Tph00h00|8'0Pp 0@P`p(<PdxP`(@Xp0H`x,O 0P`p 0@P`pX 2`''DX 0@P`VplOP B!!! 0 @ 4H\P`p`p$8L`t(,3'8<Pdx ,X3( L4@ @P0T@ h@|P`pX p  0@P`p x4444(5T5555606\6666 787d77778@8l88889H9t9999$:P:|:::;,;X;;;;<4<`<<<<=<=h====>D>p>>>> ?L?x????(@T@@'(((P(x(((()@@ @` @` 0@P`p^@)\JrAtXEh)0D0A @`\A   0@ Pl`p  @` 4H\p$8L`t( 0<@P 0 H 0*PdJ(Xx0CJK B,@"U>ͽ*}W[fir2{_)o9l|,`]pBO&zT"9>lg>m"WFp'Kedk'S)02lWVWRwWU6R_R*5't)05ͤO/%@++9t*<*++Y+"o+S+!! ?>>~<Ss>n=<F<<.=MS YI  G;J =&1s;z7O)@>@?+^B x?=?XIe_?e43S404D4S=@????b@@@@t9@S J _c%IY4z"/@@=?@5AtS9KXIee7dk  l{T@@A@yAaAt2S9A&XIe*' _@Ac%AAASA9t^+KXIee7dk 2S = s  -*B *4@B2S _@UB9t B:Ke7dkO"KO#lDLKK*Lj:@Q9OS RS @w*'XIe&G'&&_&t#9u'&-&'6'&z(7(%%%'&//o+S!! 9M 0,KXIee7dk 40 s2"c,@&G'&%%%'7(V')XIe'Kedk'&t9 SS))6zc,u'Y5A S̜*'O@ͤ&XIeSV''Ke7dk'&t9 S)(&%%%)c,6u'@ c,T&XIeG''Ke7dk'&t9 SS)(')&%%%V')Y  (z*'OSk(@&XIeG'&%%%'7(0V')'Kedk'&t9 S@&XIepc,S@ۦ@&XIeK& Sۦ@f&c,KXIee7dkt9 SMT0_ 5AeMNOzO@&fKXIee7dkt9 SMҪ(&<ITҭ%%%lc, & G''(OS0̜Yz5A%_NeM@l9S&XIeծۦK$s@S@;x9S&XIe%%%6'&z(7(G''V')Yu'c,z@%%%cK&c,@&XIe%%%6'&&z(7(G''V')*'&_&t#9u'&-&''&ݲOSS|&@9eM7ݲM&(&%%%6'&z((G''V')OO@9S&XIe%%%6'&z(7(G''V')6@o9tSKXIee7dk  O.k&|S*wOzg_?[ i*j@&XIe9S%%%6'&z(7(G''V')ȴ@z%%%>&sc,/S T+^  S)a{f@7UY&XIeS9&%%%6'&z((G''V')Ht6غEcKKedk s(&ҭf|/c, _eMoBMNAȴSYۦ o O.k<Ҫ >z"/''S))*'u'@gVTSHUXIeUSnTTT3W$V&&%%%6'&z(7(G''V')9{eMN&(غEs YOծ@/S "/i @fKXIee7dkt9 Sc,@üf@ü@>Uͽ _zS@ü}*Uͽ>W\ +^B x?ݾ@ݾU>ͽüS@+U>ͽ SKXIee7dkt9 üS@p@U>ͽ@U>ͽB@ +^B x?U>ͽSfi@4üSx 4szSf_Y" I@QU>ͽ zü@_+>Uͽ^ 9tQS+^B x?*Wü/_ݾ@*Uͽ>+4x Wz B4üݾ@+^B x?U>ͽzQS_+^ 9tY@$b+^B x?>Uͽü*W+i}t"[f_V9W\+_^ SCXIeBSݾ/\c,B7z4sfY"/@+^B x?_+>Uͽ^9t "*}W[fi+bVS@+^B x?U>ͽt"*}W[fid9@b"&e43S404D4S"t+^B x?U>ͽ*}W[fiS /_"Y)3@@z@ z@OS@ @"t+^B x?U>ͽ*}W[fiX>{//&IeSo+!! lg>m"WFpXH I|.M1/ 0/00OX/`0N0P1.0"_$0 111VJ*'G'&_&#u'&-&'%%%'& S7U8@]&XIe9oIoH*HS5C&aA6'&z(7(//o+!! lg>m"WFpSiM @Fw&|oIoH*HS5CXIeaA6'&z(7(//o+!! ͽ*}W[fioIoH*H5CaA//o+!! internal/cpu/cpu.gointernal/runtime/atomic/types.gointernal/runtime/atomic/atomic_mipsx.gointernal/runtime/atomic/unaligned.gointernal/runtime/atomic/atomic_mipsx.sinternal/runtime/math/math.gointernal/bytealg/compare_mipsx.sinternal/bytealg/equal_mipsx.sinternal/bytealg/indexbyte_mipsx.sinternal/runtime/strconv/atoi.gointernal/runtime/syscall/syscall_linux.gointernal/runtime/syscall/asm_linux_mipsx.sinternal/runtime/cgroup/cgroup_linux.gointernal/runtime/cgroup/line_reader.gointernal/runtime/maps/group.gointernal/abi/map_swiss.gointernal/runtime/maps/map.gointernal/runtime/maps/runtime_fast32_swiss.gointernal/runtime/maps/runtime_fast64_swiss.gointernal/runtime/maps/runtime_faststr_swiss.gointernal/runtime/maps/table.gointernal/runtime/sys/intrinsics.gointernal/runtime/maps/runtime_swiss.gointernal/stringslite/strings.gointernal/bytealg/index_generic.gointernal/bytealg/bytealg.gointernal/runtime/exithook/hooks.gointernal/chacha8rand/chacha8.gointernal/byteorder/byteorder.gointernal/chacha8rand/chacha8_generic.gointernal/chacha8rand/chacha8_stub.sruntime/float.goruntime/iface.goruntime/netpoll.goruntime/signal_unix.goruntime/os_linux_mipsx.goruntime/select.goruntime/alg.goruntime/typekind.goruntime/arena.goruntime/mheap.goruntime/lockrank_off.goruntime/lock_spinbit.goruntime/cgocall.goruntime/cgroup_linux.goruntime/chan.goruntime/stubs.goruntime/time_nofake.goruntime/proc.goruntime/runtime2.goruntime/cpuprof.goruntime/debug.goruntime/env_posix.goruntime/error.goruntime/symtab.goruntime/traceback.goruntime/extern.goruntime/fds_unix.goruntime/hash32.goruntime/histogram.goruntime/metrics.goruntime/atomic_pointer.goruntime/type.goruntime/rand.goruntime/lfstack.goruntime/tagptr_32bit.goruntime/lock_futex.goruntime/msize.goruntime/mprof.goruntime/lockrank.goruntime/malloc.goruntime/mem.goruntime/mem_linux.goruntime/mfixalloc.goruntime/mcache.goruntime/runtime1.goruntime/mbitmap.goruntime/traceruntime.goruntime/fastlog2.goruntime/map_swiss.goruntime/mbarrier.goruntime/mwbbuf.goruntime/mcentral.goruntime/mgcsweep.goruntime/mcheckmark.goruntime/mgcmark.goruntime/mcleanup.goruntime/os_linux.goruntime/mfinal.goruntime/mgc.goruntime/mstats.goruntime/sema.goruntime/mgcwork.goruntime/mgcmark_nogreenteagc.goruntime/print.goruntime/mgcpacer.goruntime/mgclimit.goruntime/stack.goruntime/mgcstack.goruntime/mgcscavenge.goruntime/time.goruntime/mranges.goruntime/mpagealloc.goruntime/mpallocbits.goruntime/mpagecache.goruntime/minmax.goruntime/mpagealloc_32bit.goruntime/mspanset.goruntime/netpoll_epoll.goruntime/defs_linux_mipsx.goruntime/sigaction.goruntime/panic.goruntime/panic32.goruntime/pinner.goruntime/preempt.goruntime/symtabinl.goruntime/write_err.goruntime/runtime.goruntime/stubs2.goruntime/string.goruntime/rwmutex.goruntime/security_unix.goruntime/trace.goruntime/profbuf.goruntime/retry.goruntime/set_vma_name_linux.goruntime/signal_linux_mipsx.goruntime/signal_mipsx.goruntime/sigqueue.goruntime/slice.goruntime/softfloat64.goruntime/sys_mipsx.goruntime/stkframe.goruntime/synctest.goruntime/tracebuf.goruntime/tracestatus.goruntime/traceallocfree.goruntime/traceevent.goruntime/tracetime.goruntime/tracecpu.goruntime/tracemap.goruntime/traceregion.goruntime/tracestack.goruntime/tracestring.goruntime/tracetype.goruntime/unsafe.goruntime/utf8.goruntime/vlrt.goruntime/timestub.goruntime/vgetrandom_unsupported.goruntime/asm.sruntime/asm_mipsx.sruntime/memclr_mipsx.sruntime/memmove_mipsx.sruntime/preempt_mipsx.sruntime/rt0_linux_mipsx.sruntime/sys_linux_mipsx.sruntime/tls_mipsx.sinternal/reflectlite/swapper.gointernal/reflectlite/value.gointernal/reflectlite/type.goerrors/wrap.goerrors/errors.goerrors/join.gosync/atomic/type.gosync/atomic/value.gosync/atomic/asm.sinternal/sync/mutex.gosync/cond.gosync/hashtriemap.gointernal/sync/hashtriemap.gosync/mutex.gosync/once.gosync/pool.gosync/poolqueue.gosync/runtime.gosync/rwmutex.gosync/waitgroup.gointernal/synctest/synctest.goio/io.goio/multi.goio/pipe.gomath/bits/bits.gomath/bits.gomath/cbrt.gomath/exp.gomath/ldexp.gomath/abs.gomath/frexp.gomath/copysign.gomath/log.gomath/log10.gomath/modf.gomath/pow.gomath/signbit.gomath/sqrt.gounicode/utf8/utf8.gostrconv/atof.gostrconv/atoi.gostrconv/quote.gostrconv/itoa.gostrconv/decimal.gostrconv/eisel_lemire.gomath/unsafe.gostrconv/ftoa.gostrconv/ftoaryu.gostrconv/bytealg.gocrypto/crypto.gounicode/tables.gounicode/graphic.gounicode/letter.goiter/iter.gobytes/buffer.gobytes/bytes.gointernal/bytealg/count_generic.gointernal/bytealg/lastindexbyte_generic.gobytes/reader.gointernal/bisect/bisect.gointernal/godebug/godebug.gointernal/godebugs/table.gostrings/builder.gostrings/reader.gostrings/replace.gostrings/strings.gostrings/search.gocrypto/internal/fips140deps/cpu/cpu.gointernal/itoa/itoa.gosyscall/env_unix.gosync/oncefunc.gosyscall/syscall_linux.gosyscall/netlink_linux.gosyscall/exec_linux.gosyscall/forkpipe2.gosyscall/syscall_unix.gosyscall/exec_unix.gosyscall/syscall.gosyscall/flock_linux_32bit.gosyscall/rlimit.gosyscall/sockcmsg_unix.gosyscall/sockcmsg_unix_other.goslices/slices.gosyscall/zsyscall_linux_mipsle.gosyscall/syscall_linux_mipsx.gosyscall/asm_linux_mipsx.stime/format.gotime/time.gotime/format_rfc3339.gotime/sleep.gotime/sys_unix.gotime/tick.gotime/zoneinfo.gotime/zoneinfo_read.gotime/zoneinfo_goroot.gotime/zoneinfo_unix.gopath/path.goio/fs/fs.goio/fs/format.goslices/zsortanyfunc.goslices/sort.gointernal/filepathlite/path.gointernal/filepathlite/path_unix.gointernal/testlog/exit.gointernal/testlog/log.gointernal/syscall/unix/at_fstatat.gointernal/syscall/unix/copy_file_range_unix.gointernal/syscall/unix/fcntl_unix.gointernal/syscall/unix/getrandom.gointernal/syscall/unix/kernel_version_linux.gointernal/syscall/unix/pidfd_linux.gointernal/syscall/unix/waitid_linux.gointernal/poll/copy_file_range_linux.gointernal/poll/sendfile.gointernal/poll/copy_file_range_unix.gointernal/poll/fd.gointernal/poll/fd_mutex.gointernal/poll/fd_posix.gointernal/poll/fd_fsync_posix.gointernal/poll/errno_unix.gointernal/poll/fd_poll_runtime.gointernal/poll/fd_unix.gointernal/poll/fd_unixjs.gointernal/poll/fstatat_unix.gointernal/poll/sendfile_unix.gointernal/poll/sock_cloexec.gointernal/poll/sockopt.gointernal/poll/splice_linux.goos/error.goos/file.goos/pidfd_linux.goos/dir_unix.goos/dir.goos/file_posix.goos/dirent_linux.goos/env.goos/exec.goos/exec_linux.goos/exec_posix.gointernal/syscall/execenv/execenv_default.goos/exec_unix.goos/executable_procfs.goos/file_unix.goos/rawconn.goos/file_open_unix.goos/types.goos/types_unix.gointernal/syscall/unix/nonblocking_unix.goos/getwd.goos/path.goos/path_unix.gointernal/syscall/unix/siginfo_linux.goos/pipe2_unix.goos/proc.goos/stat.goos/stat_linux.goos/stat_unix.goos/statat.goos/tempfile.goos/statat_unix.goos/sys.goos/sys_linux.goos/wait_waitid.goos/zero_copy_linux.goos/zero_copy_posix.gointernal/bytealg/compare_native.gocrypto/internal/sysrand/rand.gocrypto/internal/sysrand/rand_getrandom.gocrypto/internal/entropy/entropy.gomath/rand/v2/chacha8.gomath/rand/v2/pcg.gomath/rand/v2/rand.gocrypto/internal/randutil/randutil.gocrypto/internal/fips140only/fips140only.gocrypto/cipher/cbc.gocrypto/internal/fips140/aes/cbc.gocrypto/internal/fips140/alias/alias.gocrypto/subtle/xor.gocrypto/cipher/ctr.gocrypto/internal/fips140/aes/ctr.gocrypto/cipher/gcm.gocrypto/internal/fips140/aes/gcm/gcm.gocrypto/subtle/constant_time.gocrypto/internal/fips140/subtle/constant_time.gocrypto/internal/boring/sig/sig_other.scrypto/sha256/sha256.gocrypto/internal/fips140/sha256/sha256.gocrypto/ecdh/nist.gocrypto/internal/fips140/ecdh/ecdh.gocrypto/ecdh/ecdh.gocrypto/ecdh/x25519.gocrypto/internal/fips140/edwards25519/field/fe.gocrypto/internal/fips140/edwards25519/field/fe_amd64_noasm.goreflect/map_swiss.goreflect/value.goreflect/abi.goreflect/type.goreflect/deepequal.gointernal/bytealg/equal_generic.goreflect/makefunc.gounicode/digit.goreflect/asm_mipsx.sinternal/fmtsort/sort.gocmp/cmp.gofmt/print.gofmt/errors.gofmt/format.goslices/zsortordered.gomath/rand/rand.gomath/rand/rng.gomath/big/arith.gomath/big/int.gomath/big/nat.gomath/big/intconv.gomath/big/natconv.gomath/big/intmarsh.gomath/big/natdiv.gomath/big/natmul.gomath/big/arith_mipsx.scrypto/elliptic/elliptic.gocrypto/elliptic/nistec.gocrypto/elliptic/params.gocrypto/sha3/sha3.gocrypto/internal/fips140/sha3/sha3.gocrypto/internal/fips140/sha3/hashes.gocrypto/internal/fips140hash/hash.gocrypto/sha512/sha512.gocrypto/internal/fips140/sha512/sha512.gounicode/utf16/utf16.goencoding/asn1/asn1.gointernal/saferio/io.goencoding/asn1/common.goencoding/asn1/marshal.govendor/golang.org/x/crypto/cryptobyte/asn1.govendor/golang.org/x/crypto/cryptobyte/builder.govendor/golang.org/x/crypto/cryptobyte/string.gocrypto/ecdsa/ecdsa_legacy.gocrypto/ecdsa/ecdsa.gocrypto/internal/fips140/ecdsa/ecdsa.gocrypto/internal/fips140cache/cache.goweak/pointer.gocrypto/rand/rand.gocrypto/internal/boring/notboring.gocrypto/rand/util.gocrypto/ed25519/ed25519.gocrypto/internal/fips140/ed25519/ed25519.gocrypto/rsa/rsa.gocrypto/rsa/fips.gocrypto/internal/fips140/rsa/rsa.gocrypto/internal/fips140/rsa/pkcs1v22.gocrypto/rsa/pkcs1v15.goencoding/base64/base64.goencoding/pem/pem.goencoding/hex/hex.gocrypto/x509/pkix/pkix.gounique/clone.gonet/netip/netip.gounique/handle.gonet/netip/uint128.gounique/canonmap.gocontext/context.govendor/golang.org/x/net/dns/dnsmessage/message.gointernal/singleflight/singleflight.gonet/addrselect.gonet/lookup.gonet/net.gonet/dnsclient_unix.gonet/ip.gonet/lookup_unix.gonet/interface.gonet/hook.gonet/hook_unix.gonet/parse.gonet/conf.gonet/dial.gonet/iprawsock.gonet/tcpsock.gonet/udpsock.gonet/unixsock.gonet/ipsock.gonet/tcpsock_posix.gonet/dnsclient.gonet/dnsconfig.gonet/dnsconfig_unix.gonet/fd_posix.gonet/error_posix.gonet/fd_unix.gonet/sockaddr_posix.gonet/file.gonet/file_posix.gonet/file_unix.gonet/hosts.gonet/interface_linux.gonet/rawconn.gonet/iprawsock_posix.gonet/ipsock_posix.gonet/cgo_stub.gonet/mac.gonet/mptcpsock_linux.gonet/error_unix.gonet/nss.gonet/pipe.gonet/port.gonet/port_unix.gonet/sendfile.gonet/sock_cloexec.gonet/sock_linux.gonet/sock_posix.gonet/sockopt_linux.gonet/sockopt_posix.gonet/splice_linux.gonet/tcpsock_unix.gonet/tcpsockopt_posix.gonet/tcpsockopt_unix.gonet/udpsock_posix.gonet/unixsock_posix.gonet/url/url.gomaps/iter.goslices/iter.gocrypto/aes/aes.gocrypto/internal/fips140/aes/aes.gocrypto/des/block.gocrypto/des/cipher.gocrypto/md5/md5.gocrypto/md5/md5block.gopath/filepath/path.gopath/filepath/match.gopath/filepath/path_unix.gocrypto/sha1/sha1.gocrypto/sha1/sha1block_generic.gocrypto/sha1/sha1block.gocrypto/x509/verify.gocrypto/x509/x509.gocrypto/x509/cert_pool.gocrypto/x509/oid.gocrypto/x509/parser.gocrypto/x509/pkcs1.gocrypto/x509/pkcs8.gocrypto/x509/root.gocrypto/x509/root_unix.gocrypto/x509/sec1.gomaps/maps.gocrypto/hmac/hmac.gocrypto/rc4/rc4.goencoding/binary/binary.govendor/golang.org/x/crypto/chacha20/chacha_generic.govendor/golang.org/x/crypto/chacha20/chacha_noasm.govendor/golang.org/x/crypto/internal/alias/alias.govendor/golang.org/x/crypto/chacha20/xor.govendor/golang.org/x/crypto/internal/poly1305/poly1305.govendor/golang.org/x/crypto/internal/poly1305/sum_generic.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305_noasm.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305_generic.gocontainer/list/list.gocrypto/tls/internal/fips140tls/fipstls.gocrypto/fips140/fips140.gocrypto/internal/hpke/hpke.gocrypto/hkdf/hkdf.gosort/slice.gosort/sort.gosort/zsortfunc.gosort/zsortinterface.gocrypto/tls/alert.gocrypto/tls/auth.gocrypto/tls/cache.gocrypto/tls/cipher_suites.gocrypto/tls/conn.gocrypto/tls/common.gocrypto/tls/defaults.gocrypto/tls/common_string.gocrypto/tls/quic.gocrypto/tls/prf.gocrypto/tls/defaults_fips140.gocrypto/tls/ech.gocrypto/tls/handshake_messages.gocrypto/tls/key_schedule.gocrypto/tls/handshake_client.gocrypto/internal/fips140/mlkem/mlkem768.gocrypto/internal/fips140/tls13/tls13.gocrypto/tls/handshake_client_tls13.gocrypto/tls/handshake_server.gocrypto/tls/handshake_server_tls13.gocrypto/tls/key_agreement.gocrypto/tls/ticket.gocrypto/tls/tls.goos/signal/signal.goos/signal/signal_unix.goflag/flag.gostrings/compare.gobufio/bufio.gobufio/scan.goencoding/csv/reader.gogithub.com/spf13/pflag@v1.0.10/flag.gogithub.com/spf13/pflag@v1.0.10/bool.gostrconv/atob.gogithub.com/spf13/pflag@v1.0.10/duration.gogithub.com/spf13/pflag@v1.0.10/errors.gogithub.com/spf13/pflag@v1.0.10/golangflag.gogithub.com/spf13/pflag@v1.0.10/string.gogithub.com/spf13/pflag@v1.0.10/uint32.gotext/template/parse/lex.gotext/template/exec.goregexp/syntax/perl_groups.goregexp/syntax/compile.goregexp/syntax/parse.goregexp/syntax/prog.goregexp/syntax/regexp.goregexp/syntax/simplify.goregexp/backtrack.goregexp/exec.goregexp/onepass.goregexp/regexp.gogithub.com/spf13/cobra@v1.10.2/command.gogithub.com/spf13/cobra@v1.10.2/active_help.gogithub.com/spf13/cobra@v1.10.2/args.gogithub.com/spf13/cobra@v1.10.2/bash_completionsV2.gogithub.com/spf13/cobra@v1.10.2/cobra.gogithub.com/spf13/cobra@v1.10.2/completions.gogithub.com/spf13/cobra@v1.10.2/bash_completions.gogithub.com/spf13/cobra@v1.10.2/powershell_completions.gogithub.com/spf13/cobra@v1.10.2/zsh_completions.gogithub.com/spf13/cobra@v1.10.2/fish_completions.gogithub.com/spf13/cobra@v1.10.2/flag_groups.gogithub.com/spf13/cobra@v1.10.2/shell_completions.gogolang.org/x/text@v0.34.0/transform/transform.gogolang.org/x/text@v0.34.0/encoding/internal/internal.gogolang.org/x/text@v0.34.0/runes/runes.gogolang.org/x/text@v0.34.0/encoding/unicode/unicode.gogolang.org/x/text@v0.34.0/encoding/unicode/override.gogithub.com/subosito/gotenv@v1.6.0/gotenv.goencoding/json/decode.goencoding/json/encode.goencoding/json/scanner.goencoding/json/fold.goencoding/json/indent.goencoding/json/stream.goencoding/json/tags.gohtml/entity.gohtml/escape.gohtml/template/attr.gohtml/template/content.gohtml/template/escape.gohtml/template/js.gohtml/template/template.gohtml/template/transition.gogithub.com/spf13/cast@v1.10.0/internal/time.gogithub.com/spf13/cast@v1.10.0/alias.gogithub.com/spf13/cast@v1.10.0/number.gogithub.com/spf13/cast@v1.10.0/basic.gogithub.com/spf13/cast@v1.10.0/indirect.gogithub.com/spf13/cast@v1.10.0/map.gogithub.com/spf13/cast@v1.10.0/slice.gogithub.com/spf13/cast@v1.10.0/time.gogithub.com/spf13/cast@v1.10.0/zz_generated.gogithub.com/spf13/cast@v1.10.0/cast.gogithub.com/spf13/viper@v1.21.0/internal/encoding/dotenv/codec.gogithub.com/spf13/viper@v1.21.0/internal/encoding/json/codec.gogithub.com/pelletier/go-toml/v2@v2.2.4/internal/danger/danger.gogithub.com/pelletier/go-toml/v2@v2.2.4/internal/characters/ascii.gogithub.com/pelletier/go-toml/v2@v2.2.4/internal/characters/utf8.gogithub.com/pelletier/go-toml/v2@v2.2.4/unstable/ast.gogithub.com/pelletier/go-toml/v2@v2.2.4/unstable/kind.gogithub.com/pelletier/go-toml/v2@v2.2.4/unstable/parser.gogithub.com/pelletier/go-toml/v2@v2.2.4/unstable/builder.gogithub.com/pelletier/go-toml/v2@v2.2.4/unstable/scanner.gogithub.com/pelletier/go-toml/v2@v2.2.4/internal/tracker/seen.gogithub.com/pelletier/go-toml/v2@v2.2.4/internal/tracker/key.gogithub.com/pelletier/go-toml/v2@v2.2.4/types.gogithub.com/pelletier/go-toml/v2@v2.2.4/decode.gogithub.com/pelletier/go-toml/v2@v2.2.4/errors.gogithub.com/pelletier/go-toml/v2@v2.2.4/localtime.gogithub.com/pelletier/go-toml/v2@v2.2.4/strict.gogithub.com/pelletier/go-toml/v2@v2.2.4/unmarshaler.gogithub.com/spf13/viper@v1.21.0/internal/encoding/toml/codec.gogo.yaml.in/yaml/v3@v3.0.4/decode.gogo.yaml.in/yaml/v3@v3.0.4/yaml.gogo.yaml.in/yaml/v3@v3.0.4/encode.gogo.yaml.in/yaml/v3@v3.0.4/resolve.gogo.yaml.in/yaml/v3@v3.0.4/apic.gogo.yaml.in/yaml/v3@v3.0.4/yamlh.gogo.yaml.in/yaml/v3@v3.0.4/emitterc.gogo.yaml.in/yaml/v3@v3.0.4/yamlprivateh.gogo.yaml.in/yaml/v3@v3.0.4/parserc.gogo.yaml.in/yaml/v3@v3.0.4/readerc.gogo.yaml.in/yaml/v3@v3.0.4/scannerc.gogo.yaml.in/yaml/v3@v3.0.4/sorter.gogo.yaml.in/yaml/v3@v3.0.4/writerc.gogithub.com/spf13/viper@v1.21.0/internal/encoding/yaml/codec.golog/log.gonet/http/internal/ascii/print.gonet/textproto/header.gonet/textproto/reader.gonet/textproto/textproto.gomime/encodedword.gomime/type.gomime/mediatype.gomime/grammar.gomime/type_unix.gomime/quotedprintable/reader.gomime/multipart/multipart.gomime/multipart/writer.gomime/multipart/formdata.gocompress/flate/huffman_code.gocompress/flate/dict_decoder.gocompress/flate/huffman_bit_writer.gocompress/flate/inflate.gohash/crc32/crc32.gohash/crc32/crc32_generic.gocompress/gzip/gunzip.gonet/http/httptrace/trace.govendor/golang.org/x/text/unicode/bidi/prop.govendor/golang.org/x/text/unicode/bidi/tables15.0.0.govendor/golang.org/x/text/secure/bidirule/bidirule.govendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.govendor/golang.org/x/text/unicode/norm/trie.govendor/golang.org/x/text/unicode/norm/transform.govendor/golang.org/x/text/unicode/norm/composition.govendor/golang.org/x/text/unicode/norm/forminfo.govendor/golang.org/x/text/unicode/norm/input.govendor/golang.org/x/text/unicode/norm/iter.govendor/golang.org/x/text/unicode/norm/normalize.govendor/golang.org/x/text/unicode/norm/tables15.0.0.govendor/golang.org/x/net/idna/trie.govendor/golang.org/x/net/idna/idna10.0.0.govendor/golang.org/x/net/idna/trieval.govendor/golang.org/x/net/idna/punycode.govendor/golang.org/x/net/idna/tables15.0.0.govendor/golang.org/x/net/idna/trie13.0.0.govendor/golang.org/x/net/http/httpguts/guts.govendor/golang.org/x/net/http/httpguts/httplex.govendor/golang.org/x/net/http2/hpack/static_table.govendor/golang.org/x/net/http2/hpack/huffman.govendor/golang.org/x/net/http2/hpack/hpack.govendor/golang.org/x/net/http2/hpack/tables.govendor/golang.org/x/net/http2/hpack/encode.gonet/http/internal/httpcommon/httpcommon.gonet/http/internal/chunked.govendor/golang.org/x/net/http/httpproxy/proxy.gonet/http/request.gonet/http/header.gonet/http/response.gonet/http/cookie.gonet/http/server.gonet/http/fs.gonet/http/h2_bundle.gonet/http/transport.gonet/http/http.gonet/http/socks_bundle.gonet/http/transfer.gonet/http/transport_default_other.gonet/http/client.gostrings/iter.gonet/http/h2_error.gonet/http/pattern.gonet/http/clone.gonet/http/responsecontroller.gonet/http/mapping.gonet/http/routing_tree.gonet/http/servemux121.gonet/http/sniff.gonet/http/status.gonet/http/roundtrip.gogithub.com/spf13/afero@v1.15.0/mem/file.gogolang.org/x/text@v0.34.0/unicode/norm/trie.gogolang.org/x/text@v0.34.0/unicode/norm/transform.gogithub.com/spf13/afero@v1.15.0/afero.gogithub.com/spf13/afero@v1.15.0/ioutil.gogithub.com/spf13/afero@v1.15.0/os.gogithub.com/spf13/afero@v1.15.0/path.gogithub.com/sagikazarmark/locafero@v0.12.0/file_type.gogithub.com/sagikazarmark/locafero@v0.12.0/finder.gogithub.com/sagikazarmark/locafero@v0.12.0/internal/queue/eager.gogithub.com/sagikazarmark/locafero@v0.12.0/helpers.golog/slog/internal/buffer/buffer.golog/slog/handler.golog/slog/attr.golog/slog/level.golog/slog/record.golog/slog/value.golog/slog/json_handler.golog/slog/logger.golog/slog/text_handler.gogolang.org/x/sys@v0.41.0/unix/mremap.gogolang.org/x/sys@v0.41.0/unix/syscall_unix.gogolang.org/x/sys@v0.41.0/unix/syscall_linux.gogolang.org/x/sys@v0.41.0/unix/fcntl.gogolang.org/x/sys@v0.41.0/unix/fcntl_linux_32bit.gogolang.org/x/sys@v0.41.0/unix/sockcmsg_unix.gogolang.org/x/sys@v0.41.0/unix/sockcmsg_unix_other.gogolang.org/x/sys@v0.41.0/unix/syscall_linux_mipsx.gogolang.org/x/sys@v0.41.0/unix/syscall.gogolang.org/x/sys@v0.41.0/unix/zsyscall_linux.gogolang.org/x/sys@v0.41.0/unix/zsyscall_linux_mipsle.gogolang.org/x/sys@v0.41.0/unix/asm_linux_mipsx.sgithub.com/fsnotify/fsnotify@v1.9.0/fsnotify.gogithub.com/go-viper/mapstructure/v2@v2.5.0/mapstructure.gogithub.com/go-viper/mapstructure/v2@v2.5.0/decode_hooks.gogithub.com/go-viper/mapstructure/v2@v2.5.0/errors.gogithub.com/go-viper/mapstructure/v2@v2.5.0/internal/errors/errors.gogithub.com/go-viper/mapstructure/v2@v2.5.0/internal/errors/join.gogithub.com/go-viper/mapstructure/v2@v2.5.0/reflect_go1_20.gogithub.com/spf13/viper@v1.21.0/encoding.gogithub.com/spf13/viper@v1.21.0/file.gogithub.com/spf13/viper@v1.21.0/logger.gogithub.com/spf13/viper@v1.21.0/util.gogithub.com/spf13/viper@v1.21.0/viper.gogo.uber.org/multierr@v1.11.0/error.gogo.uber.org/multierr@v1.11.0/error_post_go120.gogo.uber.org/zap@v1.24.0/buffer/buffer.gogo.uber.org/zap@v1.24.0/buffer/pool.gogo.uber.org/zap@v1.24.0/internal/bufferpool/bufferpool.gogo.uber.org/atomic@v1.11.0/int32.gogo.uber.org/atomic@v1.11.0/int64.gogo.uber.org/atomic@v1.11.0/uint64.gogo.uber.org/zap@v1.24.0/zapcore/level_strings.gogo.uber.org/zap@v1.24.0/zapcore/console_encoder.gogo.uber.org/zap@v1.24.0/zapcore/entry.gogo.uber.org/zap@v1.24.0/zapcore/error.gogo.uber.org/zap@v1.24.0/zapcore/json_encoder.gogo.uber.org/zap@v1.24.0/zapcore/clock.gogo.uber.org/zap@v1.24.0/zapcore/memory_encoder.gogo.uber.org/zap@v1.24.0/zapcore/field.gogo.uber.org/zap@v1.24.0/zapcore/core.gogo.uber.org/zap@v1.24.0/zapcore/encoder.gogo.uber.org/zap@v1.24.0/internal/color/color.gogo.uber.org/zap@v1.24.0/internal/exit/exit.gogo.uber.org/zap@v1.24.0/zapcore/level.gogo.uber.org/zap@v1.24.0/zapcore/reflected_encoder.gogo.uber.org/zap@v1.24.0/zapcore/sampler.gogo.uber.org/zap@v1.24.0/zapcore/write_syncer.gogo.uber.org/zap@v1.24.0/encoder.gogo.uber.org/zap@v1.24.0/field.gogo.uber.org/zap@v1.24.0/global.gogo.uber.org/zap@v1.24.0/logger.gogo.uber.org/zap@v1.24.0/sink.gogo.uber.org/zap@v1.24.0/error.gogo.uber.org/zap@v1.24.0/stacktrace.gogo.uber.org/zap@v1.24.0/array.gogo.uber.org/zap@v1.24.0/config.gogo.uber.org/zap@v1.24.0/options.gogo.uber.org/zap@v1.24.0/level.gogo.uber.org/zap@v1.24.0/http_handler.gogo.uber.org/zap@v1.24.0/writer.gogithub.com/apernet/hysteria/core/v2/errors/errors.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/quicvarint/io.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/quicvarint/varint.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/connection_id.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/encryption_level.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/key_phase.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/perspective.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/protocol.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/version.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/monotime/time.gogithub.com/apernet/hysteria/core/v2/internal/congestion/common/pacer.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bandwidth_sampler.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/windowed_filter.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/packet_number_indexed_queue.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/ringbuffer.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bandwidth.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bbr_sender.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/monotime/time.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/clock.gogithub.com/apernet/hysteria/core/v2/internal/congestion/brutal/brutal.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/utils/log.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/utils/rand.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/utils/rtt_stats.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/utils/streamframe_interval.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/qerr/error_codes.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/qerr/errors.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/ack_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/frame_parser.gosort/search.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/ack_frequency_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/connection_close_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/crypto_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/data_blocked_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/datagram_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/extended_header.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/header.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/frame_type.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/path_challenge_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/path_response_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/handshake_done_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/immediate_ack_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/stream_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/log.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/max_data_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/max_stream_data_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/max_streams_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/new_connection_id_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/new_token_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/ping_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/pool.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/reset_stream_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/retire_connection_id_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/short_header.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/stop_sending_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/stream_data_blocked_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/streams_blocked_frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/transport_parameters.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/version_negotiation.goruntime/debug/mod.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/qlogwriter/trace.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/qlog/event.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/qlog/types.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/congestion/clock.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/congestion/cubic.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/congestion/cubic_sender.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/congestion/hybrid_slow_start.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/congestion/bandwidth.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/congestion/pacer.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/packet.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/cc_adapter.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/cc_adapter_ex.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/ecn.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/lost_packet_tracker.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/packet_number_generator.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/received_packet_handler.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/received_packet_tracker.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/received_packet_history.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/send_mode.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/sent_packet_handler.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/sent_packet_history.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/packet_number.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/flowcontrol/base_flow_controller.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/flowcontrol/connection_flow_controller.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/flowcontrol/stream_flow_controller.gogolang.org/x/crypto@v0.47.0/chacha20/chacha_generic.gogolang.org/x/crypto@v0.47.0/chacha20/chacha_noasm.gogolang.org/x/crypto@v0.47.0/internal/alias/alias.gogolang.org/x/crypto@v0.47.0/chacha20/xor.gogolang.org/x/crypto@v0.47.0/internal/poly1305/poly1305.gogolang.org/x/crypto@v0.47.0/internal/poly1305/sum_generic.gogolang.org/x/crypto@v0.47.0/chacha20poly1305/chacha20poly1305.gogolang.org/x/crypto@v0.47.0/chacha20poly1305/chacha20poly1305_noasm.gogolang.org/x/crypto@v0.47.0/chacha20poly1305/chacha20poly1305_generic.gogolang.org/x/crypto@v0.47.0/hkdf/hkdf.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/initial_aead.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/aead.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/cipher_suite.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/crypto_setup.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/updatable_aead.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/session_ticket.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/fake_conn.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/header_protector.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/hkdf.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/interface.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/retry.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/tls_config.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/token_generator.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/handshake/token_protector.gogolang.org/x/net@v0.49.0/internal/socket/sys_posix.gogolang.org/x/net@v0.49.0/internal/socket/mmsghdr_unix.gogolang.org/x/net@v0.49.0/internal/socket/msghdr_linux.gogolang.org/x/net@v0.49.0/internal/socket/complete_dontwait.gogolang.org/x/net@v0.49.0/internal/socket/iovec_32bit.gogolang.org/x/net@v0.49.0/internal/socket/msghdr_linux_32bit.gogolang.org/x/net@v0.49.0/internal/socket/rawconn.gogolang.org/x/net@v0.49.0/internal/socket/rawconn_mmsg.gogolang.org/x/net@v0.49.0/internal/socket/socket.gogolang.org/x/net@v0.49.0/internal/socket/cmsghdr_linux_32bit.gogolang.org/x/net@v0.49.0/internal/socket/cmsghdr_unix.gogolang.org/x/net@v0.49.0/internal/socket/sys.gogolang.org/x/net@v0.49.0/internal/socket/error_unix.gogolang.org/x/net@v0.49.0/internal/socket/sys_linux.gogolang.org/x/net@v0.49.0/ipv4/batch.gogolang.org/x/net@v0.49.0/ipv4/payload.gogolang.org/x/net@v0.49.0/ipv4/control.gogolang.org/x/net@v0.49.0/ipv4/sys_linux.gogolang.org/x/net@v0.49.0/ipv4/control_pktinfo.gogolang.org/x/net@v0.49.0/ipv4/control_unix.gogolang.org/x/net@v0.49.0/ipv4/endpoint.gogolang.org/x/net@v0.49.0/ipv4/iana.gogolang.org/x/net@v0.49.0/ipv6/control.gogolang.org/x/net@v0.49.0/ipv6/control_rfc3542_unix.gogolang.org/x/net@v0.49.0/ipv6/sys_linux.gogolang.org/x/net@v0.49.0/ipv6/iana.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/interface.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/connection.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/conn_id_manager.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/conn_id_generator.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/crypto_stream_manager.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/crypto_stream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/packet_unpacker.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/buffer_pool.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/client.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/transport.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/closed_conn.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/config.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/framer.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/send_queue.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/retransmission_queue.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/utils/ringbuffer/ringbuffer.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/datagram_queue.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/path_manager.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/connection_logging.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/wire/frame.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/ackhandler/ack_eliciting.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/streams_map.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/mtu_discoverer.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/packet_packer.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/protocol/stream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/frame_sorter.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/errors.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/internal/utils/tree/tree.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/path_manager_outgoing.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/receive_stream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/send_conn.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/sys_conn_df_linux.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/send_stream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/server.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/sni.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/stateless_reset.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/stream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/streams_map_outgoing.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/sys_conn.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/sys_conn_buffers.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/sys_conn_buffers_write.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/sys_conn_helper_linux.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/sys_conn_oob.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/streams_map_incoming.gogithub.com/apernet/hysteria/core/v2/internal/congestion/utils.gogithub.com/apernet/hysteria/core/v2/internal/protocol/http.gogithub.com/apernet/hysteria/core/v2/internal/protocol/padding.gogithub.com/apernet/hysteria/core/v2/internal/protocol/proxy.gogithub.com/apernet/hysteria/core/v2/internal/utils/atomic.gogithub.com/apernet/hysteria/core/v2/internal/utils/qstream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/qlog/event.gogolang.org/x/net@v0.49.0/http2/hpack/static_table.gogolang.org/x/net@v0.49.0/http2/hpack/huffman.gogithub.com/quic-go/qpack@v0.6.0/static_table.gogithub.com/quic-go/qpack@v0.6.0/decoder.gogithub.com/quic-go/qpack@v0.6.0/varint.gogithub.com/quic-go/qpack@v0.6.0/encoder.gogolang.org/x/text@v0.34.0/unicode/bidi/prop.gogolang.org/x/text@v0.34.0/unicode/bidi/tables15.0.0.gogolang.org/x/text@v0.34.0/secure/bidirule/bidirule.gogolang.org/x/net@v0.49.0/idna/trie.gogolang.org/x/net@v0.49.0/idna/idna10.0.0.gogolang.org/x/net@v0.49.0/idna/trieval.gogolang.org/x/net@v0.49.0/idna/punycode.gogolang.org/x/net@v0.49.0/idna/tables15.0.0.gogolang.org/x/net@v0.49.0/http/httpguts/guts.gogolang.org/x/net@v0.49.0/http/httpguts/httplex.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/body.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/stream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/client.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/request_writer.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/conn.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/trace.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/error.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/error_codes.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/frames.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/gzip_reader.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/headers.gogithub.com/quic-go/qpack@v0.6.0/header_field.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/qlog.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/ip_addr.gogolang.org/x/net@v0.49.0/http2/hpack/hpack.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/response_writer.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/server.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/server_conn.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/state_tracking_stream.gogithub.com/apernet/quic-go@v0.59.1-0.20260330051153-c402ee641eb6/http3/transport.gogithub.com/davecgh/go-spew@v1.1.1/spew/bypass.gogithub.com/davecgh/go-spew@v1.1.1/spew/dump.goio/ioutil/ioutil.gogithub.com/stretchr/objx@v0.5.2/accessors.gogithub.com/stretchr/objx@v0.5.2/map.gogopkg.in/yaml.v3@v3.0.1/decode.gogopkg.in/yaml.v3@v3.0.1/yaml.gogopkg.in/yaml.v3@v3.0.1/encode.gogopkg.in/yaml.v3@v3.0.1/resolve.gogopkg.in/yaml.v3@v3.0.1/apic.gogopkg.in/yaml.v3@v3.0.1/yamlh.gogopkg.in/yaml.v3@v3.0.1/emitterc.gogopkg.in/yaml.v3@v3.0.1/yamlprivateh.gogopkg.in/yaml.v3@v3.0.1/parserc.gogopkg.in/yaml.v3@v3.0.1/readerc.gogopkg.in/yaml.v3@v3.0.1/scannerc.gogopkg.in/yaml.v3@v3.0.1/sorter.gogopkg.in/yaml.v3@v3.0.1/writerc.gonet/http/internal/testcert/testcert.gonet/http/httptest/server.gogithub.com/stretchr/testify@v1.11.1/assert/assertion_compare.gogithub.com/stretchr/testify@v1.11.1/mock/mock.gogithub.com/apernet/hysteria/core/v2/internal/frag/frag.gogithub.com/apernet/hysteria/core/v2/client/client.gogithub.com/apernet/hysteria/core/v2/client/config.gogithub.com/apernet/hysteria/core/v2/client/reconnect.gogithub.com/apernet/hysteria/core/v2/client/udp.gogithub.com/apernet/hysteria/app/v2/internal/forwarding/tcp.gogithub.com/apernet/hysteria/app/v2/internal/forwarding/udp.gogithub.com/apernet/hysteria/app/v2/internal/http/server.gogithub.com/apernet/hysteria/extras/v2/correctnet/correctnet.gogithub.com/apernet/hysteria/app/v2/internal/proxymux/manager.gogithub.com/apernet/hysteria/app/v2/internal/proxymux/mux.gogithub.com/apernet/hysteria/app/v2/internal/redirect/getsockopt_linux.gogithub.com/apernet/hysteria/app/v2/internal/redirect/tcp_linux.gogithub.com/apernet/hysteria/app/v2/internal/sockopts/sockopts.gogithub.com/apernet/hysteria/app/v2/internal/sockopts/sockopts_linux.goencoding/gob/encode.goencoding/gob/enc_helpers.goencoding/gob/decode.goencoding/gob/error.goencoding/gob/encoder.goencoding/gob/type.goencoding/gob/dec_helpers.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/client_side.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/server_side.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/util.gogithub.com/apernet/hysteria/app/v2/internal/socks5/server.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/endian.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/tproxy_tcp.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/tproxy_udp.gogithub.com/apernet/hysteria/app/v2/internal/tproxy/tcp_linux.gogithub.com/apernet/hysteria/app/v2/internal/tproxy/udp_linux.gogithub.com/sagernet/sing@v0.3.2/common/native_endian_std.gogithub.com/sagernet/sing@v0.3.2/common/cond.gogithub.com/sagernet/sing@v0.3.2/common/format/fmt.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/cause.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/inner.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/multi.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/conntrack_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/addr_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/nl_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/link_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/mpls_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/route_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/seg6_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/link.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/addr.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/handle_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/addr_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/link_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/order.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/netlink.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/protinfo.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/protinfo_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/route_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/route.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/seg6local_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/rule_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/rule.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/xfrm_state_linux.gogithub.com/sagernet/sing@v0.3.2/common/buf/alloc.gogithub.com/sagernet/sing@v0.3.2/common/buf/buffer.gogithub.com/sagernet/sing@v0.3.2/common/buf/pool.gogithub.com/sagernet/sing@v0.3.2/common/rw/write.gogithub.com/sagernet/sing@v0.3.2/common/metadata/socksaddr.gogithub.com/sagernet/sing@v0.3.2/common/metadata/serializer.gogithub.com/sagernet/sing@v0.3.2/common/metadata/addr.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/icmp.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/icmpv6.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/ip.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/tcpip.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/ipv6.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/tcp.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/tcpip_compat.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/udp.gogithub.com/sagernet/sing@v0.3.2/common/network/name.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/error.gogithub.com/sagernet/sing@v0.3.2/common/network/addr.gogithub.com/sagernet/sing@v0.3.2/common/control/bind.gogithub.com/sagernet/sing@v0.3.2/common/control/bind_linux.gogithub.com/sagernet/sing@v0.3.2/common/control/interface.gogithub.com/sagernet/sing@v0.3.2/common/udpnat/service.goos/exec/exec.goos/exec/exec_unix.goos/exec/lp_unix.gointernal/syscall/unix/eaccess.gogithub.com/sagernet/sing@v0.3.2/common/bufio/vectorised.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/ipset.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/netipx.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/uint128.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/monitor.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/monitor_linux.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_gvisor_stub.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux_offload_errors.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/errors_patch.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_run_patch.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_system.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_system_nat.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux_offload.gogithub.com/sagernet/sing@v0.3.2/common/rw/file.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_rules.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux_flags.gogolang.org/x/sys@v0.41.0/unix/ifreq_linux.gogolang.org/x/sys@v0.41.0/unix/ioctl_linux.gogolang.org/x/sys@v0.41.0/unix/ioctl_unsigned.gogithub.com/sagernet/sing@v0.3.2/common/cache/lrucache.gogithub.com/sagernet/sing@v0.3.2/common/x/list/list.gogithub.com/sagernet/sing@v0.3.2/common/ranges/range.gogithub.com/sagernet/sing@v0.3.2/common/x/list/cond.gogithub.com/apernet/hysteria/app/v2/internal/tun/check_ipv6_unix.gogithub.com/apernet/hysteria/app/v2/internal/tun/log.gogithub.com/apernet/hysteria/app/v2/internal/tun/server.gogithub.com/apernet/hysteria/app/v2/internal/url/url.gogoogle.golang.org/protobuf@v1.34.1/internal/detrand/rand.goos/executable.gohash/fnv/fnv.gogoogle.golang.org/protobuf@v1.34.1/internal/errors/errors.gogoogle.golang.org/protobuf@v1.34.1/encoding/protowire/wire.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_unsafe_go121.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/proto.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/source.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/source_gen.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_union.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/messageset/messageset.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoregistry/registry.gogo/token/token.gogoogle.golang.org/protobuf@v1.34.1/internal/strs/strings.gogoogle.golang.org/protobuf@v1.34.1/internal/strs/strings_unsafe_go121.gogoogle.golang.org/protobuf@v1.34.1/internal/order/order.gogoogle.golang.org/protobuf@v1.34.1/internal/order/range.gogoogle.golang.org/protobuf@v1.34.1/proto/encode_gen.gogoogle.golang.org/protobuf@v1.34.1/proto/decode.gogoogle.golang.org/protobuf@v1.34.1/proto/checkinit.gogoogle.golang.org/protobuf@v1.34.1/proto/proto_methods.gogoogle.golang.org/protobuf@v1.34.1/proto/messageset.gogoogle.golang.org/protobuf@v1.34.1/proto/decode_gen.gogoogle.golang.org/protobuf@v1.34.1/proto/encode.gogoogle.golang.org/protobuf@v1.34.1/proto/merge.gogoogle.golang.org/protobuf@v1.34.1/proto/proto.gogoogle.golang.org/protobuf@v1.34.1/proto/reset.gogoogle.golang.org/protobuf@v1.34.1/proto/size.gogoogle.golang.org/protobuf@v1.34.1/proto/size_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/descfmt/stringer.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode_token.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode_string.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/defval/default.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/editions.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/placeholder.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_init.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/build.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_lazy.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_list.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_list_gen.gogoogle.golang.org/protobuf@v1.34.1/encoding/prototext/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/tag/tag.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/decode.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect_field.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_unsafe.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/api_export.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/checkinit.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/pointer_unsafe.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_field.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/merge.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/weak.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_map.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_map_go112.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_tables.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert_list.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert_map.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/enum.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_enum.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_export.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_file.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/merge_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/validate.gogoogle.golang.org/protobuf@v1.34.1/internal/filetype/build.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo/v2geo.pb.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo/load.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/parse.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/compile.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/matchers.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/matchers_v2geo.goimage/names.gorsc.io/qr@v0.2.0/gf256/gf256.gorsc.io/qr@v0.2.0/coding/qr.gorsc.io/qr@v0.2.0/qr.gogithub.com/mdp/qrterminal/v3@v3.1.1/qrterminal.gogithub.com/apernet/hysteria/app/v2/internal/utils/bpsconv.gogithub.com/apernet/hysteria/app/v2/internal/utils/certloader.gogithub.com/apernet/hysteria/app/v2/internal/utils/geoloader.gogithub.com/apernet/hysteria/app/v2/internal/utils/update.gogolang.org/x/crypto@v0.47.0/blake2b/blake2b.gogolang.org/x/crypto@v0.47.0/blake2b/blake2b_ref.gogolang.org/x/crypto@v0.47.0/blake2b/blake2b_generic.gogolang.org/x/crypto@v0.47.0/blake2b/register.gogithub.com/apernet/hysteria/extras/v2/obfs/salamander.gogithub.com/apernet/hysteria/extras/v2/obfs/conn.gogithub.com/apernet/hysteria/extras/v2/utils/portunion.gogithub.com/apernet/hysteria/extras/v2/transport/udphop/addr.gogithub.com/apernet/hysteria/extras/v2/transport/udphop/conn.gonet/http/httputil/dump.gonet/http/httputil/httputil.gonet/http/httputil/reverseproxy.gogithub.com/mholt/acmez@v1.0.4/acme/client.gogithub.com/mholt/acmez@v1.0.4/acme/http.gogithub.com/mholt/acmez@v1.0.4/acme/jws.gogithub.com/mholt/acmez@v1.0.4/acme/account.gogithub.com/mholt/acmez@v1.0.4/acme/authorization.gogithub.com/mholt/acmez@v1.0.4/acme/certificate.gogithub.com/mholt/acmez@v1.0.4/acme/challenge.gogithub.com/mholt/acmez@v1.0.4/acme/order.gogithub.com/mholt/acmez@v1.0.4/acme/problem.gogithub.com/mholt/acmez@v1.0.4/client.gogithub.com/mholt/acmez@v1.0.4/tlsalpn01.gogolang.org/x/crypto@v0.47.0/ocsp/ocsp.gogithub.com/klauspost/cpuid/v2@v2.1.1/cpuid.gogithub.com/klauspost/cpuid/v2@v2.1.1/detect_ref.gogithub.com/klauspost/cpuid/v2@v2.1.1/featureid_string.goencoding/base32/base32.gogithub.com/miekg/dns@v1.1.59/ztypes.gogithub.com/miekg/dns@v1.1.59/dnssec.gogithub.com/miekg/dns@v1.1.59/edns.gogithub.com/miekg/dns@v1.1.59/msg.gogithub.com/miekg/dns@v1.1.59/svcb.gogithub.com/miekg/dns@v1.1.59/types.gogithub.com/miekg/dns@v1.1.59/client.gogithub.com/miekg/dns@v1.1.59/clientconfig.gogithub.com/miekg/dns@v1.1.59/defaults.gogithub.com/miekg/dns@v1.1.59/dns.gogithub.com/miekg/dns@v1.1.59/labels.gogithub.com/miekg/dns@v1.1.59/msg_helpers.gogithub.com/miekg/dns@v1.1.59/reverse.gogithub.com/miekg/dns@v1.1.59/scan.gogithub.com/miekg/dns@v1.1.59/tsig.gogithub.com/miekg/dns@v1.1.59/zmsg.gogithub.com/miekg/dns@v1.1.59/dnssec_privkey.gogithub.com/miekg/dns@v1.1.59/serve_mux.gogithub.com/miekg/dns@v1.1.59/server.gogithub.com/miekg/dns@v1.1.59/udp.gogithub.com/libdns/libdns@v0.2.2/libdns.gogithub.com/caddyserver/certmagic@v0.17.2/account.gogithub.com/caddyserver/certmagic@v0.17.2/acmeclient.gogithub.com/caddyserver/certmagic@v0.17.2/acmeissuer.gogithub.com/caddyserver/certmagic@v0.17.2/certmagic.gogithub.com/caddyserver/certmagic@v0.17.2/config.gogithub.com/caddyserver/certmagic@v0.17.2/storage.gogithub.com/caddyserver/certmagic@v0.17.2/solvers.gogithub.com/caddyserver/certmagic@v0.17.2/handshake.gogithub.com/caddyserver/certmagic@v0.17.2/dnsutil.gogithub.com/caddyserver/certmagic@v0.17.2/ratelimiter.gogithub.com/caddyserver/certmagic@v0.17.2/async.gogithub.com/caddyserver/certmagic@v0.17.2/cache.gogithub.com/caddyserver/certmagic@v0.17.2/certificates.gogithub.com/caddyserver/certmagic@v0.17.2/crypto.gogithub.com/caddyserver/certmagic@v0.17.2/filestorage.gogithub.com/caddyserver/certmagic@v0.17.2/maintain.gogithub.com/caddyserver/certmagic@v0.17.2/httphandler.gogithub.com/caddyserver/certmagic@v0.17.2/ocsp.gogithub.com/libdns/cloudflare@v0.1.1/client.gogithub.com/libdns/cloudflare@v0.1.1/models.gogithub.com/libdns/cloudflare@v0.1.1/provider.gogithub.com/libdns/duckdns@v0.2.0/client.gogithub.com/libdns/duckdns@v0.2.0/provider.gogithub.com/libdns/gandi@v1.0.3/client.gogithub.com/libdns/gandi@v1.0.3/provider.gogithub.com/libdns/godaddy@v1.0.3/provider.gogithub.com/pkg/errors@v0.9.1/errors.gogithub.com/pkg/errors@v0.9.1/stack.gogithub.com/libdns/namedotcom@v0.3.3/client.gogithub.com/libdns/namedotcom@v0.3.3/namedotcom.gogithub.com/libdns/namedotcom@v0.3.3/provider.gogolang.org/x/oauth2@v0.20.0/internal/token.gogolang.org/x/oauth2@v0.20.0/internal/transport.gogolang.org/x/oauth2@v0.20.0/oauth2.gogolang.org/x/oauth2@v0.20.0/token.gogolang.org/x/oauth2@v0.20.0/transport.gogithub.com/google/go-querystring@v1.1.0/query/encode.gogithub.com/hashicorp/go-cleanhttp@v0.5.2/cleanhttp.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/client.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/cert_error_go120.gogithub.com/vultr/govultr/v3@v3.6.4/account.gogithub.com/vultr/govultr/v3@v3.6.4/backup.gogithub.com/vultr/govultr/v3@v3.6.4/bare_metal_server.gogithub.com/vultr/govultr/v3@v3.6.4/block_storage.gogithub.com/vultr/govultr/v3@v3.6.4/container_registry.gogithub.com/vultr/govultr/v3@v3.6.4/database.gogithub.com/vultr/govultr/v3@v3.6.4/domain_records.gogithub.com/vultr/govultr/v3@v3.6.4/domains.gogithub.com/vultr/govultr/v3@v3.6.4/firewall_group.gogithub.com/vultr/govultr/v3@v3.6.4/firewall_rule.gogithub.com/vultr/govultr/v3@v3.6.4/govultr.gogithub.com/vultr/govultr/v3@v3.6.4/instance.gogithub.com/vultr/govultr/v3@v3.6.4/iso.gogithub.com/vultr/govultr/v3@v3.6.4/load_balancer.gogithub.com/vultr/govultr/v3@v3.6.4/network.gogithub.com/vultr/govultr/v3@v3.6.4/object_storage.gogithub.com/vultr/govultr/v3@v3.6.4/reserved_ip.gogithub.com/vultr/govultr/v3@v3.6.4/snapshot.gogithub.com/vultr/govultr/v3@v3.6.4/ssh_key.gogithub.com/vultr/govultr/v3@v3.6.4/startup_script.gogithub.com/vultr/govultr/v3@v3.6.4/user.gogithub.com/vultr/govultr/v3@v3.6.4/vpc.gogithub.com/vultr/govultr/v3@v3.6.4/vpc2.gogithub.com/libdns/vultr@v1.0.0/client.gogithub.com/libdns/vultr@v1.0.0/provider.gogithub.com/apernet/hysteria/app/v2/internal/firewall/firewall.gogithub.com/apernet/hysteria/app/v2/internal/firewall/firewall_linux.gogithub.com/apernet/hysteria/core/v2/server/config.gogithub.com/apernet/hysteria/core/v2/server/copy.gogithub.com/apernet/hysteria/core/v2/server/server.gogithub.com/apernet/hysteria/core/v2/server/udp.gogithub.com/apernet/hysteria/extras/v2/auth/command.gogithub.com/apernet/hysteria/extras/v2/auth/http.gogithub.com/apernet/hysteria/extras/v2/auth/password.gogithub.com/apernet/hysteria/extras/v2/auth/userpass.gogithub.com/apernet/hysteria/extras/v2/masq/server.gogolang.org/x/net@v0.49.0/dns/dnsmessage/message.gogolang.org/x/net@v0.49.0/dns/dnsmessage/svcb.gogithub.com/apernet/hysteria/extras/v2/outbounds/tinydoh/resolver.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/ipstackcaps.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/zonecache.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/ipstackcaps_sock_cloexec.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/ipstackcaps_unix.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_bsd+linux.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_connect_generic.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_freebsd+linux.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_linux.gogithub.com/database64128/tfo-go/v2@v2.2.2/sockopt_linux.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/client.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/protocol.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/server.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_direct.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_https.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_standard.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_system.gogithub.com/apernet/hysteria/extras/v2/outbounds/fastopen.gogithub.com/apernet/hysteria/extras/v2/outbounds/interface.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_direct_linux.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_http.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_socks5.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest.gogithub.com/apernet/hysteria/extras/v2/outbounds/utils.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/internal/list.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/simplelru/lru.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/lru.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/ed448/signapi.gogolang.org/x/sys@v0.41.0/cpu/cpu.gogolang.org/x/sys@v0.41.0/cpu/cpu_linux.gogolang.org/x/sys@v0.41.0/cpu/byteorder.gogolang.org/x/sys@v0.41.0/cpu/hwcap_linux.gogolang.org/x/sys@v0.41.0/cpu/runtime_auxv.gogolang.org/x/sys@v0.41.0/cpu/runtime_auxv_go121.gogithub.com/cloudflare/circl@v1.3.9/simd/keccakf1600/f1600x.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/sample.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium2/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/sample.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium3/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/schemes/schemes.gogithub.com/cloudflare/circl@v1.3.9/pki/pki.gogolang.org/x/crypto@v0.47.0/blake2s/blake2s.gogolang.org/x/crypto@v0.47.0/blake2s/blake2s_ref.gogolang.org/x/crypto@v0.47.0/blake2s/blake2s_generic.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/sample.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber1024/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber512/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber768/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/ckem.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/hybrid.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/xkem.gogolang.org/x/crypto@v0.47.0/cryptobyte/asn1.gogolang.org/x/crypto@v0.47.0/cryptobyte/builder.gogolang.org/x/crypto@v0.47.0/cryptobyte/string.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/alerts.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/authorization_data_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/cachedinformationtype_values.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificate_compression_algorithm_ids.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificate_status_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificte_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/cipher_suites.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/clientcertificatetype_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/comp_meth_ids.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/contenttype.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/ec_curve_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/ec_point_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/exttype_values.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/handshaketype.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hashalgorithm.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/heartbeat_message_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/heartbeat_mode.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_aead_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_kdf_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_kem_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/psk_key_exchange_mode.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_frame_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_transport_error_codes.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_transport_parameters.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/signaturealgorithm.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/signaturescheme.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/supplemental_data_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/supported_groups.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/usermappingtype_values.gogithub.com/cloudflare/circl@v1.3.9/ecc/p384/p384.gogithub.com/cloudflare/circl@v1.3.9/ecc/p384/p384_generic.gogithub.com/cloudflare/circl@v1.3.9/hpke/algs.gogithub.com/cloudflare/circl@v1.3.9/hpke/kembase.gogithub.com/andybalholm/brotli@v1.1.0/transform.gogithub.com/andybalholm/brotli@v1.1.0/http.gogithub.com/klauspost/compress@v1.17.9/internal/snapref/snappy.gogithub.com/klauspost/compress@v1.17.9/zstd/fse_predefined.gogithub.com/klauspost/compress@v1.17.9/zstd/snappy.gogithub.com/klauspost/compress@v1.17.9/zstd/seqdec.gogithub.com/refraction-networking/utls@v1.6.6/cipher_suites.gogithub.com/refraction-networking/utls@v1.6.6/common_string.gogithub.com/refraction-networking/utls@v1.6.6/handshake_messages.gogithub.com/refraction-networking/utls@v1.6.6/tls_cf.gogithub.com/refraction-networking/utls@v1.6.6/u_common.gogithub.com/refraction-networking/utls@v1.6.6/u_hpke.gogithub.com/cloudflare/circl@v1.3.9/hpke/hpke.gogithub.com/cloudflare/circl@v1.3.9/hpke/util.gogithub.com/refraction-networking/utls@v1.6.6/u_public.gogithub.com/refraction-networking/utls@v1.6.6/alert.gogithub.com/refraction-networking/utls@v1.6.6/auth.gogithub.com/refraction-networking/utls@v1.6.6/cache.gogithub.com/refraction-networking/utls@v1.6.6/u_pre_shared_key.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/header.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/packet_protector.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/quic.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/payload.gogithub.com/apernet/hysteria/extras/v2/sniff/sniff.gogithub.com/apernet/hysteria/extras/v2/trafficlogger/http.gogithub.com/apernet/hysteria/app/v2/cmd/root.gogithub.com/apernet/hysteria/app/v2/cmd/speedtest.gogithub.com/apernet/hysteria/app/v2/cmd/client.gogithub.com/apernet/hysteria/app/v2/internal/utils/qr.gogithub.com/apernet/hysteria/app/v2/cmd/congestion.gogithub.com/apernet/hysteria/app/v2/cmd/errors.gogithub.com/apernet/hysteria/app/v2/cmd/ping.gogithub.com/apernet/hysteria/app/v2/cmd/server.gogithub.com/apernet/hysteria/app/v2/cmd/share.gogithub.com/apernet/hysteria/app/v2/cmd/update.gogithub.com/apernet/hysteria/app/v2/cmd/version.gogithub.com/apernet/hysteria/app/v2/main.gocrypto/internal/fips140/cast.gocrypto/internal/fips140deps/godebug/godebug.gocrypto/internal/fips140/fips140.gocrypto/internal/fips140/indicator.gocrypto/internal/fips140/sha256/cast.gocrypto/internal/fips140deps/byteorder/byteorder.gocrypto/internal/fips140/sha256/sha256block_noasm.gocrypto/internal/fips140/sha256/sha256block.gocrypto/internal/fips140/subtle/xor.gocrypto/internal/fips140/subtle/xor_generic.gocrypto/internal/fips140/sha3/cast.gocrypto/internal/fips140/sha3/keccakf.gocrypto/internal/fips140/sha3/sha3_noasm.gocrypto/internal/fips140/sha3/shake.gocrypto/internal/fips140/sha512/cast.gocrypto/internal/fips140/sha512/sha512block_noasm.gocrypto/internal/fips140/sha512/sha512block.gocrypto/internal/fips140/hmac/cast.gocrypto/internal/fips140/hmac/hmac.gocrypto/internal/fips140/check/check.gocrypto/internal/fips140/aes/aes_noasm.gocrypto/internal/fips140/aes/aes_generic.gocrypto/internal/fips140/aes/cast.gocrypto/internal/fips140/aes/cbc_noasm.gocrypto/internal/fips140/aes/ctr_noasm.gocrypto/internal/fips140/drbg/rand.gocrypto/internal/fips140/drbg/cast.gocrypto/internal/fips140/drbg/ctrdrbg.gocrypto/internal/fips140/aes/gcm/ghash.gocrypto/internal/fips140/aes/gcm/cast.gocrypto/internal/fips140/aes/gcm/cmac.gocrypto/internal/fips140/aes/gcm/ctrkdf.gocrypto/internal/fips140/aes/gcm/gcm_noasm.gocrypto/internal/fips140/aes/gcm/gcm_generic.gocrypto/internal/fips140/aes/gcm/gcm_nonces.gocrypto/internal/fips140/nistec/fiat/p224.gocrypto/internal/fips140/nistec/fiat/p224_fiat64.gocrypto/internal/fips140/nistec/fiat/p224_invert.gocrypto/internal/fips140/nistec/fiat/p256.gocrypto/internal/fips140/nistec/fiat/p256_fiat64.gocrypto/internal/fips140/nistec/fiat/p256_invert.gocrypto/internal/fips140/nistec/fiat/p384.gocrypto/internal/fips140/nistec/fiat/p384_fiat64.gocrypto/internal/fips140/nistec/fiat/p384_invert.gocrypto/internal/fips140/nistec/fiat/p521.gocrypto/internal/fips140/nistec/fiat/p521_fiat64.gocrypto/internal/fips140/nistec/fiat/p521_invert.gocrypto/internal/fips140/nistec/p224.gocrypto/internal/fips140/nistec/p224_sqrt.gocrypto/internal/fips140/nistec/p256.gocrypto/internal/fips140/nistec/p256_ordinv_noasm.gocrypto/internal/fips140/nistec/p384.gocrypto/internal/fips140/nistec/p521.gocrypto/internal/fips140/ecdh/cast.gocrypto/internal/fips140/edwards25519/field/fe_generic.gocrypto/internal/fips140/bigmod/nat.gocrypto/internal/fips140/bigmod/nat_noasm.gocrypto/internal/fips140/ecdsa/cast.gocrypto/internal/fips140/ecdsa/ecdsa_noasm.gocrypto/internal/fips140/ecdsa/hmacdrbg.gocrypto/internal/fips140/edwards25519/edwards25519.gocrypto/internal/fips140/edwards25519/scalar.gocrypto/internal/fips140/edwards25519/scalar_fiat.gocrypto/internal/fips140/edwards25519/scalarmult.gocrypto/internal/fips140/edwards25519/tables.gocrypto/internal/fips140/ed25519/cast.gocrypto/internal/fips140/rsa/keygen.gocrypto/internal/fips140/rsa/pkcs1v15.gocrypto/internal/fips140/rsa/cast.gocrypto/internal/fips140/hkdf/cast.gocrypto/internal/fips140/hkdf/hkdf.gocrypto/internal/fips140/mlkem/cast.gocrypto/internal/fips140/mlkem/field.gocrypto/internal/fips140/tls13/cast.gocrypto/internal/fips140/tls12/cast.gocrypto/internal/fips140/tls12/tls12.go  ,  -   !* $#  XXNM6    <  X   ( '('(!      : .7    A KHGI5:   6 [ mp]ZYZ_]OR      ^ ; H; NMNM^gh  mnopong8t' ['9;= #  "2   ''        p "%14#D     =  OL  ORYZ        ) C55(  :      (&'( + n )? 1   ("'( ' 365.),?? -    %  5 ILKD =@EH[? ;   ('( # ehg`Y\o? )      y|{tmp? %    HGH &L    * XRD ;   21      `_`*6     `_`$`   `_`(x     0/0/0 X/WX      5 81 43 @8(       9  @         # &   a D"?+ )% G ?  ( pop op%opop op  "#    " $~u .  V    J: p*op op opR    F0 0  Z $   N>             "   8u `>_` _`_`P    !%   K&' H  @  "         {$@  "     0  pm      #  X  k : (2"1 ] 0  H:GHGHGHj    ^I R  NK   k        (    4   &'  / L     -  @      !  & + ('LI +,+,  -o    &   b !   \5%2+D'=21Y -  <  ! (   xq" POP OP OPOP OP OP  FI.C.-  W`    7  ##   POPks  on{z %edqp ' ,        popopopopopCop2  , 36/2!  y|   H&82 q 0/0   /.-010    ABADC TILK Z )3   @>?@?@?@c   W%$ ) PzOPOP  ) !"  j$    pop~op op   ) !"  /mD+       $! ()()('  ,!            `m_`!A    .  n0   !    A 8j7878w      *>8   XWXWX  ) !"               o)    0+/0/0u 0+i8 J       h|ghl<     - O0< P'OPOP OPOPOP OP OPOPOPOP$OPOPVl   @9NE      <&mH   CU  Vl @?@$$ @Z?@K?@                           @) !"VE*'(ARVY\z9      @^?@M?@                @) !"VE*'(ARVY\~;      @Z?@T?@               ) !"gla`( zB       W $   :      7XWbab /! !l;! !2! !    &,?= L   (     `_`Z_`     C) !"rrmu 2ituXGA`CFABKPhAG           8=78 ,      G(, 8T78  )$ +07LO( fO       7   8   ) 47!":}3TU   $        ! !    8      __? '          7       ) !"U   6 -2        "!$%$%().+('('0/0/  4: ?@1  E$   ID=T     C 0CD  W:%&  ;8 Dl #   ?@1 '$' *+0-,+45"87 :9:9>=<;$ 878B782    t`      (U'('(f   #Z9- 8)7878 788  0  ;JLE8 p;opopopopopopopi  9 =L      %/ -  n< w     1    .(' ( &               .+  -&         #(/0 "-,  BkX 9    L "!  $%(',+*) .-0/01.-6543%89<=/@A DCDE- ('( '(+  YDO"   "  69         '  ../       "   p>opT#            7     ' $t  #        xowx4 /   p)*4 / Z      )                      $  q  = F  ) !"#&4yjZg 6*       )   "!$#*)(),- [      +                        q p = F  v) !"Ir[>;U/" 6*       +   "!$#*)(),- [ 4$                                   !  &sY^ N \ &,+n87 U5) !"Wv<7BCD=, 6  8 ;4'     "!"!$#&%*)*) , ,+! [ 4$  )                              !  '(G,VON Y^ N l87  K5) !"   8 4' )      "!&%&%(' *+,+ *)!      ]    )           $  q  = F  ) !"#&4yjZg 9*       )   "!$#*)() ,- ^    +             q p = F  v) !"Ir[>;U/" 9*       +   "!$#*)() ,- _ 6&                    !   &sY^ N \ &,+n87 U5) !"Wv<7BCD=, 6  < ;6)     "!"!$#&%*)*) , ,+!  P  A      b    2  ) A>!";N- \%. A      R  F          2  ) 47!":'H %.! F      _ 7&  #   !  feFa g7>?Y^ T   &abn>= KU ) !"UzKPH ,LVDKJIsa  < :g7) #    ! $#$#&%('*%!$ $#,+,+  .  .-!  R      $   R       2  ) !"QJIU M> ?@?B8 $        !"!&#*)*) T      '     <     2  ) !"U  8 '        !"!&#*)*) Y 3  $       0  qej Pcyz GQ) !"4jYZVI>? 6N6  6  13'      $#&%&%#*)('.+21 434367:9:9<)*)0 @#?@      111 (K'(3  xJwx#wxwxwxwxwxwxwxwxwxwxwxwx:  NA  =@E  HOD 6wz       $ D,uQ8AW ) 0%/0 /0C   7* XVWX?WXWX C@7>?8        O\ u popop ">r/(     ">    EF  "   hgh h(          , 9 -) p1op Qdc^ uzst3%#  p`op!      a N!  0C/0 /0E/0 * 9B? @    GNu *X  ~ Jg 21Vqbs"    /  ('( F,   21  e ( '(4 < ('(N   ('(  0/0/0 /0H  <$ H&GHGH GHO    C$    @?@?@?@K U AK          878  @?@(  `'_`4 (( ('(#      @?@ ?@?@;   $+; @?@ ?@?@;    D%+;   ^#   HyGH^'(ST`        s)1`  ^*A*A    "^'(' ( "  87827878O ,O\ sL,# h5gh ghghS\    " ! @ 0/0/0-   XAWX"            B<"  @?@r  UV,0/Z {}~ *.        G < N  ,C0 /0r   p)op-op`opop#opop*rFA,Hg hA,pghgh_0/A,5A,   &|uv MNM             _      !H 9Z0 E$    )  @\5"#   rA,:  @a?@rV  &   b+V   T  ('()'(r+B0/A,   =,   0/0r%        XWXr A, ;<(wxwxBwxwxwxXwxrkA, A,10/0/A, A,{ghghghg h   Za#$  klk           _       -$  3o 4 ck    . B  c )    HGHr30/0/C              +0C    rghghA,    _   0/0r       rghgh     * hXgh Y0  \ .     nka\.     3 *@2 -"  |A9 |A9|A9:9|{)|A9 h hin  5X\Y     ) *  H6GH    6     H>GHGH [   *%.# ** 0Z     )   0 h @?@         #(9&# (3 .-"!"9&&'  &'987.-"!"&#  '&'  )9&#  78 )9&#  74  6_ZO2; ;   * +& '  > ?   " #:  ;.  /67BC   2 3  FGLK L,  &%#!###%""'65.""%"7>)%CJ G @' $ '!# %    HDGHT      H7  @X@?    <     #* ]#5      g )-#5 hgh(gh~     # #0 PEOP8OP OP i ji  V      Q PDOPOP OPOP    #     + 3  Z  TM +   5 3  344F  D= B;5      x3  34=>= 34=>=>H2/ (= &# '"1214 x        0$/0#/0 /0 5V"7 POP   I       "-D  I    hMghJ  *5 #o%%  X0WXAD       #q" .  &' #  w      Q     (  , NM6    <  22CD1S5T$#  ) > J     Q  (, 0+/0 rA 7rA/    :+    #. ""  (+6 ## &  0/0#       ('('    ('(    @_?@?@?@"   +   " "   / ""   + POP         '7 8s   `_`_`_`?   * 5& ""   1$4 #?   POP"        '8 ; t      HGHxw2 LS   P&OPOPxw J  41  , 8 78 !r    !?6   3& @9?@ NH   5P,OPOOP%OPjijiCjiji8z  [dcd* 9C8 ('( *  0/0 -   0)/0/02 /  7 1  *5 1  AB   h?ghghgh-|   J? ! @# N/#9`7$$/ /& ,/ /&   /@99 [bGRmly 4$1 \  8G78G4MNMN1-$   D /  '<   "*(41$ $      "VZ '   8$78278[78T =op+opoppopoop4 "Xv6-& 1XXU<9 (CJ )   ;#  !R        / ,&, , poph] -:9:9G] ^  H        9   $ $Nl]    ?h:9:9LK1212LKLK12  QK ;K :9B12 12Y   l w     '.5.   0-         uv o 9:#  c 9:BEX!  D7  =@!++2,SQ   C%         B Y P8OPOPOPh  :9;<;<  2    7;   "h A"!B A"           4    8G78ZhD12h   -.  yDh XPWXWXh 6565  :9:9:9:9:9656 5G1265S656 5           >` ]P_j%!0 0)*/     & (4         %S  `_`h 6565  :9 :912J1265Q656 5&          T]l  k634 90       qE    %   Q & pop h 6565 F91212:k2H1265 8656 5%             X alk         1,IJ     a P   %    8 % `_`h 6565  :9 :91212:k2H1265:9*656 5&             r  a  MX       0       w)2        %  * & XWXh 6565 B5KL12.656 5>565KL 656 5 J 2G         *0M .             (+'('(hW   K0' 0i/0h*   klk'( 5:9  Jj6,*    h#   (('(h"  )!"h  (4'( h 4   2' ,    h tfsHt  &"V  B  +# ( fH @?@h 0/0h  XcWX;WXIh"6565 A":5:9/656 5 A"1:965 A" > %17 $ :!"  /     1   H9GHGHh:9 :9:9"  ?3 "  (  (   (  ( '(  (*'( #cd    + #('( `&_`_``)*;   >0303/0/0/0/0`)*)*=>=>* S)  '`)*=>=>  $(U'('('(`"=>=>F     &   9 r,I"*  8E78<78"7878`BABA=>=>=>=>=>\ }S8  S  (3~      LH#;H' `)*) * U,+V)* GH!          -  S        )VE:       !-C7 `)*) *GH           90?   ('(`)*  `)* )* 7b?P  4`)*. A 4  _`=>=>)*)*BABABA              Sm d     `)*"  0%/0,/01/0/0 ` $    !/9f @`!UV)+V)*x     (# !x8h78` GH&           (($i7           h%gh6ghE`=>=>GH     N     /50  -N]`BA)*H  ]H H0GH`J > !` &p}~} *         6-  $LgJ~E  #       C=      M$   06/0\%        /%  " \,A QR,A|v#   hgh%\>%&3QRY        7'  1  X>3Y XuWX\%&)FEQRTS%&       !S)   \7%&&QR^ *)     ji  1N1*   A3k(7&^ 0 /0/0)\QRQR QR QR& M&  & yz9:9:9klk'( KL9:9: 9klk'( :KYZY ZLKL9:9: 9klk'( 9:   J] `FH 5J   IXU IDCy|  pm!"    @= J1873 3Z!%-&    :    +" !!$#(%&% * -0/  (A'( V Q2$( 0 /0/0yz&  & 2 *?N (   %   *    (6'('('(_* 65  xw 8+  (5#  []   *X 1 *    Z_H_0   9  *$ #$#$#$#b$ #$#$#$#l l    *1(     ! q     0  q     0  {$: }3 $i  $ ?   b      l POPOPOPOP OP *\  xwN       !=X+ Y  C  0 /0*       hghDgh*\      87( 1h \ H,GHGHGHGH1KLA<KLKLKLKLK%LAX An121A<KL*      at  m[        %    * @?@?@wxwx  mpWX$  HGH ijwxwxwxwxwx&wxw  X_    qtY*+         @_?@w~A<wxwxw xA<-.-;<;<.  $ $ lllooool 51 `         wxwx w  0 A  %%& K& K 2 `_Yb< @             . wxwxwxwx   /+   HeGH$GHw~A<wxwxwxw x-.wxA<-.-;<.-.- .A< S  kkkjjookkkkkQ+    wxwx y    8Q78w~A<w xwxA<   _R3     & wxwx   '# `wxxwxw  xwxw wx% PS  [D_ KL  V2_9:4-*+ r       %0/0 d   0/0    0/0     @ ?@   0-!    ('(!   X9WXWX,N,    K  0 HGH,V  $  2/ "   G0` HGH%GH,I  ,vu ! ('( ,'   `_`, f e       POPOP,1   % X0WXE,  5u  " )    .| (0#,+:9HGVUdcrqPj+`)" " " " " " " " " " " " " " " " ""! $"#&"%("'*"),"+."-0"/ 2"1S4"36"58"7m:"9<";>"=@"?B"A D"C F"E H"G J"I"L#K N"M P"O R"Q"T#ST. ('('0XApXA% &* P     +v7p * 0 %&% &  2- $    0 XA% &     0%/00 XA XA  A $!    0XAXAXA BWXAXAk)% & % &  at e.ABf 7535IRi/  JY'fM  *  )6Mbef      ) 3M??$     k)    :0:  : *_0(' (-0/  rqrq , @3~Y*0+NM6    <   {|u~2!$34 [ K &-&+' <2           "!"    &%(' '7 X-WX 0-     6-   0/00 : Or   L 878.78j    1      0,/02 '(& <1 ,& & (I'(2V  5  2  `_`E_`2 T  6^ ^ T @?@2 '("!'( '("!'(2Y(lklkl(lkl k 6    ' h      (?'(2"!";<;<!"!VA'( VA jjjooooj@($    @?@.?@?@?@?@?@2'('(,'('('(      4X,  M<2lklk lkl klkl k !  DCDCDklk'( k'('(  ' (Ilkl$ kl k"! '(< $#$     %4)4    J?  J; :        a                -cL0WT    !       " !'$#&% ('()*)*),$+ ./0 /2143 < p;op2H  ' POP2     K2    "!$ '(#          C  X     X p              $ # Z2$ & {   ~[<$& 0'/02$L K   $  0/0T(!"  2 '(kk lk-DCDCDklk'( k q$ 2'('('( VA VA/0 / 0*YZY Z121="!'('('('('('(-'('(0:ijAMVAVA kl k0/   h      J           (    -0  XU    y  -        1#          J     %        #,6E(<  A  -      q$2 ! $%(   /0/=65B8N7878787:  =>=@?BABADC-DCDCFGHKMNORSVUVU XWZ[\ [F 7 `_`  8 2E     9(( 2 8,78D782lklklkl klklklkl k         4        r(   2/klklklk 2El       *      jW\c f[ V    +- #}/    2E  XxWX 2#VA";<!VA"! SogS/8#        2L K   "  2aL K   *E    K# O +1B+%za  0/0B/0 2VA2Y('('('(VA21VAVAVAVA!/0 / 0 &1 -0  G>     "#!&  ' @J?@2VAVA#'(   P#   0/02VAVAVAVA       W    @A?@m?@?@ 2  ! %,   * !5, ('() TjX\ .]  % | q r'    4'  ' @H?@|qrqrqrqrqr apopchgj_bX-    | q rq r  _ b>(    x;s|qrqrqrqrqrq rqrqrqr"!"!"!M"!Eqr"!" !  Em(9!^4/0 a*J[ JEJI JQ 'UY          ME  o|4qrqrqr$qrqr   _ _o4$    (_'(| q r$qrqrqrqrqrqr #    __=_b>;n!P  $        |qrqr &MR XJWXWXWX|qrqr$qr F `Y\O%  P   hqghgh/|qrqrq r0qrq rqrqr6 |   `_ S_~HW  & 4 nm nm >z          > @?@'4G  1;, 87878K4!)* I*C vkm5_. 2!C 4  )** I*)*/)*       *),  !"Ag5!    b2>  *   /   XYWXWX 4 I*\   D   * \ 8#78784nm  ' `!_`7_`4 TA TATS TA Ysn  nnX"!       14P),+*TATSy (  \U& "-< E 7k #!@P     _ 0%/04      GI4CHq*) *)* )*:)*)*#)*1)* BABABklk'( i%  BABABklk'( iBABABklk'( iBABABklk'( i  2=fBXz?  g%ghwts hg#4('(J&#w  0J  J J #R3?* * * C    :#1  % " $ ',)*). 163438 ;4 4   P4%:)*)*G!)*_                    3=%)M%:G  !  _ ! 4 TA TA  rg      HWGHGH GH4 TA ;<;<;<;<I*)*TA TA     fnnnnnoooq     + xu    A4 ) *TA) *   ;<;<;<;< ) *)*TA ff    ee ff  ennnnnoooe             ! 4 I* I*+"!"!)L!BIL =>!*rqr q I*ArqQ"! !"!"! I*5 I*6      X ' op    s .x                       . .E ,&0-K / ' +        *  AQ  "!"!$#$#&% "%&%&% ()5,-6 4 T   {     N#(, \4BJI)*JIJI.JI)*>JI)*JI)*?       *'&Bh"qX h"}dq)g'6T)g4>=&  "-*)     X  I:B.  >   ? HGH 4(Hq*JIJIZ)*JI  WTOu *S,8u<  K (Z   POPC4,+G,+ 0' !   C!G d4  ,+, +[%JI JIJI         'F.FC"8  9"2 _21  6CJ A     [   %  HtGH 4,+0,)*+,)*++ > !, CF"   ad oR$]};K0   + @?@4   @c?@c?@ ?@?@^4.+*+,)*)*+,+,+,)\JIJGW ,    # /L =/  #xVt  \W hghzgh4  #+*;+*)*+* ; # "   .   %#N7$W  # ;     \4 .+*)*+,),$   oa    X/WX4<    0$  0O/00 + P0  [ @? )D7IL4+,!   -  ;" [     [       X    6$Y>* (# 6 ( '            ;!) =IopoA   ^>          " WX @  <C    YRT R] (!         =I! 0&/0/0/06/0/0-&%*     4   "VW  j- * b VUrqr9 V^klk'( n2       " !  B     87  %" J       /?)7 ;#     T 2 PnOP   klk'( n       J    o   %        8=78            @d?@klk'( n    J    e<    0,/0 /0,      0,  0^/0-           2[- 65              -  /         K  &" _`          i^     .5   "   5 \.     .5 0/0/0/0*     3*   @'?@    @"?@?@[   "XWXWX. + #P+ +    XWX.+ #  ++ POP-+ #  ++ PqOP Y klk'( n J  q$%    p /0/0       pop opp)efefefefefefef   ' G)     (w'( p0'('(H      sj0H ('( pA*   R O&  pA*efef;<)*A* lool    t pA*<A*' ( A*A*  2 ' K   6+<         pA*A*  `_`pA*A*  K "    m` 3C  (7p/e f    ,/   `5_`pB  * 878p#    popp/0/0/0/0x,+,A* knmnmpop=        x   pA* A*@A*12  A* A* "    `_              ?      @   "# Q p *   !$#>      ' `_`b_`@p2121J  1 2121W JQJI0?  ##$        34Y#C!=J  1     Wp)   p(op\op op opp efef 12712e42           &1l+       H5GHpH   %  PXOPpE121213fef   H E     p1213fef  H,GHp@ 4 pef  Spef T    (pS  QVUZ-&#+  (pL gnmp&&+ fp7] ^] ^] ^]^    63 v   7         > V    /)#  P?OP OP^  )  -#  K f    I P P7OPOPQ     E9 (e'('(dLKLKLKL AD74;>UZO XY ZWP5Y         popopdYZ Y Z YZYZYZYZ[ 63 ? 9   [ 0=/0 dYZL K LK YP+ '   @d$A $AYZ$A0 (k%   p  0 " dC   @ p1opop6dYZY Z Y,+Z$Y ZYZY Z eZ@ XU  * TSJ I@JM   { *A2   $   @ @U?@?@ dYZY ZR  XU    5=A J {EdYZ-+Z YZYZ klk'( 9YZ -.-,+*-.-.-.-.-.-.-%.). -.-. -.-+Z*LK Y Z-+Z -.-.!Y ZLKLKLK- .LK&YZ-.- .>=-.-* -. -.?.klk'( 9-.  B= -. -.-.-.-.-.-.-.-.-.-.-.-.-.B   J! *%&""C,    X ""#"""UdU     R    #L""""    $                 P  C Y%C %,;:"""     J  %+     S"""" """" sr """"""w 5E, <-8}r6 ^9=     !"!$#&%&%('*)*),/,%+214367 <;>=@?BA ('DC  *FE H GJK ('('!N MPOPORQT SVU&XWZY\ [^]`_bcfe ('hgji lknmpotqrINux {(Nuv}~gh  I+ ('('B @5?@6B"  ' d$A$A      #  pdA). -.,  3             VA    ,    xGwxwxdklk'(9YZY ZYZYZ+YZYZYZYZ klk'( 9  J                     J    .%       +   ~d YZ YZYZYZYZYZ!Y Z (             ~ k        !  ~   D ~U    I.  POPIOP~  &     # = (('('(~H 4 0L/0~Kst       EK ~D   '   PiOP2~* A8 A8 A8 A8GH%  *  Im     0/0~    ~#      ~*   (#'(~5   )  /~ A8 GH A8G$H   R[f  MJ      ('('(~ A8GH A8GH A8  41     @,?@~9    PaOP 6z   *. 66+,+, L9*   6    0/06zy                 a6+, hgh'?@?hg@klk'(g+, + , +,+, RA+ ,+,hg+WRAX'?@?hg@klk'(gh g  J            9$    J     `D5             ! #$#  ( !   06.YZY Z-.-N@?@? RA @klk'( gRAIRARA1  XU    XU R J      Q FC D? 83 * _RSR% '(Fm, w-;I N    I16) ! H%GH6.YZ-(    ('( 6& SV  . 6C    = .%6_ \a$2/0% KSXC 0/0/065      !5  64343RARA4RA"RA!RA+rq,+,+,+,+,+, +,++ ,+,@?@?@? @klk'( g P=  efUOVU"BX PJI &%&78        J # B 9 Z  2,    "!$#$#&%&% &%+('* ),+,+.-0/4121 6 9  @?@ 6,+,+,%*)#+,+,2+ ,       ,          !mF&     #      ;6lklk]lk        j         <= N&% (%4]        j (R'(6 @?@?@? @klk'( gRA RA J (     `_`l6+,+,+ ,+,~}~}o    %8    *Aki        i   P6+,+, 0"/0L  #>4F 0/006V  '++ @?@6hghg RA[RAXgh g    QUX  a*m &       @?@6hghgRAXRAXgh g  &  56'  f ]       %     P{OP OP6 RARA3hghghghgh gRAn}~}RA! !!     !%   3           ()'('(6RAn}~}RA"    ! *  PmOP6 RARAhghghgh g"  " "  l#         8L786 RARAhghghgh g# !#"K'         $+6n#  )   `/ @'?@?@?@16hghgRAZRAXgh gRAn}~}RA8$ "$    "###!$   iO        %    * 85786 RARAhghghgh g% "%!$         8T786 hghg<;<JghgRAXg;<;<' #oooK % KnnnnK*%      6 RA RA' %rK#' HmGH'GHGH GH 6RARA+,hghg hgh gRAn}~}RA&' %'$' ""   &'''$(sr%        & HcGH GH16 hghgRA$RAXgh g% ) $ $ !!&)  % 5 $ $38       %  8H78786+,+ ,+,* B#"87 ?$ " " ##QB*   0&/0 6 RARA* (*&* -   0/0 6)RAn}~+ARAn}~+A+,RAn}~+A RAn}~+ARAn}~+A RAn}~+ARAn}~+A RAn}~}RA + PO )**+J***+K&&)**+)**+#.)**+***,***+)***(,&)   "%&),/03 69:=@CDG JMNMPQ  87878 78786?RARA RARA"- '*! +-= >54+* Q RIH?>Q h_^UV *-)*-)-@WC              ( 6 RARA. ,.*.2/  @5?@ 6RARA/ +. ,.! 8Y78f6 "!(*'2$UT * 0E/03l  5% 1 hgh l6 bafeb!-.3(     c+67  7c p 'E    * @2?@?@l A&A&A&  8(    1l 6#  L %"S:9 2I!8 1      4       Y        wl',  &   : #  #             ,      ('('('(l56'   +' l-. \ ,        #   x:     L `E      ,  ,F3<  %    I-%%  + L -z{%3 ~ L    e       c"!"#$#&%&% 0/0Kl-.-.-.-.P  . "#,#&   P PYOPOPOPRls-.a                 Y  Bi+  &  1 % popRl-.+ "                       i ,              >+C0          ! #$% $ tl #$$ 9z     `w_` 8#ji >ji        '0H# > ?,8 4346i4343&   vqt pkL+  & 0A/08?-.-.  *$? (G'( '('(jfL   Vj #1Hv  ! #1H POPOP j   +, inJG2? ,34   ZY j5           x_wxwxwxj 83  67   H('( G$ 1> Ss  LK 7,q{S2LRQ$      "%&%(' *H)(&  \& n>   *i3 (d'(/'('( n   ,Lt   n5G*H,HH 6=@?(<G #2=.9  5G*H,HHn-I.-(%           F5 >    ? "! -I 0/0/0'/0n` %TA" nn 1     C!  {n3    {3 n#   ('( :4  :hg     :hg     :hg  "  `_`r_` _`_`: /0NA /0/0NA 3/0/0NA;0"/0#D   87878>3434    87878>343434     >34    (!'(>.   ( >U  #$&-N"     >V     ?,$ POPV>      $  #($G6 (   % #> U   :   _ (2'(>B    xwx)Alk;)Alkl)*  f{ n  wfv^wuv3 "      "! '&),-01 XWXWXeWX    rq ,q+,[  wvv-2w}     !$#&#*+.- @T?@7& rq|Nww|{wr`M b; 1   "# & ('('(-  878'% SX_Z2%@@.?@)@Z  W Q 2 @5656HA5656      Q  @5656HA56   9! @565 65 65 6!5 656 5656[565656                   !      [        `,_`_`W+*   )JIJIJIJIJ>IJ   >?@-&F+P ', +P    ?P  KP ST ( W     >9B78787 878  !"j i9   (B 78FA;878FA /2:D      Y B7~A7878 7878787 8FAFAFA vnk@6323 ak<     3NB&;<;<78787 878787 8 kookkkkkkook                  B7 8    ('(B  y |  0v/0/0B7 87 878 7878,7878   fsxqref!$ /,l"         8G78S78BFA#7878FA 7878FA7 8787 878787 8787 878787 8    63  , 63 , 23  J  23  8<8       !"!$ #(  +  B(    0&/0+BFAFA `Y             Q2     JP      ,     6 N       $d  ) t )* @?@?@?@ D    +3 D !M!!!!!!Hl R7   D343!$  J=  z4kL I7l M  D^lPOPJOP   7878C     ) eQ 7XWXWX&  #   (%'(2  K   ;/ 1H@=>?     SS' y \   ? 87878(  hggh%ghghSgh2gh   MN    2   ?A + f}>V   ;   0 hDghghghgh3#    I3#     8!78 7  +       X/WX780-XWXWX  '  0/0#          @   [7  7878C D79878C- X_L?0"VTS       _J i!#    7 9-       mK  ' (-'(L r  P  0    L   @#L.   @!L,   @$L/   @"L-                       L!    L   ) L>  2) ELP      4 @#?@?@LABABABAB$ <9ws*) . $ 1 hLgh\L RQRQR4B;RQR QaXQ<    ,  /7(    a   x3wxWwx^L*RQRQ34RQ)RQRQR Q3<ARQ<;   4 "  bi *) 3     !   #L0   P3OP^OPL      :6 XLm      2*L  J  L       m <9) E 0 /0/0L%  J [L5ZY7 %  &     1)D57 8%78'78G78L VUVU VUVUVU,           w+        L  ('(L+  ($'(LPOPA    XWXHL$A B  4 (PJPaVO^U  V  /1WOM$ 878L " H(GHL)    )H#GHL  .  X>WXLA B"     ,  " A  & LbA B<A      %Qb  L    _RQRQZ QZ QRQZQ<A; B<A<AXQ  6          "" 9_    LcLRQRQRQR QRQRQABIBRQR QRQR Q                    c              L7 " -"   L @%0$  /,  @   @&1H  P  \  d  p  x   P OPbOPf<;<;0RQR Q  5 -s=LKN9 = ,((         zJIEF EI#!  NBABABEFEF'EFEFEFEIJ0IJ.F  ,$"E+PP: !$ $     #$#$E$Bq,$9K3/8 q,$.- q,$#+l]   . . 1k#|z 5.   #  !   '.. H&GHGHsEI!EFEIJ0IJ.F %   . . #  5'!..  (%'(M A> & CK LKLKLKLKL -KL2               $   $   G  5,o #       -2 0"/0DAVGP D32$  6 G AV ` AV \ 07/0 /0/0E     ! E     #          @9 %4 @A :A 89   #      !.  " Vf +]  (  J^      Q      0 /0   03/0@ +(8 popuMN:AV      ( wu  0  pop~opT(;<;<;<IJIJ IJIJR SRSKQRRQPRTtt    ss"9  @9!rsss /  %:"   R     ?  T  T+ T  0XT4A;JIJ( X_ G  T  TIJ h?ghTJIJIJ< B3JIJ Ia4A=JI  ,952)&   a  =  piopTJIJI;<,JIJIJ I34A JI436 (#   :f 4, 3    6T       T    POTZ 0 6 TKL   = TIJIJKLKL q *w         XvWX TIJ4AEdcd c4A  ;         P E      % T 4A4A       ($'(T NMNM 34+  *  $$   @Z?@ TJIJI A!  MN  MN   g17     ! T  IJ   ZYXW:=>=g4AIJ 4A1 POP O\                                !       5 8+\      + "  &'*),+ .-011  \  "TIJIJ+ GS   ' + ('( T3  ! @?@T#4A>=dc4AV         &  #       T&  T   hsghsTIJIJJIJIJ'!"!"klk'( I JIJ IIJ0IJ6 J    . .' 7  5'     .. (T IJIJ _2_ >/  X.WXTI J XIJ I0IJIJ0IJaIJIJ0IJ6       )3  . .)  . .;6 5&6 5'  -   ..0.. &'TI JJI XI+      3& +TIJIJI JIJIJ IJIJ-;<IJ;<IJIJ       ^Y 0    g-,'          -  TT6&  T ; <;       " TJIJWI J      4  (('('( TI J   -  HBGHT 3y|   5 $ HGHT  hAghT$JIJI JI JIJ I  "$    `_`T 6T % %' %T   IT"!"! "klk'( I4AIJ"!"!2 "! "klk'( I43 1IJ4A4Ad ( J_JUVU  >   @X   @? )? m.01@ ]  c    2   "!$#&%('*+,+*))0-2367d:9  xwx T JIJ[7J7 J4AI JIJ4A;< ;<""!"!"klk'( IJIJ I K  _ X_   JAJ7$      "!$# &%*'(', /212 1(#'(T'%& 6 TK E% T    POPOP:T>= B3IJIJIJ4A IJIJ4A4AIJ4A4A  .      {I DC\72       #$% popT JIJIJpA_4A"!"!)"klk'(I "klk'( I"4A 4AXIJ I! !  !J    ""   "  QY)V _    )  " ! $'( ' 6T%4A4A#  """%% XWXXTJIJI4AcJ IIJIJIJ"!"kJ&4A#  !#J  o     !!!!!OX!  #4=B  $*A5&c         &  T$  `_`T KL : =*"!"!I J"klk'( I%""   $J### % %"(.A   *     T I JIJIJ' " ###$$ ($   @n?@TS;<;<; JI J'   #####t "  & '6S  T "!"!I J "klk'( I"!"kJ4A4A>= I J : =(&J%%%  ' '$(&&OX&&(%( ##' ' "U7      " !& 'FT IJ I JI J>=>=* %%& &**$ %$####G'#        )TI JI JIJ +' '& &%% *)   T ;<I JIJ+''A& &%&   8`7878 T JIJI ;<;<4A ;< 4AJ IJ I , "### (((( *,((),####!|$4         8'7878 T;<3- ))%"3 0%/0/0T JIJIJIJ IJI JIJ I- $$$$$$$$$$ $$$$;     UT 4A4A4A4A4A;< 43;< . ,.*-..*.,.,.**-.****R?       (5'(T4A4A #. ,.*.    #T/ XWXWXWX6T JIJI4AXIJI;<4AXI4A4AXIJ I4AXIJ I;<JIJ I9/ %%%%- &c T&`:::]B,,, c===,/ . &&&M+ &&&d,,&&&&<=a  l        !" !$#  @W?@5?@q?@?@?@!?@ ?@?@T)"!"kJI JI JI JIJ 4A;J-IJIJ4A4A 4A 4A1 <<AA...OX.+  X w) 1 10 0-./X.$@@1100 -1-1-1%00-1%^ + W      "! $'),+.-0/2367 :; >=@A `7_`T*IJIJ;<IJ0IJ=2  2 0 00/  . .$0 5.  ..   T;< ;<3 .///   G T IJI J4A4A3 1X12 21333/3 %       @?@T["!"! "klk'( I 4     2J111  0*>$[   Jc@d>MebTIJ;<"!"kJ44A4AIJI &$/; <;<4A 4A7JI8IJI JIJIJ IJIJIJIJI JIJy4A;J4AIJI JIJ4A4AI J4A 4AI JIJ#7J7JI JIJ 7JIJIJ%IJI J4A43 I JIJ"!"!"klk'( II JIJ"!"!"klk'( I4AI JIJ ;< 7 l!"!"klk'( I 7 J4A;^!"!"klk'( I;< 7 l!"!"klk'( I4  3X200 222OX2  <<3k6==157m22 37::l ll2 <<35 253K33+555 5ba33b43 6s=\436666&  3 :   5X534::55'  444 488 86r959(  1*7K7/78 8t77tst7K899 w8899  9:999 9998:66::88*  72J2221+ (  67J6665/K 5899(  69pp90 J777600 6 37::y3J4443-C9=pp=+ J3332,9<<a)Y8 : u,9 7 D    ; 7" 7+%6!   I% 8-\  /$ !  ' *),- 0145:7<;> =6565 @A65DCFEH KyNQVWZY \[^ adehil knq tux {#~ 65 %                P H GHDGHGHGHT27JI8IJ7 J ; 7722227K880::  0 6 H7       A4T;<  @IJ\; <;<; 77 8"r:::::r q ; :9X9;: 0000-.#V/ ,+,/ 3l ll8/0]`ef: ///cfST10] Z/ 4  /0:`0B     0 8 8178078 78TT4A 4A4A <  /// /1 101:< 8<8</X        @N?@T`= /// ///.1, $  POP9OPOPOP OPOPT(4A!4A4A4A 4A = *;= 9=:= :=9=/+  '(!     ( T IJIJ> == ==  &  TI J> = =     T"!"!;< "!"klk'( IIJ4A;<4A ;<;<;<;<4A;<4A4A;<4A? 44<J<<<;;  ;;;5(??A0=?+og+;?3oo222332nnnn%2;;=?+og+;?22=?+og+<?L`04      $#& %   +.-0143:;>=@ADCJK 878TDIJ4A4A4A;<;<;<;<4A4A*@   w  ?X>>@>@AH))GH>j))) 1nnnnnooo1=@`=@lmrs*j D   "#*T 4AB =A   XWXT"!"!'"klk'(I;<;<;<"!"!"klk'( IB ?J??? 2A>7=>==>$#> @J??? >8T 8'  XWXsT "!"!IJIJ "!"! "klk'( I;<;<;<4A;<;<;<;<4AIJ0IJ6B @J@???? ;<<<?7=>>=>$#?@B'nnnnnooo/?B440 . .4D  5'      "#,- 0/2../C  TF EC ? ? C  propTIJIJ;<;<;^!"!"klk'( I )IJ0IJ6C 0@@@ =??=>$#JAAA@:U2 2540 . .40$ $ 5'    &.. 8[78T "!"!;<"! "klk'( I;<;<;< D BJBAA@@==A7=@@=>$#A\;     : T "!"!"klk'( I E BJBBBA; $    E  pop'T;< I J@IJIJIJ;<;<;<>E AAD D    ?AAADD=AA=>$#B-    @   >T*F==  `_`T"!"!^IJ-;<IJGEJDDD   , FXEDDFXE Bc^-    ) T"klk'( IHD>%  0?TJH 57G 5 $T 4A;JIJ4AI FXFF_GEH#    878T;pA0!"!$"klk'( "klk'( I4AI EJFFFE HHHE?EI/!/$    @QT\JEEJEJA 9 T "!"!"klk'( IJ HJGGGF@: !   878T$K   K @d?@?@2?@?@T "!"!"klk'( I+"klk'( I LJJIIIHB )HBL5  +   TL 8!78T%L " M  847878T 4AIJIJ4AM JLKXJJ_KIL     POPT "k l!"! "k J "klk'( I;<;<;<4AQRIJIJ;<;<;<;<4AM I JJJJI L I7=II=>$#JKjMMKXKK_Lnnnnnooo$JM   F+-      ! &#() ,-67 @?@TP @@@@  TP  0/0P   0/0T)P popTJIJI;<IJIJ=@?: 9:-9:9B 7& > T"!"!"klk'( I^  [J[[[ZT% (%'(T;<;<;<^ZZZZZZ  8BTM^ / 6 (<'(T "!"! "klk'( I^ \J[[[ZT !    878GT#;I J;<4A4A4AS4A_ \\ \\  "\_<9    _ _\\s\`\_*\`C[_O  -    D @&?@?@4TIJIJIJ$4A`M]]] ]]#\_+.$ T 4A B34A IJIJ 4A;JIJ$IJ4A 43 IJ 4A4AI87JI J7 J,IJ"IJ4AIJ;<4A-a ^`` __`00"aa_X_aa -aa_X_aa1 7  ___]a  __aa__`aa k]ar`babbbaK_a a X ^KL``  aX`ac`_aoo_c       $ !$% ('*),-0/ 2367:9:9<?B AD E,HG"LINORSVUZ[- XmWXT 4A[4AI J4A"!"!"klk'( I"klk'(I 4c ac =G  `d d d`dbJaaa`Z`[ dc#b?"G))> X    !&%$ 0!/0T.e    2T$IJI Ne  bbb _!7$  T 4A;J IJIJIJ6IJ4A;<4Ae eeeeceeeccdXWd6cc D 7   )*      bf.'bb   x cf feX&_      6  T"h   T!4A4A 4A;JIJ4A43 h .fheh fXff_faafheehh %t!   @a?@?@ ?@T 4A4A43  4AIJ4AIJ;<4A 4Ai gigieehi eigXggig_g oo eieiol     "# &' (S'('(T4A;< B34A4AIJj giogiffifi iih  T;< j ff  3+TA;<;<;< koonnnncl' @?@T+JIJH;<I J)l liii3230/ 4CDEJI Dhhk l K&+e$            @s?@ T;<FI Jm hillwxyvu xklmpo ll l s i     0/0 /0TIJm  jj 8#78 7878T6;< ; < n "   kkj j '06    9@ TO;< 4A;<4Ao  kkmoogko7^2O T;<o kl dT; <;<;<;<;-!Q'jI.E    7    H GH-    .NRpE('   44       :&'(B' +   9-, 6-[a          6 s" o A_Ab abaJ  IN  y zq$b v}ru! 'Jz   5    J      (6'( 0/K }   O O K (;'( AA <  7   AA   p@op*    *          ARA=@       @Q?@?@   xw"!ws wV& &     @3?@    wxw )  (1'( WX2 & '  8N786  MN '!5  8Z78.# /MN0;MN<!I," 878H         G H t                        9  W 01     <!01 08/0) {#  ) Z]   [! &] y ,A "+,   R   " R[R#  +& !"1. A:y ,A   WX %  ,$% (*'(A A-.qtz t       C    AAX   [ \] fV /         0'/0t&-. F   '&  5 t4-.\   /( 5 4 -tijijij -.A. |st[sd'      t1J ijijij)g h0-J)g h #0-.- &%& ,)R~*):%)R~  )R~J"VWq % (   ('$   .    "!PK"!:O         ), ( _   !",-{|, RI,/{,+ H     5y    ZWD      4-i2PEM   s 2*@(P) r    1J      R )  J )  #$%&%R('3('3*)*)*t#      POPOPW# #  %A;     2) *     )/8A"                 < ; B>A " (24 ~ y9 @L3 ,@@ I.'F$    :   @    < \]           "    < 87878K2# $%   2?21         G t +0/     342 ] r     o      @=. W  _R,<           "$!&#(%*',).+0-2/416385:7<9>;@=D?FAHCJ     $!(%,)0-4185<9@=DAHELIPMTQXU\Y`]dahelipmtqxu|y} 0./0 z Wf%WF$mF,qZu~}T,V,!  OWFN?YEH  xwxwxX2:9B& 2/:9JIVU"+*>Y(2 & XZWXWXWXXB::9   ZB  X    yxkl ! &{, 0  X!   X  wx   8F78X B JIAM NMN  B   y |/       pbopop opopop!Xj 9K %( L   oLOj    *C*A  ,878XMN popCop?opopXi:9>     gj   +''  !X;  8( <.OXyz9?@?@ 9:9 9 9?@? NFEFEFEMN MJIN NMMNNMMNNMFEMNM JINMNMNMNMNMN  9MN MNMNMJINMN  :2        L J    @                B         @5     EVS          <  )     L Y' X5 B         VS   CJ;@         & #0/ 43 658765:9 <;>C<;DCFEHG JINKTQX Ub _lknmDCpsvu  xwx,XF0;P  ML )    6561           ,! F0  ; P.X6 +31 $ !   XE9       o2#E E  XV >GB (oXz $+ A--X OP. (2'('('('( '('( '('(X":9g 2  3/'S="g('('(X: 9: 9    H%GHX :9   #   X   8E78XR  5  HNGHX7: 9  J[ U  0/0X"0/0X :9    -$E  !           )+# !   :  B   @i?@  +abN +*%&    CD8 Y <    +  ('(7    %  ( '('('(;   ).1.      (! ,  nn    ,  n PbOPOPOPOP OP~OPOPOP .-.%     /4          PbOPOP OPOP OP9OP "!" 1(       '    xXwxwxwxwx wx,wx!  #/> <,   03/0/0/0i  K %  P/OPOPOP ^  E $&%&%$#$#        K   "  = H  POP+ !  0+/08  0         +m H!GH. "  " " H"GH/  !    #                    0 /0   87878C Y ^  0     5   % 87878: WZeh $     wz    @>?@7V6 +     0 !`6+ (Y'(V   K,+L 5    )8?      5 8=78VB1 2A   C6   @A?@V 212A    i!.   @*?@V2A2A   '    7lV)LK&2A  2A     klk'( G)2A21    7>@   DC J*' ;G    cN&c ?7b/>%       )$#"! &% ('  xwxwxV    klk'( G  K,+L( 2A2A  2A2A JB]BAEL   9 G S& S: L        "#&'*)*) HGHyV  LK)LK 2   87  &#    *h   ) 2 GLV   6 _+   ^h  ?V?  ?     8 78Z78V$@21      @ a      %- $ %   MVMKL^P O POb     X      W%'O 5          V=>+D CKJILPO [PO    *   S% `S  V32222       )4?3!i  )B Nw&[ 6(2<       +      [V  V  / i     !VKJILKL IL =>U=>  Q\OPXD' op. ! i".    R `=_`4V2A 2AB12A3   k   3 878@78 78Vm    ;2V ( '( '("   G+!*  A de                   9$L'    4!*      A  " ?@&I5E3     lghS    zW      /> ,)>+\h(  '% + ' !  &"            &I5E3 (@'( "?@?@    2#" F-:  (+(+(!    V/>c XWX)~   h#gh0 $&  x'wx4 (*  +8 ,.  `E_`3_`          9;  `_`+   p%op2 &&  )6 **  0/0$/0/0 Y $  9:-   0?/0b   !" @     PnOP      $" e {           $ @@?@]    ! 8W785 qr6r656565 rK      @_?@5qr6r656565 6TR   hIghghghghghghghghghBghghghgh       b     f@?@?@67F (  xJN(XWXW XW   H #  <;&           "          =  M   @I >%3B@8        }N   $       )4  popNCDji   )        0/0RNf "! *c42   N  P)OPOP2OPNXW$XW c  b    fR     N6  .  @?@!?@NC je   7   Az{NPOPOPOP O$CDUPOPO POP OCDPOP O  !T    FEF "     S+,+:  kG  K!)g 'U9           E<4  PEOPNXWXW(    B ( #   N%    &% RNb  !+# @ ?@?@NTS   %   @ ?@?@NTS +0&  =<N $    , %81\;$  H+GHGH        HKGHGGH J1212#>='B= 1X %"   sv Z3 #'   J>A>A P  8%78 J>=B=  @7         JH , P(OPOP JTSTS>A>A>A !>AXST S     @<         !  ,   HA=>=>  #$ -4A XWXH!    878 H  L I   `k_` H=>q   ;  ]qH@A   ( '(H ('( H => @A@A= >=>=>=>@A@A      i      (`'(Ha=>=>     Wa `_`U_`H=> @A@AA= >=>=>a=>=>=>@A@A/ tm   *)3&IB1Hyzu  P1  &      Ms*[g&  (  A   $  "#/H  POP H VUVU@A@A 0=>=>@A=>@AXUV U =  l"   # =$s    # #$ # POPOPOPOPH!=> =>=>@A =>@A=>@A=>=>=>@A$ "          3  "        $7.>@!    !$ @ ?@WHI=>=>=>=>=>=> "!   j           7 I   X2WXWX!H=>=>= >=>=>@A=>=>\=>@?-      t mt     F/      ;>=HG    H   ) -w&  Z  8278H=>= >    $  xIwx$wxgwx H=> =>=>@AK=>=>=>@A         =  / ^- (          (  #ELe  K  8E78'78 7878H=>@A=>@A%=>@A.         =(%.   $ Ho= > => = >=>=>@A=>=>@A+@A= >#@A@A" *  ab  (#{ nQFEFE&   =C?5?8A  $o       + #"%(  H=>=>=>   @(?@?@H=>= >      @H?@H @A4@A    G" 4 cH     p1 5 !`KH ,  %&     X[ fJ    H(   HOGHGHGHH=>=>=>@A=>@A  '( #d(   H (m'( H@A= >=>=>@A     /cwX       7 H@A= >=>=>@A    +    89782AD A^ w  _%7   A^A^    `_`\)A^ A^0  4: U *   #& )  0 +,+mg   2'  :@GMO g `Y_`;JI& 1 ;& `_`    'f8   X wq 8    %  0/0A^ A^     A^A^     hFgh"+)  -.1K? H*GH   # xAwx) S@ H)GH6  "  X6WX K "  $ 1      MO  " '" * B=  -1 uDC2 O *8W X W XWX?WXWXWXWX  )4 CD " E[nmp,   <; 4 6    C(U  8     ?       py;KW X%WXWXWXWX   4   s        8 5, <$.' K % @?@^\ V /#m#0&\   WXWX   (*'( '('(M     + td,   ("7"   vDz  xKwxwx  WXWXW XWXW Xn Gr           `  9J,+/ 0 kD,  ) * eD,&5 ;tmr   lW 4  )tM   -xI-x   WD, _D,'A                   /            ('('('(V     A x;wxwxW    X6WXWX%    -% hghWXWX!WXW XWXWXW X     \ B!   0/0/0-    !!QRQIx        bkbkl4  =F ( !x n     $C rlcWXWX$WXWX ]WXWXWXWX "   <  T  2       3<3,#$          .A<KJ|st(   ('  ) >O ! 3 Q            ]o F&& & AWX9WX     +,5A9   XWX/WXW X  +        ("G /    0= 1(   %2     878786  8+78 78&78/7878 #WXWX$   CN3 $ (%'(['( m     $t  m  II f  C, ,','" ;> wx    `\OM&           f hGgh 3    "+#   8678778QI0JI#  ,>0   XWX (! +.32  ;AH  ('( '( '( '( '('('(.W    XW1 1G.  x7wxwxa    $( 0/0/0%)9   ' $ 3%)9      @+?@?@,   '2,xwx# adc:*)*          &      P*OP.  %       CDAD     ('(  $:                        ( ( 8?78 ADADAD     /C       @8  (.'()  X_%   F  ; {{/E  ;     .$ @?        % t]^g 0+.         @1  5                 <      $ ('("    0"/0Acp eH    {~  1' b8 wIP{ /K0              z mpm n,+,+ mp mpm n,+,+ mp R   ~ }< ~} ~ }< xw}~ k       "!$#$#$#$ h)ghz h jitstqr  z,   hghcgh gh+        R65 !          )6"+     0(/05     P3OPOP 7X X  HSL     7 `D_`+_` A; A  MP~&          0`.-|_      vv vGJ Iv('('klklklk'( ' kl9I     vklk'( '   p6opv  h5ghv]`   7  #   878v%  H-GHv:  & hDghv(  (   Nv!"!& !  '( ' !        v!  `>_`v]^      `/_` v]^/  %/v   ev ml!#  &- " !# \v ]^) '" )  xEwxv'    ' xFwxv'    ' Wv%  #   )"%  # jv mlk n,+,+ ml   }<a     Gv      $  v4   # v  klk n,+,+ ml  !   }<    aP       ! HGHv+ v kl%  % H0GHv ml  &# v$  8'78vk l k lkl       P(OPv/BA0        ~K%JIB >3% 2 `e j;2%+ % 87878&   hEgh"   uvklkno: " ~V &   t                            $  Z5V                    l     ?-E l xZwxg 1 /YV 0 )2/4  3" ?0)03,     321,  34"KE H     )      4 ix* !!$d`_` _` xm n,+,+ mnmJInUf ~ }<  ! &3 .~!     U@x_ \A>x._ ` _`  & TC.  44    878@  popA  4 Al   H          XC       (        ('($  AAp  (     '(3'      y|{:BAB               0  M-          &''  ('(AFAFX 87878&6   P8OP N   |{   6-&mn mn""*0`                    0 C(G-           "5D  "" V    " 9 NM6    <     Y-  ) PGOPOP"*$ !  +M *$  "">=>=>=          p;op,op&"3J Zu6(!+ *GL   klk^ (7IF %B! 3!   ` _`_`P_`d"0fA#fe$# ; +=h&  "%+4/    XWX)WXWXMWXd"NfA# fe$#     +{ k=&  "+34M     POP]OP OP0"/fA# fe$#i    =& "3f.    i ('(9'("   I)     Ef"4, + #  "'0M  (!   C&  %19T 7-1 4  r, 0z%f"QS 0 NM6    <  iNM6    <    *!vu QRKRK :w + 78!]  !+klkn o$PG34 3$PG34 B E:* ` 0* #  @4   6   g Q     0      0\  d             3/7z       E  +    ~  HGHGH8   ##      POPOP.OPm   p],ASH GH%GHM  4+J85TX      UP ! A^A^ _ux      `__` -.-.+ m .-klk'(  J   #7            XC: 9: 9F            (  (         HGHTIJ;<;<g TdUUUU7   )&=! ^  @T?@TJIJIJA4AXIJI4AXIJ I?  55555? ; 555; 555!@     T  L   DL[ L   0   8  C ': & $#   X8  `X        !"/! (    , 8    ;          4Y    /  , (,'(OKL  ( & ?t_  %q  ( "II  -KL,  4, 2    (+'(3    0:  POPOPP,qrar qrarqrarqqrar>ab0   I` 6 . c   5+     3     I          >"!     X+WX ab        8b78$qrar3   !2 M #3   V  8 78278\ o pq# "  N    ;)*    ) 6    g\  S   ZYaX1 qN J              40 5'3,N4TSWs t   `, 7 P2OPOP OPNZ      B P3OP OP '     0  JJ   J J   P(OPOPHE$      HD   HX hghghHM?           A2!"   `;_` HP   "/H%   X$WXH1 ('( '($l 6        -.-.-klk'(  -.-.-klk'(  A^*A^+ m++,+, 2 +m+,+&   OP      ` uJ _ J    t    :  <#$%   2u-9B 90 6                &%(),+*./2 3+2121 65656528787 87:;>=>=@AB AD CF EHGJILKNMNMNMPO RQR  `#_`0  ("&   0 /0  5   = *%.  , @  (''(4)$ H'GH4 '4 '5)% '5 '5 '5 '  5@'@@8 )('8'87LL  39QQ  79RR 8 9  R@9@@R9R9R9R9R9R 9  R@9@@R9R9R9R9R0)                                     0,,?CJJ?*6`p@?@     0/0/00/0)?@     3$#$#$ #$#    .   !   .  @?@    "      878//, +      @   (-'("  HHH  (b'(oR (F'(SS; R (/'(<<1 LA 22' (( (&'('(8 ('(* 6' I1   8j7878||f 0/0FF;<  ('(m-  0/07  0/012  0#/0KK@A  m$.$/$$(         $ NG^[   @$!7 ~}^  #    :0 "%/%#+%,$        @/?@  #   :&# %|%  v'"p' j+ & %7^7  2 !3V3  .A 6 n  g       5  *Y aNM6    <     ('('(     W    ^aNM6    <  YZ eV   (  A    E> A @,?@  ' K:  '        "  yzw   ;   0  ( '( 6  +  i    {R 'NM6   <  $ ap    #)C     #) !   "          9  "!R ('( '('(  ,) 8/787878(   ? ( h7ghwghghghghghdghgh-ghghghghghghzghghghghghghAgh]ghgh0 $   ($?     V   q  " }~!Kc~c "!"'.  Q/4 +&34 +xwz,+,CNcET3  H  ! 88o0  $ ! & #$#$#$#$#*'('('('(',+,-.-05(:;@    7>7JKLKP   ENEF 8378 8      - > 8 p5opop 9 ?D?@ ;K8( 9 87878+    ` _`BW  !9) ` _`bz   !\I 0 /0/03/0"(/  %NG^[ r6D"%     0/0/0/0    I %     &L    *B +      K (  #84      3Y I) !w4    8   ('()   (.yzw  !       /cZ       %  |  8$7878*Z   * XkWXWXWXWX'WXWXl     $GH ?        R %  NG^[{   _h\'K    R  xwxwxwxwx4wxwxV       NG^[O  &!#'= $, ! V (   (1'('( b`    9 W  HLGH GHGHGH   &#  52= &) ((.FLdj| &|    hgh Z   -#HG 5  FC     _2  W 0';F  K M ,"       Q 0    * (6'(  H ID   .'   5 * +,   &     @?@ "d   @?@     POP &    \ "-           j A`   HPGHGH   2!0 or  ( "# 2mn    # *  ; '   @D?@Q    3'  P)OPOP OPOPOP   98*I#    7        " % r     Gz { <  0:/0/0/0      %    " 0% @D?@?@    <     +0 I< PCOPOP      ; >9:)>;    ;+5; @?@?@6              !  A& 6 0/0/0      % @?@)?@ ?@          1'   l     , +        3 4        Q R          "0 xs x  "     0;/0      2 "   XWX/WX   *  , _f   L? &9:% cdcb_    Y  *       ,   H>GH&GH           14]" 6 &)1    ^k         :.-  @-?@?@ ?@"     I*-  0/0    popRopop T ) " 4!>M  9 #  $c7+?M          (     |j- M           *  N   U   ! @  ]4)                  xn% E              *  N    M " !  I$                  r  k3   t7P@6+  " M  D#uMn _,J#6     2 $7(C0+: )-           mf P;OPLOP < 0       $   5     D; 7/tt BNMT(@KL?BrMNi xY585[^ >          r E #<.T4H*F)/&            jq HFGH)GH   D      %"4L          XqWXWXWX  "L2121@    3 ""         " P 8:78A7878T                         &TC%  8,7837878                   L5   HeGHgGHGHT !       }                 + Q )%!$           HSGHYGHGH  !  CE  W   C'%"2        /  (&'(3 '  .,  (5'(B7#     @"?@?@d  Y#   XWXMWXv  . 0+ `F_`_` 0-.-('   &!*   `"_`   -! 4Nt6              /! !"!Ko=3;1$ @:?@ ?@     < 1! X4WXWXM B   xWwx wx     <'.   @2?@E 9$  xnwx    J!  XWX WX $          ;e# XWX+Z   b       M 7m 09/0/0/0 ',R] ,%   ! '0T 0-/0/0< "M   !" @D G  nf        c $#  i` # =O  E"         *6#! `HCF ('('(0        @?@!          ("'($ 878-" @?@ @?@,!   H@GH - -   J2 - &  # Z"  & # (#'(0%  (l'(yynJ        @& D     & &H  & O-v(3  X WXWXWXWXWXWX4      w y z{ ~  O      `_`4  rFz   @:?@/?@?@B  +  2  0+  X 36 ) =!n     @ 4 (* )   :P deP  $!"!($!"!)$!"!)$#         ' &(  )  )  9< F ? #'4@ ; () )    ?$# $!"!($#    (   @ % 5 ? (  X!WXWX     8D  84-  8 plop "!"! &"p )* &;  #  &x 12  & #ECCD "!"!2"!2"!0"!E"!0"  < a <+ N?#, % w: pHGB=   & & & & * +& ! =; - - + A s1 = = ; >8 &ZE$  6& & & &&   J:#"!>"!F"!9"! "!            g  6 p :  #1 I J R !:       PXOP(OPROP OP""!h"!9" &    & 8   8 % B1 A"&B&qq         /% PuOP  "  9 4;2*Y l  !X        q        !_  ' ?   4   3' z   .' 3BE.UoU%  T  r       4F!  31  4          _[)  24             _Z)  .d x     094GPU43U4x CV[\ KV[\ GVq"  :UZ_\YZe A Lc/aA!DF     #:781:789(':78/  &%$7878*JM  x1wxEwx&wx&wxwx  ! $$'5 C(D2 | ""    &    "      .1 ?XZ   ( &47 "k&$  :          "@.b pop  #G" \* xm    54)( ()( $# (7E9      !(=* hghghS*   #  7- 7 &'G.K2 K      #  7- = ;] C2 0/07  "! 0   !  4          M/5 <          @?BAb{ 8;3 n *%    //1 ""CTzI'  q46      6  XWXV    8     A7 5F   D7HG         H7GH GH Y     N'25 q P8      # 8`+!8-   h.ghgh W  Z Y^ ] XLD   h4ghgh ]4 D CH G BRJ  F   ^ R & %* )0$N I  X f    0|H I  0  Y        0        A!HL H?    PO %   ; [Oni, @           | "| PUOP**v    0 B** h;ghRgh5ghgh!        """ """ , '      K#!W!*~9jQ =!  !  8:78787878Z     O? ('(6'('(]'(&'( '('('( '( '(2'(/'('('( J    d,+ & mn     ]  VQ C   " 3Z# 4;  '$ J POP OP/     K) b9! S  34- ! &%w    yz*A  x>) >=>=>%    &(   =2      E %  !  v KcDn!Y ! 8!   S  )D*W( $Qdc. 1  X cpi  hg dW   F  QXW  NM RE :oL" %# !     * @?@?@ ?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@+0 "!          65*     />  3:   -+      POP%(    3.( `        !   >     +    PKOPXhX  "$ 878                                       8!78!Q!                                                                                                                                                                   ! 0/0/0 ;f  # $&/       <  % 4 D* !" ! V8 :& !" ! uL4 0/0/0/0B    # 0*/0/0/0    M/) 7a IHGLKB-Q<^  @?@?@/  ' @?@?@0 ).( %B         94  X   878  dSP" _         R    0/0/0   HGH[GHGH ]`_d-"!"#(q| !%" 9d  JY   (7'(J wx& - & x`wx wx          ?# ? Si   ^+   H): ' "     H?GH GH%'  0"- $ ('( '(('(   3C&      2   0/0/0/0W     = 3!   :  C#  4    t gp  yd <J 4   H"GHGHGHGHGHGH?   f$M 1 h7ghgh!ghghHghgh"gh$ghgh      [ Z   $ )P)&4-09 2%   N &f Xp  7:  - H  !"- 8 5414   9:  3Q!^|e@ 1 J   / $    34  ;46! Q             0&,Q   `1_`;_`_`  " - 2-$ @7?@J     0 @0?@@ + ,% &%5   @       +, =*$K?$7 J$  PA  E  H 6   )*'() !() D-yX2@!    (    [ @-?@ ?@ 18J (?'( '(\P   A 8 "  ?   $ :          0+/0/0 /0k     O B$ 8   0       | 310    HGH8GHj    F9*  $    XNWXWX2WX   EH   -  R3 4N XXWXBWXWX C@7>?8      P` z XhWX>WXWX SNGLQH        [a[  B :>))))))    +  *  *EX BC VCDcdWCB  -C:!D cd  I:(ij QJQ"0M  .W d9 .W d-9 B#***1** *!*`?4S1>5WD      $:1"  !3$#$#hQ          $,   # h, $           "  M X c . 0 P     @ I   "(#   #    O!hV+-L  30 !K  $45\] LM(DE 3w,lm<=de  0TUtu58  vN QNT    d^ a^l klm:9=nV YV  D~ ~  Nv yv  ^x {x~ }~$  "              '"+'0))$9)    @   )                "!"!"!$#$#$!   HcGH3  !"       ! !23 0&/0/0a  y~ }vyS")B  8&78'  @ ?@ `nil   hIghp 7<1#7&"  O H1GHGH  ` 6  H0GHUuvij '(  -   A  K    !'  A$" 4.   A  (2'(?       q '  "     f$ '   0)/0* *  ) J xwxX   %('" e $  GJ  ('(     7,   !^ h x   @.?@> " $ U L I  "+   `O_` e m d4a  & 0# <  XTWX $         052     4 6 (>'( '([P   @ 7?& % (+'('( '(h     L ?$0& %& %  HGH5GHg   C6* 5-7Z      0   @  UG   T@Q) L @"?@ `8!   popop  P  qn O    ;:   !   Q  !/02a \ B pop V  "   &5 "3""% 34%%( 3'6  i-V  "      %. )!)EW@ `<_`I 5(  5)    P8OPE     -    @?(? 9$=2 /*90! '(C16/   ?Q             $            ,.wN       H;GHGHR     9( UEI   34   -.  )$!*# '. #P5-" XWX4 e {b   .    nwp  Vge$"  `|_` "!" !c0           7%  #/8  c P>OPOPOP"!0/-0/" !" !V 5> G2 7&    XWXWXWXWX]WX    2-4P  hW X= _3?pZ X        #3 ]BQH= N  W X?DZ6     @5?@  #) #3      ?@Z2     8278   % 0*/0//0/0   "{-Y pZ '$  $ )         '#     4*:0&.< 0&  Z '$           7q .-        $  16QT9Z ?kJ5 P,OP  !  N O &&  (1'(>>3&  f, ()'(+  *C5   #"  '& ]R *+ (^'( , 2      4!, 0/0',  0/0/0..#  ($'(0     ``_`{@      % -% 8(78 5l !" XUWXWXWX WXWX  #n, +      K-Z  n $ #^3 4a    w  #`W +    )K   `%3 4" l  &4/   - D8$2    ( '(' ,+,                 % 2+ 58                        c   "!     | `WD H[ >;   fo  b_ VU RO2E     *!  EBR#WD ("; ) #"" 6 &"j1*A(  (  4   \( `3_`_`_`_`         (     a %      13V %  U+    A  HGH +   p,opgop *          e0& @ 8'787878*A    M R1* .  ( ' ( '  B!"   .  < 1.        #  x     !!)%&6B  .    B   . @?@?@?@0      0P. +   6 +>344u/" E   "      00T0 8:787801M"     #31) P?OP _X  T#<(     _ ,       z       FQNWV_^ h#  $ ) *30   %\ J N u    !!      "!     P$gN   Kq           n8(8bj `G_`6!" > 85 6   > P   /0          bv@   a 87878b       0/0/04343 GLK (( $  #0    FT < z ,O &   e  -I=z ,O 878 781  @'@@@@@@@@`    QD T       "  0I  HGH&  ' +   K    ,      @8?@?@(?@?@%?@:?@ Z/   gh c    ^ '% $ h=5 ?     T  :  . F .            m4). E-            4(- !r}vuzy %! @?@?@5  ('('(1'('('(  &O"      0/0 /0(    :   POP%   8O  C $G ;$# $M   4 $) *   &) *U    : &/ p.opopC   8 P)OPOP     AB    P-OPOP      'F    P&OPOP    $6   878781   %  XRWXWX"             pkli  p,%   pVopop"            8 RMNK R0%   xZwxwx"             /436nunmrq|w /2 '   H;GH"          VaZY^]hg%  b"             chgj  .5.-21<7 c: ''        PEOP"!           WPWXSTIN'! pFop""         mfmnij_d'" @9?@"          4  H=GH"          8 H?GH"          8   PFOP    @:?@"         4        hBgh"        %            H:GH          %            P@OP"                  '           xXwxwx"              2!%  "         4    hKgh"'          # '' n "                   H'!%$   "         '    pHop"$          '$  HOP %  xPwx",          (%', hJgh"(          $#%(      `S_`_`"               -%        `E_` 8 *- &J I  (4m r g    8 3 XWXp XWX p op$ !p#op $ POPOP ?   3  hCgh"!         %!  `A_`"         % f (8'(E-   0/0L      &QL  %   &       ",` !*) ;] XL $)1                ABIJ !0 V?     g  hghIgh  #$     x@CW       La      . r o       1            *)*-/). UM!!!!! %(   .   >    #" p3op+opop  )) $ !*u&= (M9  L1  gA: 1< C ^  |{;    :U 89:365Y < y<;?:O   :O 2  :O T~ :O  \.   :O  \:O  \  :O N  :O V:O  \     K:O  \$*  *   O:O  \ c:K K g:O  \ k:O  \ ]:O  \/XW@1 >q:M=u:U9 {:O  \G9:O  \ =:O  \@  :O  \ :O  \ :O  \Qxw:O  :O  x[ :O  :O l[\| :O  \ :O  \{  :O  \ :O  \ :O  \ ST=:O ST=:O |{ ) Y:O  \YZC:O  + AB+:O mAB+:O m   )  G:O  \GH1:O i  +  3$/$..#. +)[ b# U E$ !*  u&=   (* *    11  3A719   %010/0  /4/     /"!./&303&34    %$8!&  !(/&/%9%@,E( c           1 PP   %9Z$  -%',  '  !=9 !RA Vy0^/w656565c65d65*65665)65665[65@65I65 6596565656565.65T65.656565?6565;6565=6565X%76565$o6565%6565$]656565@6565656565<6565656565Q65656565@65656565265#f DC t&2    V&2    V&25 t&2 n  V&2  V&2   V&2   V&2  V&2   V&2   V&2 7>        V&2W*    V&2!   * V&2  V&2.*  V&2*  V&2CH  V&2  V&2  `&2 Q=nm .-  V&2  V&2 +P     V&2S&  V&2  V&2   V&2 Fuv C  V&2 q 2  V&2  n&2  V&2  n&2,  V&2   V&2   V&2    V&2) M  V&2  W  V&2      $     $   $    $$    WZ    WZ 1M      WZ   WZ #0     1         )          )        -  V&2 )*[ 70 ;  V&2    V&2)D)"*+)#y%&3%w//~Eo#   O   4 4 \Xpp"{QTwo >  y @ j G2Z L2   K'   R  5  D  91843w+ ?4  **G7   R,&& &$#"!"!(&%2,+*)*).-7434365o>=<;<;@?@?BA@?@?HG]P1MV-SX  FWXW-$^1[`YVYba5d  cdcd cdc+ . %         #TS\Y &   VI  POPvOP OPOP  \ oz s   h-H#$8 0 *88 i1E33D1S%j2  1      no  .'  0  m v      :   '    DCR*?=O #P-G $ - 0$ & : ( ( 9 & *  FAv$ i   1   R-S! %  8   2  1T " r  NID&                        $hu r  NID _"S  ~        88I   _"!'  ' &[. $    3j       "    h=gh  !+ 1 878 /    9  6 . POP)    HGHGH$  8      $P  `_`(_`_`_`$9       X     d%9  hGgh &]J  # 5 9  &j  ll &4? -!:( ^^    ee    S     )"=   # -K6_ 6:   # - er  ( ,5"!"!&    ( \/H' D     PROP8"!"!    8n+!"'*A     pop         $ T$M pop          2  K/O @%?@2     XRWXJ"!"!    8}5I  @   .*  p&op6   8N7878   '(F9dc #(Z{(7aN,   ]/pyv +{(bifGP+m V +Q ^_`gps^  mZ,   oG;)n YK+7$HsAF M/ :8 8 :   N    :     8=7878 78$7878 7878    ! 0 % + 5 POP     - e 4  &%  1 1     !9  k 37x  *  .% 8N  *1 0)* , n{ % ;#4 % `/_`<   0   ZN       # $#"  ? K-.#UQ3 - p&op op?   #           WZ   WZ   WZ   4`      0v' m             9F  yzyz !   o]     G %]  >5 G  * T815 G G 5   +  (5 ,9 - =J - 1   I  DG  FMJ         WZ G Av   "!  y     DBWZ3   ]#b ~2WZ 33     F"m  b  ,;N1[xs  cd5 dC$  $k ]      `: "      0 !Gm A  @?@6?@?@5?@?@ ?@ ?@ ! "     41C 5_  P                   UE*    -  Sc!* |s[nmvu ^ ]f;<   M@?F EVU  g      wj ip o RQ fa b AL  k^]d ctsHQ  ZO  L ALMR  aTSZ YjiZ}@? r     zy  s{IG.E(    u        '               G   'A  J       {fG     [.          '.%T    %        %    r  9       wzq r} P#'  Z      -$                      ol   >?@GD   J#  8; 28; 2       4      (   $ - ! &5. %& '1U   i6 /?s X %:Cg'UC3c    B                b   "  &  #$#('  %,+,  )>*).-. -.-E( 0 /212  /  P-OP(OPc X*9 tn T#^[~AV  ; <-B  ;<1 40/Y y| }   E6 E0&        S = c . 9J I V! )  !  A     L>         O)  "!$#&%+('V P7OPOP[  .4' c    Z   :9:9  ,+  ,+,+,+          e^u  (0!8[ 1  Z A/AAjAA AA AA@  b       $   4$,@  b  [c'* : #8;.   #bhD @?@        +^3M HGHGHGHGHGHGHGHGHGH+GHGHGH GHGHGH GHGHGHGHGHGHGHGHGHGH'GHGHGHGHGHGH+   tsC  "*DC}  5.KD 54  "y $e g  NB]&p o#b3kN      ;<?  " 0=/0/0/0m 73"c %$),  "%  $'  &)  (+  * -  ,"    YV (s XKL[  ZMP  N MVUVU  WZ   WZ        (k    CXI          &A%  "!(') HCGHGH GH GH     "  N$6Kl (y'( '(       -4 kk`,4  @>?@?@ ?@ ?@~     "  I&1Mi (v'( '(       +4  70"a %$&,  "%  $'  &)  (+  * -  ,"    YV (s XKL[  ZMP  N MVUVU  WZ   WZ         (i   @XH          $A%  "!('& h(gh .+ 0=/0!$!  J! D!  ! $'!   @!# !#  '!#  5`#=   .&< B_   ;=   .  ; p2op9% P$OP RQ '  .#  ^  efiha h8 f  ; $  h8;c  h8;c  h8;c $ tq +, =D   +,   ry  g1D/e  P                           =b     ;.(  3 $$       SW$$ ] ^       z  ,  #%%   6  ln    *  aY      !"- p(op5  0/0 "  _=|  (%,% <  HG  / 1 M ghk<)  { |y!&  ;  76.NS \ %  POPOP" #   "        `    U 'Lw@T  POP #       br: `E_`1_`_`  ?# 036#2;6 )6#  )6#  ( H,  ' q<$ #      JGHEF?=E$/ HzGH   &O!    ('(I( qnqr ~}$1 k( heghxN     ,%  'L XWXWX*         c @.#   ! j` &WX[ZS Z8 X  9"   Z8;U  Z8;U  Z8;U $ fc +, =D   +,   dk  zY4:`9G/e  $             +         (&'( '(      /  ! .      ! . @)?@#   2" # 0./0/0$8"e   $(\ f   " t   + & h3ghghgh  - lghe lF  - p*op7    0/0/0.(   HGHGH,GHGH GH14   ',   #1 %/$h      ER @?@?@,.$   h ghgh<3$   (='( , ^OPOPO   , 878+t  @?@?@2v '  x  $   &  R MNVMN MNMNMNMNMNMNMNMNMNMNM N MNMNM N           X qdU( 0 qdU( 0 qdU( 0 qdU( 0 qdU( % X qdUV c  d V     b9R' (' ( ' (' (   H    *- (' *)* + gR            R~v268z|~ X0WX$WXWX2         ruporqr sC=     " 8"7878 l     "+ X-WX.WX *r       ` @'?@      p`opop*      #  B-K  xfwx *|             /-8   *&    *  *   B  0 # (N '`9%!" %   (<'('(0$D baf inm z  (X (<'('(0$" $ BAF INM ' "Z  5e   POP0$    0" < D9 PYb a       +K<& <0 H&GHGHGH< )2 /, )<: `0_`)_`_`< BZ 250/ 212 3HB      b 8&787878< 'r -, 'z (-'('((Bp 4 8$78(  =:y x      0'/0/0( UX/cd*  H&GHGHGH( - 30 -( W v(            $,+      wx$  ,1#"            x3wxHwx(  %&%&    4%. -  NM  Y Q      Hw(   [. %. -      ),$    [           Dm(   Q         ) (     Q        = F= >       H(   H        )".$    H              J  9(    f t     %&  +$  3&%('.   - C^)S%'    7-       b CX (   N!         ) (   N    !          CZ (   P!         ) (   P    ! Ef (   \$         ) "*   \    $ M v(   d 1             % )7    d   1  X0WX'WXWX(      F@       PMOPOP OP( 1+        h) 1+ X-WXWXWX( 1    7. 1  XBWXWX!WX WXWX(               a)      XAWXWX!WX WXWX(               a)      `>_`_`_`, V 5'87< +U  L%E  ',6U V5@3 4 2b,   j       VU65 )B#       ,r h*gh"ghgh, 3 !92 3 p0op-opop@     nqlk nmn oLF      @& 1R)X? ' >  VSVUV QDK  @?BAB ;.5? '  ] =  X%- .- .'('(' (x   | 1-   ;<  56F'0   56/0#2B:0 L%   XX&z  X A B     @?@ ?@Z7"   )# h&gh"ghghB +,  74 B `&_` _`_`B + ,>  52  F x6wx{wx wx wxLD      + 0   GG\!N DWL! "! " K"  #$#& #$#& ) $   %      " Gi L! "! " Y .  mnmp *8565 *    _f}~(1*)U )/'   +     . X#WXWXL6         HGHGH  !    I\0     0  %  0 /  $0'/!.]^[b      y  ; -    /  '~4m;b0 %   $'!\ $ DD 0/0 ~ EL, $Z| { z y x w 3                \    , 878f-t  H*GHGHf=v  f6D  xwx wxR       xwx wx      #    <L>   7 > L    DElkGlkl klklklklklklk    E    ` </" - *   ehmr cdcfy,yzy|,+0sUVop{  -  U,E% E  / / ( n&    ,$   G                 EDE ("      #}u"   p klk l        @!?@p klkl "       t"  0/   )   -$"%5"O =/$ t  #" =  56  ,""9t    0/0t"   POP,n, rAx  @?@?@P  M      !        ,%IQ!    M   hghg  ),      P9OP+ S^]b  +     !    36   .O           POP*   *      ) +   - WEnmnm(nm6    36  ( V_I  :?,* *,WE( &!"!"! "!"!"!"!"!"!"!"!"!       1 0'\     ('( '(,    p8op opFop"op ~ kr%+,+, +,opop,k B U^]  .       w  ) #% %     ,  ('( '('(~0i j    / )0  XbWXWXWXWXWXWX~qrql kr2i ji ji jk +8 U^]S [ V Q BA <:'@(b       ~k l$3 4' `5_` m  YZ        ;H <=-  HGH$GH 87878 7   #*   LI 87 @87 8 7&   *       (+1& P  @  & X3WXWXWX 87K E* K   h"gh43   hnghgh 87878 787  <9    O#'%    /2      HFGHGHGH 87 0 {~  4 ' 0 @!?@ 7   @?@ ?@4   "  PuOPOP! 5     /79 HGH    (   87|{            ,\   )   187    0 /0 /0   Q  -        !"2!Q  - X8WXWX&8787   & HGH QRQR     R%(    @)?@?@?@RB   '   1 @(?@?@?@RA   & 0 xwx"wxR+'( 41   8  $!    _iR!V 43-3376   TSTS /  ::98 U\[ -us-ARA$91G<!V -7 @%?@?@   HGH         P"  43;K hcgh$gh 4AB3434 3."   ( . )0  .  " hOgh!gh 43434 3P CFCDC J ( 6 -  P POP OPe .+   '  #=e P=OP .+    `-_`a_`_` 43 343433H C ,+c{  +w/#*  H x( 43  34 3B  YZ W )1%'    B   X.WX.WXWXL %       $ / *L% _ ;/=o popo 9C~}~}~}~}~}~}~}~"C-.BC-.B opo popo opo  op)op79:95popopopo   }~9C~,opo CBCB6 *)0 1434U\[ " ( 0       0/.!7"   U\[ d   U\[ | + J? ):7h/.-.-0)( ^~}}zyjgU\[ AC< `\  ghgU\[ *" c q '     M}. L]:6D;=  "             )7   "#,&%& '* ./ X=WXWX4WXwWXWXWX X U8<U78AB7 7ts!t4( '%&+, rs !#% P566# X    !4 0@/0/0/0/0ds>      3 a 8787878d7l    % 6JQd7 UV UVUV))    96 OPOR  x  H 3"  H 7   ) )  dQRQ    pRopop opopd%t sts O P  +,+ , A" )%   ^c`  Cf? dXWUV CVUVUVt stsUV/   1 U 5 //?#(         /d `3_`#_`.  ni $ . * .  %&   )~   0/0/0CD &    %  8  J  $ 2  $k    *xw xwxwxd             $ * d H*GHGH GHTX      3  HSGHGHT @<  ) 9 ,  @V  )  `_`V_`V)ji;P&%   2 3Vr r7)  H-GHGHXM   7   CN  Q a    =D  Q a[\V+& XWX4jPOP OP*OP.     L * }v jOL&%o[\[\SH     ( @?@=B d*0!') 2 Q    S / j&%NM&N  cdc h iFY & |I02 ^-.-.qr,  PI K !6 hghghghZn7@?@?|;KZYKY:&A     )      +fc*@i* j  . a(!%S-AK    : h)ghZ6> HGHGHGHZHV    ~ Z Z Y'(&  (N'([P". .  (A'(NN"!  popopopI|:jiji lkP,  q%ji P Ovuvulklk$P'O!8]^[b     y  ; -    (  '~7m;b:  %   $'!|  POPO&%,+ POPO&%,+! |{|{      +  p)op!!   , !  !    !   P7 |    Y    *  P7 |    Y   ,   @*?@      H-GH      0  &(    `A_`-_`_F      !,'D_XWX P  X WX&WXWX  Ax Q`     '  A pPopopopTv$ 0  k8 @#?@ @ ?z     2   N  !  @?@L  n         'QL X?WX>WX9 N  "; $    D,%5     pop &="#   5  " H &       u14 5  " X h  A XhWXF!x ")    ^F  @)?@6    ( h Z $   C  ICFEF V    9& 0  PCOPOP"    /   3B/      -      878 4           @?@?@  * ;    *       &(   .        &  ( x{wx&'%M< $  S ) /'M hZghghgh+D('\f      CD   `7!6 D\ .9 j  q    @/939 j           uv   `.HRJ  *!*#  1@U-HRJ    )%*O 'jT !$    $     2 1 B/O'j  X_WX+     (F( U.       9&CU. HGHGH  > D A -(   P$OPOPOP OP !     gjilkp  T,  !  @-?@?@,?@?@?@%   7 7       "  W P(,+2 %   7 7 *4           -K &! )  ?5 x0 %C0 %-          0   XOPe   e0E :.!+ x  C   b-"!.   JO-. J     ,.,4/ J" !"!   j"(!$     U]  $  &  + "    8  ('(   F        \      D 1l%  3 ) 1 F 1'  5! ) 1 p,op   -  x.wx       0   -                  (2'('( +65636 XOPe!7+  H&GHGH $ ## m p + #   4 p}opopop, +,+ Z* ) ,+,+,: & ( '$5 $ ! !('('5 ='"8  Z   .') X & $ x S "3' X hgheghgh* ) .-.-O m p   K ! .#  O @?@ (F `._`_`_`($! "!"  L  & 3 G   $    (B ' R    d  $ "     O /#'.)%B'R     `^_`_`_`( & /     #    >/*4%&/     `G_`_`(>  |}~' *  F-   (f ; ! 1 cfe h j 4 C@ !C f  ;    !$%()!,/0/ *          8+  B  "(        0 )+EE8+ .   7  _ +JE>=     .&)t7  w+<YYL E     ! $&K*%. &4  -        33- |>      m S SI  a             # =#l)  3    5     b      B  1% %%%  0   * z$34 yz       4   4 *%%%%'J:F<O3Ca *  3  %     &+    11      0S_>%:P4' >J8(        1         !     \CX   %  !   ! "?LL:>N;78 %%% n%%% nm nEU $ UB$$   c  c$$%%%% TMNU $ $U $    $ $$$$$$$$$$&% $$$$$$$$$$$ ZYG U$###S$$$$$ $  0&6KA#  J( L+,%, '!H&5 I  %  z  *+  " W    T  1             $  ,+,+..-./2 /0/ 434 565<9:9 @ ?@?@?@?@ ABABABABA F EFEFEFEFEF GHGHGHGHGHG!45L5N5 4MRSRSVUVUV UX WX  YZ [X `]^ ]bafcd c%hijij g nmn opop otut ux w?zyLp]~}:>H /;& q-( [ ,-F?VS--F?VS""" """"""" . H [ _ ,v^    + &  . z,#$u  $$$$/   +  ,  . r   #**)*) >*)@@X*)*) *) *)J         5878M  9   !$C>E  * >@   @X       #9      '    ZV&!   #9   popop4       '    3 sZ l $ w" ? -  ' #   0        ?- +   ',  "F  %78   ? -# 8$78  "    ,%"    )         D$   w\D             +    C :9 ,    "2$,"J      +$! "  # 8 78$     # "  #   TS  !# NM6   ' @?< 3 L    '     @8?@L $F )" @2?@F @ #" @?@?@?@?@TS"    $$" 0/0B/02-   !' $  S~ ) J4/1G @?@   X_WXDWX    MNU  [G 8z78 3V ~   + `&- V dq  G" "  D$zhABAAt%1 .&g  B_`Eb% ~   2= "   !  abA& G &I &!'-F/ !@d-HF @8/ -'   Y8# ~  )"6R%Ac#!!  '   b   ~R NM6   <  $ ]n      #)C           #) !  !"       H"# $' *+,/21R (|'(        ~`                    ('('('('(-  * - HIGH GHGH,;        + h6ghghghghghdghgh-ghghghghghghzghghghghghghAgh]ghgh/ $   ($?      F   a  " ~!K "!"'.  /4 +&34 +,+,CQ<T5  H  ! 88o/  $   "!"#$#&+(016    -4-@ABAF   ;D;<   ,)"  &        8'&,) #!%`"!"!"!,) "!"!"! 21 . )*  -.!;<   "   5       L]# "/dfD]   \J        @ d    + z "!"!"!@&% 6' > 8? @       "$34          16 9:9:9:W(=V<C$; >! (      @      z 9  POPOPOP0OPOP x   $R B1 ('('( '('('( =    ) = @??@/:    A:   "!"!A"!i"!"! "! "!             &)'1     0-        4 %\ [\[! ' 6 %  HOGHGHGH;ZY! !  !A"E; B. =!     ,'   !y60!  '88 Dk" % &(   00   XWX WXWXWXW2XWXW=uH"!"!"!,) "!"!"!XWTSTSTS!"     ,    3 &        ~       NM6    <  $ !NM6    <     $  5 4$$$ $"$$$$$2$$$$"+       $      t t pkLK  %%%%%%%"% %%%%%%     $$;_     '3  $$ -  .   ' NM6    <     $ON EF  .  }f   .            @M"""""""!]& '  #     )[2?E(2 a ;#$; HO   B ?+ B5^        "#5&%*) ,+* )()*)*)2*)*)=.-0/0/]214343.6 5878787:; >=>=>='@?B CFE=HG1JI(  +*)1NM"!LM POPSVUVY\[\_baba1dcf cdcdcdcdcdcdcdcdchghinm"!lm popuv{|)"! ="|   -9! 0"/0/05' % u "!"!"!B&%&%%%%%% 8##@ 1A B&%#'   X@'    !!!   #g1%2O @3?@?@! A( %%  %%   ZF $ A ""!"! T S?"!~8N !"!"!A"! "!(  '''' (  '' "  ;< && V#"    #" ,#""" "#&'&& ))))G'  '' '' M+    h] &9   1  "  9"   8N !*    @'?@?@)E@ECF* \L"!"!D"!|+((****     $ #"  **'#    = e8 U1S 74 D"    LC+    4 , ))#,+29:E) >  5$7,; ,-.+'('LK"Q U1,   21,8    '  C RS :  !R"$#  : POP;o   !     !I 8)/oW  !z   !     9 "  8>78H789  Z   <5" 6             @ 8;78, : /mpsvy| "TN   # x)wx$ ": # L+#  &' %   *N"   #   &       0    W 4R   Iy 3|PDYZ1  Bjx   x   @j'. '.{|y'.yz~alc %X< Md      w w !   '."!    lklwZ     &34 +    MvX 1 ) ,!, + kd     +    P  Ht 4   34  \> ! ' +,$'$7D  1I0  7 ( ' $+  +*eL$        ! ('*)&*+.-.-*),+ .-2387 :9:96523<7878'( 565 @%?@?<;43 2121NFED34 ABILKL#K*)NMPOLQB K&FEPO TS TS VUFEPOXWXWZYZY0L C\[\[^]@ 5a`_`_a('W ba4 R J     $     N %     '   F  "0    2     klk         NIJkllI   1:n/4    6     eP();f%;<    ""C:kllklgh  W   pp  ? " =z  # Y Y'>,3 (J      $       N%   "! "!'$# F &% &%"0('(' *)*)2  p & x  ^^   t 2` &   x       , 1$-    z    )%    |{   ,          ng( |9zy@*^        kABzyl        +3 EABF &  !         3  v*Q    =' 2  2~6g      # 1$-  z"!"!$#  )   '    8(784D  "I   # @/?@?@6?@+7     F?VS  `      (*'($      ~ )=     p$opfop,L Q     "%i 1     # D$| '"4 & F# ($'( '('(. >  "   !% [4u'     $  *'",5 469}*(< L5   6    p}xQ              z    K I0@G <    ,          /  & W 8 787878 7878&787878 $'#Q ('( .- "/NM:QF    *   ( '( '(%    (%'('('(\'( '(- >    *     -   ('( '( "    " (X'(7~    W0    4   Ap $;!"- 8 78$< "  # (7'(C $ H . (1'(=  B ( 0F/0/0/0/0/0/0-3 @ 9;>;.)*9 n]      XYWXf!   L$   A 878$G! 5"(   # 8=78,J! 5" ;   '# 8R78, F! 5/"B P      ## 8578"     1  ) 0'/0I"   ! #   (='(^" ! 8  D 878,S" 5"4   # (E'(# ![@  L 8%78$U# 5    "    # @_?@1?@.@H># ""B?B% &  "  ##=  ""<3 9  )62L&' 2  *   $ 0 /0/0)% $$   P1OPOP% $$>3: 9 <*  &&   0/0/0/0$ .&  ## !)$$ 1  . (+'('('('('('(-  B( &&!!!&&&!!>;%%0+!&,&&;& T;&        8V) 7   @?@$M) %5&&& &".   # HMGH 0) &#########  AD  0 H;GH$k* &&&&  &"&$   ,# K${* ''''  '"\  B# )<   + ))'%'%'*)(%%%%%%%%%(((((('(((%%%%%%%%%(%%%%%%%%%KH0}N'  ?)) 90                  ( (L'(4.      (;6,6/      (&'('(1/ ,,))    % 1(0 -    2 ( 7C48j%0    //-- /     %u I =  .  O  % @2M'1 's  M' XSWXWX%WXWX(WXWX8WXWX1 00         #   '+]e        K  * ]W3Y3i=2 1  1 RY111        QR    %   Q,+R%   %+ ()6    85                         ..           ;  # #*;D*'=!2 /:        %"       " !"!"!"!"!"#$#$#$#$#$# &'*)*,+,-.-.-<0/0/212 145#  0"/0/0/0/0/0/0/0/0/0/0/0J/0/0[/02/0J/0/0G/0/0/0/0/0  (&+     +3 00*'000000/G11B11  +11.)11111.........1111.11.........1.........1...........511-)11HG1.........11> 11))  11))    11!%  (&+      "     &#$#$#$#$#* '('('('(',+ .-01656 34343434387:9<;>=@?+BA! 5 ..22 1!  5 ..  2222   5 22   @??@& 5 .. 22 &  P*OP75     P,OP6   ! 6    PGOP6 444H   POOP6 455% P   X6WXX6 555!!!5%!  6 555!!!5 XOWX6 555       D    XWWXx6 555% L    XEWX0WX6  55555!!!5*% !      @b6 555$$$5)!   P[OP7 5         55 qH   PcOP7 5%  55yP   P6OPC7 552222 ,$   X7WXD7 566$ #   P.OP;7 66* *7 666$  ::7  66-4?' - C:7 66  -=?! &- 0//08  6666  *  P\OPi8   67 & * &W  PNOPOP8 7  77C  $9    C  @?@ '.  ** " '     @?@&3  $2    2i  6F #&&u     u$34 !:    h ' P> $ '$HP=Z* * <           6% ]1z    gjNM6   '< 3 L 2  ) % se v;' ;  >    " R NM6   ' @?< 3 L A    A     2\ &%@F 6` *% @J >h 2"&%CR @ ?@  &  @,?@!5  : * @:?@$ $34  H"      = .l" ! "!"!""!"!V"!"!             +98 % :%6  &        <      (!'( 7   ! !       9   21 2 52         '   /&   *pG  W5# M      ? P=OP OPr    ' %, .J9    D 0/0" B  (P'(]@ `S D   +    @?@                ( '(    (C'( )  $T) (='( #  VN# 0#/0   %%%% &    \        s"! d %%% % H   H+6 ^ E10 -     s   ko}v#5\-]>P                            <   `        #  s8O %%% %%%% % NM # 6/0& &&&&&&&&&&&% &&&&&&&&&&& :34*W.+, ) HAB;<QR.[.+, ) NGHABWX].+, ) TMNGH]^6M2&), $$$$--F?VS-- $$$$--F?VS-- $ 'opij/$$$ $&S.+, )NCD=>784 ef_`7v/**G 2e'A6  3 '! D6K                !"! $#$#( %&+* )*)*)*) 0/0/4 1276 5656565< ;<;<;<; @?@%,E ?>A@9   ,$    p{opop, d; $ &1 & +8 &   & !  &    (=E  Q%,$^]^] ^]J       & @.?@,       !)    HAGH,^] ^]    '       ,hghghg'('('('('('( '('('+(   -< = z  +  KFE> -  #J5& / # J5& 9:       F %%V-<J   + ( ('      .   B O      I     33 3 `0_`=       P'OP4       )   `,_`       H#GH      )        )          xwx9wx0      $$$  # 4K 4 '"> # 4  043 43434 36r        "'#     # 2% ( F W ?  "P"I%   "  # # 2%     !  HGH "!*    #    M # 8x78    #)\ `_`   '8? <i+'  HtGH&('-('  {|     wx   ; b&- t3('  (' @9> 102,-VS  %%D 2 C&< $4%*)'6 Q Q3 02       & %  %      k      * )& %$ .$*%   ;^O !A"$*". A        $ % %9 g    D(' ('$43 43434 3  &-F?VS-.4f    010 $ %W ) . % # " $  <Gu""<   4      !0  $ iC"&D  h= 3 N    A :A!bg"[ #"      878 ( ( ( ( 6b*  A     (   ' $-F?VS67J   [23  &'./  :; F G  " # *+>?  BCb#-F?VS  P'R9e)A * A ( /               >                             B  9    .    '    `                                              *  U          u                         /87sc     ,            1         P      .  /    2 \       D%     ,      1                       >     +          5    2  5             !(         #         #  ( n          &              %    %         !        !    $    $ T &4 ![ ! * k] - %]g c - 03 &W([$4  }4-*' "(#) : *'% )) 4+t  !0u p" 6 ,D          ,   1 /2 " ! $ #$ #&%('('&%&%*)*)*,),+.-.1-0/214 3('( 3438765:9:9:9:9:9:9<;<;>=>=>+=@?@ ?@?@?BADCD2CF5EHG J IJIJIJIJI L KLKLKLKLKLKNM PORQTS=VUVUX#WXW ZYZ Y\[\[\#]`(_b9'('('('b9' b a('babadcd&cfe0/0/0/fe0/fefe0/fehgh%g4lkj ijijijijijijm'popopor!qrqrqnmn!mtst$svuv$u ('()                        2 (' -F?VS-.        3)          e     R   0/0 /0 /0    G,# pop-43 43434 3D     - ( " l   -     - h('('('('('v ,$ *#$M`e/0   2.    '(    20       Q   D  /3.f$'# 5% "  2M81       7M >  c/ @= ; ^/ "8BLYK5KD" %'nW0,2    J   2    }$"#  5"!"%!? %&2%      x*P    '    Y!N*  pyop   &3) "3'&  -  (%  % <  HG  /  M ghk<)  8   ~5CO2  [I"- @ 4   "       @ 9ij- @ 4 T?     /  b?  4@P   ?0   : %P  }    JGHEF?;?$- X      #e     ('(7 uruv Y `P_`cR      %9 A-.      S - $/     ;/ ;;#   ('( '(    0/0/0<      PCOP#OP }  =>?B 7:9:9DCB  " -# 0*/0/0 V _`Ed Y\[fId !      @(?@!U      @  #    P+OP8   '  # 8678 L   # $1 X&WX WXWXl  6'E 0s/0 4($   an g I-b 4%$  P[OPOP OP: X>     B +&$   20          pEop       "       H,GHGHLGH _      *&-!    0    $#&   X1WX>    '     (W'(  %   "leH .  9 %   (T'(  %    "le .9 %   0     "         "     ;          "       878  -*143.9:9672 $v3  .B  ( < &  + 9-MDCDCDCDCCU   U  P,OP  DCDCDCDCDCD   .&   H.GH;v   pop %'  '%1  (!G pop %'  '$1  '!G p*op5opm !' " ,! Ub <))9 `-_`:        ( OF I   1      ?-!    (   -.'$ 8)78 NM     H)GHGHGHD    ' 06/0$   0! (  "   OP F 1 <  OP H 1 >   n^9353-CA#                 n BAc           &     ' H-{ c hgh     8.78         H "   ?OF I H   1 >     >  ?OF I     1       >  7q8"!8 C%3  '8&8 ( T /   OP  IF   1 <            OP  IF  1 <      OP  IF 1 <   ?  Z C) }Q(+++/(J?5$ /5)(%>                    -&%&#'   N '  MOF I    1       L    OP  I F1 < U.+%#'    3     hSgh&gh  !! &a |*] :% ; (" ((s1$/P !$  6$$          B3`U     >5$n9l65 23$#           [Ka$C""  ," #  #" "> 7 $Y  #%4 8(7878$<     878178$( !&     vG! ! p[op( 3 n -0* #.  3  P+OP"OP( <;5x  #  9 5 HGHGH(C !* 87878(8  (''('(S 1" 18# $#&%.      on[ ^  P ? >1 4  i o("&%0 E  /       =? >1 4T    &,$&*  A    $    P (  # #!   -"> 6,'    X2WXC         p`op^]^]^]^!]8^     6/)7!8  V$  ? >1 4          G'(:]!       Q        Vy  E H? >1 4      G'%:;         %        8Y78 o      $D  hghgh     ? >1 4  #'(&!       H}GH     (H   6  `_`     .M   9  N$Gbjs" FE FEV l/;Z)) ZY</M \Q  !   ? >1 4 /N   '    ~{ |q \         #D ?     21 J 1     21 J    '21H'Ji   w!  !J!1 ")*=69 "!*+ %      "!      # s%%>&E$77 9 #*96#*p  !        .  %          I       $[FE      ? >  1 4       $ ' #  -'#% j   $Q  R     "   POPO       1          "  85        16585 .+  ///x3,+$,P:  2    & 0            #    @UV=>1.%    >      %        $+  b           h              %#)(2)1*#. 'C5 /    ,  M          8r780TH GHGO        &Z.    ( N            BR&u "  RQ   ^QS    fe `]\YXU (! DxGvZ!  /whY,J/gx, ;yt4 h4 QT  G, @/gxDe K, @/gxD k2 '  M '  M '  C   <1        *)$*%$/)<P% 9     #$   PO):9  9          T  BK5<1    vu^[ :? >A1jq91N&<,)                T   ~ L    2$#*gh%434/KL27    '#    $U :!1'+G8" 3      4  n.*+,*+c                    "             "*= &12  3 F 1  !21"? 1   % 6wY B?#'--.,c                   "    l  C     tL  C HXZ24L" ? >1 4' /)&6*2     L   PE    4         ? >1 4   &&$&#           `<_`5_`6 56565 6 5.    B2&   . "6C 6E   :8   E        D @      --             4 35K)          3                      P_65 D565 D5/     ,+,/`m     $!         f e , 0/%! "#<W_    %  Z  D713Q!";W; O            +    '('  LKLK       /                            /             )P&9A#r(%f^mR D7  1     3Q!";W;      O           ;$B R "  &% &. ;   OP# / 8 QR   Z )X8F^3'1     ;  $ B  R     n  Z     FCD3     +. ?  = .  QZ   en m6 5 ji ba NM  :9 ^A(713_             R( "4CD384CD3         "   # )G4"8  haghgh  !    *"  %". !   R h  !/  5. *   ,  2                B W  ; =0  :*   ,   .% &  +,          8 7 3 6b!  1&  +.-. 6  7  DCDCu &!1 <Tu <  7  D CDCu  #&!1 BTu    @W H*GH  XW !  hghLC      >                 /.A2C  'W   x     b)y'7 (% Wx (#'('(      "   "    `_`*$  w-= #  :  F  h    (4 T#J  # HDGH&GHGH+r  M+ 02/0 =@9:?@9:( #W +  ORKL  +    `_`E_`o    !                         COP  I H1 > BEOP  I HFI1 >FI FIDGOP  I HFGHO1 >FGHO FGHGFOOP  I D1 :NQOP  I DVS1 :VSVSPSOP  I HT[1 >T[ TSRTQPMJ GF C 634 /0 -.+* '(%   OP  I F 1 <    OP  I H1 >  vUTlXSZvw/+1-1-I-2/1-'&  ):)                                           & & *) ,+ . - 0 /21214343656587: 9< ;>= @ ?BADCDCFEFEFEH GL KJ  QRQT  SZY\]^]`_ba    %   ORSVadOP  I F 1 <    k por          |.)! -&f+       %  "!"! $#$#&'('*)*) J0       ?5 HGHGH=    xCwxwx 1  0? (4'(6  x wxwxwx M         W)  #7" M  `6_` L      P>OP\      k!                   @G     H8GHV       $| T          ^)#7 T  ,XL                  (      D Q R Q         >                      /sE$ W        (      @$?@?@          9  @?@*** P!OP.$ ,,"  0/0& S        "       `       0l/0 a   (   "M D    'SF     % $       &   ( *    0    *  d   z          FE    `c_`t       (^B ( ('( &%&%&%&%&%&%&%&%  TSTST'  '  '  '  '  '  '  '                     "!('.-X f }}4.    W @D?@?@?@?@ IREL?@  ;, 6 Cf  mxircd  t/:(f 5  0,/0/0T     B!3 "hgh ghghghgh ghghgh  }mS 3="      `B_` _`,_` _`    #  2      w 2  u     # , %r 1 '+!(*#K]    +!( * Q +  0F/0/0b 2 Q V - 9TSTST STST STS     (9#9   Tm$MV UcV U fe   "  &!   A]>M c   XTWXWXWX WXWX WX"WXWXWXWX V Ux    ZY>Y        7 &  %#-R,i x !i bdcdcdcdcdcdc   @!4$53      vO   P    =   #  Y $+ 51 ?q%  *R+WIW39_3 (7 xg ('( 'VU('('('HVU*'('( 'G('( '&%b*'l& %('    )21* 83 D3&,$33, 3+     ,303  7  43 (3 9F33 d          3 <7:DE@565GXOX$('T  0 3" -6  A 1   7 7        ^         #  {< ,-VS                a S  %   ,-VS  * #r!$   $#   (# #-F?VS    <3 @3  &DM * !C*+:6=   "      ;8! $,3 E;* :! " !$)@,  3J @*! 2'/ 8$7 : ?  S;        >     "!"!(%O, +,+.-. -G0/0 /21b85l< ;["!"!"! @A$ BA  0 /0/0/0('('  $  &  % @'?@?@?@   : z + ( '('( 'Y&%$ -F?VS 5 '! D> = #5   Y   $ R$#$# Tc H/ !"#H7%&'H )H 9H    cLQ\  cV[\ ]^]d_6 $c< 0c045 #% r    ('( '('( '( '(5'( '( '( '( '( '( '( '( '(R#$ #\$                    u \PF  PL Z ('( P3`  rx  P(  P6OPPG  &   P?  .   B   $  &1 T(2,?. BP$    (.'(P>      MP_  \ /   LPIJIJ I HG HGJIJIJIJ  MOF I   1    L < ' <p1 !* !;+(I         rP   47. -.C$ J     b)7$   $ =P (4'(PN  76 <  X  mP      "    P=7  0 B  PK,L   Q , p$opopPD   %!    pop opP  U4VWZY"d .V4"(  P  e fkr hI!),( P   ,  ,/  $    1v-K/{!               +  ~% 5 =*W]7?w#(P #$# $#$#$#$#$#$#$#$#$#$#$#$# $#$# $#$#$B# $# $#$# $#$#$#$#$# $#$# $#$-# $#$# $%&K#$#$# $<% &<#$#$q% &tKL   d8       FE  & s           0 )  # ,ktu nS) 0  lm     "+ ^ F(_"y gH-0) 1 a " $}7747Z       B       " !"!$ #$#&%&%&% ( '('* )#,+.-K210/03<6 5<43438 78 7 871: 9J  21    >sUX{%.P#$#$# $ #$#$#$K($#$#$ #$#$# $ # $ #$#$# $#$#$#$8#$# $#$ # $.#$# $$# $#$K*($# $        K     KR QQR      zo zy $ % 7&<d "  $;B'$  $ K1 - K; -f) .[ 9  %%#%    Z  Io/0B                8  "! $#$ #$& %(*   * ) J&P #  $Y $-F?VS-$&   ':, Y%  hB^|  (%,% <  HG  / %1 M ghk<)  { |y%) ! C  7;2SS e *  `_`_`"^ (   " "  #$ 5*     m  b'UH^  `_`^ (        l@ pJop6opop^  ?( 036#214;6 #6# /")6# /4 ,M3  / {A(&' ^ XWX^ "  +Y&    ('(N^, qnqr ~}(5 p, hjgh^}N     ",)  'Q hghgh^*      %   q G3&  0/0 NMNMNMJIJIJI$  T S b a  0*/0 NMNMNMN MNM^]^]^]^ ]`_, vuvuvuv uxw$  0*/0NMNM$ YNMNDMNM bh& 1NM > 0B/0N MNMN MNMN MN M   ;D    NM      `_` I&%&. -%& . -%&%&%&%&        ;'WzI     hgh&ghgh &%& . -. -6%9&   k   &  #  (''i  &9  @%?@?@?@  ' |!26 56 5658 56  516 56 5658&56  5656   " # +-F?VS+ ++-F?VS-+ +-F?VS+ +"+-F?VS-+       :o)uJ    1$!&&! $! qHY    #$    a/Ob*   @+?@?@"?@  KLCD   EK1 @/?@?@?  ijal  !wm < @??@?@    S @6?@B  U V M Do  < 743+        .  ++ `N_`_`_`_`     8 { j    & 2  ( 2 G   & *2"  Y (4 @A?@?@?@     I T 87878 4 1   87878 , )   ("'('( #,  $ @?@?@ =>78 $  .6 56  5=    OP  I F 1 <  $-F?VS-$$-F?VS-$% #      X   })`$   .= 7 Z,/43434,343434 3"4      x             bJ7/     " XtWX *. -. -C    &  k   &  XzWX *. -. -E    ( !  m   (  XWX * . -. -I    , $$ #q   ,  `_` *. -. -P    3 '  $'    3 *     0&/0/0*9 # (#'('(    # *D. -. -      3      H*      %2&*> 5   3\ 13<*. -. -    IJij4/ $9@  !6  E N3I     k z 08;3  + ;,*?j'+9`   5~   3 `8 ;cs b );8w    '       (8'('(   " 878C  XOPe%  `_`_` , XWXWXWXWXWX*( R'*( R'*( R'*( *HG,HGHGHG ````"0Q#       "!,$#&%(' xwxwx%wx%wx%wx*( R'*( R'*( R'*( *HG78 5 65 6C787           3'#' &'        3   `_`_`_`_`_`*( R'*( R'*( R'*( *HG0HGHGHG  ````4Q!        "!0$#&%(' XPWX!WX]    !-]  `6_`_` HG;  # ( ; `Y_`_` HGHA-  Z%(  @ - }Q#C        XOPe @ %Q#  hghghIghL(     > l v        IC2  (          xwxwx  0        Y)+7  0  POOPOPOPd  .   H Q  # (d  V  VF# gt        %t  2n      ?/8D    7 (   orkl    tqpm%   */ Q   J6  $   #    ?/      8D n ) ?9,       = I, ,) ?    9  ,  &      '+ 3   & x/wxMwxwx NB  &   O" ('(N%\    xwx>wxwx"h:G7>8]^[b     ;"-    &  ,P9U4:G7> +Z QROV/ N,B, N  & ' POPOP    QG&D 3%         $ e  7  (2/! &D % ADA*  ;^  =  X1WX HHHGC 1XOPe(     !  h@ghgh ghgh V          '[  V   @)?@?@?@ *        h)/  *    878 878# D    21\ +.    hGgh 0 1     C0 1 yO  %  & %(!""       7 )+N' e .  %        &d?@?F9XOPe  01/0z  [($( R             _ b   h g i n |   C*  *R        - {  ) XOPe 2 $      xawx wx" @          e   "   B  S  B $ 9  $ #   ,) $   $ #  %*:G7>*, ,` a  hg.XOPeM  HCGH*x{zy$* /,  9:9:9<\ y  =[ <  &  J      sr u BAD . >? ' 8[^   & a d x   k H  1 4 w&  V, -   d D,LYB   &  *     1     ]c<  & ($#$% $#P$#$#P$% $#P   T         #"  *A!?221TE 2 D %  &                 <  *$     T        1 3   >   1  \t  *$ ,           , 0    <   '   %    43  8- fef {|ij{| mn{|{      )      R  Gc2   '%                 - <   #   %q    :9  >3        3  $=  GK)   #%              ^       <5636           <w[h      T     <$56      Q0$   popop op op opopJEDAFEF V 812 ' #  " ) 4 6_T  `-_` _` _` _`J^     # ,,  B hkghgh ghghgh JEDAFEF&%  %"& %&%    P  ` *5d    "   PXOP OPOPOP6OP JCF, &%&%% &%&%&%       !   P R $- 'Hb6   ,   $#! `_` _`*_`J 56#565 6    @  #         lklkl  XOPe p%op"op  #" E3E   -%6 5' 44        3s   $ 0B -% '  76 5    "(7  POPOPOP   . (   6 5   +   > *(J IJ 5 6 5b~6 5 JIJIJ P  D    Ob  0       )    8R,51&&&&&&/O (    b     ~   8    5 *&&/&&:6 5656 565J6 5656 565) +  UTWVYX  0  < 7    / WP S+ L:    J     ) T;&6 5656 565{6 565C ,6 565I"      $  OP  I F1 <   Ab4  Y    SNc+$")&?   {   C          , I @-?@?@  ! - ! 1 HGH"   ^KL] L c fSTe T 12 ;<e E @   %0-b % $ /           - . hgh4+*     M#  +*  d   P  A xwxmwxwxlwxwx  &% D" "!  '  +   ")ly Z*> ) HjGH $#$%* ) V#8' .  @S?@?@?@ ?@I?@?@?@g?@?@  58  - !     oj .%0)  7 RL h?gh    &  / poptop/opop`y 8 C~9  @GNQ    *9       {UE y   (M'(7     PPOP   NR r m   /H  N 8(7878  Bz .+  > B  &y 7               ;43 6;0 wt0%       f6&1)\%/   !H  s r   I +!  &90  $(U Q7U1!_+E/   6% y         7      P,OP[OPOPOPOP     !    YQ+^2 @.?@?@    ;g A )      n    %H ),  =    *I!JUL  W XWZ/= %` .  3&X% )   !       ' 8%7878   !   = #  (%  % <  HG  /  [EF E1 M ghk<)  8  ~ 5b|SO2  %  "C # # # #L #  EF E EF E  "   EF E EF E     >H     >C 'Q*SE*0 C         L i # #! #   EF E EF E      @Nw,i    ! ERh #*#1#,  ? EF E036#2EF E;6 )6#  EF E)6#  (  B ;   < vA%$$ h  *  1   ,  # # #"  EF E  EF E  EF E <: O*30             ( uruv $ ``_`sR     )#  %I 6 #  #,.   FEF E     @EF E   ? 7 D6$ 6     , `_`~6 #8   dEF E&  F D-6  8   9          f  `+_` wz   , P*OP      2 8786          80/0 12%12 1R  NI POZYZ[PO FE  NG         R/&!*  ! "!"!  % "!"% 2/P 2: 5!b7#      @?            '('(+,! +,/0%$/034)(3478-,78;<10;<?@54?@#! /A 02343y43  ] 1     ?/$0  y  !!!!!!!&& Q )3" ^  A  kZ,7(BL* ( 8+78 78784N   -$(4 p|op br  #  ?8CF b ptop   -            ?-C>    -  < 0 "$3/tt BNMT(@KL?BrMNi xY587[^ >      < #3.2?*>'W          >    D     !#M          XkWXWXWX "L2121@    - ""         "  /     )4 (  # ?  K0##  11 $$.R0r/ W   !6   / /!5 36580   !6       p''      ) ((+&Jr (<r K "PD IR&)G).>).)), %J9 /    ( 0 -q5 %%*"H   *** oT!c  *b ' * **2;E*^im (-g-((+129eK Y>y F<9 1  .gh XWXWXWXWXWXWXWXWXWX@  )(#$)(#$ D C ?@9 ?@9   4K<6      @ X1WXWX"WX # $   b W   g h M  L     q r                    s  r                                              $ 6{          $P W;A        %&  ? @         * J * 4**A      0         hDghF      ] #    9           ZT 04/0/0/0$          c/0       #`{"    !! !  N       OM!   ^ (  #LA !FA  BA  DCDK DLK FK BK HGHK H LK FK BK LKL K L      PO   ?(6+*#  ( "     $  -  #     ) %      *  4EE ;    : ) Dl       #   "C2U B;W#!'#%) "  w      +,+, 6K+&   %  B  1 !47 $ "%                      705q$ "  % W:)     ( B ( Dh= F  \  8   -$*6q F M      "                   Ey "      /p  9O/Z<?<6    ;/$   0  0   " ^ _ "(2 : VtH 9 0 /    O   0  06       ) 1EYs"         %'B*?   Q    !"!" !"!5  B  1  N -     0& -  bD*    ) M  ) `/A       , W/ %  T <  0/(  0 l>"`=/> "    0' 0'       ? @   ) #3 / x6u& +&(3 $ 0/ 0 2 4      x  8j78V78&7878,1       $   >*      $ .        &      !" !/ 8(eEq|     2     a@     !"!"   1     ? @     .b '   +  *  ? @    ) '    )      ? @        !4      %  CY    *#$ HBGH+GH>GH!   % */R >  f1 #/>:&       P0OPLOP 2 0       $  5     +m% KHv N=2=  NH[(HSTGMRFE585"  4 t  & +#{) S  / %    K 1   `_`5_`_`"$  57  <"]^[b     ;"-      ,GB?4$57<  I        @6?@?@  &L  (    3( & 0*/0./0   =   , '        8F7878 >" (:'(GG"  zPg   D  +  77/07430/0 .t #8 g   6 B;    0/0!! +! 878!!(!! . x(wx `(_`!!  5!     B GB    &         XOWX WX%    !""  # %  8778      ` -  `/-  HGH?GHGHGH7%  8B7% @?@C?@?@%   !"    %     )  p+op[opop ?A 0 + cK+  ?  H8GHGHD    W,6D m3-'6m ?  B *   !"O  ?@) 6"#  %+    2  D    "1*E "" !    6 m   ? B * M  h(gh  ()'( '("1    ,$ "1 @?@  F )1 (   !"      7  7 )  "0& )  1 (    878    . 3     !0    1#  5    $S g.%      878   Q!/   \ K Q!/ HbGH (       "    "  %,(    K 0  @ < 0@/0H ( "! 3H @?@?@1?@ ?@G    `BG O\      +  8"7878   87878787878 78   "  $+  . .  * + %  *  h@gh$ '&% (& 8,78   "/    @%?@     H)GH   !      hgh     !               0/0/0$/0$/0$/0$/0$/0%      # #####$'       .#            xiwxFwx )   B Bmx- u#  AHAB;6    )9pC ^ XWX WXWXWXWX   }~wxql >) ~ >2 j *+     & B ;)) )    $%    'NL #        Fa  @4?@o?@ ?@"?@"?@    " > !! ! $   !   P      +D ?  !    "  "  $U 0c/0/0 /0          b   < {            &3   Ki  C   )'=? L!1"I `j_`_`_` _` _` ;      (!w):5 Z  !                      4 (4+" *  :  @$?@ ?@  & " * % A ^] ]^ ( V%               5 XWXWX$WX$WX$WX%WX & B ; # ####j i +%      #        T#I   @?@?@$?@$?@$?@$?@$?@   F" a@> w &&#  # #pu#Z_# #<        "        c#H  :  +8  % NA  ),/      M@)  B? , 3 ),)I  6],GR U/     r snid[   5 BUV     S " ) 5 08mf3I7xr{+  U,! % A 'g 4$! 6 *# 7 %* xwx  X`       Z                             ~   0F/0E hgh~gh ` I ,  1" - "% &   + <4 m`I  ,% hgh&E  a"wxu K   S N&E  XIWX WX WXWX N"V       S!((N_$    "s ;s 6s ;s ;s ;s ;s ;s 6[ (ja%`,[\[\[- "  ? @   "  ? @      ? @   "  ? @   "  ? @    "  ? @    "  ? @    "  ? @      ? @          Xa Zc \e ^K  5                                      N    vQ!D/      ;      6        ;      ;*     )* );4       34 3;>     => =;H     GH G6R "    QR QZY\[^]`_bad cf eqh,ghghgjkji'6N* N02> !9@I^ ]^]^] ^]^]^]^]f$        p%<7 I  f@^A. @?@R& #($   '  87878   , C,               5@IB, C bZZ     3   2B%4 bZ 3=     5 = l%410   C0/0/80 /G0/0/        .F+2- 7,59 PF0   C    8G       +      ,O& #~:  H          ($:   H `9_`_`_`% 0 /k0/     t-N" k   HKGHGH ^ J P 0/0      "V h5ghgh H / U    &  "Q$    & N}L-  & \  B- ~   u- /0( n E7C *5\  8O78G78W 7                  eD# .#       .    (Kn     4 -       GW(#G it oz        3#  G (%!B     %.,# Ju(     5    j>6 H[GHAGHGHGHAGH GH ( 7vuvuvu0  & 3  " !  %(   AZ'? 70 3 <(}T   !hg  jnhg   '  (  . &#%K: &#!   - &#  #   + ' L   &#&%          .(; (Z  D),gii-  _C6(   $3 8   d;A=A3 ) +}T !    j n $(2 DA&$ ((6  &#*( /(I T D/( > PM"43   L 0      [     1- ''9    " &/ $ !\Z*-\8d23 IT  R         D /   ((5    (P  .   K 3       ) %& /'i  6&  =  27  P (" "(  # Q(^   "+   ;(w      8787 % E  mp    1,)4@D*<  W # -1Z# 5)3 + w BV(   8/C]j   `"Fd. : 6  # sP(F7@      5        AD  6 Q )  @ #,H% >6F7) sP(F7      5         6 Q )  ' #,H%B>6F7 $(1 #         ,( x ILKL LEF       4(   xaej(    2#,3   [ X WJ=3   =,   "'# g  #%/ HL4,VR Q+RQR QRQRQ&RQRQ    "%#    O%:4  V + & g      "  %  "  N  ,H B \K0.  ^\7 @  "$1D! :   42    &+DH$E  >  H    B _  )        ,6 j #        3     ,!(=6 j I      , &       ` & o      ,                           #,        )   8LK" @'FM]    $$ C !!_'$'"WC M  S     `M_`,?  %   I? ,5 `CD=  C $  -  0  ?.*' 7 "  5  ,NM,  8*7878,  >, 3                 /   +, _ U 3 *G:"'  3  ,,0b    0?   Q05<E2 ,0b  """!""["""""""""" "",M>     #        %6- ]" "  r""!         >  0  !  C  f  2  @?F<+9Nk  El+ =l/M8lk  g    ; d [ '(. O l$1ng27^7' , , , { <C=F3GIB >            # *,7 # PXOP,e D    /  X,[ *#$4[ o,  0$C#!?,  R~  ?\POjOjO(   '      { !  1  9]  t  w~ h X!" LA/> =>  @ O<WRY<Y^ynKL OXWLWX [dcXgh kts       ! m%)4\ ) ,!`  -M \kY + 4/  F  -  ! ?\           O6B `R_`_`_`m     =  # ',, BPO<   " P"`    Pj>=i=il  IfcH"iL!   X?WXPj>=iji efcdgh'  ! xGwxPj>=iji  qfcp st + % Pj>=iji {fcz}~)  ! fc  QP&j>=iji  fc38 5 %&  fc?D  fcKPPj>=iji fcW\+  ! fcch fcotP%j>=iji fc{3  #% x"wxP    #$ %   !"     JM G* 'K p UVUVUVUV4B UVUVUVUVZ2  (*43h*   J  '$N 2+,`  =J  =L & /p* & ( ;  (  4 B     ]pB >;* &   B ``_`p&UVU VUVUV 5&  x&wxp     <pJIJ>N3 434343 43434 3 434343 43434"  j       4 $<!$                     "   `5_`_`p  %  hRghAB?, RM2 3 (? G87 :O3    (OPo%pOP'   `]                  )   $"'>JE > :            (  %   ' p7op%op%op)opopop(   Lp                4%(L p9op6opop!6565$  d_  ZW  ' -! x wxwxA& * QM}% &%&)!%& !%_ j - '(4~w   n 4    a  R OPIB7+,)   z {|{ C*$&O     #    *1    !(d+/h  )7)/&"/%  )! ! %Bij F&%&%&% & %&#T`& % "z  hOPeh gvo$%+  Lw b  V)%8-   # T   T    D3  `_`/_`\   -:  * p,opKop9op)op * +  *@ 0 (P'  ^  I         !6 1*&0.  4o r o ropo r o rt s t*st   + 4  + 4    " ]:8G           * POPOP#o r o ropo r o r    + 4  + 4   1           .921!2121" lg   d_   N JE   . )  'V+;2!v P o     %&9:-:   o)K @-?@4: . @?@?@!4\  04( -   !4V zc b8 '   HZGHGH4'O   /Z5"3>  ^3 4 $ -./   ! .)&4'Y 8$  F!4s &6+, A   H M 4 C <;J ; >'A 3; &  %''  `_` _`48     S 4   / !# % B+/< ('(+'(+'('(4      "!       x}wx4 4    70ykO`                 x2wx*wx 4u   -3  % p4p G   @(?@?@?@4m    G5   |JP4 c         8(R ; #  &    M.4A-.-*=#  /   kA= w$Y4M-.-*jiJjijiji-.-.-.-.  ! % %   %; &     5   (9'!BMJ             P,OPOPOP2)J  ) ('('(2%`   xrwxwxwxwx 2  &  BZ O: ( '( '(2 /6    % h`ghgh gh2  8  ((] pdop:op op2 : ; 9=C) q2 >H 2=;F @??@&?@?@6y  2   /64   `_`_`62F  6\ ) $ %  F ,>z   POPOP OP OP6S   2" {6o(  & j (Q #o(6%  z6n(  & ZQ i (P #n( *      j          P_OP:OP*0 /        /2GfX%   *  >1 * <) +*   mn  *    cd   HTGH[GH$GH$GH-GH$GH$GH$GH$GH*     . CF -    [T SN  14 38 7& %  $(-> u  "     %/\5 h           * $!"#@           ""  G   % ;  N-  *)O' 6RW >a@ HTGHfGHEGH*    &   ((;R1 > I!O 7:   !         4?  PP*' I!O 7 7D $  pPop1op ! kP9  6:Y ,  /B'E!k   17 y < =$ BA2 U  %6&'&7 y X9WXWXZWX4WX2WX     3 ' i/'<3B  3(UI"6!<3B 1.m   0    A 8 0/0/02    |+I            >&%& %   $ C< 3&'&' ( 0     e  (   /012 ( - 6;  0 J ;"1 +,!,Q.[!'e,    U    > A     * !  x+wx8%#  XWX!WX%WXWX .@ ""  && oG       ; 14G xzwx@1 21212 b (+,    +0/ <$  x   J @ 3 7  C %5"3"   (    +6*( O'       %rHG  'L'!    (   1N KGE(12121212121*S 1(2121212121*2   1(21 z {XUVUFOP     L  IJCB ?@=>= *#    * '  5B 5: D       '$#j;  .BIBh,!%%] " D(      +             &    A  +- 0< 0 hVgh gh4     F.#!, high gh!  @d     0 (< ! @ pop6opb3, ! P8OPOP ! "!"+!"  + &  + pop6opc3- !1    XWX     J%%e @/?@?@E   @s?@?@0?@2 3  0 ?67@  I<K  <A  D F0r                $N   }|}|K a &@>I  DABA  +  f $          )dS&   n D@ 0*/0/0+"   !  xwx    G     FL<EO XjWXw    L t                v L XQWX^      3 P  f 1"         ) ^  k#8   @?@$?@M     '/ 87878=    %   ` P%OP6OPOP  $#J- .- $     FC@ !8I9 :9:9: 9:9:9:9:g&       o,  /P6 I  g9V0  n G`    @J?@ ?@a: 0 %> Q @T?@ ?@kR : %H [j 36:  Y\ -  #>=$#$E.    (  /0. SfcRQR ! c= KA  '*T E h,gh9` H6GHGH ( fa   ( ,*    `<_`_`9_` _` _` _`+E FEFEFEFEF9F    WD+ 9EbP  w"&+&     &    e 9 M  ! &+ #BNM O POPOPO POPOP O POPOPO POPOP;"< O POPOPO POPOPO POPOPO POPOP O POPOPO POPOP;"< lk;!<;<  $+> $'$S> /&.$O: -.$K6 - .$O: +,$K6 '&             !SVX }  % ,<t%.DE$ E R E$Q (  r              "            " ! 0v(NMlklk O POPOPO POPOP;<  &         #   _ 23V  & &g((( /               vNMlk O POPOPO POPOP;<      12 &        .-  _ +&{3V  &g!( /              `]_`_`     ]c J  +%   6  OU &    @  CI ->=.=.\  9fc82i<%  h  EfcD&iHt  QfcPiT XGWX%->=.=.  mfclip%  !% !>_>=TS(     9fc46-;< , & 4 %. xlwxwxA>=TSr  YfcXYZ  $, :.AV qC[\[\%e fefe"fefZ        '% "%p   xowxwxwx  4  ?QY1JI    `q_` _`  8 \  8  8N7878 78?@?@P @   MPk  @   @  @P?@?@ ?@m  @ " M X_WXl   #  4  ("'( '( 0I c   %  8E7878 78 U 7   8F78 78 78 Z 8  ! L Z 0D/0/0 /0 F 6   C F x&wx wx ? 6  #   )   8M7878 78 M 7 (F M Q_gh 5>#L )    G*K)_FL @J?@(?@?@"  =     : uvuvuv8 `_`_`3J  H#GHGH GHP`   # HGHGHt  P OPOPOP\   J!;-  *  4   H9>Q  +3DQ5  [%  @/?@?@?@Z    4& *G *.  Zo /41 4  pNopNopNopLopop op  @@@ @  ''% D D B M3>=4 =4  fcpi HWGHGH_`_`_` 5>=6=6   fc ^i   % &%  <   )fc(Bi,  HAGHGH5>=6=6 X  Afc@*iD  # % }~}~% "% l< #    9 < #(' ]d   p]op opv 8 *N P!OPOP7     uN' 1   ))GN '  08 ,+&Q p^op op : 3E#N : ;  h  8 ;H+Q yfX 5=5HQH5  S54T%EbFH Q 5>L~ *    G2L)qGL  ={|{|{|63H  ^ 2  4/, C @  >   8      @  K <R[ >  =-*    &."  &= $(.'." popop op ope    =*! D8 {3 1 8%  C7 h_2 0 7 >F $#   efefP ?FEH@   8   : ; $#   j 9<8 a SV 6 e \ ux #  =+ij"  ,) 0        .- d 4<X'  $  7j "x     3 ! m  ;<?@78 7 49231  P6OP*OP OP OP  uvyzqr    a B3/+Y  A5 >50 . 5%  0"/0/0 .%  pop  `    878ST      Rg +9-  & @4 Yb/ - 4     , <t>  <'!4 8787878%78787878c  ] *I`L` !s]@5%'c  ] G .<   7 /3 %2 #? # 9  ) `  C  (T'(aF i (]'(jG  (0'(=2  W9|  (%,% <  HG  / 1 M ghk<)  { |y#  4  71+JS T !  @?@?@"    "         U     J 'Dk8L  @?@         Zf6 PAOP-OPOP  ? 036#2;6 )6#  )6#  % D%    i7!   8n78     "G    ('(E% qnqr ~}!. g% haghtN     ,"  'H HsGHGH*          X ;*   K  | x;wx2121  $   A521212%12 1<3%  D * % -=B]  pTop?       F@ ?  ("'(              J     &   (6'( J     '     h&gh#H p:opJG% N \  K 4<34  0/  0 P 4<34  0U/"  0    7H    w     &P  ZS  3TWF 3<ETWF-1<  }   }  }  }   D@_t/                       <-$#  *+78        !Y+D? `2_`_`    0     B 1        E9B 1 T* {    (  (;(   :% { H5GHGH  ( - x%wxwxwxwxwx(wxwxwxwxwx  R:9&9&%:9 &9:9&9:9  C&9   :             /     [[ o      #J9i E{!-M D9   R         C"#& % ( '  Gmb 1       &#                  0 WL  5 * GB       &  _F$ A ")   %   n  k                   7!" n !   'o-% 1"e  !  &   6      %      aI  @F?@ ?@?@       B (K'('(       I @Q?@?@      S @D?@?@    2 xF             0  &w         }             12    = 9>       }     EF      OP  }  " q   q         m  q &  }   u       }           q>&40T;%9 -,+ ) !u$                " #"%"!('*  -0 10/0 /&%& &%6 76565: 9:9> ?>=>=B ABEF   0/0/0   84787878    9 +%     (#             C  ) ,  3 %           [ $7*)< 0   3        }  &}   !& 6?%# ,           &        '.86  XA   (; 1+&;  '<;    qtR9(9*  78}"'7(9:}tc / qt$')",Y;?,; BA       '   " #"'!$#   0/0 /0    PVOPOPTOP:OP           )#<  HGH   `X_`&9: 9E     %  E POP? (;:&9&9:9":9/<         f>       "    p3op@ (  (  8/7878   2     x^wxT= >  +S f  1   2   `I_`Zh!   %2  0'/0   !  ('(L[  :    @%?@ ?@J 2%     D 7    XWX; F5     /C" F5ttX    uu$#  C2__   0  `Y )*% ,' . V! K 1      ' ,   , \ X1WX5` 1L ,85 X2WX6z Kf -96 0/04/0/0W       5 ^ W   `_`  {   $   1 F"XBt#{ `_`  ~   ! (G <1 F"ZBw#~  D )   ,  $ j  3                   S       'TQRQR OROPOP MPMNMN KNKLKL ILI JI.|   |y $'&3         S       ' d  !         ! $     858 - = *$L,!             | XWXWX       &! &!   ~ Z 79"   E  . 2.  #9              &     !*  o*]J9  & ('(                                                6  *!                                               9                ! $# &% (' *) ,+ .- 0/ 21 43 65 87 :9 <; >=@? BA DC FE HG JI LK NM PO RQ TS VU XW ZY \[ ^] `_badcfehgjilknmporqtsvuxwzy|{ ~}               6 ' (     \3T$ #SZ         #  ,   ,;T S P       #^   e  V*)c|u}21 ~Q     5 %&BK%    $#fV  +T+ P  87878378        A1       POPOPOP n q= %  S T$       !# '6 Kji j i ji        ,     *) L9                + x   / WT gZ ,  '  6     K     4         g '!#   1kt XUWXWX  '' ) p4opop op  TST ]^] ^]^ ]   _ bah     sd         @.?@?@/ B  ('/  * j  3                 S   r 'nklkl ilijij gjghgh ehefef cfcdcd ada ba.    $'&3              S       ' p  !            . , * ( % NKN C ' $X,!              # `_`_`.  #           \D+&.  #  KG  .  2. G !H           mjg`+4un (eRH     E  .  pNR  +(@   w mM0uVQpNR S  % .:0 8 2 c&$&$ * n m  Xm<; 21"!`4242 c&    $  &$  @?@ &- - $$$$$$$$$$$$$$$$              4  ' 4\[\[\[ |  {~}|   x '(  -.    12   .,  O G J15`U4%= (5(*( 4 =   6  12 9-  L%%:=% MkA 4  4  <7     0-<!>WXM  6   9<k M$L%/  !:=-kA   8784#('( `  42  [8p "         '   "   '  ,9Be]g9 :    .   @8?@?@ 21 21  5   <M 21G2121211    #          e*$*! G1 p7op ,  ,    *   @9   o1212 1 2 1 2 12 121]o1(             8   "= !" \:"9      ]( !  !  `T_` _`! $S $   F&&U $ PA  2121$   /      2121   y 1J%IJ0I O  >=> C}-4]%$#,>]< #&   m -m} m m]2m^  Q" C 1#0mH2mn-: INRJ-3"%G" ")2 %,MA  $        /       "!$ %$#$ #$  '*%)*0), -,+,+0/0  xwxwx      '(. 9 6Ym$bK#D z 5$1# k    H ( | "Zi%& 1 . 1 fC  "Y H L { ~  m j  E   U 6 " ^   . @TLek#D z 51 k        - (  &c  Y Fd cq          @=,8  6 +   ,       (.   o\+5  5G  Y F q   J&&*d c# 3      7 )d* # 3  HCGH.GH GH&GHdcdc " ;     .$ , " ;    h""!# !##f xTwx&wx&wx&wx$dcdc8         A 'r$8    jWl1 .!" 5.-.-#           "V       "    " *       .-.-.-.-.-.-.-.-      4o                               V[                      d;UO?$: 6  &  2 c '.IF.     5  #           V   " !  $%&%( '* ) & %,-.-0  34*12 52 7 : 9 < ; .->=>=@?@?BABADCDCF EH G J I  @$?@0?@ "!" !"!"    4& G   8E78787878dcdc dcdc!                ,S !     XWX,WXWXWX d c      5-    X'WXWXWXWXWX$dcdc!                /?$!       * ! *$#$#X $#     +       HJL-#$"B *X  <)4 U  7            %     $  > _!( ]\4 U  7              89     sB%49L%     G;~n;,;jWCd cB$# $# $#$#A$2# $2#ZYZY %-x%-/ \ Y& w.&     *.&q *G-    - +S.&qT- +q.&qr--  ,(D-.&C-.   U Z4   > >))&U-4** - 4N*-i-!C #     A  2 2=  Iqdcdc dcdc&"p            &dcdc""A    ?   dcP  <; .!  $  %<% dyx e:T   [#;       E >&   '#  S       P     &#         A      Au 3$  Kdc h     f0 @ YL(?,Al@% z 4 [8  dM#1j =6 %> 7 )X 6O(/$P (T  &   p            " !&$#$#&'('*+,+A. -0 /2 1( +4 3?6 58 7: 9<;P> = hZgi .   9 99<;<3? 3! -9 ; 6  ge CC(."/   R                                                              5      .-.- ;                                     ?                  B     &                                 &  7"     L  U @0&.- 'D b#(K')    m (! $=! H(& ! ;               " ! $ # & % ( ' * ) , + . - 0 / 2 14 3?6 5 8$787878         #5~   (  "!x 8 <D "          in 34-.34-.34-.34-.56/078129:34       9      P[^WXA >    - !  &!Y*&n+                     i "l k  " A 11V,  _T w O$,$GvKLrqrLKLKL o p o p r qKqrq KLopr qrqrq KL(opr qrqrqKL K LI$#o p/rqKL K L#('o p N 9:3 $ ' ( - #@HA6   =X_`YD 2 Uryzs\     ,% t }~1 & s+ !O !(&aEB  *  :       (    " !I$#& %/  ( '#*), +  _r[bOe#v' 'WrqJ ItsJ ItsJ ItsJ op >op o p*  @ op Aop o pz$#    #$ R        +"2 _   }~      v      > {   F    :  . !mB  1 ! % 4T+=& & @ D 9  O'     >  *  @   A"! $ #z&%( ' (' * )#& @`I| +Q 2   $Tg hSD3 4 @??@?@$RL   A$P 4f 12=T S*@?&T S12HB B?  POPODC b WDCDA   '('('"!: 5"!"   8Ee $ :' = *&   H Vf}     - Y  -# XBWXWXf)N KL ?   2  ? &)    P!OPOP|.u v ^     &.   iW |#EFEFEDEFC1 v CD-  Ct     @0"8# -  | W   t"0"  **   b0;|QR/EF*EFu v u v)QRQRQRuv u v u v&u vJ      q ^ ] R  78 7 4 3 . Ly v X 1 7 E )& j  /* )     & J `!_`_`_`_`_`_`_`?_`_`_`_`(       ) #$r ; 5\s#(   :9f-/    !8    + 10/6 +  !  $% $#!  3R5/ 2! W7"     f     -/     w(&%J $ 4.*J P OPOP  $( @*$(h g    3        (U212&  #     AH&   IHO&*OPO#  < n !./8 M  '(+~h            A*x,2%](+  xBwx!wxwx( ~ }r   " %  r Fe%$ (~ }i}:iji}f   [S&% ^'L :  f !!$( :1 <   "3"b  4 P  > C, NO^=(   $r  &u &-F?VS-&      E &-F?VS-&     >4+ 2   4       $     r&  u 4      q   '       n(hghg42 1n! "?R        <)  $ & 9\\ jsr  /0  ~          7   j Q9>))!#E-B$'  C4n ?    R           u p-.TX (   !   .." -  */ !'  ! ( !   " !  P$OP(@  &% X%WX(A  )& h+gh(G  -, 5  r($          R   )    HG           4     )       :  NC -DC          /  18 "G  2^  B0(  6:.. ' 5/; $0/"$R) d((EhghghghghghgC hghg + !    +  , &   ) Z Y'CE;CEC         (f 5 #  $?&:-(T! "      1 60     2  (/)3!$T "1"_ /7(~}~}g hG   <+   "%E(g #  NM NGHKL  -GHGH klu@9 8  1+#(ei}~}~}~}+~}~}~}R~} B  m   >  < ]         6  "6>.+  T           9   m(,:9   QR   a D"       k:*.B* * ,;3D p9opop6op( <O &9;( h xwx7(X  4 6(Xhghg5hghgh g7      . L? #  61!X5 7 (hghghghg|{zyzyz yzy"hghghghg   (81%& )0Z#  6z2!ts&  Ns>L3s#   +L=  *   !       \[ S\a<.Ns\YWWa0 -:s3;  <:    6    1F      <.Ns  <m  <]f    _\ 9BDI]y:#    " :? }+ *      #    " d2  6 '?!:C6, 5 ) \+!,# ! $`6 7/-2E 6);0>: H ' +:%  / !TS T 1 !V 6 $ AD EH3 Kz eC&    #  x  S      \.    $# (' d   J )*),+,+,+, +.-.-.-0\/2-1 0% & t U&36\.36%3 %l &7P ( [ T  3?+ R !,b ababa % &% &+b ababaX,WXqXWrqtststs'b ababa % &4:=     2i  ] PO J    Ri   @_"(87 9           x" 0q! :    sD)OK  .NQ =    +  *         4  ,-    -  0/0/0,    "   -v]"",    dcdc   dcdc               O 7<.(P{        "#$# $#&'('(',          ?00',go tS go tS go tSgo tS ``` `,@       # ('('('('('(, To TS To TS To TS To TSM `c `c `c ` ""     zI        M,+ ,  hghgh ghgh,_    ,$U ,%    %   % 3` 4   3,V r% &"nm% & 8-TS  "             C           , BK /V !, " D 5 #?(,656 5b a-65T  2121<CC*) &%&%07C)            G)*   ")*1 .56=  r r K r;'K'jM (#(; )5~pv  [       P:OPOP,M  _Z  e~,mb aPb ab apopob a3pojcdR  w            +       +          , d    +  >,E +   /     C    nmpo   +*nmpo *+nmpo nmpo nmpo=   nmpoA    #nmpo1 0#  #        %% %% $   , L 9 1*. 0333/& 120$"W]1D1#&(*"-#0 P QH!   $   1  %" " !"!  %&%)j*) -.- !"121       ()*565 0129:9 678=c>= <=>AdBA BCDERFE,> $,pop  Cop      3 !'  %'  3      3  '%&,popo pos        %%!3&&5H,      pop ,pop  Cop      3 $'  #%'  3       3    ,p   Copo/21 &,   3' &"7 ' v   3      3  ,zb aba,     ?(-    5,wb aba'% &%&            3),A/%:5    R,5b aba   * 2-5  |,,p opopop T ))7,  @,i    #E( @?@,@? e l  )> 8 ,"  `_`_` ,pop  Co% &pop      3  #'  "$',!  3     N,jo  7        E;4]#;7o 4,;b a    %0!;   <,PTo TS po TS po TS po TS% &%&% &%&0% &%&0% &%&% &%&$#   ``,)` ` $        .#&$  ?P         0 0  " !"!   ,       ,H#     @  -,*       % & % &dcdcdcdc% &  % &dcdc%.-.-bb abaJb a ba% & % &7          ?N& &   <<CB; ,)  C         WZ  WZ            %     Jle &     P& >6'' F 1`&!7g#*                 % b$ #$#J& % $#( ' * )7 pFop op op op,b aba % & ba            i '4      ,5 M        BA.!85 M O,P  HC% &  ,+,+,+,+    (# 8         4)8!(;1+ P  HC  d@   ,% &b aba%& ba?1b aba*b abaJb a ba ba(    ' -      2    *\      ,*)*)  "           A Q+[%&IJ   N    % DC     <F+ MN! [(+Z H$  4 E.RQX:*(0);&,$   %Q@!78'-E#&(/   ?1   *   J   (  p&op opop,"   y, /% &  #$ #$-"        " !  """"   " ".   677#!^(  "]R /      - o,| )    .(Y  ( '("  p? IW 'a %1TQ@Nza>u %+$+'")M) [F5'        %             %                  &. :      %      (&)  $ '  ,+  u"  0#/0 GFG$   989 8%78 +*+$     Y  ZYnmvs ;K#  d  oHG@ VU IR    (J J $   g <q%V & )E  & :!            ) <  "! $#$&%&%1( '    =  ) Y       d RQfeli M    \     k@?8    NM   @?   21  AJ $#   BH   % lkj] X$+)#%*C ,H"*    !        " !"! $%(+.147 :=@AD EHIJIJLKLK5N!MNM  &'*):9 *)6523 >?:; ./*)67 "#*+  B               '  *8     - 1>  $  E P     5 8   P     ] " L!+                         @P [ 2 m     (?. ' $#"%&)&  W* (+   2M[ 2 m n v>  "  @5 W6565  &=JI> =W 5n          n      G  n    (,+ :                  + 8!78   XOPe *'   XGWXJWX         ,*(  %   #$         <   *     =  U*    '    ;?,<,) _  " +$ibg  8ef.ba _5p{ !0         ' !$  !)*  +,)    *          ('('(,  R  & -  ,  fn ( t _p ) ' !  {   :9! `+_`    z }rsp     P&OP    2  dgd -           !)  > xuv   y   LK   LM  :"$Z %""        !)   &   !%H l  ,# 7  ,   hghgh    4 <9 DR &  !%     H*       (   @X?@  Q OL(   Q @?@?@     8j78w 0   =  < "%##(# 3N %dah e!%#!0 /8 3 &+_  )$+   :**q  lcC"FGH&     &=:**q   ,+W  Dj%   1 %$,)W                '#               >1t!'9$2 z2         3 m   !        s -? < ' m 3 ^   !      s ? - ' ^ XHWX  )  4  ; 6 po __ (& 8 (   . #   @#?@?@0      6 0         9 3&$   )V    '.?    )&A 0,/0/0 /0/0&     # W &   x!wxwx98    9A     %2 NG^[ -   % X8WX     !T NG^[-  ! 0/0/0f  0/00"77      D  $  @>?@?@ O*   : P:OP GN       '    |    < HG&#   1 1  M   ghk<- . 8Y78O78      JC  8U78   P H4GHGHGH? ?01" 36  ){ HGH1     0* i    V IJ GHEF?60" ( 8@78 M    )  $    H@GH    K ~+-   $7D (       W  G   BCM `8_`- q 6;   878) G  %" PDOPOP U*   > P    0*/0 . 1    > hgh      HM ~l JI LK NMTSVUXW Z      W! W t[] _        |  HHGHU  $ PxOPZ  f  m   P!OPOP/  =7/   ..33t s4t st s0 2   5 F C  . 3: / 4   XlWX3WXdG    587@    "   dG POPOPOP        ~H  P!OPOPOPOPo     *"M -$ Z m Z m Z m , /```4 %-#!J/X$           z "mt s+t s          8)   ?P@r m +    )  :(Z m Z m Z m    ```) !  '0 &%#aa=60]2d        :D6 ( <;<9  FEhgnstsnm== +8D *$ 6       'N~}! &D  ('(Zr &&&&&&&&&&&&&             ('(Z ''''''''''''            POPOPOPZ^    7 Z   @!?@?@ZC  "   HGHZ@?     8A78ZT G/  Z ZZD '  ; +:Z S Zi K>$ W Zm ! O>( XMWXZ @?V        1 0   * V @\?@Z? .    @    ?  Z  Z# # #Z`           Z Z  Z  IW  "$5 @?@?@?@J[   +                34'(     C     "\I J[ 3 4  1&! J[#] I4   L  ' '     ?62;8! #    R  I\I J[, +  &  5'*J[J[\[ J[\[  J[\[ J[y J[ +4^Y 4R 4 + :2) 4  nu:\Y  .):AB `Y `c%C    0 5  # 5 6$  g r 0 5DE/        K !B e"!"!, +3 4 zz zy    1i,&+  )  &m   ) #     #  i8?)&m XxWX zyz yz C   wX   C)   ( 0/0/0    ) 0   #h A  S          . +  \ 8 %.nS B'i1 KQr q,r q'r qZ k Z k Z kbRQRQRQRQRQRQRQr qRQRQ!r q    )*D          0 1 3` ` ` :9>  23 +FC%%&$#C"$'5=-^ K<    , '          W" !  !$ #  POPOPOP-OPOP9ARQRQRQRQRQRQRQRQ    Mc/ { 7    O$r q    +  /-  O^I^I  >" I    O  878782  qzy&  L6 &   0*/0/0/0/0/0 @ ) !  :'L @zy 1  "j rr q-     #$     h?I$. )=   9` I  4,56 I' 9;'  I PQ (3<?<7<;"SRQ   RILKLKJIJZc&    "7>"   }~       % I P)dQ `Q> dO V/3'".*( #'$0e> k  $$     |  yOORQIt XOOOOOOOXOOOiO5PB,|abaxab     Z m 0 1 nPP*                       %                            @?       '              #                                           !&& &  x:< ) ( 01  / & & & & & & & / & & & ? &   ( O m 9 QW?2(]  &  < &57$#$hc6  8I00 0 0 0 0 0 0 0#&0 0 0 0261!0 ? B2,3I$1Z,Y5X      J  J (  X    K    "  ! & % (  ' ,R+*J%$J. -*21 4 3436 5658 7): 9< ;<;> =>=@ ?@?B ABCF.EFEH GHGJ IJIL KLKN MNMPOPOP OR QRQT STSV UVU X WXWZ YZ0YZ YZY X0WX WX0UV UV0ST ST0QR QR0MN MN0KL KL0IJ IJ0GH GHG B0AB AB0?@ ?@0=> =>0;< ;<J98J76056 56034 34- \[\ [\[\.[\[\[\[J  - 8/78O78| g     ,  #   J XMWXWXWX WX|           *  &< PAOPOP | .       "  # %  .  `f_`O_`O_`|          :' &  o2#% 2 JJ H4GHGH|_JI`"  !0  (#"|I`    H0GHGHGHGH`|    6 1        7 "U4 `?_`_`|l 4 + ( ' @.?@?@|B    )  _ +|  st  # 5    @ I $             = H 1 Q YMO5e HI  L 6N .   J |*    U |_JI`O!0    U$ $O  hAghgh|_JI`/!0  5#/  ('('('(|    ;-| h+a    %     +    6:,;2 O   +0  7R!|   VGHG Z[B7 NO8Qhcd_ FEN    ,' $  #837&HG@C4/&        - ) +1j "3 3  0 0    `8|aba b_`_JI` ab   !0      `          ;9% m O9ZW(': %          g% .   .  |ab ;N  %|'st"_`_JI` abab. +st       !0      D "&4?*'" . +  pLopopopop opOop|(      ) /_  ;#+#(  `J w*8O|!"!" X!"_`_JI`         !0     $       :  ) (%7+Y 8 0  R      $   K.  0  X>WXWX'WXnWX WX WXWX|$_JIv* )  !03  !     21       R [(71            *   `V_`_` _` _`|aba bab[     Y/( [   |ab    |_JI`!0 1 # ?+|   |abab_`_JI`ab_`_JI`1abab abab !_`I`I`n   &!0 !0    (!" 0abih ; $ 5   &'+ ->  &&T`?  '" .    1     !n H|U     8#78|0   G|_JI`0!0 &  ) %0 |ab g  }1 h3ghgh|@01      9'@   87878|   )   x   0C)%   0/0/0+/0/0-jZ ij jiijjZ ij jiijjZ  jicd    `ef ef`ef ef`   %*( .;j9-        ]0   N] P OP OP:~  !  W|7     =>  r  o  ! Q   ^  )m $ WZY65 0 =`_65 0 (u  '|{65 0  oj gwp[ j D65 0 =65 0 b  : 7> ; &65 0  +,D-U u X4r          ro  !"  Q& #( ' * )^.-.   /m,   ;       6- 0  "@    0 5<4uL8&   `@_`R_` )<;  # 5/$! h[gh ghx  $ (C; C >   ' W   L   (   650  _    \  !   ! 7           65 0  5    tf ()  a% !      7   - "  =>  > >    ('('( 3 4'('('('('x w 2  (             -"  "             F'/&O" * v"           !"!$ #& %2( '* ) "   ('(3 4'( 3 4'(6'('('( '( '( '( 70+ (1  &G3     /") R.,)!    3         4%! * ('(3 43 49'('  (' ('('  (3 4'( 3 4'('(' (' (' ('(' 0  C650    ( 9   N 65 0    ~xw      {(E 2o%+(U Tu!   (         "  #$  #"#$!* ),+. -0/2 143$# pop ('(3 43 4C'(     3 !'  $'  3  pop ('(3 43 4C'('   3|)' ($'  3 GB;   30A  A<5   3*;  ;6/   3$5  ]p C5 $( 3 4*'( 3 43 4,'( 3 43 4)'( 3 43 4"' ( ' ('(' (#   !   #   #         !$##  !   #   #     " #$# $   ('(3 43 4C'(      3  '  %'   3      3  uQ  . %]E0!(K>uQ xwxwxwxwx:wxwxrqrqf      ?/f V* E  !  => > xwxwxw xwxwxw   65 0 =65 0                '      X0  $* E           0')'  &   V7   )(  3     5""X Dq c- >Q  "  F&( '('('(       -/&   '('(3 4'( 3 4'(7'('(     3  ), :),)'   3 ddd(dddd dddddddddd6dd3ddddddAddddgdddd dd dd ddddddI   w xw xDn'w x(*I wxc,,  wx  wx   7  g ,%  7Z& #   "     8    }zq??=  T OH  D% &"&  g)~   ,  -"#     ij ST S   i RQ    )"     d A615)   Ujq 1                |; :W ( M[   j .H = D    =L/+1]e  1'D*),+.*5.?1K46L-       D'  *I"# &'**+,. - 0 /  21 43 6 5 8 77: 9< ;g>= @ ?,>=>%=>A$ #7 =$57-Kw x 0#-.-.; ] -.72 !    LU   r qk W              a  #   @   * : !#)Z# eW"+   )C  0#    ;    ]     72 !%     i       "  v u~NK-. A B"-.-.i-.-.-.-.-. A BZ{ |{|>7{ N.,- .-.n2- .   "!    % F   4      0!   "  /       ,!   !  $            'G4h 0# *J>$:NuQ?* ! 3  ~NK    "i Z >7    ,  !$%2" ! X$WX$WXV    6vuvuvu 1$#$ #$#$#$ #$#mnmnL     !)*    !  2          CLN &R$ Xw![ 1      L x- ,!"+$(!"!   % .,;$!'    ('('(-.n(n0 -         6LP$ (  0   g9d%"G *&S vuvu cn2  02$ #       VS  @)        RABO   !ZqXGZO87        %  Y=   a        (  3$ 1=e I;p" ^ 1>1 B1 /5%S+ ,P' 6, 31"# " !&S    c  2 0  2                  .-8 -6X:7& 4 7vuvu   3vuvuvu}   D            ^]lkr  *i    n     !      nilk| ?9  l,)ET& 4 7         ) z          q6  )  0        & XO * 9M)   0 x2wx&wxwxwxwxG            $R(/G  HXGHGHGHq       & i ,  6- @?@?@?    $ 0 :7 QLXE Dgh\  /0 /0N /0 /0                $2ED      $'  -#   #  aN[# #/< N % *   8 \*.0;' '  +"'!$ +'% D\   N     popop    D'    !   !    ,;.@o ?  /  % !     4   bB9:%     B,69B% `V_`_`)C     *   , @  AC    < 9^ T[' (T\[\[%>' ( ' (`        qrq HG   # eXOPB  ] ` S V '  !R$/)V$hFg "[ T   %  >  0_ 0V/0/0/0/0/0/00/0/0/01\[\[ GH' (' ( ' ( ' ( ' ( ' (GH ' (#' (G     8                $1:1         #   l;%<3G1z' (L' (2' ((zy' (GHGH# i/pGH[ \z yzy' (zyzy56+ , @' (' (8      F M4o =>  $ XOP Kw;$N*  )M) -r#-$- 4-       !      "  !   (         '( "!(E    KKR6  3   8{ TO8 ^y+&2<d% b 2!< z L   2 ( # i/p  !$ #"!('*)+,*-@0 /2 18 0>/0/0/0/00/0/0/0/0_/0/0 /0\[\[zy' ( ' ( ' (' (zyzyGHGH' (' (GHV' (                    e+       V  *v M%' (    _' (E3 43 &34344 ' (' (                "    7   T e#)$ 1*/E$&2%  _ E     4         1O0  (  ($. ' (   #' ( ' ('' (' ( ' ( (       /  /  "66  6      1   '   /  /*p, C Y!(3E=7L  0    $ .                #   '      >8%?,| 30C y' (zyy' (zy'( !            )   )           Q  6 * &- 8'&<0  !C       ]8! s' (343434           XOP            n N"PT6 7 !     JU'(        !4    :     ;+/6 :u*)'"+!    ! U Z% & 34Q'    !B " R2 ' *pM Z  Q' D)  ?' (GHGH' ( ' (' (GH ?$[\[\%K=                  $      A )  )o0  )  /= 9 ?        ? $%K=  H,GHhFEFEF E6      ( hFEF3 43 4CE/F 8   3) %' 8$%'   3/  hL  ('('( h>9=>5=>Z #ba\C%ba\CB5J hF 3 4EF 3 4EFEFEF EF3 4EF 3 4EFEF EF E F3 4EF 3 4EFEF EF EF3 4EFEF 3 4EFEFEF EF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF EF3 4EFEF 3 4EFEFEF EF EF3 4EF 3 4EFE.F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E F EF3 4EF 3 4EFEF EF EF3 4EF 3 4EFEF EF EFEFE FEF 3 4EFEFEFEFEFEF /   1T AG    I  < /  Y   [ * !g uj  iuj  y ;  ;; { ;  ;;  1  11  1  11  '  ''  '  ''  !  !  6     6     P      W n     u                  _d  _kl e   AF  AMN G "  '",  '3"4 - '        ' H7  H7  7 \1%  $P1  aVI  VPOPOP  9 ) r$r$r$r$ r $ r $r ${ _J,                          ! "  ! ! " !( '*  +,  +*+, +2  34  3234 3:  ;<  ;:;< ;B  CD  CBCD CJ  KL  KJKL KR  ST  SRST SZ  [\  [Z[\ [b ad  edcf  ededcf el kn  op  op  u.x  yz  yxyz y (      (      (      (      (      (      (                                        hFEF3 4EFEF 3 4EFEFEFEF EF EF E F EF  `[z{  ZTSrsT        +'[*         hFEF3 43 4CEF      3x hFEF3 43 4CEF  y   3n  hgh hFEFEF3 4EF 3 4EFEFEF   vo ni  h{bay -%,v     pop hFEF3 43 4CEF  sng   3^o $'  #$'  3  P OPhF EF E     X#WXhF E     $    OHA    38I  h2ghh&F E   -&  `_`  ?81    3(9 %'. HGHhF E   hgh hFEFEF3 4EF 3 4EFEFEF     %  # ,%+v    hF E       3     h FEFEFEFEF3 4EFEF 3 4EFEFEFEF   "  )*%& M+&&           3!    */6   3A0     MT UZ  [HabJ   hF E    !   hFEF3 43 4CEF  fkt    3}l          w        Y d          3     3       3     3  0 )    3  R EhFEF3 4EF 3 4EFEFEFEF  ?   NNG !o       hFEF3 43 4CEF     3 %'  $$'  3  @?@h  H.GH GHhI   #&%.-( %$#  _>S_SebVt%h0>=>!=>= >%=>=> ='>=> =6>=> =6>!=> =]>"= > = > =>= > => = > =>=> =>= >=> => => =>=>=>$=>=x>=>=>=>='>=>=> => =H>= >=> =->= > =>/=>=O> => =F>= >=>=>=>='>=> =U>=>=>=>='>=>=> =$   65 0      "65 0 &     65 0    +rqfe856    C Don WIJ K X#O |w i0I st { F  ~  b;dxIA.G&s 65 0  65 0  9 65 0 %     ba \<    9  65 0  >m 65 0a\    <    4`  W%R Pj ,  U5  F\ HIX $8!9L@ KD !  d!/9 0       '  5 6   " !]&  ' * ) , +./ 2 14 3 6 5:7< ;>? BCF EH GJ INKPQV STSxZ WXWXWXW'XW^ [\  aH\[ fef  c-dch in klkOp or sFlk x uvuvuvu'vuz yU~ {|{|{|{'|{  $[  h   h  " $ $ $ $ $ $ $ $ $ $ $                 !  %  '  )  -  /  1  3  5   7      7  "  ,%%(+.14:>@@@@@@@@@@@                 " $ $ $ $ $ $ $    $"!"!" !"!$$#$#$ #$#$&%&%& %&%$('('( '(' hF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEF EF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF 3 4EF 3 4EFEF EF 3 4EF 3 4EFEFEFE FEF 3 4EFEFEFEFEFEF                                                                                                                          ) +G,                         "  #$  #"#$#* ),  -.  -,-. -4  56  5456 5<  =>  =<=>=D CF  GH  GFGHGN MP  QR  QPQRQX WZ  Y\  [ZY\ [b ad  ef  edefel kn  op  onopov ux  yz  yxyzy                                     hFEF3 4EFEF 3 4EFEFEFEF EF3 4EF 3 4EFEFEF3 43 47E FEF                  &   )&:#2(t                 &      3    3    3      3  X{WX hF3 43 48EF     ( "  !m   (      3     (  pop hF EF3 4EF 3 4EFEFEFEF         ##"q          3     (           3        3      3  kh0>=>!=>= >#=>=>=>!=>=> =6>!=> =:>=> = > => =/>!=>"=>=> =>=>= >=>=!>$=>=Y>=> =G>     65 0          65 0           65 0    ~z i   +HAl65 0 /65 0 BIZ  -06- 0  cX   8    z    Q  \- G    970 `,  #VId$K0          6   9"#& % ( '* )/.  +2 /6543: 7<= @ADE!J GHGY8+L MG   q hF3 4"EFEFE F         %6#           :hF3 4EF 3 4EFEFEFEF3 4EF 3 4EFEFEFEF3 4EF 3 4EFEFEF 3 4EF 3 4EFEFEF3 4EF 3 4EFEFEFEFEF3 43 4>EF 3 43 48EF9                                                         -    (  9&#0#0##%#6 # =%3                          (   '&  '(  '.'('.-210  -54   (56          3         3             3   F h)>=> =*>!=> =/> => =G>$=>=>$=>=6>   65 0    07      *# &)%`!:eF"78)  *    /  G  6h!   h         XWXhF 3 43 48EF 3 43 46EF    &   &  "!    &    &    8M787878h>=>=&>     f  &        h F EF EF E   1     pop hF EF3 4EF 3 4EFEFEFEF             &#%q       h        3         3   xwxxwxwxwxwx6h(>=>0=>=>=>,=>= >=>=> =>= >=> =>=>=>/=>=>5  ba \ba \ 65 0 ba \ $+,f\3(                             :hF3 4EF 3 4EFEFEF 3 4EF 3 4EFEFEF3 4EF 3 4EFEFEF 3 4EF 3 4EFEFEF3 4EF 3 4EFEFEFEFEF3 4EF 3 4EFEFEFEFEF3 4EF 3 4EFEFEFEF9                      9&##%##"#0#0#I%?                          $ "  #$  #*#$#*).-,  -.  -4-.-43876  78  7>787>=8              3                  ^SS^h,>=> = > =>!=> => => = > =0> =Q>=>=>=>=(>= >=>=>=>=(>     65 0     6V3  =\OIp  9) 65 0/* 65 0,  HUIA&9"=",            / Q (  ( `_`,h          %h) H!GHGHGHGHdGHh    $  ]7#a^        hF 3 4EF 3 4EFEFE5FEF             !    GhT   @/%/ Whh  -!&E  h+ h,     'h4    XZWXWXh(>=> =$     ME (  $ ^S h> => => =O>!=> = >= >=> =%> =H>     8^Y65 0       @) #4  1M ,  U.M    O       $ Hh@       h0        hF EF3 4EF 3 4EFEFEFEF       !o           3  H[GHGHh>=>=>=>    D#V             (h?           3  @/?@h>=>=>=      xwxRh                  -3gO 2\1h           R     .   A   /KK - A1WSFg        pop hF EF3 4EF 3 4EFEFEFEF      &#%t            3  @C?@?@?@ h>=>=> = >=>= >  65 0  W       H9GHhF   !  0hL    "  H(GH GHGHhk           G#V     + '   )5 Q E     *     7 &K} E g)H3  #) *P''--    _        /% 3                             ) E  E  rU.,O"  $H$**      # P'  ' 4 -#- lk#lU1 Z) *) *-             %                       !T   g (,.  KDvg  ! 8= G   ') U1 U    -  #"S  #   $4' 0H/0/0A) *    !  -4&A  5rIJIJIJIJIJIJ)\ ) *IJIJIJIJ                 & (?N h$ )  \         ;%EYf)aq]^ [ IJIJIJIQRJHj) *rIJ '     %    P  ,   4B9       $#"   3:  ZP *(I:} z;#(q [         Hj r   J  }     !    - %/=IJ  } #$"o$:?T KLlY>2) *y w&5)*  xw2) *'K)LK                    !!s        ) 9  !%=           G  3."hq Y% I *N  9B4?5C=C/Y   8 &)0 2 J T lY>    2 y &5    2 ')'('(           . %7'() '( ) *0          &  XO   i<  2  + !3!"% ,   9-K SO)* ) * KLKL KL              0    O#  #Y/ Q  iXK+1.c  3!*SO          0J/0 /0/0/0/0/0/0/0/0/0Wyzyz>    ;QW>e;ee7ee eeYeeee:eeeeee)eemeeeeKeeeeeeeeeeeeeeee eepee9   "    (9: z9 :   '(,.           q A    1  .   97:9:9:k n          0) :   ! ' +P    6)   %  "   bYZYZYZY- >    /3     '' "  I ! !   W3  _> Y . 7P ?!!<?qE9* " $ = # + :,($5 s :i"*9   "    (      "!$#&*'*)*).,+,+. -.-.-.-q0 /A2 14 36 58 71: 9 <.;<;<;< ;> =   .-.-0/@ - B /   ) 0+/0= ' )  qHD1? tMN %9:9: 9: @%&%&%&5  [ `%&%&8   )"  J=      +%   % IL  2[n     knmn (   O  '     $#    XOPeC  L "+A =;!3 &W "; 7 f6? t %        @5  [ `8    `9_`_`_`_`_`/        +& 6*3k-                 ' 5 H*  #(k- .~R1%I , H     A    f         +*  &   u~wxqn          "     & ]    H         g  +y&$?:.* F  : $j0   , H     A    f 8*787878787878.7878jijijiji jiji)jijijijijijijijijiji   !()018                                   )           !%% %&%&4 =-N "  #         "       !                  pY# Q'3F6*/E$B571 )"$ V9  4          =  - N Xp}LO;<;)<s ) <;     0)  34      "         # !  %)3 S 1_p ,!$>  G   " 7)   ) < l%&% &% 5        %#     % " " ^D _ *W-U) 1 l 5R  X ^%&  *   /   )     7R ^    * n  9:9:  ?      " 2       4    !uN 0`&    ?   A$?,| 9r\ -  t !        !      )       )       Q# 7   t)- +3.&<  '  ]\  -   t M!  &         XOPe)[!  &  ` 2 8 \OST= $f   %      ' f_> O= $\          \STK L STu  KL      ? 8  (i   4)  u   A\' # 6  ' \,0    b _ A I,,0 /$4\     ( <-\3cT<;<);>   ST0 X  JI    MT  @-N[    ,    +       kl    )j_<-NK)@  2 /#02 $6v 0  !G S 3)>  0 X @?@*?@ ?@ ?@\+<;<;9      ' 2 ++9 ;      A \<  ST<;<;%<;<);gS=  *,   )           ) ?    l   )      # K3<  5 = .1VW= N_ n  5  ) <       % )g=  *,    \         4 l_ `&_ .  & 35 & l^8 $! ($ g l_ `Y_ J   f5  Y  Xl 9\  )   " ! 9 XWXl(`  8K7878l    ~   ]H    1L     xwx>            I  h  IHGJI JIJKDI : ? 3 I  + > / @ #&      / "#     %+ +> /T! <[  !  L   9 <7+`//b!!7 M6   E  1  %]^]+> /   Q Db   `u_`_` X4.Y+ + }/ 'W##xxb" 5'!<    0"  `v_`     +b O @?@(?@L     ,9 -'  - $       :>5$  1 2       POPOP#OPOPOP^2     1 8>78 787878U       Q!/U   `_` _`      F 8` 0/0/05    FC W  $qrqJIr- J   !0    21  + t  61C *q +  $-     J'Ir @'?@?@?@?@st )      rc )   @3?@?@?@F     2 'F  ,:&# hWghghghr    ()     `c  B  2 6:c  fy '% )> `__` _`w    "!< xq JIr       V5 _0 'Ir" NbL3 4KLKL KL 3 4KL 3 4KLKL KL 3 4KL 3 4KLKLKL3 4KL 3 4KLKL K L KL KL 3 4KL 3 4KLKL KL 3 4KL 3 4KLKLKL 3 4KL 3 4KLKL KL 3 4KL 3 4KLKLKF KL KL KL3 4 3 4+KLK L KLA 9  ; G   OLK   OE   G 2 +@ 1i   qnm   qs   }xw   }JIJIJGJKL !KJM  ! *     AA $);O6|M                     " !$  %&  %$%&#,  -.  -,-.-4  56  54563<  =>  =<=>=DCDCDCDCD CD0CDCF GJ IL KN    UVU V   bLKL3 43 4CKL     3 bL K     H+GHGHb LK L K      )     bLKL3 43 4CKL     3   < = bLKL3 43 4CKL      3     3  ^;T?(kb'D!CDC D C>CD CDCDC > C: 1     d *D C D C^   > C'D0C  DCD C    DC > CB  D 65 0     65 0   pS V         h8        .  ,     .) 8    (  ba \  65 0     ,       )  x " '"$   F( 9x@58 %+ 3 [!.'           :" !1$ # & % ( 'd* )*, +. -0 /^2 1 4 36 7'< 9> = BAB  ?D C F E @ 9 H IBL K    bYZ  K             K P b&YZQ R>\QR        0 #    !   "' "'+   & >\   X(WXWXWXbD  % s:b.O   L    +  dOP   , A# 1 .O  L PLOPOPb E>  )2 ( >CDCD )* !  . RcG 87    ! ,   . .     &m   > o 4 !    . ( A  5(  ( -:   8 K'6 )?0 7) nm 9 5  nmhgh   s  4  @   H 9 hg  1      *        "ONM   '    .   9  # * e1v uX.===@% A H F! :  9 5        4  @   H 9" !   @D?@?@ ?@ ?@ ?@Q  j i  ji            \BIQ     a| "  M-.    `_`h F3 43 4 ""  5  : 3   W !'VU>    BL  UT   "            3>N &     T  ,  8      x:wx %587: &%     `R.-. -     '  7 R          1 4"   4"2  1 4 o   8+. 1 hghagh                > .(  H , #  0DDCDCDFCD)CDHABAB,CDC"D/    3  5 , /    )B %  '  ' % Q[ 5M@O&*  7 5D3  5  ,"  xLwx  )$'  SAB A    1  3  ,((5*   ",:!      x:wx     & $"  "   1Ee!_>o?#   ".#^9:9   " ('>0  >$#(#"   g:8    < '   (O'('(     &%B @y?@ */0/0/$ +,+,+     &- ' 2^  (J'(/  HXGHGHGH       [(h /1    C D ''#a U -  6     .26*  HGHGHGH?GH1GH7GH"           FW!  4 ( ` "  .       #: 0i/06/0&.h    ZN&. N    w R1?@   + 8 ?7B B hAghgh$gh      )  rd  <   $ P  $   ^ 8<$P ,       8  mmd'S   1' ,   '   X3WX+WX,WX*WX7WX6   F;<;  !"  "      /0#$ <#$9  =:39  = @+?@   - $  XWWXWXWXWX     %%+0  popop  &IJI$  12 5:    N@=C [ !    U\   (. , "!          IMX ?H  k `   *,-,% #       w@)#?5M3 6 >  ,-N             . -.  9 @ MN  >IJ IJ  )r qr  q##  Z   #S<    t          '   R8'9WD3./-G5E                  S&R 0/0+/0/0 /0 7   # $ ) ,  $M    4   !A  5   !B   W5) @6 *-#  P4OP    e  +     ,&!"!"  -   T<  #2O   J $  r            , c0    +`73 4       ::~>;: e jmj   &z%    }  6)+  5=pst 7=puv s@=:U czyzc&)  %  3434) d94     cd  cd!j =++x Kv 1&# 8   @ (    !q  L" W$4M 5JB  '!=  8 =]7i>V$2)1  #D1!    +      (      ,  8  0MA     04/0 :      * h.gh %#&%(  1  @?@ V@?@?) * 9 @)5  / V@) 8 >  B @?@ V@?@?)F '9.)@*)  6 V@) X(WX5n KN  !   p'op  4V ?@    p+op op9op op op&: !! ,!! !   p4op opg ,!   +<    . "  S @    '   ++S @        ? ( +T     877878   ! $&   * )    >    XD xhwxwx wxwx 3 *  3           (    3-+ 9    >  ^ &9kz @R?@?@     !       0/0/0  *       h.gh    pop,op  (%'    A %z 8@7878 7878    [  *a   0#+PF &          nH      {(  +    :  +(!  / ( )('                            #)'&7      "    $     =" H , "  &    7 +a $ x1wx ) ' 8A78   #  - K    3    6           !(    "     ! \@Z30    *)   >x/(4 , L    WXUX   0") # ]HGOXML?> '  0U !#@(V4 O'D     0     J"+@  $B   < 6325,-&    -  a  )_  z #! g!& h<    C  6   8> x7wxwx        2 H  61   $5 -6-.5   ==>J / 7 B;28E=      +&7H(- ZF F# " X*WXFABT EF   1  HGH`    `*`0 XWX`[\Z GH                ,-VS''''             2 POP 6   ! ! ! ! -       P OP    ! ! ! ! ! ! ! ! ! ! ! ! ! ! !" !!$ #!& %!( '!* )!, +!. -!0 /!2 1!4 3!6 5!8 7-                               M+VV] [P]. . #!7#X M-  xa kkikhq1)(=UI# :9&%~  / %  / .`/  \/  Z,  ;JIBLEf+"iH"gF"ghiH "ijm DCb,Af!"5"wf!"efwb"/   T/  R/  CX(  //0/0 /<;' ' &   XWX[d_    agh     D N = = : FJF = : P IG3XJliwT +liP$.QB *1 &1 N 1   1  .   -   ,  1 !"! (1  %&%,1#$ )*)01/0/0 /.-x2 1~4343436 9:: 2<;<; >=     U^]LI)`_b]b_JI^   , W0) '  orq-rqrq r % B)r /    -  % :)j /   X)WXWX  '1  /        ''   9+W[ 1  p"op. #j     `}_`_`      >) 70_  `_`_`Y      9@=89456C L 7 "! 212/I"C 8 7878     1  HGH+GH      "  P2OPOPCOP                3 %&  x!wxWwx+wxwx    9 +(Q   DS   0Z/0g   (4       9   %    4     `D_`-_`1_`_` _` 8;<3(,%))      *  0 " &   - !1.:* &[ 878787878T   #D H`GHGH    +3T 2# `g_`_`          %543. 6$ `5_`$_`>_`    +3 k( P        @     , 4  8@=7*   )    <aLa &&%;l-Y(  2 a(Yn *JIJI6 0"  $#    "!,'250     'J9& " LK    ,+*+ ) =BKL16C             3 kl G (Q&M< *D '*#*\%'@' %  9X*2-3\`1-3g=y^ 8>PU3:       Y    z POP,OP                  !     _!6'=2_ POPTOP                         $  #**&;2 /  cE &      ,C '      ;@M H G  F 2PO4 `-?  2 ZY<a2Q/ 72{1EN22 02B32 P   P~   a  s  e2M )OE2mFa-2#q     '4 *   w  - ' < /l! ? :' ` 8 R%E&-6$ 1K F N    G 9n  XzWX    $"? K HGHNGHGH GHGHGHGH      '     &&T [+ '7"4 $ " #0\Y04cZ- < 5   B1OXW `,m  # s e^ ,  =6Nf%"+/U     .m         Nj!    POP;  K <70 "Ic >fb8" XzWXJWXWX     = 7ZI4d T         8  E; `B_` _`_` _`c_` _` _`_` _` _`_`_`)_`K_` _`"_`                   0-   M A     ,K  !,      ROPWHE % fk+  I ! o   /  U HGHGH#GH^  $<  %! `_`_`#_`_    !:, U! ) w      & 7 =0'3) w PyOP  B/ % R          4 103. 343430 N 3 p@opop"optopopopop op x   (   `  %  0R? x % .     tm     65 478-$.     5&  &  "B / 18A$ %w  (@   jjq30/O,+          sp  on s ) L# %P   '[/ & .C|!   + ;    R HGHGH: ! P4OP"OP    # N xwxMwx%wx   '     q   P/OP D        XFWX [      2 Y4  "            1'- o:         # +*  XXWXx!     O) 2 " 3? " ( A"  5  8@7878"   !. 9 (1'('(" $ #Cr 878  X9WX?WXv  )  $?  g!    4      #  #    & Q  ) :      5  ",9 -D   ,   !& - ,;* 9)) *:%GJ",!   ,,    % , 5 5 6,  ! -' 5 <  6 5 6 5 5 6    7< ;>GD C@ ?4KNWP#$ OfCD ol?@ kh   <g  ,!  ,  ,  -\ ,  ! [  -_d78 c  ,dc ,!" -  ,  - ,  ,  - ) ) ) ) ) ]) ') ) ) ) ) ) ) )   & 6 & FW )  R 5335) M")E3 D33233           "! $# &%(' *) . -,-.-.-. /2 ,36   , , -%F'&'&%&,C J IHIJIJ!I L -M RQTS V , QR     , C DEDCD-I JKJIJ,S TUTST-] ^_^]^,c dedcd,m nonmn-  H1GH6GHBGHGHGHGHGHGH,GH$  W  n   .stmn &/ WXQR" !& Q Nm l.V $Wn       HHGH       $6 HIGHq  %](  Zd5 .  &#$           *    2 z TE F^Z Sh ]     +LOR  g4G  4)E=%%"?2     )=  !(+/h=:=+ s 70@9+* $ K   Z   % ~   & = "    nmns   "" > - !$"" "K -  4$ """ "A$  6 ( t $   +  =(  0/0        .*$+  0   !>=  +  D  +aY+=}+++Oa2'/2k lk>= l  ~}>=MPx4X>=WZL >=   Y(PIw_Y;$YY/qYH aI z9WE_KBI/& 19#                & # vt  5 A;  ^ # + +) #JL  D%c%j 0D      FS@CT9 :Q&65,# 8!$ 3"!  32      C*GL"  w  3g/E       :E(+ */M:EXQB SZM:EXY :EZ=*1 :  %   ?  -Cbg/6 [  PM   .9< ") P69( AD     i^=(' )')~:7/ N C      F   " 'A;     }zyfc t]`_ rE`]  x + udY8 AJ7Pmd)  EPmFG(@ EPm , EPmF=b](!8+'@Q# 2   "w8= (    V   21   'A;B + .  6_I:   B    R  X#WX+WXVWX2121T   NG  8)&=  )*)$ 3= 8      )# 7 & '        '               !        + !\&R&T&A&-SB)#(" " "4             -.       QT'    "O 0<   !        $8 022@(:II=    D  , *)*)r   XW63! '&*  G Y\%  G    2   *  H   H  +  ! j q    A  :z|@@16116a e s%f F) *) l   Txf }"! |$# [ `     "      *i    H  & o G                         3B?z  & oG  1   ) *     2 6- , + L )     S ) 8786787878#7878A78  "        !ZUZY^]bafejiA R  7U  3   3 K"=!"   17* 1 ('('('(  *2565  0/021     05/0     0/0/0/0   -4343  #$  8:78"     0/0 /0/0   " C 2 17  " )  7 $1  %   `M_` f  G'   $    XWXU 4HG5D50/9<=H (  (    /.gD "  3 >78 1   *5.! -.a^;@a^;+dA@ C2c 3.C%?*  !2 121 21         8#$9'    * 09:   "0! ;<;<956990   H= D    (H-8E-7!   `_`}_`_`5_`F              &1 $   %H!S1@F   :6    `$K   xwx      / 4 b- p0op=    F   500- @ 40? 0P 0000c0-0/  8!78 *)*34[\   8378`       P b: Q     b p9opopLV 7 x42    axn@   $ /  `:_`          k ($H h gh     (9'(F    +  0$/01 (%+. -      !$ #  (%+. -  0"/0/0/0>  %    (       !        !   XgWXS      %6S               " 0/0/0   *      ('('('(    K   ::   "  &       &    &        '    '  '*   *)*)*)*)*)2#B(K     :: A                                    #$> # 8%$A            "#    pDop op op  '   & q 9)5 $     5        () P -/ )5 $            I"(D   )iF-  $  '      .789 DC       DC     DC    DC  DC  DC  DC  'DC  #  .9DA"  %  9!5O t5:+&1'          !  [   P]         /  1O%5'5$]             F Wv9^       ,              $#          @    t[      ,;:EDKJYX        j2 I&  ) $   89!3 f <"^           %   "    ?           /     /      (    )    h      s  E  +# hlghgh  9 L  7/ %c     ;   !  C D  &  *  " D  '& X    +  *   ## H    $   + popop &)&)& OPOPOV  aJ 5  m33 @,?@>  hgh  ,- 6-  ;  ;\  pop         5>=@   .  P%OP2 "   " `#_`"_`  #   ) m6a                  @7?@?@  -(!   H1GH3GHGH"  #&  ('"  pOop\ P'  ( '( '(!'('(K &b c8  ('('('( =B   , +,'   )    +''  pTop/   ,   *      XWX0' 0     -    0%+7 ' 0 HBGH* *       hgh0' #   -    #%+-  ' # * *         8*78  *        @N?@   _ *  *          `s_`_`) "   # d-) " 00/0            hgh,         )  <#               !   D    0        4C & 4     * 2) 2;" &3  ! A  &D W $"  W.    !       " !  7 $ #4 6& %4 2  U( '* )A XbWX     R  l + xQwx     + 9 /j #      3      33  "     l   E  @  C )"  `*_`_`= & A#@*\ 0y 4  x w xwxw//(E    CD   &+,1  ,+,1   G%ng        xw  " fe    '@;+ Li3 zKLi  KL_  b, + 34(i8(+B a.'*/*9LA~a j}  K? ` '  I v "B'5\Q2W '  SVC95      0y 4 " $#&%&% ( ' ,-.+,+0121/21214565/6565(89:9 < ;<;<;$ @&?@  *       xwx -   m      F  )\> -     m P8OP8OPOP    *  *            ji RR     $   # ] i (&$   6      - `3_` '      '   xewx r HU 1 xnwxwx4wx wxwx   Q ,     ^QL]v  u   >5 *%*NX%5\%&)* 5 w` # A&C' H  Q   ,  0 [>qooo$  "  7 c     7   '( '*!    A+, +.!      !    " !     eee=%#"  7 0   (R  &R  &R  &"[>q   ooo$ HGHGH n qn q                   r ur u        hklklk    (5'('(    !   y    a 5  P$OP 1  P"OP  N ./  0  # 0 zqrqr qr#g4  #0-!+&  %  #gz4   ||   ! & H/GH|<      @)?@?@|mn  *    |>stz  $#   % f K!"#  >z Io   "0w:!    @x     5!+2  @o|   "0n:    S|e   ' *  {    |stEst!mn0st     * 3/ "#   # E!  0      ~uvuv ug:   )!.  %  g~4   `)_`62  4  n     1'R> /   u   @;L;    7>    ;  wxw ;0 )) 5 3$ 1'R>/          u  L *    dk     ! "  0@!  ! 1     * psop       L% TL !$ * `H_` "   3 ' >    -      : 0 F    !&%efU   b=$( CVIT '6P   (,'(  hghj  z `_` j  >= >!  4Q& M>/HE2/ '  )<. j vu  h+gh hg *  `'_`& XWX     ,+1       BX^ \v !  hgh ghJgh =   |   WF, = `_`/_`0  hc dcli    caJ ip   ib    \9J "<   g-    pAop   D  HGHGH1GHGH!*   ('ZU  DI  :9  GJ ^JCD# 5  ?-"P!/    *   (,'(ts  06/0"'  " pMop2   P 2  S  T |     O 878#78)78 78    K+M  I f  ?"  #D  #D D    s ^         [  [   [ghg         $  [$# $#     : * 2   & #' #)    "")=D@ K@>9>$/ ?"         #D#D! $D '(' *+*), +. -0 /s21214343434 3^(   ]   c               Kr ]c `<_` _` zk   5  !&%(  !$ 5 H/GHGH GHGHGH GHGH       $ k- POPOP OP  !      <  '  ''' '              wI  <,  @J?@?@      2!' I" C#5  P,OPOPOP    D c(   ('* ,-F?VS- 30  '2@ R  #   *          4'8!  H,GH  ( (     @+?@ ?@  (  (E'(@      A> `_` _`;_`_` 0 #  7 # T5 .     !/ &/   (  '   @ 2    #2    L($1'       KP S* 0 !   %:   !H")9   (       ' !  #$#"!"! &%( '@* )2*)('  'U-X3   N  K      ,-VS  "O        #"     R = # #  #@#         4 K  "!"!"!   e- Hg<;<; c ! 6S     >9:# "'        %% 1-,-VS #"t0/ h&#$     X7<iykz%   p{ ^]x{ bS: -      /          / ! ( #  D   ,|  343(07nm  ^ 0++nE     65 4JI&3&3m  4 V -:  =9c7l! <   ' #0#  m#     *3,6 +'1 +'1  W "08##+5k";7       N  $   A 7 "! X$#$#U&%&%e('( '*)*)*)2,+,+,+.-0/, +!43216 587:9:96<;<;S>=>=@?@?  XVWXWXWX^  '< #1-^ [tpP a ] T b  @dcL G c K GE:FEI R2% u&`- b 3 >  ?  &     &            #( . ?@214     #                         #        ,-VS 7 .Q*    +*        *   "      "  !-VS        ^ 2  @  +    "  +    %    +    C   3                 +-F?VS- 6G  MkA = "x X$  < }TS(z 43 Z ,!I%8#" $-! $6  $"/*%(?,'6.)5,$+. 0$/(#D 8(5 J <(9l @(=361 B$A" -DC F$E46 &" &         b   "!"!$#$ #&%&%(' *)* )c,+, +.-.-0/ 63:9: 9G<;<;*>=>A@?:DCDC*FEFEJIHGLKLK*NMNOPORQRQTS ZYVW^]^ ]`_`_badcdc2he%l inmnmpo+porq$v&sxwxwzy+zy|{h}~}, +3$  ? 8978      j   0     >- " xwx)          $ o B B" | `K_`_`=_`_`  X WXQ  ' **>$ >*  e&4 9     " 4 9 &!! 9  &\     %&'   M&Z     + & ( '('(&:   , % : `;_`_`&   *-F?VS-*  (!'(&3    (''('('(& )     ,& ) &(  0/0/0&        4& H6G H9<GH1 HG  M`  -      o,&>  6    @+?@?@n>v   n6&$ n+&  IY/ I &  K          *)   .   !  -  " OK9%%.$Av1) "  9  &   8 78   $] c&   44            19!$+ #    4      X[e& $&4        M/M&M    $  &     $%.a&   (4             %P"+    (        XDc& $4         Mf$M    $      &FcdEFEFE<       "   P`94'     $  &C   (         (  b6  +  &C   (%  ( j6  +  i&  VUV UZY XWTXWXWTX#W0        R  ( # g  _rS(        T+ #  ~-&   ^   H  $     / $ ('$$ % A)0         2  7 @J?@ ?@& (  M C( ( P=& )       <&   65&#, % 4% 4 %6 )4   54 +   &%4+    : D:~4  &N  D-DCDC Z.-. - cK  H            87     ) 0'       %;  ,   ji $  ]  &Q+? .'       N    Z    c ; ,  &" " 0Q/0/0&e     *   &   J         4'. MD(  J  u& H      %        ' ,   <4  &Qf .   ,    " 8\7878 &#   >  !  %  %#>  PTOP&=   J=&4     u& fH             ,   l:4  &S+ .   f,   " & &   & @ ?@`?@?@&/$ #< ;<=>=        =)U/    ?&M      .  X'WXWXWX9WX@WX &    '  #         8<c    '               #  J[& I; ,304#N@ I; @Y  .       '6, W    B,   $4     / 5 A0P+5 IBh  67> 87&+!&+   (' 66 "1 /</  R5b4&0(#Bnf  k  B^]^[:K^]L9 :U :; Utsfe;:!:'-:  '_d_(' ?:C:  ?@9@?:   K: 3edcn,372'%L!4k#e$*"N #   3  . 0;/0/0/0,^D    ?9 >n $ ,9  lo* ,*     $ 7    ,V  )> xwxwx, ) D  ( 4.:O         " xwxwxwxwxwxwxwxwxwxwxVwx,       ,   ! .  D%                ( ( Q    ,K il  5 / xwxwxVwx,   D  (H ( Q xwx"wxwxTwxwx'wxTwxwx'wxTwxQwx,      D    D    D A    (     (     ( % T t s 4 ((0O"O!   O L  xiwx  D (- ( O xwxwxYwxwx,    D     ( I -;Q  x=wxwxVwx,    D.    (m (_Q x#wxVwx,   D  (> (0Q   D   D   D xwxwxUwx    C    'I (;P   ,0         ,F        xwxVwx   D   (3 (%Q    ,<    /            D   ,#   xwxVwx,z   D  (1 (#Q   D   D   D  t Dq  b D_  P DM  > D;  , D)   D  m ," !"!"!"! "!-"            )F  - @n?@?@ ?@?@?@661212_h       . aO/'    * P;OPVOPeOP6     z{ZW:3:34" U4E  85  FC$ R9V85Q n9';6    W,/+" t(  6;  t   "   /  *4!)1$; t 6!!   66   `;_`_`6HD C , ) H  H;GHGHGH!GHGH6     #& 4  4  6(  9(D (   ` _`*_`_`D 8   "  HGHJ&   '     'GO# 1               HMGH7&     E#    @4?@&        XvWX&  *        #!%   *  H+GHGHGHGHGH&22c43437  67&# &22c    s Bpopopopop oNMNMNMNM>NMNM=NMNMNM'   +*)2  '(   ~}~xw   341mx 'w'('=9h %O<(@ >    =  '  E,&   ,           &m.-. -.-. - 1       KLL [\"!"! ! JIPO!"!!"  $       " C   `OgLKh  L LLhKh  jL vL `L 656/   87 874) ,      6   2  Kh XgL 8 * !!! ( I *Hb 02o3)!NyF (&"] ?E9W'[$$^+*(?N1!m W   `  1     ('(! \v +  mV|  (%,% <  HG  / 2/0M ghk<)  { |yA '         !8gJ}U   &  +V  (<;    +$ &" +5$<#$;    )*&    , %  . )   % )0( V  ( +=:       ,       0_ tRV   %&  5? 30!214564")6  /"5"5" /45& $ 3%        m3R2 V V  3  &  &  #   )H 7  *  *  wV"E qnqr   ~}      !. "E VN      ,"  (x V*  &    D"    % rO0  & zy  # ! !!!!"6FA7< 0 1%Qz#uh  ,.mz&= G,(%p9%* m +V  (<;    +$ &" +5$<#$;    )*&    , %  . )   % )0( V  ( +=:       ,       0_ tRV   %&  5? 30!214564")6  /"5"5" /45& $ 3%        m3R2  V  3  &  &  #   )G 7  *  *  w VN      ,"  'x V*  &    D"    % qO0  & zy  $ ! !!!!"6FA3< 02%Mz#qh  -.iz'= K,/%q:%+"  (S'(`=       &% (N'(&% &"% &  2G   ,&%& %&9&% 0"/0&%&&%&% 0 4343  " +  ,2,   ,  WU" ,4,  H0GHGHC    `__`, +!., XWX *"GH"^- $''   F '(       !           N C$ mQ   Ax(      !/ -222 A 0/0   8                             0/0   > p$%% %      @ n    (4'(   B l 6    (5'(   D j E   F h H f  (:'(  J d <    (;'(   L b% &&&&&&&&&&& &=    (<'(   N `% &&&&&&&&&&& &L   P ^% &&&&&&&&&&& &R \% &&&&&&&&&&& & (B'(  T Z% &&&&&&&&&&& &D    0%/0  V XX   0!/0   X V V&    1X^]^]d 'z)[ N (y.-F?VS ?97(     .I +4 .($S#$?#$4)T4$ *+&'  DO  : ; "#67. /2 3 B , G>I8PK?LE)  ,Q"(( /'1 0 B .(S?)T '!38%?!4y( '$#X&%7&% BC23./Y \gj  "#*+ 36 679:>?&'NO :;RSF EJ I XWdc d " 1@E$`y X7 x4wxwx[wxwx812 / 0/0/0/0/0/0/0/0 / 0/" ' /-F?VS-/ jts .G    :%   @C?@?@?@$ . -K       % G0  K   )--<     .!,-*. f1 +  z.+58555% I->=NP($$$K * 6  #"+"# ./&'2&  (                  H@= #P  ($$$K *! Q +b!> +  V  + I      & # &-43 "  "        8  U: M# 0   V         I   8H  * "#H # $N    H #$~        H  T Q   P M j g    : / M >  ?21""M67./2M:IL  E.-.M &%&M6M212M JI F!") $"C5 h`gh $u   C!()$** n Q -W ,,$    8  8  \ .YD Q0. E6,1FQL,a 00 &4  0/0#/0/0/0/0/0/0/0/0!/0/0/0/0/0/0/0/0/0/0$ $'  #D G 4 ?H K 03(+, /    B %!$- h^gh $s   A!('$((  iN*T ))$    5  5  \ +YD Q0+ E6)1FQL)[ ,+ '5  0/0!/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0$ $ '  #D G 4?H K  0 3( +,/     B # + H$GH GH$;  +* s Q -A-+&+$     8  8  x .mf70   . ,1N  ,#aiD0< 2R  HGHGHGHGH GHGH GHGHGHGH GHGH GHGHGHGHGHGHGHGH GHGHGH GHGH GHGHGH$  L OH K|  l  w 4 ?D G`  kP ST_( 3@ C  r  &!&-,/ H#GHGH$8  (( nN*@ *(% ($     5  5  x +mf70   + )1N  )![c> ,6 -L  HGHGHGHGHGHGHGHGHGHGHGHGHGHGHGHGHGHGH GHGHGHGHGHGHGHGHGHGH$ LOHK|l w4 ?DG`  kPST _(3@Cr$$*)* nN*@ *(% ( hH*F &"* "$     0  0  x +mf70    ' #1N   #!U]8 ,,,6E  HGH GH$0   * n Q -W,,$    8  8  \ .YD Q0. E6,1FQL,a 00 ,:  0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0$ $' #D G 4 ?H K03(+, /    B %  HGHGH$-  ( 0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0$ $' #DG4?HK0 3(+, /  B # dI+W #!#$    1  1  \ ,YD Q0' E6#1F QL#V -,-+F! W0t <+56 34343434S34343434343434Pb   '.-F?VS.. .  70    2 (+/#A+  SP  6. *M&M :9:M >M >  ?21""M67./2M:IL  E.-.M &%&M6M212M JI F !") $"@5 W0s <+56 34343434R34343434343434Pb   '.-F?VS.. .  70    2 (+/"A+  RP W0 <+56 34343434O34343434343434_b   '.-F?VS.. .  70*      2 B A(+/P+  O_ 'Y'H?7K:    % CJ'# ((   4   %'    3  L A  (  s 78     FX    $@#   #   F " @1?@* *   *    6*  ,-      ` _`KL    + .  $J H ()   -0     GRI>  6   1&#J  $t     ' t POPOP5: /2oHGp #&cHGf?Fk0/l !G      : POPOP OPOPOPOP OPOPOPOP OPOPOPOPOPOP!H          .-&    /6       F@  !! XWX]WXWXWXWX ^ uv     .  /]^ pop%opop f   &K  H&      #  V!'F- &  `\_` _`_` _`H_` _` /7                   B7C/ .7   X!WXWX  + / "  0                !(cD1"     0 0 "                  !(bD"      n9I  "  &                      !(:^.8"   &          \&  \& ." -"   vs   #+   #O.'    %= ij   ,;,jH& P& # <(P <(L! -` -`m <&   < & ."   "        y `(_`_`      :  +&     +   #  J M    ,#          ,7  8 !pNv &       +      ! & !!!  )  #      '@'R;  !  >(9DM  `L [\  o  }  |7 8  6W p + 5U!!                xwxwx wx 2/$ (=      3" +>=/0=& 30/<   B   $  `E_`_` n   \ w}5;      $ ,+, 0        &,)*   />=&%:92165*)  6).1- ++Kh"0 S  J'   9'      $                                W  C('w*'    '   Q!!; #     , ""    K  g5/         . Re.+, 9@?('<;4387,+ 0MR[^!6 0 3.!H|  x?wxBwx!wxwx   1"! &  } &,> `'# *'#  *) =@Q      Y      [  !K>`>`k` #              #  .E  "   :9  ' & ebab  cm$ Q 1/"   t '# 5 '#  U# c#) "A@    k           # / ;   y  2'b(' b&' ^$'T  t # 5       #  6# D#$    h-ghgh$gh o $ %-B pOopop$opop f   # % 4r  ##4" 1   6 ? 1EFSR(!3   )# ! *=E#7  X$WXWXWX  !A pLopop#opopop   # $  1| `Q_`'_`_`"_`    (( # L~ xwx!wx$wx$wx6wxwx!wx!wx;  ZYB G S2ABAL)"?   +""%6IG68 |  peop    F2 he@0/?@ 9  %)F 0./0    B  he@0/?-  *      C ('(;'(   %$9 (9'(      8  PMOP OP OP*   j#+,-U  2|#         Y he@0/?^]     ]^  ]^W^  r /0@?<' 2^]      ^    @?<2u ;P' ) 1 mP5 )!     @  .         r!.      5   1|#         Y he@0/?     ]^  ]^W^   )*  @?<      ^   2 ; @?<2 ;P' X( ySA )!     @  .         ?.S     5    X1&           ; he@0/?     ]^  ]^]^      FHG @?<'2' ;G( > )   B/   .        @H?@?@?@         6 PHGhe@0/?   :* 6 PtOPOPH         1  (PHGhe@0/?&fK.  ! 0  ()2165<;C           y P%OPOPOPOP"  !$f h(ghbghgh gh gh gh<     . - 3     (l+] D X8WXWX  !  : 3   "  ;d   3     CFKH U2%  ( ! &H% $ $% &'&'&%=+$      FSTY' (' (' &X )%. AB % u%&%&%$<"+0c !6K&%74        &'& # 3&%2w L   # 2#  #   #  <6     # ' +'$x x?wxwx wx;wxUwxwx       =>AB       % ??H6(  p0opop'opopop&op$op&opop#    -.  .7 $   .-.(!   ->' !'%'" !W09P 4BAB AB(AB ABABABX  ( ^ _`  *=- (     4!z   465 6565B ABABAB ABABABABABABABABABA B ABABABAB ABAB ABABABABAB ABABAB ABABAB ABAB AB ABABA B ABABAB ABABAB0AB ABABAB ABABABABAB ABABABABAB A3BA x$t"t"!"     !"   +md*)   t"  t"!" CmdBAdS8ImdHGLOmtNMT -t",+./t"!" 2 5t"43: ;t":9>At"!"BC&f!St"RQTUt"!"XWX[XW !" XW\mdX     j//P  5:&2/" &2 (  ,  + &"")8*&2 / 2                   $ #$#( )('(', -,+,+0 10/0 /4 54343 8 98787< =<?<;@ &?D EDCDCH IHGHGHGL KL KLKLKP OPOT S3T  64 65/  /  4   *)  $#)*EF QT I8  ]^]BaJI N-L'\)C5[i 0436  p5op2B2 6# 2M< 0 # 0 HGH GH2+F   2t 21) #   =2Z # # H2F3## Y2f 1$;# 1$  =2[ # # H x<Vf    > O"6V~  5  4>  0<        L   M3 `Q_` <    he@0/?zhe@0/? Y 00 | " 09 -  \)0  @*n  0 % &% &%&%&%&#&6> ,-F?VS-.Q,-VS    A:   ;    6 > @4?@?@0% urkl)-       "0+           DA85$   /(!|. +  `1_`_`0  5 he@0/?.( 5 -(f'0 %&\% &%&% &v%&%&%&%&%&%&#%&i%&%&z%& %&%&%&%&% &^%&% &"%&% &q p     ;  }!! !!.-.'      "        % )"   U         -HylD '""&& -) 4 >    v   #iz   !^$#$ #"&%& %q -: !0 %&%&@% &%&% &o%&}%&% &   ;  E"  !I        " S$& 4   & <    o }   N3 W!0 %& %&% &%&%&%&%&%&%&%&%&%&%&%&% &%&15%&% &%&% &\     '' )  /+  $   Z[ W   &&          ( O   ^ @(  3$#'  *!  $(O!7#7                15   \0 + #) + ? 90 %&%&%&? <     he@0/?ji   ?      m  0.I  121 )         * 9     >  0%& %% 0!   pwopopUopop0 %&% &%&%& %&%&% &$%&%             'H5,    $    %   x`wx"wxwxwxwxwxwxwxwxwxwx5wx+0%& %& %&% &%& %         "%    A     X/       0 %&%& %&%&%& %&%&% &) %&% &%&%&%&%&%&%& %&%&%& F%&:    PHG  /       he@0/?    !   **e A , #            "!"!F : 7<0 %&%&%&%&%&%&%&%&)  )% & (     '    ""&%" PHG       " "   he@0/?    k2> /     $ ( K0<#& ' ,-VS   6< gE0"%&% &"#&#&      ,-VS     ,-VS  1  Y1" "   J0;#&/ $ ,-VS 5<#;/ p;05%&% &#&4#&/ $   ,-VS  ,-VS    5b'#5 4 / hOgh gh0%&%&#$%&D     !-VS #M5:  D x[wx(wx'wxwx0%&%& #&      ,-VS %   (  0  ZB@B 3M864O0 %&%&%&.#&8#$%&9#&;#&i#&#$%&1#&/#&-#&,+&% &(#&%&%&%&% &%&% &'         ,-VS    -VS U ,-VS  ,-VS P ,-VS     -VS   ,-VS  ,-VS  ,-VS 8% $ ,-VS       9>B-A*:53~%21 22  ( . 8  9;i$!*)&'10-/85-@=,BABCD C(JGLKLKNMN MPOP O'B pUop;op0 %&%& +&% &D#&    % $ ,-VS  w:    D  V0  )%    FHG %   0  6 he@0/? 6 /%~%F4<RL Q0)#&*' ('(% &#&#&i#&#&% &#&#%&]%&Z'   ,-VS     @) ,-VS@),-VS ),-VS  + ),-VS K   ,-VS )  )  $x$@( 8$EFWA &/ B,B, Y$h" , " 0)*    i"*'. -41#.-]  Z   q&K 0 %& %&% &%&%&%& % &%&% &q%&%&#%&P5%&% &%&(%&%&% &%&% &z           '      q!               5l       } !( 9H! *$Q% 69            qP5 (   z @p?@0 %&%&%&%&%&%&,%   M$ , hjgh0'%&%&% &%&%&-  $"#' - 30 %&% &       r A  -     8B780O    0V' ('B8Q_        )7 V _ P07/ 0/ 9 %#/  E0// 0// %# /  h3gh!0/ ! +!  3!  ( `$_`!"*   *[ ));dP               A B<   .    ## ,2*'W.  (*'( '(BE  , )BI 7*  3 >=> =>=>=>=   "  c,X>=>= * ,*>0jX*      7 .po  .% !7. P;OP OPOPOP OP OPN:9: 9          / \   hghzyVU<;<;<       #R   &,)+, `_`   * # $ ,8* A:[ ,  ,' G[, pop     y   - 5.x-  `_`%:9 }~+1  &    $R)*% - 98 pop%:9 ~}.*  2  ,      %OX;$S% -8 8 mzyV$y<;<; y< +   u V+1  )m y p[opop Q   opAyJ $B Q pxopop; Q  $A J $B ;Q h    T )-F?VS-)   U"<T ,1< &   m ! $    )     L$8<#< &   m   p'op"opKb  !  1@"b  *G,f [ \ + *  % & ,' ,-VS 8  5       %& +I* "E';=6NC!  ,(   \+ * ?;Z ,    ,!Z, 867878    %   (HnS[QFg=-!!)-pWe 6$YZY/`    / &!&7&<&! [ % 6 , T TD  )< f   &-F?VS&&&  $    7 &$& 8$*  r    :Ms  " "   "$% "*  . < tw jm   ZY Z{$%`{|{P   +&-F?VS   $-F?VS-     $     &$.  ) FFl ?!@@DbI#/]F&lfF y" > `  1 B>=  1(  /`          /  "!"!&&#!*&'7.&+<2&/!"!" ![6 3%: 76> ;,B ?2CTJQR QTSTST ITST DVUX)W xSwx   ( $-F?VS-$  4      ( TN   S^3  ,             ,*1 >  '    S    ^ 3 , +w8* 1  Gzy VU<; <;l#   +<;   """">' """" """" """" """-         C    ""> +:7$ 4;<  '4;<- '4;<-4;<-     +6;<%      p+6;<   +      k            1)  UAd Cw ! o /#8    *       1             #$    =# !$#$ #&+%  878B7878  ) ,8 3  %;5Nzy VU<; <;L  l  rU  <;   ba\[      a  HG(  1  ,'XU$ RK  RK RKRK   XI $   X?+ . n-6         )6 '   n X/ 6I X !$     +  SE!-GN=y7J j8"   EM :  %; 5 * $         ! l  r     U     87878   87878  Z P ) )* ) ) 43  . /  ,'K ) k )   a ) [ )    oC 20M1LZ O)) ) ) ) "D7P      [D~f      - Y #D#    +!# 8787878DR     D\&  B   & (@,\&  *=D  (7 ;D"!"!"!     @- a(9H ('( '('( '( '('( '('( '( '('( '('( '( '('( '('( '( '( D :9     ( /XWF    Md       '$' BDn    M[M p'op0opopopopop#opopop6opop8opopop9opopopopopopIopopopopD          XW F#+ @    +   J 4IP f#E PQOPOPOPOPOPDr )E(I# 878=787878787878D}     \)6\ `_`)_`6_`_`_`_`=_`_`_`_`_`_`_`_`_`_`D ' @9      *(  M@ 0 xm'A!,e@ `_`._`6_`_`_`_`_`=_`E_`I_`_`_`_`_`_`D ( D=  0     ()  QF 0@>uk6.!-p XWXWXWXWXWXWXWXWXD  *( #` ['$( `_`i_`_`_`_`_`_`_`D      )  +U/6'5 `_`\_`J_`_`_`_`D (   ))  m A4"6$, XWXWXKWXWXWXWXWXWXD`   # 3D D$`Z( P OP OP2OP OP OP       P%.W D5  " XWXWXWXWXWXD     (      "  2x #-K AD!:   B?@ITJ!   2/09D *D  ;6 72  ?};   (%'(|'(D2{         o { @)?@?@?@  !  @) V.c      X"WX"WX.:%&% &    :   `=_`. %&% &1 #"# #FM(  1 7.l#&'%&%&%&S%&%&%&%%&$% &"       O,-VS      !!!!!!!$! ! >B>/ (3l'      S  %$  q.$        :$   .$   %&%&"    | {| {<<W$   " 6.,$O   ## . %&% &, +3,$= +> OPO * $  C    9$0: ?4         ! .   %+ *d0  GB 3 +     * 5. %&(  &  ( S. %&%&%&%&%&&% >  & [. %&%&%&%&%&%&&% % !!!!!!!!!!!!F  & R . % &N  3E  N . %&%&%jCDC\%   %{ \ .P#+.  =       S  * @ E4 .  = 878 . % &%&     D.  &,$O  8P;,  >P;,L , +{ +  ) + ^ Q;    /2    887  8  B   " 8   $. 9      ^7 +) +     _ c<0 <0  !   Ll+4G3 4H?c  - & +# &%B('*"(*0.' 0(   8     >L   !{$+#&)% (+'^*)* )Q,+; . -. -       pop< 01 71 71$+( 710 105,7 7 7 D2<2<2< #  <;   3 ('( '('( '( '('( '( '('( '( '('( '( '('( '( '('( '( '('( '( '( < >=    ,    3baP     Wt       $ %N<      $"x0   %V<    <7* BBMP  O       ?H    k;>  E L=}# %b | ^<    3 d9-  <        5B!  ) E$ L[ZM3< *)*)*) *)  *5 4$3 e$; J b34% # 53  sts   t     AB                              )- /*$!     ";:"*!!  #   M4MD4H =     2  #        E      E 8 E8 E! R " 8e8< 5       )   16          IV   +s>0  #P  L0M  "  v8E <     )  16 ;. X4m  R0[ `|_`_`_`<     >  8 O2 e87< 5               )  IL           _l   +JL="/  #PT  J0LE   "    m88<     )  % Od  J0-  88< 5              ) /    .         _   1 (^40  8"7M5 V"D     E      FM< )   )6=^X-  d8< )   G)!R  Q-  = T  7 W('>=(7-(7"+<<J   \ i X)"X&J*  :]? 3     y &            s    gF`    r POP_OP(OPOPF       O/42. 0D/0/05/0/0/0/0/0/0/0/0&/0T/0=t 8 ('(%.+&9',    _DS? zu&IE"E?@$= $=>=U>=$ =%>=>#$=k$ =;<9:34s 0 1121   #     fab[ $X   L5 0+,% "   wt~ d+oHj^ .w +B-O. -!. u   U %k  N^5@$=$=++2> =>=-> =>=      jj)+haba haba !{    m?;#0>r       )+     @('( ' (). - #         k_#f#  0@ @  '' U5 BH  O  H 3      3 hghH     ,  P<,  XWX WXH  !&#   35 0/0/0/0H      D   7  G*& 4  4z'#              HH             #      +,        vmlc ;l       WXab   k  5;    d3 2%$!KH !% 878787878H<    ) XaWX9WXH   &#%$>  * | 0$* H 1   + 6 /# H      1!%< &EH# J&H   ZK  0/0  #0) ,97IN8 qH .  X T<H    !1  5y#$2 M.H   *  I` $) MOH   '. 5*  H$E FH^   #* % 5= >k H    <M  #* A  dZV $!8 >HH       AZ3 $9 0=HH        9@  =  AJ "$9 0=IH        3:  =  BJ "$: H       8        a    2qx W$  ' BR83&! 'H>     %    >1H       GY  $'      06H-Q6@6h  `_ ZYHW @G$       .   _$@? J' n[  5-Q6@6h  .a(*yH*83J8  $      I  D D Of        $  )_   (  !D*N)E       8 3 % 8 XWXLWX/WX%WX.WXH*            l      M*((,) 878%78F78787878H#       Y  2<K#3() ('(7'(,'(/'('(H' ~  %      S    ' ((  %X%R.H)8=                  q  n   )8(m )   In8H2  &  "    S2 & | 5. H  0/             7@U     (!#]()" p:op7opopGop;opopH}         "       L k   $vPH & 3( ! D3HZ  !  (':'        %&          jZ # hgh6gh6ghghgh H?! @C                 #$          F!      ?        4 &  & &  ?-&WA-gdHJ?2Y3883y 8/Y"   !!!!!!!"O7    !"9D   ""   O OqI!!!! !!! !  #!!! !!  !       7  DPc"""#O <5<%%""" "2!  "  1#$""" " .1 "))<$)!"!`  ]    -0 bJ(2   ( +  3883d(y 8/  HGH,GH,GHGHGHHE6=_% >5   6;*)## ###  # 7 65 ##   #   6  :*E6=( ,-G$nZH9 4& UVUV      UVUV$$$$"    B? D5$5%$5%5     ' $  $ 21&_Ac=g9-;e6 {%}#!o1q/ ")k536u+w)9?aC][E SMKU WIGYFAOQ: FMZ    J'' +'''  ','' $         +, ' 'C ''''&'''&&    !        )  & '& $$ %$           d)6"$'D   B)'9 ( V   4  (( =BH44   !* OP+s- Rp[^y|sz      ~Rp[^y|sz d)))))  )  P ?@    p$q-   vQ'#rQ'(#$jQ'(# '(Pc P OM(w^ u>-)))))  )6))))         -,?!  !0)  (   VJ0 UA44   ( !   H78U,  ****  >@    +,3 -*** *    '*) *bQ{ 78U HH) )>0-    $Q (mrq KF\ UhUVl0++++++  + ++,,,+,,++,,,,,] "l   6x (x /05"l" UVl" (l,,, ,+,+ , ]plmr ve pe[q b<Qe[qklq]`TluxTluxTlW Xklk,$O -?Vl=VlKL?, lVX+     G1?Vl1Vl# 7?Vl1Il!$5,,, ++++,wz    ,,,(-+!! oyOG) )>J 0JB = N~ J'AB ABABABAB AB ABABABaABA BABABA B(   Y9 V(A&B8  kcdcl\k [ d   F$$$ $@?$$$ $ _ Z0=B  :;B 8CD                  &' &n/PX/MH</@ C +%1'       a   ("! $ #$# &%&%Y('9* )*)V,+,+(  0/0/04/0=/0/0/0J ABABA BABABABABA BABABABABABABAB !  % %%%%%%%%%%%Tm                  P#OP^OPoOP8OPDJ ABABABA BABABABABABABABABA BABABABABABABABABABABABABABABA' G Y  % %%%%%%%%%%&% %%%%%%%%%%% Q%'U                    @;?@?@?@ LaD  !   .9 5 $4 >9=>  O       @--F?VS-. ' "\3   4&4 "+49   O$>=> =>=>    $ a      >8=>G      :+-F?VS-+      @pG/%!2     w/  3(',]    8G  $  R     $1     /  w: C$ZY656$Y :fc ;  = @     3!/8+  %  O      H7GH$  ,-VS "      ^;22$2  )2 )*)j 6 56 56587 8 78787% ]8 787 87  +  4CwxDCDC-.wF.D    2.D  ab  4$u.Dy  "Dep%   I       !ijDQ  \@? D?@? 7  (('(' 7rC    4 hg T% F   4 ; ' 026a  \'  " .-(:+(- # *+$) )W.K" *L  "   j        % ]   "! U4636 X$         &D                        2C &A  >>=              D  P&OP OP>?     ) hX    u LXj  Y  0 ,  ,   , P:OP< ;<;    5   < HGH'GHG212'121# I' "" " H3GH* *   *      07/0.       ,   . HMGHGH)  E" {~   (  )  Y!  5VU  WZ  9 `5(#} #ji jij&k ` _ $#$&% &%&"= #*) *)*"A #.- .-."<;K  65$87 878"O #<; <;<"S <@  34 JI  Z  %S    .^  w   z      l7)7:  ]  d .     arqN   3 >5dcdcdcdcd) (  },    >5 X W \ ^I *lPN.2               F (    09/0#    1# HGHl    |{|{"!")|{01|{878?|{F  UX  i|{pqpoxu x    %4 l P6OPOP ( '2  *   2 xwx5wxG  '' CG _ fe MZ4(L 0/0C/0/0J/0/0 *     ] ^     ` * `&VP  #(N * L RQ R     5 Y;    yy (,g(,S(,+'       $[\[\3I D   ?  #  U ) !A"H&''  D 8,78 \[ba %      3 878 l                     )  h gh]^]^]      2  v{$               2  1      "  0  0 @+8 2 h]^]^]4^g   ,   mhstkli! r}! vk)qp}tk)oFSTE!^}!)3=[9}t)3=W0QRD(w&P!QRO5`_ JI  7876`!Fpab[8}t7876}t78`6785654}t56=9@? 0/L}t}F&EKV4Z<56#}t{*+,#}!gfe\[8be!~}!}!>I!Q"$D".s4K { $z } ?2 #;$ "%"" (      $     ! # & #&%$#$ (). /.-.-2121' 65658 98787< ;<;<;@ ?@?@?@?@?D CDCDC 0/F9,$(##J IJIN &MPOR SRQR UVUZ YZ _^]^]`[XSL# ^(]babab(ah ihghgl mlkp qpopor 8 8p787878L787878  ( h     (        TM H_ be \ k9[  (      (    A hg=hghgh ghgh ghgy ,   hgh#k *hg    TZ$#$ T           %(    D5,))          + >7  Cn D a  :0C  #&0 ' = "1#$=    y      ,    # * hSghgh ghghgh hghgh &  ,$ h \ <       (  #,  } }.. / >vx[%            (   ddj  h-gh   hg h/gh g ( hgh"gh gh   hg h/gh g=hghgh T M   T L M w tT      T L M     a: Bbq"03g,13*# $    "  ( "     "  =  s1j#    @G@I !!   49<= 49<=    c,q.+t   H        & -        Q6B?@=>9    2=    *    #z "    C&  - Q P4 $  B)        y         `Nstvuv   :8.P y     (Y  feY                 * '( #"  %"    = Q [  <@  f$ Y      2 T STS baTS babad cdcdcd cbabaF be  "  83:9  '*B""         XWP%  -I;T STS ba b ababaG    8 5    XU'B!     Gz 87878?  ! POPOPOPOP>   0/0 /0/0 /0X     2 +x                 !                 lk6 ]>  (g   +-  &l7.!IjS \  !(!/W>I~N.9 !          b , V, > 0"4,    ("    |*)*)*) *)*)*)*)-*)*)*)@xw *)|{|{*)* T  xqJI%*F  zyzyzk  EHKPKL IRz        J?zW zy        )A    $ zzPBzy %  ozyzw J     %< b T  :xE   >?1C.,W :%<O V|Y -      @   e    T|{|{3xw"~MRQT      M- 3" (< D! 0/0 /0+|{  +B    . 8;U  >F     $"  I. 8*U @%?@?@   c  @$ +,+,+,+   L >{ g 8 2'c )  `\_` G        #G#  ( +        ;G# HbGH GHGHGH3GHSGH GHGH:GHGH*)`* )* )*Vx *)*)   klklkv y         JKV Ydgt s pU   Rdck,  !     "  `_`  | y  X!WXWX>    # / 4( )  *)*)*) uxB9   T#!)    6  +%;%4  (%'()'(*)*)-*)* ) @EH = :  (%'(Y'( *)*)`*)*) "'*   M m9 h8gh %  "5  % :g7 "A     +L! (<  Q7 "A hgh%ghM "!   /-  , @(?@?@5      5   0V/0 5  E J       :   HwGH &EF'$%"  % @F :    0_/0 V   *)  DS  #  ?   1$     G( (   340?GXkyb   $   / pmoJ\ HKGH+ j     p opmnk   *) CD71    `_`_`    ! V ab56/   7 LX+\ #  ' " ++&  2 +H  V  f#B  R ` `m&38%  &%  CN   z w  @7 I@ R S  BA %-7#8 1 R `  l   $    6# (L'(4'('( #X    1-M/#X ('('( .   -Vs ;0      (    pe  "    ' `.  +!  &fefc 8Zk-/T^&70 UVJ#/ Qv+/ " r;%_  1 #7 + ts3    % Y              VW )   8 N' &' f $& SZ" n&  % _   1 #7 hSghghghgh#   3I   t q   D    M +3   &%   ) &#  n2E2 #*        2 /         C$ " 59$      &   8)7878 O    #, ' PwOP OP OP   A<; DYY&d B ' 9  W.           )  >     &5OT X 9   ) .    `   CBC Lw      %      &I2:Lw POP JQ        " JQ D R  FL !     % 2 )  6  FE  R Q  0/0 , , |{|{|{        <, ,  , C  & {j    Q  &    !       #>  0/0&/0/0 !  $  !   ' Rz AD CCB YTSRi d D   P"J!_"!"!   [  >.: orop 5!c DE P )_ s H8     ~ } ! "!)RX$$M8  N5uEH%  2 )     )      :  ,  I      $ #      /A #< 0//Q- 3$4+!C,! %  25                      -C ' |8   A B    '+ 6  'J$*/ C '   z  .  `_` F   "= J " G | x l     kb  Q(\Y\YZYZ Y,ZYZYZYZYZYZYZYZYZ YZ Y^Z' ",-VS ,-VS ### #    ####  -F?VS-,2 ']" !' $  , ^ h+gh  # 8)78  |    -0= ) 6 L D         ~ s   ,e } ) 6 L D L A  , !        ,e Z  +,_ 0D/0/0.     "5.  8"7878        @|?@?@ ?@?@?@ @d >=   < 0%0|@11 k E dABABA      h_gh u  <F A, `F_`_` _`       4      N';74 `c_` "      %     O@("% 0 ?   a l    >= *p y    R-  3 7  %  0h/01J    3D.% 8;78       ~)!    @7?@ !       noxs loA1 !  @-?@  2 HzGHGH'               ile hongl srknwrqnmU1;D#'   I    $, POP    8/  '" '" ' <9: ! [  KI!X %  O  +  ?   `         )  -&9: /& 36js./       *    HaGH -1       Fa-  1 8-78 : 8978S7878 78    A <  5t , 87878  ")  0B/0=/0/0/0       DX   6    f  m n  *   A :(K    f  s 2  =   >=  d;R2 = d  CS $ >=K\ [LK  S # G Z i" 8[E[d  AS 2 vdX8G          w D        ?  }   "C "C ,)(# C* f{`_`YZW 65  2K214'(@  _  \-   CL #           '    n  4   k   / skP y 0r,  d5^U  ) L    w D  3    "!"!"!$ %&% & !       x    &6  - *    S    P  s8#x   6     pLop      )$   H!   8            r  9   JG  )         , $ ) mmC Y   D | #=c)ZNE, 8            6r9  u    -6 ) ,    S   P  z6%hBu   6      v  5 '  )N 5  \    9    C4J x    9     C 2J .  @   <0 9 .  -'Ge@ (('('('(    Z  d75,     O<-)!5,.    !-        +  TS0$S T# $# . KT  );-    + % 1=       <  P       3     &NK$CV3! $  &,4+ V #/ O  H) 19 = <P    3   ("'('('("'('('('(/'('('('('('('( '(+           ,e Z 34,           ,e Z 3 ('('(.   (#'('('($'('('('(2'('('('('('('( '(F           ,e Z 35G           ,e Z 3I   B[J      T + , *   !   -. -  .+,'FH  8f&#  ()(POfGC rq fi       63 .-0/ "%&  ABC.?   ) . N  s  '8!+$" d*A#S?fB .      ^ Q. . (%'('('(     +   U%  8cdcd 75  "   0. 0# !!:?<;8M: %50*9H?/#XWB   '  O4 1%_L<,*%2:=.!6U6aW(C% ('(0'( *-.-&   /" *& P>OP-    /- 8/7878 7878Ws !   " 6AB!  \   3O.W6; P&OPOP1OP+OP1OP-OPOPOPOP%  *:K   ! !     !                  !  ,   & % $ )$%  * :    K S"""""/rF      tOBC6 3M F32Q:Q F34PS  ` _h gF E< ;4 v DE FE          :E] F*     $ }'/a( 5%        c Mz /jcjcdI dcd]!ZY   lWJC  X UDUFGZ+  : 21230 `GJK323:7[X abghg $ LMPQ 3,3:up Ue\  :,9$2o6:. B  &                ,e Z 33   [D       hUghLgh. O %    [ F)-      6 878:)*  @0?@?@   *    mdM     %   B%(!" )#<AB    )*O$#.343d.:2                      n,        !f9    XuWX v :l z!y z/ ,   (H'('"H      .'" f orklm   $$ t  utyz{   !%'"    'NS   +S[p!<>!|     $   $   % `@_`_`_`@   ]^ -@ ji XHWXU   , ? xwxL 2  /0HG)*LK)povu 2  BC14>=789GS0'<#!%         - ('&#$#*)('&' *+0/0 +  &'"! !  !MKPM++!( !$'$$. >  Gj  >#    (E'(#"   {|vu    /#" o      7  S.ui   ,  %7   0(/0/0   c $  XQWXHWXWXWX     p   '0'      )$0F9   p @!?@?@?@?@ ?@ ?@. P          $e. P  1t         # # 95(   i  k6 E   >=               ) !7 -%6)0    +  0/0/0    1 BO       0 KB2   M  C         7 O\3 h3gh%ghgh ghgh     #$ ($3  h\ghgh     &     & XhWX WXWXWX WX>WX WX  (   X  ,d `%   PW0        K $#0%(   0 )$"  ( X  , \j "!"!" M:     WC Y7 xwxwx!wx'wx!wx  @?   </ "aIj F    36 56 76;<!/ _D,h  -/ P?OPOPOPc  # " `%_`_`4k  3L> #G P(OP ,+  <; |      v         8  8*7878 * o`(   * 8(78 78 & o`$  & 8'78  o`    . c !!2 1    Y 9xwx[|,+,+      PKLKHGHG       2 .   /  !!/!W&H)"*    1    Y     n PEOPOP !* ' *) \wxw,       =  P ef DC (#p1K/ =;     " !( '. -43D43(:;<;,  A )0    "Jg               3#? M11P$  H,:*&'   %(* *&' J"\w#  _ *   A \[ /  CZYZ  TSFE* )$ #h  -'+ ;"#    _     p*opopop +^   ( $ 1 !  /1B + @?@?@        %  K <;<K     8'   5<      !;N"!;N  VPMF  1T6&H %  K hCgh)gh ghghghV  &      s       *B9,,V&    p\opop opopopop   f%6   9    /          i /    (@'(&'     8^78 _     R       *,2,9 0K/0/0/0/0D .    GD . x7wx/wxwxwx  ." }($   6   5:H+   F0        .    0 -2     Q/E%(5d/   Y B + Q,,C  6  - ;F0  t "    i hcd(L  "     "    @*?@?@   (^'('('(I ! ) I      hBgh!)!5-!) P|OP !<!$'uA#!<(   b,Qvuv x,wxwxw |\@$2,s L! ,  R,  &  %,%%%%%         $ 1 !C@?@?@)<          ; N  0W           ! (  +FF Q+m v VZ8.#,,    ,   V!24  !9 0 0   !; 8878 > 5 55555 % O O  0/0                            POP $#*+&                        C u * * * O POP7             5/ 0F  Q ?^]^]+  0'kvwx  0/I  ( P @   ' )1 _Gj kK o=  *_j k  j k 8      ;<1  !  #=1)VUV -. -  !% i         9<-       w;f    B#!&  J+ ;"gj @#      !=   v *"!_$ % (  )./8  ( @ # . ('('('(#'('(U       %  M: 8U 5h  .bae3{baA      $  (i    +  -            I#"! #+2.  e 3 { A J/ts    ) /  '.6  @#?@ -:   % `_`_`    @$?@?@?@     fI.G( l kh 1 =   ^]^].^]m        "l5?0,Y                    #=  5%VK%V%        8o?  - $7&%/ ;   U  -+ 7.  $ * 0G@U $C'`9'.* -g0  36$5 7(  h 1    =)   .m `d_`W   F   'W   MQ y  # B6- A) y ^]%) =v   *#X !?      3     #= ^   g 2     <2%)    = v   l k    j =  #= 2     =  0 /0  -' 3 hdgh ghgh  - 5  +     8M78787878 J"     .& " P C     8  C 85787878dM  : NW9S4d**    (. JQ!R*  * )$ # * )$ #   * )$ #    !"   02 5 BVNJ3V> = HP+ (% VDl,@ &' & WZ  ) :o8 69/gjO9z* )$ #vE7 60L$  F , ?GXeQ  o$)2               J$!    =Jd     !-  d.-   (  4'po& ( Q!R (  ( ( (  ( ( (;n! }   ( *('CB (  WZ md(m((( (( (( h!D ;# +*"3 % # !4F!*"+**1+,)        (   ( ' "!$ %$(# ,)0 /0/4 54(38 98787< =<(;@ A@(?D ED(C H IH(GL ML(KP QP(OT (WX    Fd{ *    R. |     ** )$ #,#$!      * )$ #* )$ #$   $  $E#$#+{                   | @dEF    ,3 du <' !4 `8_`_`_`d  )     )dd fdDpo   < L*E. DdLe f1  D?5Zd      h(%>5Z xhwx wx wx.   R O  u 7 (.  ##  %#% l}4n    #4    +   "#     "   4  J   + B l4//   8}~ } ~m n}~      H"; 8    S, "Km=n}~M3"}=n}>n}4n } ~}=n #&m=n} |A{|  "-{    &!     %=    (~*#= 5lk!     6#>A#4  #=  $  = y    |{  N  o-  "  ; B    a )#       6    / %'  $    (5 /DE$H     GP O K% =  + 3 " =`6>4 "=#"! &*=)( +A,+  |  %V    r  !@   %V       8b78$787878 ,JWX ` * )$ #   H]      ` XWXWXWXWX} ~}~ #}~*  OP$* )$ # 2l  #    1z} ~}~}~}~}/~Q  %  )  17  /Q xwxwxwxwx}~ #}~*      $* )$ # 8$!E #             )0z7} ~}~}~}~}/~Q % %  >)  =17 7 /Q )Q<8}~uv}~ } ~}~}~}/~ uv u$vuv %    %       Q  _   AJM8      /   Ku v"  "   P" -u!v}=n  WZ  #=  #   >  - =  8M786} ~      06  `]_`_`P_` _`_`}~I   %    a05N&2I *fA1$!"J          f_  >     !       %"  ]  VOPz    ;J   2  ! " &   7           07/0 /0 /0 /0e      71 m0}=n  #= 9   "   0=  XMWX <    *& <  6lS     ' 6l UR  J &   1  %         %0."1  &   1 9ZZZ ,    )( * / @ P * )$ #  } !* )$ #* )$ #  !  ! /2   !    ! < %Kf}&GGC'Y  P G[5       )          / @ P   p"G    G 3"G65;"  4, <  "12 !"     7    &    C ;E"&.E* ,  <  XWXWX %(    % % pzop3 (  % !0   BA -"  $ ! KD, *3   pOopopop !  !"    (     ('     "!(8!  ''! s    ,    "           BA%   $$  $ ! D,*      h  !0  8?@)  (    E:7!@  }  !.";! 8C/    G E!0   K!  E !  0I/0/0/0/0P       )#*P Xe /@ ]j  `]^Y%%LGW    &%('( /       N_  KA 4     %  -,/ PQOP%      $B     *).+   3Z&I'  XbWXs       ?1 hghJghn /; '/ POPOP 3 +  6)m 4*!   `+_`8 ,  - ! ! ! ! POPOP  .  @??@+     $+  vg   '   D*!"-    PHOP OP } ~  }~      B      ? V   1)- hghFgh l " A      $  #3*  %= 0/0/0>  # e ur 2  } ~3 }~L  !            +   C  : <Z;  #A%$ $ ( (  L znAa V B !          .         "        8 ! IZF' ($ A *a R   '   0E/0!/0/0/0"        )  ,6805'   g `_` _`6#    p&op opopop# ;>   &      &.) !42    Sl!0 4 0/0P/0 /0/0/0#            < X C  0'/0/0 $ $#$#  $  1   $  """" " "@    1/%   !, # 2J)  0*/0/0 F%   IJ #    pop% ( ! "/%DI ( ! % ) # )  ()'('('(`&     #w& )3 # %  < )3  HTGHGHGH  U&  $ $$ $    #49/#  U hgh'   (v% + 0 " 5   (% +0 4' (  % H+GH GHGHGH l' $ $   )  i*] l POPiOP r(  ' '   vu     . F Q  .    #(     ( pAop[opop op opopf (      + ++&        5  82ID3\43         )   `_`_`_            ! RQR QRQ   &     7<  + >*%0 (   L:'# )!        & *  x>wx/wxwxK :*  /( (     K70!K : ('(#'('(( -+   ) )  G( - PuOP OP+          .  - (P ,. *  L, (   ,,   , p}op op,       ,  8  /;    A,   , @@?@G?@?@?@?@b h-      + ++*        0/ M2[    h   .        !  &7<  $: 6 (   4:'# )!     &   <,>=0  //  $#$#$# "                 #     $ -14(C=   Ea>1G>= >=)> = _"!>= JIIJIeJIJI$0 ../'*..). / 0 / K   0..  ++& ,,!! ++!++2 5o7"`, Cb> r  "  /  )  ^ Ie$>=> =1/// /   RM>=>= >=1>=K>=>=>=>=0+./;,,(./)(000 0./1   00 #//.. //# 6/66 5-%  :" J'$M       "K    e)F- \  2 0 11D11>"11:!11 10111#$)*111111111 1 &4'D";6_ ,e)F-        <I2' |o: 3   **3  % 2222  4( -R:  3! l 4  Y7^cd O#XW44 34a/9S*)   43_ 5 `+"O   @E?@    5  4 !4 !4 "(       6 7 * 7 8  H[GH  9  ////////#5  @V?@?@$9 000/      )$ hgh9   :    *  9  *#!p :::; &;8  3 0/01;1 m{; ! (   "-  0,/0/0/06<;";    %6<;9 8278 7878,<;";   1!,<;9 `z_`_` _`_`<;"; "     # <#<"4<;9 xVwx"wxwxwx{=<";      4$4I{==<9 XWX WXWX=<"<             :$A*-d+==<: 0//0 /0/0+>="=    0"+>=; @Y?@?@I>="= = 4   (!? (>=; `0_`"_`@%#F 0/0/00@  87878@  (6'('( A @"@ @ >       4   A @"@ @ >       ,#A @"@@ > * "# % A $  6` ```%` ```'.3 3k)?   @  @           51P!;$,*4@ ]!JI JI,B>><< 9  4! ,C$ B  FlB     \:   01B=D KJ   RKLCD   + )*   rrrrrrrr,,,,-.CDB%% 66%%   " JIJ)      "7 *%;HG  '   7 6    2,2)j0 7    )9             C!D `[_`hF  "!  - F 1" $!HH H @1?@ ?@?@?@ H    RI 8 JIJII EECC: ,' 87878J *3434ux (H9 `_`_`_` RCJ   FGGGGG  0 $ 'W7 1:  uK       ++  V S`K `6_`K    !- ? UK    &" + 7K   '    XMWX WXAKK"J      "$$ AKJH       #      5 L       66    ,  ,   839, 21 &; &; < ./23   % *' $-  !  T cf   i-?UV    .3/A           J    <(AG`%Q  X  X @^      ! -1# MMLLLLLLL %f5N  ! /0  -   ,    3 O    9$   O     # -I !(O ~)}~P}~O IIOOOO (  II/_!   )P * P   !          3 -71 >"    <  \P      9( 2  HGHQ  ZZZZZZZ Z.-- %-# X Q   u   `wR      ///H 40 -''    k*uP%!!  S &R&R' "R  NGRRRR" "!  &%    MRS ,  iQA  '    H#GHmGH T      ),   .!  }  8)78 & T !!! !T`SSS! /  T  (!'( '( U !!! !! 3   HDGH ZU """ ","    A 0  @9?@ OU """ "" ?# %  tOOK U """ "- @787  87  +      )'$  3"   &$W6) $  B3   #0 V ### #>> >?'    "'       U# "-5S' ,  P:OPOPOP xW $$# $1 =   $ h9 J  p/opop"opopop W $$$ ?*?? )??#$ =0   J  xEwxwx rX $$$ $ $ b ( H  hgh.X %%% %           S$% D+      -  2  `5_`_`'_`_` _` Y %%% %4 ?44 & " #B  2 Y &&& &"  "" "" "" """""")  9& ZP%`.   P   Y uZ &&& 'AAAAAA' e(   IOQ0G "!"Z ''' '8>88$ * CC"CC# CCCC"CC     C: 9ByCC#"XA? !B  #! "+  J""    (    "    g  hPgh f\ ((( !  ( :#*    \ ))) ) ) I   " 8  ] % ) R ;!\] ))) *   # """5D55DD  2-   .=S7 +      # " Y1*N2 +: O         q   _ +++ +  A+  (   &  _# KV>=Z>=_ ,,+ ,6E//#/ /////#0 .. /  I$/ fT> 4(_b4   9   ,     `0_`_`R`    *  xwx` ,,, ,   ''''''''GGII . - - -,, '     F+ : ]         Ga.@>=P>=V>=Z>=^>=>=opEp op=p` --- -1 ..  11111 1111111 ..  11111111111111 ..  11111111111111 ..  11111 111111111 ..  11111  & / &211&1..1111 .. 1``aa```!Aa` `aa`#=a88GG       % 1 JPTX["6  ,  c @DV\`dN >b 2 "@8&                  & E $#"=#&%('  $(6 a ... .,% \\\\ -%\- 4  ;G4J*  }(6  878 ;!!b  XXXXXXXX  56;!! `f_`_`+_` b /// / >  $/ 1'i  b# hghc /// /   $ / O  .4H  c# Cc"" , 9& < c   5 < j  0( c! @"?@Dc  k d 000 0        #  0 ^#+%&    5 Kd 111 1 1 ;& !  0./0 d 111 11 4   @s?@?@*e 111 MMMMMMMMM M   v/ "" e e`ddde ((  hbghgh ghe         , \<f      7S  g c c ;;; ;;;6i +    :  B7= pT  fw!xg f ffff3f^SLQ --Q--QRQg gKPQLK g g----  >787d WZ d81D       y gggg ('('   @[Rd6 > E= :    D6-Y  2II ti %iiiai Xff . ... u     #-($ 2     3    wxwxoi  ggeg+ 4#   @Wo 'w xj  gg 2V  G   #' "wxwxj  ggfg+ 4       @W ej  gg 2Vj Tj ``    %  5   ' HpGH   9   k jjj"jhh hhjhhh     %%9 k22   5k     l   }/ok;poprl $#*, 9  jjjj* k3kkkk(       jjj Y$  ( &4'   >  * !!,  8$ XWXm  XWXm  H%GH0GHGHGH O 8m  22  l l ! g:@ ( 8m      X)WXYWXWX o <<< < `    < 2   4   r  2o<<< <0/         A (< A ( #   <,& >  ; *!!8 p# p[opopop+ , *p n* )$ #nn \kk nnn* )$ #E 4             x>wxHwxwx q  ! p p% 1  (*'('(q  #  K]q       qqqq> tD  !K]r `3_`"_`ct'#F 0Qu +  0/0/0u  87878u  HGHGHu   Qv ,,, ,,,P, ,,,"&%"33 m 7          ;D)2TV p7opop]v  0  $vv  \1v    %  -  #0  vvw   @3?@?@ "yx!0x  ""yxvy  y`xxx' y  8:7878 (yx!0x  .#(yxv (9'('(Jz       ,z  h-ghghBz   " z{  9Y IOPO {   3  z zzz{wz{w www{NPD#Y         1:5+ 0 K/u{ z z  z z vvv`z     &&&& $ vv  &&0vv ('v`{   %% c&& u% 4MG0@;.. )($ E!  &! + 0 "     N/ *+  @*?@0| vvv`vuv @ !  popop8opopopop| B)7F  GPO &-   !    "6B B ,  h2ghghghgh} % xwx} $ $$$Nb   0F6i ] y I~   ' } }  %#ny I~   1 + 6 B= B~  #"+!$     ## ##~ ~~~~~~~ffff u uuuuuuu ~ ~~ > ~~ } ____  cc     }D|  cc      $$$$ hh$# ,  /  -   %' ;B    7 1*    Z w!b A C*A xD} 9\#!           D"j"!"!&%&%.('& %Y* ): xqwxwx!"! ! ! !! !$"%$     0(/0/0 !0 ! }  !0 Y dYY "  e  '0"'*!} 8/7878 !0  $"  } 8678 7878 /!0   5"/~  `  L121I$_!N xw xH ĀH    W.H H6GHGHƒ  &'   ƃ߁ځ݁     ҃    9R      > !"!"܂܀    !     #  Z + !"  2!+        ƅ Ä ƄńȄ     0//0/0 !0  %!     :"  {|{|POPOPOPOPO 3Džȅ B;<    <ff % &i). J12^]1 25634B m). Z12^]1 25634R    w mA a7 aj+6* -> ->                 U - &  -&+N҆!       0NQ6 i   X+@      0!&3ч ҇R!!&3R!!&% "   yppyy yzz     ч    և$#$      ;D  Ul ׈Đ  '# F$ hRO\G.'1103 ,J U9 '.! p6 i        !  @?f "!"!%$#$#&%&%('   f 9?  f5 1 ʊщΉ͉!0Ή         \*@2 f5        ԊωƇ p l Յ؅  \+E   =          n    '     ‹ ي!"Њ Ј Ԉ  ݈hފLS hLKhC /R] R OOW  &"ʋщ‰ ϋЉɉʉO O"!"     !g'$ 5 *T#;#/#!        G            hghghgh gh               %F< d z          D)U              N      7   "\&  Y    V581.  +0q[|| ,'&"Ȏ5ƌɎČȌ5ED,SMӏ"΍  !0  mm EFN65 "ݎ l m ٌڌٌތ|UVs[ v    E,5 Q!19 :P     .  N    B"!E&%$%&%*) , + ( )*)*)Đ!!   !0  8/ xxxx x    *$4mA   d S3' l >= đ    #Hc0!$  l   [*JI! ы֋0 -*!     !"     #&   ُڏ ) -$!($#'  4   rB     "  % >  '     ,       A     5 ǒԒ"ʒѐuʐ)<ސՐK pmnK =? 9 04 vvv`u"  - G? /    >&*( '  ,           5 8!78  vvv`u “ `c_`7_` _` _` _`_`Ĕ  ~~~~     K  C* 1# !   *+,+  *%      ,-  -   #$a,-,  (efg <"! efg <"! efg <"!  efg <"! efg <  efg <"! $efg <"   efg dU   ,J&  ;   U963$+$$"*J-oH!  ""  4  ; =  `=_`_`+_`_`_`._`_` *      n}# a`,     ', "#   na3B^ 8>==   %>=  ,ppW>=Jc  gg g ..  gg.    ggggg .. g    $#$j$#       2 o~++"cc  """      T p  " p   $#$ ۗ3ݗ3a  #     h {G # 2 %  $n '$Sa  '2 **".: 1[   ' )A !\$ %&%,-01)43&658 9  878  > K>=;>= pii i //i iiii iii .. iEi05  -   ]c :         X36< Y  W  ~֙    Ă !"!"Ղۂ Ƃ  !0  ____  ++ _"  J   e  6>lAV< R   !       )   0  '  Iš ]]]] ә!"Й"ՙ" ݗؗ          6 =< ' @  P*,2`   5 V      s       1   X yyDyy  yz!"!     Йz ل܄ ߄؄&  z:ƛśț"  zי̙HCǙ™zzי̙HCǙ™ӛ z:;87S z   I!"ך" ɃɃƃۃڃĚÚƚ" ǚ    Ճ   T  /x  = a)  2v!' =  ~ \          !!!"! &%&% &%&%$   ' *)* ), +.-. -0 /43876 787:= <=:A:9D!CDC@ GHGFGJKNMN M D/  `d_`_` J !0 _ _    #+(  HDGH GHGH <!0    9##< } &vvv`ޜ&uڜ&&&&  )G         PGOP OPOP ?!0 y Ƅ  E% ) h8ghgh)gh ghgh i!0 y ބ  f  h o% \ 8@(! &/    .7.g g 5 63> i "    xwxVwxwxwxwx* eȟ ՞!0О   k#- 1*  /؟Ӟʜ   NJȊŠb bx% 9:    )   !" ǟ  $$    G \  " #)   xxwxwx wxwx#   gԠ++۟ܟݟ؟ן!0Ο      + 1' gڠ՟̝ ]J A Lz !0   !0   F  -+ "% A  L X[WX 0ء !"֠   ' !/0 JI  )    آܢ XWXWX:WX??     L 2 >??   3    " @4?@" ݡ  ޡ " P%OPOP  & P%OPOP֣ ( # $( ) $#))))+6     0./0/0 {| žѣԣ   {|{|  w x  ϞҞ ã"  ¡ ;    4V        p#opop     % 0/0/0          /      $Ħ   ֦     x9wx :$  `_`         ) ʧ +  ԧާ  Z*JI  0 -* ڨ K V  pppp77            ~$LFK  7   2 $+" Щ G T֩           :CG 7  2  P    B) Ȫ̪  j )8ت  <787rrrs r66r       4 Y% ` )8! POP"OP OPOP   ÔĔٔ̔+  A Ӕ S  nT$v `  .  ֭   = 1. @ U `_`_`%S    $,,  -&% *   % ? .#e'1E XWX$ȷ      !    '.b k! XWXWX       3  -JJa? XFWXUWXUWX   >        ;        ?  **  SV=> ;     ?  hghFgh#ghgh        4 ;  30 379 N_ Z  Y ZYZY\YZ YZ YZYZ Y  /-F?VS-/ &&&&,-VS& && &  %%% %HQ)   :!          d  v   )          J    n#"$))I   y R/[*J  "!  43*  )4 / ,#     * )$ #  '?\R) :/<k R/[   J ( '('(E'(!'( q      K    16+0%&%*##4  %4_ H!! 878,,   0(/0/0  '/ G    &  '   $ B8*%   h @?@?@h _ ` _`     n   ;!(                   \               w 1$M  Wv  @;!(   ^]^]5 == 6565/ #=#=w         5 = =  pzop opop op op tj i=        q 2#0:  t = Z'"4{G  j in! i"f5e    A *efefe      2!        q!  2 !"             0 ' $ $ * )$ #" Pt 16 2"$  6 91@3 .1'F!  .G   n  "4     A O    e (*'('(     H$GHGH         HGH9GHGHGH J Y     =  Y XXWX WXWXWXWXWXWXWX)J d         AD) d /5X (j i  p  Ea   K     !"               +4I +&IJ      /  a!"".ePWR J (    p       Ea       `k_`/1  A9/1  hhgh   @/ s !=  #=-     != h5gh gh     %    !  .      ;. $     0/0/0    0&/0  A  @  ' PdOPOPOP&OP    ) B -U*(6   m. Kj i*. j i6    *=  P5    *).#       !5'  K *.  6   ;I  IK &  H BH R6"  # &X   X ^1Z YZY(ZYj i 612)     8GL3 :K =  .1 (     0 /0%/0 # 0)/0/0 " 02/0#     EFE2   V~=)')b  & $  [#\  [!\[!\[#\        #     $&*# '!!#  "  c Q   # .B#   & $  #         _ !!# Dwb IFE?,W X    BWX!S    E    !@              "  S$7 f)2% 8 .        3  "     B!S @A>:=#DCDIF:ELOL:K R Q"TWT:S0Z]Z:Y`c`:_fif:e lk nmpo r orq twt:sp o pozy| {.DC ~ ~ }~}: XQWXWXhWX1 ,     * * * )$ #   * )$ #* )$ #EQ6                 {     '"  # "  a1" n  f  @     D.?   W .n ]  <  6 ;*6 ; 1 ;    T#-    2  / <      +  0$/0H .1  |   st etst !      )  ,Y !$$   (&'(0'('('(   ! so w  _&G.3,     M   &  {|  n         *  !   ZS 8T        88888  :  ?>KL{|   Z + W       &    !e!  mn     .   i       f+EX%_  O  2)k+b&M% Q ') # "%"%8(96+,^-/2369< f )     &n"!j$#@&%&%$ J( '('(' ('!*h),+, +,+    3  %  !I!   % L4w# 32 "  ""  "" 3 !!!        & 2  PHOP{4l" "#4".   4 `d_`_`     C""""""0"    #  %  #C#"  @V?@?@  @#"!0" ##  ! %"; @#"  87787878  /#"!0"   5!/#"  P,OP/g#   .?!F P+OPOPOP/#    .DO$   xwx{l{4l{4lG$ #3#$#4$$#4$&A& G    4 4 G$ 2V*{=l,{4l  I  U V%   #%EFEF   %#=%  '%#4%"   $ ;  %% %%% %%%%% %%%  %%% # #h  S 5  F  &     2*=, 4  e     &  `g_`_`AJ0)    !(()    &A0 HGHGHGH  #) (  &  # .DRzc *    -**))#8 #**  ! : L /  . $ 6  4 Ez,  w   p+{=l**#=*4     +=    / +) +)  **"#** I +  %$+   ' /  +)3 4) 8 78787878 -+ + +++  +5 -   1J ,* ++ $,+,, #! 1   8,*3 4* x]wxAwx  {4l0,  %%+#4, ,,# E   %  3  4N        ?00RQ00"/  0 -0"0    E+#      ?0/- `d_`    #    2 1!"1//#//1/   !J#   *   stI21!01 "!"!"!/// /   / A#s  ) I21/ ?L2  '3   @?@?@&?@   "5 443)33 (3-   n(b  p  5*  :::`994    4 5885   * ,,"5*%   "   Ac  [(2 0   `R  1  !6! ('( 5 5       "6 :::`999<55  55 9  "R\      =    7   6 666')(=   +          *7 2 (27777777777!j  !^ +  * 878!7878        7 7767  776 66   H^GHGHGH     +PO87!07 888888   66  4"2 +  875  G87!07     !+G875   9888888     9 8889   hEghNMNM9 55339 +' hegh  NMNM9 445533 J ,'  :  8%78*78787878    P; ::::   $,P  = =`<<<    w({4l yzyzy z> =#4= ++ ++88888 80 -  !@4  > d>  <<<<    sd>?      `E_`_`[,      !+F1 ('('(vuvu   &Z      g    .,_J 8378787817878  v4vu.vuvu         0#/U  . -F  C  (I3?023@;cN$ ` &  xw -  T L [xw &  xw % q  $I,>  P18 .+  (   &# 21   ' "UV   U NnaX     "5 xDIqrJO klP      *+  +  TA Fv     "#'   E 9 5 ( s(*! -+E3   J   *S    $O" =    N ` &  - T L [ & "! $# &%%('( 'q(' * )*)*)$I,-,+>0 / ,+  +P  1b\ ;   8%782P  HGH)F)  xLwx wx wx wx:*      7 * ;:* @?@?@ ?@?@?@?@?@?@?@?@cxw+           h-c+ W=x w, +,+ , +,+   # "   &'      xmN   Axwoxw ZxwD `5gl  b   :   7  :"^#J" Q3!B! ;!3 >  1  U      J :  K0I     0     S %7 nK0I $./" xw          3      !'. ( D       zy:9 *)"+27ZYJIBKRWjibkr{N$`  `h_`_`vcnL  8 A "   Z    o ,+*Y.   QD <&@IX ]JoWvP7      c  n      5 ('('('('(*o   m  "*o   V0     $            <B,$,#Q ! ' / 'V0  ! =   ('(K'(E'('('('('(  ;$UA Ub#xwx wL *,!"/:!   #L     0# +  Jo "%7*(Jb#   L eM BxO Y      % 2YZ     ' &   '%"&%X  O &"2#7$&J ./O    Y  ( '('(6   `  M   # !0 M     8'787878Y   ?   h    `q ;D    (;'1 '    s!  )\  0       #5F<<   h    xvwxwxwx8wx%wxBtststs       : "9  d 9 ." + ?0  K! "lkSl(klklklkFl*k%  L;    3    3 + * )$ #  3  !? * )$ #% ag&h*1 :  ")    F % POPDOPOP!hghghghg hgghg            3^   %" !  7($P   3     (*$P { :#+        # o9 :#+ `6_`_`_`;  !0  *$$;    XWX WX       U #& P8OPOPrqr qrqr       6    ]rqrqJIJIpopoJIJI +p\                 D   7 @I6        +..  !0  :965$#     C I   ,#e*  !0   0,/0/0!0  !"   04/0/0$!0  ! $  @?@?@.  "  xwxawx wxwx*wxlk l*k #/#  * )$ # # # 8P      #/ #  8#78787  H^GHGH    -F?VS     cK.     8+78!78 78 78    !  \;#   X:WXG       `       !""    \       1      $w  xr%  >  B+*     DCp  )-F?VS) )      '* ;   &&./,9i2C *         p  8J7878#    +2,1         !"!"   !& @j?@?@F&  $#"89,@  & ,H*)  z#8 *) 6E  ;P8 ,$+j j j  l ? ) `/" "    # 9    V   "   "# o o  "K  )           %       ooooow) .D  "b!+ >  z %49B    "!I $ '8    ,    #  < C#   " # &%( 'l*)*),+,+. -?0/0/0/('('( 21) # # -:   #    @?@?@ ?@?@ 9u )     K4B9u 8`7878787878787878    b  C n n      O        mmmmmA'4#2     W  C +  4%  !0         % c ?!47  4%     $  #  `     "        "          - h :%"         @~?@+/   !"             /#"+/ @C?@  !"            !"         !       ` 8978F     ;   !&$0)       DL.* "  '  f    B///...3:9 /    .&   HK, #      (  J + .    75A$T$8-!S     >I  #  7 .   $   ?   }~}~+P" ( - %# kR GRQ  ? TS0[   T+/0 .3:9 / S>=NMH   )3 #       '%  %W(3_  %H    $ G @/?@?@"   $! S+  / .3:9 /       ""  "l  Z1  $   30) C      #+) C  !0 !0  ##  xewxwxwxf!0      2">%f q7  !"   !! 7    e x 9 .-4+G  : Vh /0+*Q FE'c  4<    "<   --")*) *} ~)|          <=<= >;      SAG& -0n H     k !0    %# '  , " #  -% '3|%@ P[OP 1   R1  H  @  @(+ ,/ *  0#   Z ^on}|         #= 6>`7     9 =J 5 p   H        %B %G5:.       P ;=V! _! !6 ,Q '!2!$ $ ## N*%&%*=)"*),=+",! $7  X% = @? @? BC :  B S; V  ?     )\  S"!$#& 2'* )E,+.*/234%36 56587 : 9Q<== Nq3- $# $#@$M        >   .L =3" 1!- $ )M  XFWX=v#=   =-   h.gh   $%   0/0E           5  R_  I#   h0ghNgh!        Q*!'!u !  !"!"    !  ! !0 !  01/0 !  !"!"     !  @B?@?@2! !0    !#2!  XEWXWXWX=!!"        " =!  u- "   !!"!"!!      "A  %E]Q..-. -.Wvv-.- # $ """""     " [\   $ #"!!#"U    $ EFE$_      k  1"  H ;#3$#3$ $     /%$  "$  s  !M!wG`* 0)>gnD&?  !' ^ : L      Q   CYW !$%f  5  H6GH GHP$    3!  $# HDGHGHb#   )'#  #$TDCU%   (%. )#   q, +,+$ $U z+*kS-.3- .-.\#$R& ,#  !!Y0/  ,!   !)!!?D -b""eba) %.$7'S H 1 @3?@?@#$#$/( "" "" % $&/ XWXWX\(   /4 ( ( 8989 :7       3& ,  A D  '    &.'( E )     % N " ! )''' ****#* 5))h*   4u4v `4v**!"!")''*(""""* *0/* *.-##+4+**$43%%*3* (( ##+#4+     , h'=FG  K L  *)  2 K*I   V=G D9B6)* i `[^q ncl g  O ) c + bV a 2 ) 4    &"! $         4 G4 =   " !"! """#,*** +- ,!"!",**,*  ! -,!0,  &! -,* a w-       =% .    ~ . /.)*%+* * ***|  +    _.-!"-++-+++--."-  * 1  .    &C      ,.-+ HoGHGH GHGHy/.!0.     ! -#S(4-/., `y_`_`_`  (/ . . .!0.,,,,.,#  1 6     (/  00000 @?@  W30 / ///////.u?S /            AF ' 3 1  0D/02          !2     !0    1  0           A  v 65BGH       U   P   (,  $  >5 >/           p ,3  >/     '( %            >   ),'Ac'IA7\_[  1 # !          &*   J  EFMNcd!R T  M&#E 5jB  '@#  ! ' A7_J?!  0/0 '<   gP  EK          >  .:#V 8 %!)  P B   @ # @^?@@?@ +*(  ehcd     > / #F" *(  . 8 : +O4   <5 !      H/GHSGH      V &!/4 r # EFEF"EFEFE  b a    \sba   ( P3OP   6    # 0 H GH#  X=WX  1!   X?WX 7777 2#   h7gh# 7#7  # ******     !    6 666)  ('(  3 3    H!GH    (  ( )    (  (  ((************ 88  `<_`" f  fff !"  (<  i <'f    @*  M*  H-GH   $      !         p;op% % "  %         $ $   rr       01 I1  ' 1 w www +    $ H,GHЧϧĪê        0/0! !!! !  p*op1  @-?@  *  8478   + ) "  >= j\̝   ՝  %\vu$# `R\ !\N %R]] &  O O  O OO OO O 9      V2   ' $< Y;$ 2 K2 ^ ]^ ] ^     [ ^ ]       HGH>GH2j   3 " @?@?@* T Sn          x3wxwx wx4^8        704 X          #     -! ,#)  1  H$GHGH   #0  P!OPOP4F  "( '     ( '      - &   " "-  7T ^ OTST21>=>?>=     52" u#   !23/ ,  6" !Bh"   0 B 2  !DCF  - 5     "  ?  B> $#%k5 e   i /434   $  $#& Ei l    S    h 4 # 0D/0/0/0* 1P.!09    #&% 1* CB* q(V!0a ,#   /   # !* q,X**P**" 2/ & N63T 5^ 5r |  "    |m    $ #$#$#$#$.#$##$#$#$,#H$   #,  C 1 / ", . #,H i$#$#$,#$4#9$#$#$+#$#$#$#$#  $#$#$#$#$#$#$#$ #$  ,4TS   +             &4 )   5 - $ I*(i1C;>( ,42     +        $ #$  E m !"D $#$#$#    # $4#$#$#$# $#$#$#H  4  /. +  #'!7+4 H U$!    " =     $# $#,$#$#$#$#.$#$#& D          (4+   >+, eji  higj  |W  BARQ       v 4  <  A)R) 9$!    " =                    D   $#$#$,#)$#$#$#$#$#$# ,- @#"! !-4,) $#$#!$#$#$H#lk H%2 !#%   $#$#$#$#$ #$4#l klk   4   ; "%$' 4  ; $  ( x@wxwxT  STS) &-F?VS-. 2   ) $    4  W`  b a *  9 @]^]`_`)aba d6 +/$  *  yX %^]^]^]  P7%&_!      !    !       + $+  H]  \]X]P].+"!)8^&]^  O   Q+>2    1 DIVtC'+&*!  !     P7&_ p Z YZY XWXWXW PW,X j e  $, ^ +"   ,   ^cX] 8/,:/,):/, !:/$%:/( :/ 0/ 8/2 1 4343 :/.5456565 :/:,';d# EFEFELKJI"LC^cPm^cv5$efefelmjilklk nmnmpgd{|{|{ ? N+H1 '                "    `2_`/_`1_`._`x      $!       XW  ^]   878783  @ (   p>opxopopopj i           $! m'  h9ghF /- 0B/0*%!&f d h   !*' W^]^   *%     *- 2      Z -  WM}  'Y   `L  %      ZY + Z^*\)M! Ew   D:57+ (]"y   ! - 1am.+ (]"  / C L        $+!*>Z) / C  L  \. !     T2B ABABABAHGHGHG+*BA       "$!   -.-.-.+$      Q  a   ) #(     T2  + * hghbghgh.('*)*)* )*)   '------F?VS-+ \!42 @ ?@T?@?@?@.   ) D8  0#/0/0/0/0/0 /0/0          6 33  o + @  8-  *      4       (  ( +@  &%& %&    ?           L   ?      j"0)<""   " 9 !    U       x*wxwxwxwxwxwxwxwxwxwx&wx+wxwxwxwx#wxwxwxwxwxwx * +& ' N O    " #> ? BCJK: ;  F G. /2 36 7 P    j*!!     $!"li !  ),    2/ "$&      & !    e  !  / & XWXWX L  0 `j_`C    )      `|      5    ) `l_`C    )      b~      .    )    ) H   ))     (O(    Y *$ @  %c       WZ        %<$6  c !Q}?BO`(_`%_ji !   #     &%  %    {x$ .P&   L    9"1(~ J - :  ( !    (%   !     2   ?~ &    D         6 ( \9! =  T :;! V~ .-.-      !73%l-#  p@op( '' 0p/0            4     $  1  6! ! )) !   "       ! P F6>t   !" , 3n   7 8178F34 CFopst 1'    87878J 2 ='J     ' +  8    ,  (   5       (G'( '( '(babaJ       %  /%J 8078=  $        H7GH GHP    -      ,%b    _ ,  /     */ m  6$D 0I%(> (*:$"Jb aba mb    ) @ K Ka    b   ,7[  ,    '/   #]          % $  ) A  &3"*  K%v4;4t  6*5-d/  HGHGH9    6>"       #$/6%"          (     p;opop    6  6   6:   "       @;?@     p  # 4       7,34/0%& 6 565    6 [`_b{t{|wxmr [        "               `D_`     8jcdcdcdcd     j!cdcdcdcd  jcdcdcdcd  jcdcdcdcd  jcdcdcdcd  j,cdcdcdcd  j(cdcdcdcd   jcdcdcdcd  j!cdcdcdcd         $*P!  (  $   %  *    ! 0  7      $     & /-F?VS-/%%%%///-F?VS-/%%%%  EA            0//0#/0#/0/0$X        fn  `*_`$fH     Y$   ^%%% %%%% %     p$}  /!5    r$ <   .-F?VS.-.- %I <&8\ ,  `9_`&&x %%%%&  & pDop& " %%%%'+ " `&_` ' & H3GH,GHGHGH& . 9:-. 9          N $''      POPOPOP 0 A 0 A  (((-F?VS-.        v  v  2          2.&        f "0 /' '''-F?VS-' p* #" ' +   '-F?VS    y$m  F  e"!"!"! ` '-F?VS'&&&   J+ <;>|d/3,-VSW6A ,-VS  W65    X9 8&U  PG.-  "+,3*%!  B q  0  -Y  O   Y*0T[ :B .;</  4        + "!" !e$#&%('*)* )` `       ,"!&V %-F?VS%$$$    $        g   69 ,         ,&  V    *$  <? ) ."!-: $-F?VS$### #    DI             >= :9    65%         N   1*+       1;ZO.?  $    "!" !)$ #$#&%&%.('-*)*) AB      #  "!"!"!*"!\< ;<;%"!<;/"!: #-F?VS #""" "      ZS                            +>:             r"I0;<N"%*  : %* %<     #   "!" !$#$#$#*&%\( '('%*)('/,+ AB    H"! R"!$ #  "!"!"!*"!f"!"!"!*"!9"!: "-F?VS "!!! !      zs                                K^:               y  "I1;@ %(N  %$ "  % * C%* %<   H   R"!$ #$#$# &%& %('('('**)f,+,+,+*.-90/  A=   "    :S=>?=>7#\7*"!"!"!"!*"!A"!\W: !-F?VS !!!!          %8?  *%            "   2  *D03  9%' <        S!"?!"#&*   ('('('('**)A,+&   AB      #  "!"!"!*"!X<;<;%"!5"!: -F?VS                   ZS             +>:         lI0;6 5  "%&  8 %& %<     #   "!" !$#$#$#*&%X('('%*)5,+ xwxAwx   ! 3"!  -F?VS            2; $     3 D     h"!!   -.- -  @-  -F?VS          5  I8+0/         h! -k  8 7  6               "   6 J     &  l  n`_`4_`F_6        &       ,     iU .   TF%"-#9.                  l   n$#$4#$F#"  _          b  =  > . -.-. -. -. -. - .-. 0         +"! +"!  <"!v           !$ ), 36             &n EE}84}~}         ,-VS},-VSW          ,-VS K  $  e]"mtI6]#aN&#,+q/ET  ! $#   &36) .) =&  .     = >       "&#( ).+0 /4 1.85:9:9<;< ;0>?BAHCD CJ KJ KRMN M XU`]dcdcfef eh ijipon k r sr svuv u|y+ +  <v ,;     * !: -F?VS  F1    ;D :*dN    $!"!"!"!* %*0+, +!"  xwxwx    3"! -F?VS     z0,   3 U4>;       ! ]m"!       `_ 8 7`_`4_`F_65" ' -F?VS;  ? ( 5 5"   ( 'ar       d a    4      ' 3 _8 . j1Z"    bX 35&3(#90   $    ! ]m  # $#$#&%&%&%&%('*)*)*)('(' ',+,+,+,+ ('(' (' ('('('(' 0/2 14 30/04/0F/.-"8565   4;J     , +  n"!" '"!  `_83 8 7`_`4_`F_6 -F?VS/   .  .-.-LK5    '         4    C: . 1   &!%    ,#  :2&3*#9.      n "!"!"$#&%& %'(' $#$# $#$#$#,+. /. -,+,4+,F+* ;       :"!4 -F?VS-.      3 4..9   -       "!" !$#$ #:&%4 b  -"!Z F% G. -.-P  %J`_`)5`_`f_"!"! ?"!H  b g:"!7 _ @"! "! "!       L&VUdG    \&VO  V   ,-VSNM63,+~{   !bc5C>K 2121JI" #      .  *   * !C   !C     , 1 -F?VS-  !D      &KTV%W~?   xw tk K\H /-.$/#    !*     @   !  .>/klkl .el&V1   JY>' & -@ @ G A!G f G 8{Qu GH  d<% %S 3" +T].'# , 9.&1BL8@/ 3#   *" 3 #  +# )2&%EH*! $ %9'V3  +2 2#4   EM/R)C  -Z F%   G   P  %J"!""!"f!$#$# ?&%H('0 /b2 1g6543:7>;:BA@?DCFE7HGH GJIJIJILKLK_NMN M@PO PO PO @@?@3?@ % ) pmopopop+op opopop    'A 0 .Y*    #  " M-<) .Y xKwx wxwx0l^   ;  ! O90&[  : &[ *0%-&   jijihghg fefed c ZYZY  X W/)  '  ( %-&         P#OPOPOP0 !     (  !&. P&OP3@ ' L XMWX'A0/8  &/ }$!"= 5#*  kx    F      !{|"!"2fglkl '{|4343  85 65 CDC  | K 0(!   ' x  ! .   0/0    i l         !   P OP OP  0-/0    ~]$#%:   8 ' #)%      : XEWXWXWXWXWXWX:M    - '7# D:M p op}opop       ,"?+s HGH=GH2GHGHGH:f   %+ 7,P:f HFGH2GHGHGHGH/j      + ;4T/j HGGHGHGH`    ,+ sc1  $  28# 7 0# ,  * *46. X2WXWXE     g (#  4)-(* D $      * +     &  '23./" #        4SL (   *  &* D $   y   $+   s< % ! u(   " xdwx 05  2  !Q P!OPOPOP n       1 0 /0/0         Q  k  n  s    l  m  '  u    a        V  k  n  s    l  m  '  u    a                3  G  < {{| M{{| H{{| 8{{| _{{| {E{{| 1{{| M{{| H{{| 8{{| _{{| {E{{| Qj            X0% }~    !W  L    yzyz%    p efef8 7  z opop                E    ^]  L    %     . -               G         $  # # 24 ! 2 !   ! ) ! 1  !( #! Qf4  ! !2$#&! ' $ #*! +) .! /1  2!3( #6! 7o: 9 F K *       M     H&%&  !,  )('('8212  -8  54343_>=>  9D  ?FEELKL  GR  ONMNM1R     TSZYZ  U`  ]\[\[Mfef  al  ihghgHrqr  mx  utsts8~}~  y  _    E    Q     _"3 v <    >   *( ;*   I< 7 2     >     $ *44   ;  #* 7   2 7O% ?      ( v (% ? cJ  **J 6D  ) (     $ '%#  +  D G\  5 H          $!- 95 H    $   %    !F# C 7% M( !  %    (]W _ 8          n, 8 I%,>  %,> gv0   c     T @   1 0   c$#  >' 0/0/0"/0/0  c   E   0"/0/08    XNWX WX WX w    ( (L'(''    p=op& & $  &   HDGHGH            !  (6'(4  $    $(  p_op " . `H_`9    ;9 r& 5 8 3>1 >=  (341 >9> $       )   mD  m&)'*  k1   , 2$   .= ( 7  8   `8_`^ 5(  h[gh IHGHCD* 2  5 `=_` 0)  0   R  tq  # (,'(  P tqSPO #  :  D &  ()'(   P tqSP  # && [^  HGH GH&5 %(+&  {~  [^  HGHGH9 !&%()" y|{~ ","9"" :> 2    >B &"3J   0 6L  @w?@<6   e  l X)WXV##      = !+++++ Q TST  =yruvuvu+z E??@++ ++) L1 T J + .2 / !p?$+ *  ! H.  o=!+ + +++  $'&          %, 9#" ??@+  w   }~Z# "7; 5 *1(6'."$' + #" h j lp n L      LIJ I0 M  -  q "W    9    ,3"W  L ,     ! RQeG     P!,  Z   `F_`$ # f #1 $# z   3#8 (v'(        AB xXwx3      K             O   P&OPOPi       0-      ('(        0    r   ' POPOP-OP  M>C     6 WX F  0       o   6&5T$ HGH  *      p,op                          &  6C         (;'( "PZ   0( "   "     .  #       YZYZY  \e#hSV \W_b 0  $"%$#     +"ls tslsts     .  #      tst       #M \ / <  @#"%$         #     "dc    $kSL"   !""  @  B 2%G <  !   K0^     =.  M 0&,+, +,+6d .-F?VS.. b7&   6 HXGH 0m  " ! <  I"  "6  0   *#$#:$#'$"#$#:$#$ :9   *#2;`_lkt mneP    WZ    :A.?X"179'r'+U+,    R *   ,  # " #  Y /  B  N*#2  1215 ,-F?VS-.8#   56  #\     # 0n/06{)      K6$   6'  6"   6   H&GH63 6  6#       6  1 }    ,1 0./0 /0/06#   " cb  :  8# " xSwxwx6& 4   4 A  "&4 6       "!     6                                I 6#!0:-+"               6                                              I 9&"00=0,":"               6                   nmnmnm  IIHGHCD6#&*:-/2    pop6                           I  6#!+ :-+!          6                         po       po           I#$  #$  6#!#$&! :-+, /$+           6         hgh6                     I6#:-(    pop6                           I 6#!) :-+          6                         &     I& 6#  :-*/$        &    e6      /30        #I    I66 HGH6**66 I6 7     , 4  ,  (7'( 6L          6         1        /                           7                         ,    KL PNI   ,"% ,A<q%6 715 %/17('0  1      /,  "!&%&%&%('('(,' 6                                       I% 6#$)!$ :-.+.                 6                 R G 5 H G 5 H G 5  po  I 5 5 5#$ 6#> : : :-    *   5  5 5   6B 5      ,   v5,^ C !1B 9 5,  6F 5  3   T5 3b = !< = 53 >6   !                                    !                             !   !    ! !1(.!%!%!("* (,8+/+/+2,.;2$!            ! !  POPOPOPOPOP#OPOPOP$         j         $  POP"OP OP$      3,+      2#  8$%   $  $ <3# T  H5 % ' 3# \   %4   @I?@Vl !      1 8+788z8 ==  ..55   6 64 644//66 644.4     xfwxs     (  - N X=WXJ NN! ) X@WXM  )MMK )KMKKK #(M)N)KMKKK8 J      @9:9<       .-.-:  ) 87& DP)             @  @J?@@W '0 D HKGH@X      8 `@  !*4 *+6! ]& &'& '('  %"       & &' & '(' 3"      & pCop&P  ,  X'WX   (X'(!9 +!  (3'(5  X5WX T S & "! 878" !     !  ! "  & ' 4 3  4 3        4 3  4 3       434 3  43 P)OP434 3 4 3   4 3  4343  4343         )* XCWX4      3+! 4      3-!   @6?@%%&  % hAgh$&$& ) $&>=JKJK$   ?7$#$ #;$#$ 0zLs  B?      f]  VY . = ^]^U^           #  9"?K   $      8  *&% H  .5    (' N XU   3B  &   8 78- )      '              9   +           M"1            O%-  ."1  *D ;N3*LQLI !JA<9!:341 , 7 M,     8H   f@  +   #"5( &5(@ - ***D ;N    3@+@'X  J)    *2 )  @ @  p.op op opT       '  N'  $  z 2 +  (%?$*(    z d3 4g HSGH .hn        !    6.C U  V&;  Ya0p#3$ #$6        *  )2mp    C"0s:>  -FP z[;5;\0@\1a9;\:1;@1;0;1[25D[;J;nE;[\@10a;\0o;\6[1;e\;;@;1;.F+7+0Z)Vo$)$V  L /           z {FG n o"#  J K   3    RSN Q O./ ) :;1    r o s]  !  B G C 2  3 Z [ [^_ b c    &}  !'     vw> ?jkf e g V  W~ y    6 = 7  * ) +  - .     $$& &% &% %$&%& &&$    $&&&"+ +&$% & %&%""&% $&$%&& &&&$<!-!/X/rP/  9 =  0  - .$ '  !2$#)& ''*+ */+23,67 6;3>=%@ A'DG DKOF^   'I        ] 8,78 78 %(  @'?@?@?@J 7>=DCJ G       /JW -`'    x3wx)wx 2 121 2$12 4 ' , (  hJgh gh~  1 0/0 )7O(& K)'2121 2$12 1   q=ql g 3k= qEJ    $ %"2 POPOP OPOP# WL  "G POPOP OPOP% Xj     $7<( POPOP!OPOPOP^0     B POPOPOPOPOPOPf      J POPOP4OPOPOPOPP   "   QF 4N l$8#(     d\ a  #  chg     hghgh  Ny"L       &;)   NU B42123434$34 32K[` ` 878!! '! `6!21234$34 1!  q=q[` `= oZH!      9       ./4387<;F   87<;$#(' C D D DL V ` j 1 '     'feB   # h>ghvghY]V   &*!// highgh~  Z+A  XWX MNM % e?    mnghghabab                          . . .Zj'      %      %   k   wH  3 POP '   R 9@?    7 '      :M<?Z   :     uN<T/- "   fa %278  BGH$VU   61  %TO*      <  z   B B! f    ,   >    L '  %  G          h           Rgfa`[\ Rgnaf[b   *       .     . * PO_           % '  $ +  =   +  m                   %         EB?-7S0    *.  +=  +     \ Tg     !4#A P%OPOP-OP OP     # O  4Q34=34NL   6=u   jg    F  T  i  ' Q= 6  G        .            +=+k. A  XWX       !*h           X0WX   vj   58  48   2 1b       %&    E  49  43('  *- @             >H#$ =     3   2 1b!K  PAOPOP       3%       PhOPS A   \i=  / 8>78     0  @?@?@         zc f ' @o       !   "% L ~8 % @  A    )  "n7Z   .  ('     *#q2 !n &  3     `_`)_`_`_`r:      -   ^O& r: popop 73  MN       7  | 73 `W  !   9 + W y   9)   "    F))  ST QRgfa`[\   )Gy   h5  gh .=>   &Bu  ,    y3   ]gh X-.> < ,    N.+n   qrmlgh !  8    K & &|K  POPF " U%%P/ \)  Jl {|/QRgfa`[/('* CW    POPF   s%L* W%  N <,ba ^"_%%,'  7"<" X_  +    '    1 1UAMu'A  0u/0/0I/0>/0C ba^  _         X_LsB8& p  $     -  $  ' )$ :  ?  8H7878? 878   Q=* ^  A6FA=B;;6565656     Q=* n z      >D   $*  >D   HSGH     FF  WZ  }  v P      NK , :7 ;*' 7 {4^C$?d  q  Y  PW !  `] 8X78B l 878     878   vdhg .  J > d    (! !     # X)WXWXWXWXWX  gx     ( '('((    B   V n vu HDGHGH  Xuvkl QRQRabMNM 4 #         0-.-.- 4/0!mvl 8  9  A qY6?1           ('('( #('*),  1436587:9>  "   *D:X . & V&U $     N 34    P OPOP OPOPOPOP OPOPOPOP OPOPOPOP3OPOPOPOPOP\          .-&    /6  [b    %Y   "D  -& 3<   u "h3$n  >I po5lkD% "   6D  4  (B'(O0   @ KR3    1;d    l=;     *     S                     p     ,     *     <2         DCDCDC    D-0=>=         .                  %  &,^*  S(&8*Q)7*;p5 ,  * ( * S                 A  , * <  )%          T>G C     2 rqrqrqr q r qr qrqr qrqrqrqr q8rqrqrqrqrqrqrqr qrqrqrqr qrqrqrqr qrqrqrqr q rqrqrqrqrqrqrq            nmru               Xw !-'2,U9F                           }Jrqrqrqr q r qr qrqr qrqrqrqr qrqrqrqr qrqrqrqr qrqrqrqr q0rqrqrqrqrqrqrqr qrqrqrqrqrqrqrqrq   F?@9:3 4  F? @9:3 4( oJCD=>7 :KNGHAB; <MNGHAB; <MNGHAB; < " uvuVOPIJC VOPIJC D YXWX%1210/TST\2-9N{D                     (, .    d   .=;L,  , * ; K&        %         (&#G**;"  , * ; K fn  *   F V UV UVUV UVUVUVUV U V UV UVUV UVUVUVUV UVUVUVUV~          & 2 Vml@          9A>i  "$ 0 - &                ,)d0-F) $ 0 -  @?@$"T ST STST STSTSTSTSTSTST STSTl      &G5     hgh"|       "h 3>W $ - y"             )<  -<! - y hdgh$qR    4 0V/0$R QR QRQR QRQRQRQRd    &<h     @r?@?@$$R QR QRQR QRQRQRQR QRQRn       &-:     popopop$R QR QRQR QRQRQRQR -   0/0   $S&a^k(i     p,opop& )    % ) P2OP&?,   05/0&POPOPOP O P8   ! G    x@wxTwx wx+ t.        9 9!+ t pcopp`  " ', nmnmnm   H5GHGH GH /"F   O52 /" a** fe #*!n  HG BA     =J         '  e @?! FE!P B\!,&)-*0('     #      *!  8V78  jijiji 9: ;: VU\[ba  C  popop  vS   4      $*  *Q xwxwx 9fefe$fefe&fefeI :?<?2747  )& 9$&I  2+  ;     E M  u  P DCDA     &&    #  < 9      6 ' 3;EMu pAopop   , , x[wx wx  O    F 2  -O h>gh ghU   * , 8 7 8 7: 9 : 9 &% PUHMDILQ <A@E05498=:9.(-,1 (% $!$)3B      )Q ; /       &6" xNwx wx wx wxBwx wx wx- G-ji (), +    :C  H;; 4 @ G- `U_`_`_`_`T      F- "4< b a"34   " x!wx6wx3wxwxwx      4  /9 %  P OP+OP   3  *     { x   b a ryDz y      f)     9B   GVUX      O ` _7  QGB&7:!bG     D  H6GH GHGH   #$ , PJOPOP#bab a4  j# 48# 8$ :565!$  [  #656G56#!$#6   \U8  87  A/>CCC [= 4=2W3^A_ bCc m 6A7:W;LCCQZ[h>g x   :    "    ( / #                  #     # D T     X).'?    o H  ,   B   ,    Z 1./!$?![  G  !   `3_` _`<-.-.- .    # /0/0/ 0(/0/0/ 0<        $8(" ( <>LD    >8 78 7878 78787878 7 878T      &2t      p "      N S  =  7+ a   hWghDdD   'D212121 V   hHghFU0  * 'FHUJ2   .==@?#VGHGHG H,GHGHG H,GHGHG H/GHGHG H(         .      ((+**/- , , /  HgGHVtt      K POPFV                             ,'S@        ZKLKLK L)Z?,   Z  :    XKWX WXWXWXWXWX\rU V U V!      N U V [ :;3BAr   ! q\=343463^  XWZWV,I'9=6^OPOPO P(OPOPO P<"         @b?@$^     J      ^LR     .9 `QRQRQ R(QRQRQ R6      $2( ( 6`LB    `     R       .EK   0!"!"! "4!"!"! ":!"!"! "k R) *1 .   Hwdc"<; 3f#4343" Y `    eh        `_`_# &   # (e: 06V4:DFI 4 : k G     1  xwxwx0) * 1 4    *' " 8I \8 878$0F EF EFEF EFEFEFEF EFEFEFEFEF \ [b ahgn kZW^]dcj iDQXW^]     vwx&#V         @?@?@50F EF EFEF E FEFEFEF E$FEFEFEF EFEFEF 8 7> =DCJ I63:9@?F E  $#*)0 / <QRST&&AK/     $  POPOPOP0/ I8    # (Di{(/ I8b'STSTS TJbib   X7WXWXdJ  % "    *>35[d;<; <;<; <;<;<; <;<; <;<7;<; <;<;<;<;<] ^1] ^.] ^] ^] ^] ^[;< ;<;<      .$#> k[\qryz PMi>W MU"j } t 1|yV yMN63  +v  !    B       J   w#+ 0  !  zC 8q : Y TqDhXJR1!O0 @ +j    7  1 .    [   w)   d) $ 0   9 P;<;<;<      "    )    ) + 6&8 Z00':'*)$ 09 P       n]72F,-, .d      4! ' ''7H 'sh m! -*q6wf-VNI#0.   Zd;<;<;()* CB?B9 . :r%'D '9#$   @#? ]  ,<ON"9C  D 3hX^L5          &  !R$ #$#=&%A( ' ('6* )*),+,+ ,+ h8ghE /,'  XWXWXbWX&    <   *:       POPOPOPOP# d     "T  %""  3"      (D'(, U0     ('(  &     `_` /    /  0. /\ufE/ u 0   F 0/0 % %  '        %KF    &  0/0/0"  " hgh      [ || q|]  q    7 P$OP/OPO  3636 l@!   `_`_`}wF   KR 30GJ# M |J`/! $   xwxwxwx>wx       )< qKyz    + - 1J 1 6g   #  7  ! 6 )7   v `&_`5-8  4;8 HGHGHj %$   7U1CR|"V, T =   1"*2    0)/0"6N   $ HiGH#GH"b !,+,   H.'s- `L_`_`"_     8"h   V+Mh  @"?@ $ -   (Y'(N ('( N" * 2 : B  POPJ R b  z ( 0 )8 @ H P X ` p    POPcOPOP+       ! v# P!OP OPOP&h   % B 8 78Q78787878y   R A hKghghghggh$gh$gh$ghgh`  )* &~}vuvy    A\kl + ) ) - 'lkrorc   ?)f2 +  <  /  `(_`R5X %R Z  xwxwxiwxRGHGH,+,+,<+,x   )*%y T0< * ?R   @@ @@~    @9  ! - @: ( "A0#f<  - "%@ u P(OP#fW    "+G 0/0/0/0/0/0/0fQ   0< U5-+f  L HD P< CD A J SR g     xowxwxj*<B  %a#4*< 9?+*jCK  `   )  #&&,(% m)$LCK   popopzop jM?      ( k-M? 2Kj      P@OPOP OPht>     !fE  jh    h  fcdabcdcdcbadc Zf  T,    @?@?@?@h2]^+]^K   -u#e2+K @O?@?@h`  , 3   (,'('(h   0 01/0/0/0/0/0h+  (    >+( HGGHGHGHGH;GHh  1 ! ,#k% ' 878G7878h]^]^]^!]^]^    @(+I! POPOPOPOPOPOPOPOPL8         l D  9 3b  ; D?  ,l  !V 93 D*)*) V'('('('(  , hu       Q) <   V2V  3HD7     5       5  *     * Y R YN"-  JS{x =a# 5   " DG E      C  D WZ    _D(  P%&    X   9  / 0 #  N   uv = 2<:    - " ?:     X  N   B9  +21 3  P    v X # E  D0     vv65,+ll    ! \      !)$#$# 1D&I9:9:9: %&J 9:9:o  .    b    vl A  !4?  -W# xlk!   -l[V T -lQ   b    I I * S+! ]V%/f4 6 EB   H         I   "!$#g  lD      -  9:9:9: 1 9:( 9: 1     3<%3<% m=! $' CPDD, > =      /&             +       (      " (  <               C -       0:7         +@34;:m2dO:m$:m$$ :44  TI\gS T%TI\gTS   I x  7=}M%+ -|sL'- =                 +  %       '  ;    @! D9:9:9:9:9:9:                  `_`A_`_`_`D      9:59:  9:49:9:9:9:59:9:9:B9:9: L;  -     Y<              YL         A     1  , , -"#&%('*)*++,+ DI9:;9:9:;          N ;X I;; P!OPZOP2OP OPOPOPD      "  9:9:9:9:!9:9:9:9:9:% GD    ,                 7+`/S    !% 2D9D 9D     9DC:  # C:)           p  p      fg   " e            de[ "          D( )9:* *     v          )|+    )  **   D69: ! %&       %& %&9:9:9:9:v          , F&%   [X                     (     , &&)     KR      b.)    wqw_1W  El?, oU 4 6!     g   v !  ,D19:> =9:      ,       4    "5    G*E$(f#Jqy 1     LBD!!D D*   (N'( D./0/0/0        6)8     hogh D        , O!) X  hghghgh[ghgh=ghGghD         ba   0  L 0CV 5( : %& 4%  5D#   D  (P'('(6D% ; / 0         5 B       0P/0 Df     @  &= D C:  %&   /& C:9:9: 9:  ? Y _  vl A   x '  &/F-4p      !D  )%&          *%)        ! #+#,C5&   % D   +,'4    8g78D    *  "  `_` Nf0/E0/ f       . 7 # ;06! <E N PmOPOOPN9/ 0 lepovwba x  qzw EJ6_s  G,& V?N7/ 0d QTMNGF[\=*C :10C#!  & ('(o  x:wxwxYwx:wxwx~ 0 '  !" %  34  6   G    g J,5'%+%C  '  j ~ L K J IH GHKLM& %% h3ghQgh      %a p/P.+21  b l ~  PEOPOPX    = +! +     v   Wv)  .+`    bT*!05  +  h #6   bX, p^opop *z!0     S"#, (~ y !0 6 R##Gy  popopop9<'!0     43 ,.'('  b1!W9<% @Q?@?@?@* )$O!0D klQ T  V#&, $M gbmw"   qd  9 88 <;@?@98 3U W b r  '  1 < L $ q h|gh"  (  M!"BAy O  J!S  (  "   _!"!"Ta  !  "    "    yz' "   +21    "!0  C%    ? N&45%" i ^ ]  z +21 MTU   z y  h i z ev         '     !) > ~{|     "!"! !8!&FE    FG  4>$p %""        !)   !&  !!Pr  & 7  ,    tstsnoot    4 D9  &  !!       P6      h;ghgh4 ^      ("#       ! %*4  PIOP <  :    <   W  T2 <$P $= $Z b <;G] RMLG ZB  :=*B  POP OP OP%6    $A X@WXP       ' $  @Y?@ 5=t (    @    =    m !  CP.IOPOPOPO POPOP O                &#. $  C.H    KP,IOPOPOPO    h       '    &#.K,H  i+L !     g/ #]?i+L} "  K\  .    P, 1 G B A 878POP OP O 43: ;< A    @?@?@   ( #  ' p; $5POPOP O     52 B jg ".5 8  5 8  E?  = 0/ ! !$5KK        @B?@?@Z  xXWu  K !  />u H)GHGH    X#WXWX9WX   4&- >'    ( ! "  r55  5     *   4 I:! 0$+5  55  XWXWXWXWX9WXRQRgQp           4" gp XbWX  BV J       nmnm       XW   6  6 48  1 E)IB#' (, " J                 8 J       nmnmT          4   4   # 4( Q E#zP# "/C " }J F~T L               8 0 QO  $*+3.T= 8?78    0*?     .-?                   s  9     0$h >P O nmnm nm        2    X9WX(WX"1   )'   ! "1 "( x3wxwx%8 $o6(  j A"` !- +,x   @>?@X  /  8        "  ;  O PO I7a 6QQR  300"  '  &%&% ") ! ,#  ! F ! )N      +      =  /0`?<V.3&     xIwx%wxwxwx  2   %D K6 a     x  '' -+*MD((  pRop_,(  !(  ){3|'  r  @=>;         2  5 m!)  '    /{A|              ?o!/       +}~}~{|{:|AH}~       yput{ruv   M3 '% TcM30 3+# A    H   pCop@op  7A %  h  >   H   3 + tX   ' !+  {   C   <  p -          "   MC   <   1 2,     xwx G     !! j 5 hlgh4UVUV6  - ) !< 46 p*op        *    `_` "!$N "! `R_`%   $ 7#/G  f  !    " W*"2  S  UVUV21ST  1  rq    #  -[^  5 ># -  a s](^+ 1 ?") * h921+   (i9+ `S_` _`j  A * & @A?@^?@^?@?@?@N121212S121212] FF%@< Q8 8 $S] yxST  T%xx    [  h  "    gh  ;6 `Y_`_`"   7 &   %    @C)" 7 `  ! ]     $!           .TB 8O7878 788  gj   ! ,38 XWWX* "  ";(* "  " @X?@ q   %F    _                 n    8'787878" h gb        E      p            8t19&     p o~{   !  -:     hFgh       "+   (        hHghZgh}ghPgh$ghgh @  ? Y @ C      $#%   rqE .   vu vurq rq%I  @b=('# +i@  ? Y @ C   [  I     !    %2 1*%0.  `_`{ ~ { ~{|{ ~ { ~.-.-  w +{ 4FAX~  + 4PKX " $:8          h : !"!"W eh C  G  8 W XWXWX> )   v    # *4,)    0_/0       {d'-  `    ('"% PBOP:   (   #$!F(      (6'(HF     H$GH  jgnm    HGH GHcd# YZ # kl  }~    cd    8D78W & - $  .   Y   h    Gdr QR|*% QR a>A F B% QXgHK P      )ef   [\  =R&#i4c   h('"%   0/*-    0]/0    dy  ^    ('"% HEGH  (   "!    0/0(:  B   T  xwx;      \ ~    4:x        (7'(Iz  , LIPO (:'(  !/ ^+ F |   '0P      _"mkV   d$   $  6 w w    q=qw   q=qs     ,     ,.   9>  "  f3 s=  w=  $    B >    )         7   =, '   >\F!(#A*  *"R; " ,#07/0 '0P        _ "   m"k!"!"!"!U$%( '('('(' * )*)*)*)d    XWX%%%    0ADT"mkg  $  ,    q=q8 '(  zy        ,   !*. !" 7:    f    2 =  A 3    )           = %&   '/ \X.GF !(#Od&"q'3 ',58      0ADT"mkf   %% \ !$#$#      t     $  W+hghg hg HQHI    P!    XcWXWX  F@  1*(1  FVrt PHOPOP)OPZ[  4   +,>f)]V]  ;9 [   Zx ej&   )h   m 1>H  0/0,/0/0\    Tu(   )  +   B G 3  #- ,< ' (,4"X< \f       " N-DSQ  WZ       #  Q; 1   $        + '  (W4- '0#               -% RK:E$- ('('('(8     cb  # 6  0      +   ;/'-TeB -T na         !   !!$) jT POP      !"  1      5#e     # (* 09/0W   1-  1 G   )-    "~y "   ^    #(Y   f h LG !   H   ''F  _  'R.QRQR QRQ% I o&%&%&%&%X     (#$         #        .#                 $  $"$  - 598*(&* -'. % I       o          X      #"$!"!" !"!  )V&%CA DKLK  P)Jv.   I     nm   $$$$!&`S   "<;    `,                                              _       )-     H  e    #    5    '     ?`9  GJ : (4     "  Kr% (  / %    &)CA  !"!$#*)*)P,+,+).-.-J2343v6565-87>;B?FCBJG   43 > !0 .6! 6 ,  9#z!  9   03  43p  !0      &)f :/   . x    u  )4* 878278E  '  " /E `_`"_`"_`LC        &K &       S  J% 9               nm      nm       nm   !!  $#$#"! ('('&% ,+,+*) wR.QRQR QRQ   /           95#  A   -  w.      m ''$G,5                ,     ( v    QTSR QTS   QTS   [ 5$ d,2M%   "'$G,5    (  % 8A787878   2 :$40343 30343 03434 43430 343 !"Q     . D     &"   m       0    9  5 - M,"0q         "#  :1 !"  2   jDyZq()*)*-F H1! ?RO?# *liJ   A+ *+5.D J A#  (( H (#hg"2%3  c q 3 4  A#@  1            Q  5  &  7      #TOTSTST STS"  !        8O"k"     +4$         I  S     #8 u   ID k9i_(1'g"5 A N.4YO \~- , 70   # GOZ=              " v! @ C +'t  @     !  I]! &&    W          K         "u  Cc<   zr2@3@ A] _A)nP&2   } &  VL   )  "   5  5 Q  5   )  <)  5 P4 G u G/ @ &~ /q   /     W^w                -  E1!Q(5 ( $-EF A6S *j,  7{H[c l,+6,+; +s  ) *  4. V)) -sv* n# C_6a13 :4$ $8 ! 1  ?\ l    2  ;  s f,5 \[  - 78 $# "       0'W   2t RP:5  7$Q   #  "R/! 7$Q U    T+!    )+   d  *)     *      po3W_f(`fa e} PO3w?F(FA ] 0/ 1&(C&!>? 39}(B  G1%e   ,  %        ^?$jxk:l#< # <#E#< U$% d        | '  >  G2 3     6 7 (G&% " # :;. /  WGB,-VS   1    I0p(-N  5  R 5  ' z-4 !430303 !"g % W "D        @?@!?@?@Q  4  E, $!" 1*,. ;   1&12), S 8XE.Q9E, 0*/0  QTS!  (''('( M (3*-   6 "   #   # 8=7878A   v% -)A H0GH:GHGHGHI !     ! UI  U    .!    2&O  .# !     !"   $ " %  $  ">"     "    t3y" '    85NIFE   2 ' ! !qr 2)  (  *  '' &b 0o *    $0(T'K'  0."%?$c& # " (4'('(Y$       $  %, #  )2  L  '$#1s]$ $$ !       -*& #1s] popop opop-opop-op  j%  % ,$ $ $ $.. <3C     j I E%    ## $$$$ %&%%$$$  $ L  -EEI E     XWXWXWXWX!WX#WXWXWX{S&    <1 %%   sME{. a[  XK9F' &&('P '&&&& %%"/ && %% &&&&QTS&&  ((     ! @2-! "7   Z8    W ~ ' *    z   0 / =    ]430 0 343"9( ' '    '''"!"Q ('%%%((  'u  "83 G   :     0   S%+*430 0 343/( ' +  ((2# XUV((Y ((((((((   ((("!"Q )(&&&( 'j]Z(S3` 3#!$c$  7  ; "       *  / oEK )  / )) (( +  F wY1  = Q / 8 1D^ B* 4-    ))! 4l 2N ! "B =E: * **0**** )) % (I :  ><2-+ ****''((''*  E8 2-  X+%+/ +  :7***+'' ************ -. +++Q,)) #(((  + *  +_(!:I%      +       /    ;, &-$?") ;#7  ++ "  W * ( " 7 .; "!"! T. ,,,, -- --- f k @ T i . -- --,--,-- ;<;^9   7>5<;<;<*  + R>9 in o@! 5   7  ( ~"Q#! 8'  >K L     #a    ).-68=.^&  POPOPOPOPc: +  I>>#        )V           "#""(      ) P,OP*OP#  +     "%a+ xywx$wx   ` "g@;:56  g8$   $" o      8A78 7878 7" [^]P     K!'!    @R?@?@ $I" o.6 A "* 4  -&?   C!"L Q -! % 'J-&? n5`   g!"!"\ q    k   [( 5`    ,)  J,W  ?%    "+> .+,) #+ `/_`_`DP    DD aT/p o[f   7      6-  FTS   F> h  h ajF>g   *.I 16.I  -.+ "- "- "!87 .-$% ?  (  .I M<A^l+/wb$#3 / [E       " h gh-ghLgh       "  3V0e 8p7878784        0p"Q : !0     6!V       04   xkwxwxAwx wxwx4  !0   +  2  6* !+& * 34      +,+,+, r    D A!"6o"D5#$ LY>$ ab#O 4 W   ,G[\   '  *9./:7 6G!$?651  ,+ @=> Q   6  W W   2 )  M[ &KA   }"&O(#ZEh 8? )/                   rD 4  BGH72121&7 6!&    7 43 4+  '5   0TV(;$& 8`784  9   "  < /  I 9 HXGH4 -   !" L #  !#-4    "  `     4    I  .      Ni5U'   I  4     7! "  !0         xwxw ~    D $['!/#             7 !    ` _`_`M_`L/ !  (v^]^^ !< _"             hPgh/ /2 = 2+,1 & B:N>*y p h*gh/ghm       .S 5S  . h(gh?gh ~   %e 88t V          a4Oqt x0wx %  1  % x wx- !     }  D    h O   y  %    LYFE   0+ 0; 0; 0;K  xI tstqr   Cwxw)w,h o    NMNMx  -h.  *  PSZU  S-   0/ @? <? 0+   0+  [ " 47/3L& )X:*L-Js$6ML* W#'&  d G        }       B   J                     W W4     $ #65S zyzyzszy21.1    DC    C60C 0   C      *"     -   & T  )  *2+     /eT"-""!NMNK&%4 "!)B/"NMSzy % hg#vQbU-+ F_&"$,9,2O+r@HRF.V>H?SK92*?IB+)3L5#4&=V5  = R  -         N 7 %8#&7 DR>' *(  S0    DC  Z / ',!Ud5 0  P G      6  L %&%&J%   &%&%&% &%+     "  &   `K&         7      +         *$G&,p  [ * = #W3G6 L %   J                    + "& Mk  %J " O\ .4!# v    1 #)P < V  & "    "6G  893 ! -66 +GHc -    1 mT  mt L. W  +  j,: C +% ( &   "   !PWA   $  $   +P+          \! lm!C A4 $< :    Gx @ x    C /0    %"T   6,' -1 }ENN @ x a"J[         C F  %0e-# %J(  J"$             CY  ~#O-)o[K$e  r   %'E -         .aL M4aR  03     4 %4   < `U2'I2 $&@ <;  .+,+ ,+ ,#$!"     1 11M+N 3EE @ u) & #   0F&#  4  2'Op    %   8  9   .A!+$ :  v     T DJ  $WKL} " '* %    %&L. W} gD &  #  ) $'++  7$        "%%"aO =' hIghgh]    ! 3#(MNMNKLx |{|{         # )$& |K( 92x n6bIaKL  <LKG YL 42vw vu w n >M\LK     ' 4 9'Y  $  61  !     '$ -7l;S"`EV"1C "Ia bU   %$   X|WXb    C  1 -$5b  b;J    DCHGR3S Jm2,3;J   `:_`!_`_`bn  " 4    j'(!0     (   3#!   ) +  T.'2@j+(L k2j'(6  !0  )    67 "7 6   0;/0 /0/0j'(4!0    #4 #9 K Y","( '01:;9   R&?6  #     K '!.   ? >;`_65&4 9:"}HTK   GH 2 -W=h.  [?RS*)$@)UR-nmnm   6(N @" (  9K#M.L  N ,j/ #&       ?POP }x{  `_`(_`_`J ! +&&'$  47?";<}|urke    UH nmnm  " SR;:ihsr -.  .  I ) J$I ^";Otef nP                ? | hrgh"0   P #="0 878 b , ""!()0   03           , PuOP 3  "    & 9       `Z_` _`_`_`i  )  6 5$7N 3  "     9       H{GHGHGHGHGH   hefc  f&a!{ `P_`/_`_`_`z"    &1!z @B?@  "!"         @    "    !     X9WX:WXWXWX WXWX    O"4c `_`  *7)  -3, C7  *7 POP  5 8   !c  \ 9:34 `      6"%+   2j\34 "&! %   JP( X\f %# pop \"  @1?@\434 {  4\34 3 `If    &`" `    `x A    q t! = q# &  x A`` uz:      [ popopLopop$<6  Q $        $  ! .#26  2 $      878#78 9 4 31 2 4. % - R      4    - 7C/ l"!]$#$#f$#0&%('p !! dqEVj 3 W  k      9       9       _QM0 A0  M T } E&3 W     k 9 f +        ^     *              -+2        -K/DcU+^  * hrghghghghgh  GPOPOPO   '      "3Q/ G Y        u  :  &    C  7  -              u *)u")i)$#u"# vo LK  ( >3           -  %C* ,  ?A'  (Q (%M    X  %h$ N  # " "  S  . #   !D .LH%  P(w) #&'%)% #, -!0 + - 6m   6   -        3 A  2G  ""    2G A N *  %    +   -       -    ) '  $V (  g+I3>2>(5 k0 8/2+           '   $!* ' !  4# J3/% 11 B %! 8/2+ {  *   2 %   '               ? = 8 ~4DtKM ZJ  Z  *   * #*" z 8%1 A' %  Z ~             f      3  (; O P' 2O P O P3O P (          J Q    pi&1  I B A z A T 3Z[ o r D[p s          c 59I;  '    2  3    rS,    7     r30 kl=k D"E ts n  8'P  = r30H<.X  .^`   .'     %!  %;  HGHG@G>         #'M)=  8'  . .   =!"<-2-K?  "   #!""-K%. -..!   .            .%  HGHGH.@   .#  .0   ."    JV      3 % A       N E       8 /     I     *)*)*)*                 ($X&$ 4%ANE8 h\ghE/  *6    1E1### P  !^ /;=A:7)/)Q R   X _2  ,8*3     o$T,&T  "  & ) )S T"   T [2  ,8*3      HGHGH !"+H &    :  0./0/0DB   F V  Z  3% j  B =)%   4R34>34^B   o7to>pi.  +  R>B  X"WX  `?_`<  "  < 8F7878X  3 0  8D7878V  1 +h       8878 78 QR !  X h ! n   R>^ ~  a7fa>b[   R>  bK<  X     ! +] ` s v  efK)`  787 :!' X6;J   B +ED ]J#  5 X   ~         !    % J   :  DH OH OPO*)       Or       43 `SB!! `*    OP U    7 `k  % #} Z *  GV.BdvoJ :D     *         Or  $ #(  hcghO E J :7 " g    }Z %?4 !J     -VU       '  )&   =0/   `X_` 8      " 9 8 high ;        #  O ; l3:3l6>  #lN H&GHGHl;       l)* !0 #  /    7  ;,ZR l-* Zl|       R! ) lY)*-*)*-*% &%&[-*;]^]^%  %#"     <"!"   $ 0'$ ++/ 0!         # 4     /"Z%    <ER $/&&=Y   [  ;  p7op oplP    ;     lCH  `   `-_`_`_`l ,+     c,)!          $0q:T l X(WXWX    popopl<   !  x     7'  7" cl}   BL HGHl 0O/0/0l)*?!0     !0? nl&)*)*6- *)* -*-*Q-*$!"      "" 3     $  *N / & &6    Ql! lRQ   lQ)*)*)*- *)*m &  !"!" *!  //2 Q ml5   jlLKLK`]^[\'LK)*)*>]^ [\U]^q 5  !0 -     5 < GRO %D? " D# &I0)$!0#H$D>C`'    > ) q  ol  #5 Q "5     ] !!0&5) 0  lLK)*- *)*n    !"   -"    #=#"   nl# # AlCD]^&       7#  & `d_`R_`_`l)*  !0  - - /' !"     P     *        : !P230 U  57- P;OPH   !% .  ( .  !  PNOPOP OPOP"OP OPOP #  !      '0 % < @ + !&(~  1 %   =     IV BE@C    Z]X[   pop *|& .L POOP\  % n      =)&  /< . 2?  1 @_?@?@?@z  4/0 ? <-PJ `  B * # xpwx$wx3 .343.K3 .-. y +{| }4L  4VQV/   %  K     05/0/0 #  U X, # jO  S   LO .       %   A 4o  M 5/  1:D % ?,,D! 8-78N78        O &,2 m `:_`:_` _`_`  hk L '! J, FS   1! hMgh$ghggh gh9   !     7!` ;L) Y 9 hKgh ghghi  -  q[`7 278727 212 72 + +V-.  S4 M 4/4) 0   !%=  4 '   $+         X$  "      ) I    POPF T]^ _ ^ o%L& W!  hghF T]^c ^ F!&D@  O;  `_`F T]^c^ C !&B4  M/ /  (Q'(? @ a9|  (%,% <  HG  / '1 M ghk<)  { |y)   7MJS ^ !  popop" %$   "  %$       PwDX  pop   &#     rB A9  ?+ 036#256 )6#  #6#  uS7  hgh %  ._)    ('(C  qnqr ~}e tN       xwxwx*      (  W6  `_` LOP K J IH GHKLM (' 44 x   E`U V  _V _V  5U VUV   W TS YWX   "       _?  L.:  =     5  ` <AB;BAHG:9@?FE    Q 6 "`     HGHGH` z      +,)* -*kD#     z  xwxLwx wxwxwxwxwxwx `x  l       0  E#d x  l POPOP+OPFOPW`     $<( XKWX 9.9 '92-} 8   @  p!opH   P  X  b r  #z .  xPwx wxwx      B   RK  PW"/    @?@$    -25: UZ]badcfkpor} )! ! ! { 0  0 ! ! ? ! l 0  ! ? 0 ! ! 0 ? ! ! 0 ! ! ! ! ! ! 0 " " " | 7  1 " " @ " m 7  " @ 1 " " 1 @ " " 1 " " " " " " =  `9_`_`_`_`     bf !F xOwxwxwxwxwxwx   zqrng   b4,99 ! | x>wxwxwx wx       Q H @&            i)$Y  '    H$$6    n g  b .- Y  H ab   op  !MJg;o!<!% &      -   $$~  -  6$$  `_ ^]bc`   fejkh a  `c\]ZY  X[TURdaA!)!( -  6$$ M - 7$ yxw|{xwxsts xurs  rspmnmjij   ~}zy y  x{xwturqriP#!' - 7$ M9  N      7 O8 . V 9   3Z    1,&3 XIWXWXWX x   '   X&WX %  xuvu `vqz   4R4   V& %&%&%&%n //////     -          <- V n Q;  "6 ; a    4& !"T[E`C + ++*"P-y-{- #* -587 FEH      *+ ! */8!n5 * 2          !"!$#$#4&&%  p.opop--   #-  popop op op9op op#   $"!"UN ^R !     'G 3&- 7 #    h `9_`_`)!0   /!)t        S!6>&(!"%      },+{,, |y  "(    TO  $    I \N3.  '   !6>(        U! 2-   (!:     # :     \=  !  3        "6=  Q \= B  NMNMNMNMNMN &NMNMNMNMNMN  T mp  $-    3$ . A      &    T kC6NMNM/     1,,6/ PbOPHI"j      &  5I"    H%' 1N   ,,,,   WXQ n    %"    ,, A *"    .%' 1N H HvGHH/%&)&- )& !ol"d-Bq       5/  H- -<H -- XXWXWXH%&&!0     N!9&H)&{ 02/0/0H%&!!0  '" !a ("((H +,&4 3L4 34 3E  O&D?     ; @?FEJ ' #&% ,  /21 8  A% t O  E"Q+  & (          6  9 H +, /   =   " < 3:'F)  i. i EH4 SZG,4 H ! *7  *HQ%&%&)&%&) &%&y      "    6V /$ Q        +H#   `O_`\,    #  L  H_GHGHGHzT   O 3 POPOP;D  V  DCDA 21&+:#>  'N \ @cD CDCDCDn     $#B3^[+\#^K %^7$ K^a# f+  ##S D;   SAE<$21 3    G  -    .    > V  !L " *0 6        CF ^>     FC 0Q& Q(CL Q$G! ! !"M b    %   ,()    " *0 6 5'   )                        3<,"!Qk/'   )     xSwxwxwx`       '   `  XXWX $    ,8D $??0     L *2* J^#G.&&(&&R5&$1$#$#.'(6'(+C(+=(A$#$#l "snm;    &;<# ;< ;<  ;< ;<En-  !?)  ##=$6<!"('' ')1'L'  )6'L   6Y   30 4; / .  6  C  = A  .'(M +D(W 4!@  (  + !   6,"MDW R%gg+=(#     ( #=        +.       -J  F  "%, "Uc B g=#     )  ' !    C:0   ,R8&%,*     ~{ * )$ #O* "@8    > *j  (    *1,+,+@+!       ?@8/1 ,3:> *j    ( `%<  +&  .       1B5   # . %<  +&     Z  "3       )     "!lF+47 p%   = 4  40 ^ YX S%&  %&  %&%& 9 8 %&%&/  s'&           h,     1;   XXWXeT     .8   heghghgh*!"('V  14*) ,* #Np"    %    121212 J     $%\#2 S  /* d %  #      N  y xlovt !!!Z0/ 0  10/1!"F'_0/0/1   X <;<3.    -1$(~}  J  " } /#$f<    D>  ?      $     1_1 /(''F  !?2 ' +H/'F        NMNM LE"" B5   =  +50 0   =Q j9" N3MN4     &' *%&D#"         %B!-=*- .-.EEF-*;    WZ #=s tsv wvI35 $& &  'Z  B =   ; pqop- .-=*   #=E    = `&_`1_`C_`_`_`      +.5 !:R#    N!      "   MTSR c dk l { ~n mf  5S^NN!      " mq9|{ {| {q#               y$#      PG$212121 0-(%&!  s !"!  +  FB (51$C   q    y $    p4opop(EF  * ('EF ,' /8<; >EF     =$ <  ($ w$#%3    &   #  S 2  ( w  %    3     Q_b $  ('('(+p  !\     F       XWX*WXWX0!   7 0!       M! ******  )))()( ))))))  1 *N?  .%           !  Pa4     1W%%%$ X-$QX$!!%    )2/ 'XeLG> $. ; $ $ a   4      7 S       $  S x-wxwx@%  pHopop" ( %%% %%%  " (   h/gh =O  bijh 4 (  ] & v o+8)">.# C)6 B  \  O a  *!"% Y_ /J  @?@?@ %      %    @?@?@ $     $           xwxwx .   : =     %4S9 .   "  - p/op )       "8Mu [ H> A B     K,' ) k )H        /      !  @            33 ;  !  ! P4~d"? ! 9 %&"I6 A(,  R H  B  )' )    k  "!$#")#H   X.WX #  # 68:<>@//B// g0     b         )9(% 19= (0     b $    HGHGH4    X"5'X6-ZY   , SXW7XWXW/ZYZYX Y `      #  "    -   8,7  =  $-   , S7/   ##     #  P I$ POP%O  (          & /  c\ 1#   N      $   %  phop8opopopopop      {'  L '5!0 .- ,  ++  C  1  L %> '/  .'5 =#t    &(5    &   $0D  1  ''' '''   !! $    POP OPO POPOP OPOPO   }422$            |>  ' (<> H6GHGHGH.!0    4!. > (  *          !! - ! !1-1-                 FE| }  FE   2(Q'   , I 6       "w/S  P"X ,,-VSS,-VSQ,-VSOS\[^]^,-VS;gjil A   !$!k!%?P  &#*),+6    ( 4)     (('('(H     &(  ));dP ,*  .  ,  (7     @ :9     ( /XWF    Md                  XW F#+ @    +   PPOPOPOPOPOPDq )D(    `_`)_`5_`_`_`_`=_`_`_`_`_`_`_`_`_`_`D + @9      *(  M@ / wl&A!0 `_`._`5_`_`_`_`_`=_`E_`I_`_`_`_`_`_`D , D=  0     ()  QF /@>tk6.!1 XWXWXWXWXWXWXWXWXD  *( #` Z&$ `{_`h_`_`_`_`_`_`_`D +    )  T!6/ `_`\_`J_`_`_`_`D ,    ))  m A4!6$0 XWXWXJWXWXWXWXWXWXD`   # 3D C$`         XWXWXWXWXWXD   ,       "  1x #1K   B?@IT   2/09D  ;6 72  ?                     *         !     !  %        * AB b6      'I  'B I JIxwI6  #   ;. H A  8.?(7,             $                      ^U\UVQ B=    .10-  21  !21     .0- 21  !2   A8 1 (         ('           *)"    '2    .   pq() -           # H4GHGHGHsGHGHGHGHDO9A      O9A H4GHGHGHGHGHGHGH!GHuGH&DM9  : %   B   "-:9. =AD $      $M9          :               %      , W')X. P#+%&%&% &%&% &%&#&%&%&% &%&%#&%&%&1 &%&  3  $  p,-VS3'  $$$ $ ! NW ,+ TSB L,-VS       6-   W--F?VS  !###=  X*U/)#*%! 2I"8"}            %&#,)m.-N0187:;<;>-  $  C    9$0: ?4         ! .   3+ -*  /2    887  8  B   " 8   $. 9      ^7 +) +     _          <7* BBMP  O       ?H                5  *5 4$3 e$; J b34% # 53  ]^]ji   ^     AB                              )- /*$!     5       )   16          IV        )  16 ;.      >   5               )  IL           _l        )  %  5              ) /    .       _   1  )       )       5   ) r e) 7  6           e9 2 % )   #  lWRQ"('<a  <! 3   2      7! /$      $ !  7(;> T  7 W('>=(7-(7"+<      jj)+haba haba !         %                          &  "     0/             7@         "         !  (':'        %&       ! @C                 #$          F! "   !!!!!!!"O7    !!9D   ""   O OqI!!!! !!! !  #!!! !!  !       7  DPc""""O <5<%%""" "2!  "  1#$""" " .1 "))<$)!"!% >5   6;*)## ###  # 7 65 ##   # & UVUV      UVUV$$$$"    B? D5$5%$5%5     ' $  $ 21&_Ac=g9-;e6 {%}#!o1q/ ")k536u+w)9?aC][E SMKU WIGYFAOQ: FMZ    J'' +'''  &,'' $         +, ' 'C ''''&'&&&&    !        )  & '& $$ %$* OP+s- Rp[^y|sz      ~Rp[^y|sz d)))))  )  P ?@    p$q-   vQ'#rQ'(#$jQ'(# '(Pc P OM(w^ u>-)))))  )6))))         -,?!  !0)  ( ,  ****  >@    +,3 -*** *    '*)-    $Q (mrq KF\ UhUVl0++++++  + ++,,,+,,++,,,,,] "l   6x (x /05"l" UVl" (l,,, ,+,+ , ]plmr ve pe[q b<Qe[qklq]`TluxTluxTlW Xklk,$O -?Vl=VlKL?, lVX+     G1?Vl1Vl# 7?Vl1Il!$5,,, ++++,wz    ,,,(-+       :+-F?VS-+      @p  R     ,-VS   +  4CwxDCDC-.wF.D    2.D  ab  4$u.Dy  "Dep%   I       !ijDQ  \@? D?@? 7  (('(' 7rC    4 hg                        2C &A   P0OP     PPOP!r HG L"K  HG            7&1        *                  *   c   WR       &"        N"  g   WR XyWXWXWX?WXZ    $3  ",AHI ! 0)/0 /0 /0X      '&  '(       %"          '      %E }< $   : 5/) 0 %  '( h.ghgh  # 0#/0/0POPOPO ******   bNH.,0POPO8POPO zyzy  ,,,,   ,,,,   Jol ktsj  IRQH w  26,  + -% 8  J          0/0 /0     @(?@?@?@   $      u       H GHGH      8!7878   XWXWXWX WX WX WX WX WX WX WXWX J  klkl    K%E   (*'('(@4    8:787878TN    $, :'    !"      G"& +    !#"+      X%WXWXV    )% @?@?@P     ) @9?@ ?@?@2c!0X  8# 2a (#'('(?H   %  $ aDj     .I *   "%   I      H(GHGH;    Re jkn kU   < X>WXWXWX 9A +l   A  9 3 4      # '8    &  )! X3WXWXF  5 "! $,  8! @     $$ @;"$C ( 84, t 5  , l dN  B @MX     % G[b 7(     +''%      _/ :   W L   Fj +J   + "')4 2` C? 3 4 f   G +rK 4JK  .*" =   ' %)     F   fs   H   P  \! k  l kl6kl k  !  6lklk  p od    > *) *u  ABA \  >=>       ; 'vuvuC8`/ 7O /'       !  6    `d_`_`popo p"o9p QR   (0C 9   b sts       $$ ' 'I# "2C     ,            444 J     0 #4#4#4    bg   < * * Y#j #G    - 2   M     4 44  J  h/gh !  ('(  333333333   "# XKWX   3@ Ac 1 K=1 #=1S  1  &K=1    H$GHGHGHT  #$ @;?@?@j ?B;<+" $fG |x   d  CLEF$ #2G G ehab G,ts  - ,   !,,$      "0  D!0K   "        9 5//"$T*+,+ 05   -&$>F @?@ ?@1f    87878v  #   8f78s      !3 C<Q    L   "+:3(J  !)Q x    3r &! # $  ]"0 A q"D U '   U   9E""'x  3! HbGHGH! At!"      W !A     , +  ^,+    "py   '  M26'    ^ 01/0/0 !"   &! !e 09/0 /0/0 3"     "3W 9 "   3PMNMNSNS        *$J*W] a?"   3        /         1# 0        @ ?@ ?@?@   > ?#  S!9 !9 F3# !9  HGH! !    h"gh2ghghh<  $ R *Z   l      "" Y D! ? 1* +XWXW  (    r )\ P+OPOP@   " hghgh(ghghghgh  fsDnm nmp o nm nm, h ef0!HE FEq v BI JI    + 1  "6  D     , N " P%OP OP OPV       " P/OP-OP/OPOPr    .,0@l+&  popopopopl[ \[rz2 ck ! !    & 'K zl'<l0V $    l X   b   l d  n $ .</ l  c d  L% "+p   >9 :5        P       L % "+X    0/04                               B Co|>+=>=>=    \H$d'?            @1?@A>  *   @?@+>  +     @3?@C>  1, " @?@%>  %      `\_` (6> 56 ";:9 (4   $ a$<  #1$ P5OP   PiOP&$ $^$` !'-5&$ =k>+=>+)     \% % 6'*         H-GHGH4 h B    HGH%GH4  0x   $  0  popop4  0h&eh&e    F!0!  0& & # xwxwx4  6hNg   N0'  6&(  U POPOOP4  %h$e     ;$C  %$  XWXRWX4  &h&g    \Y>$#B  &&  HGHGH4  '   #  '  HGHGH4  )   %  )      HGHGH4  (   $  (     vq V4  "4     4Z  &  "4  HC4  &   "  &         ;@    gl   6In 5      7j6Dl  el kM  sts!v {|{|{+~#e '`!    +6(   HHGH6    6   ! ; :      8V786 ) URO TQ       8^786 ) % $$$$$$$$$$$gda f$Y       XmWX6  f$efefe   .JW  $  xwx6 "fHefefe! z  ' JX!  "$$   xrwx6   _ rqv s 4_       4 xqwx6  _ $!! ! 4a      4 6      6         T#S EC6+   gh6           q ## A06 0            #F ' 7##x +,6 *  )*)   1 6X:   . 1     X!F$6 $"  " 6 V     B  4WI     +)  +          4  4 +    2       &   A   $ &.o )'r !'C K  #%        4  4+  "$#& *),-*) b6      $          ?@4    }  2 eO :6       #" 4    $  :6 +     \;<9!HG-F(oL  K!^] #:   8  ", "4W)B 1 + %  4  @+?@6"   xnwxwx66 Z 6'  hdghgh6 (-    @I?@ 6+ ,1+ ,  !  ,&  ,  1  P56T ,     ' % 6 +          3 B     R $F 3 91 9?%I  8786    & z6"#$ 0  !0           dE  " 06'$   h[ghgh6.(   %%%   ^. (6  !8  +1 2   ;<;<;+>9<!   ?$    7$ 34        +      )K8M   QNK R ,-VSq     'H".]  C"  `"_` _`%_`_`_`8}  (&# $"8    ,-F?VS-,  hIghghgh8r   =  ) B     ;8    )   MK%1 2   "  """%" """" +2   ]VU?BAD      """"& 1$  ?t>e(@(4m   +"% 8)&>B1F    "~. -.-.-f.-.-.-\             5FEHGHo, "?  D: )%d f @ ?@/?@&?@?@?@ S        % !%S    @?@,  PROPOPc  =    S 9  O ?65:E 65@    <    O65J&U 65P   XWX*       l ' ' ' ' ' ' '  -      l"    pjopop   657 &D0  ) @  )         65 65 . &IS )  E "/     PZOPOPp   65' &40) 0 8v      ; 650 A  /   /I%&'%,n S(8d    65 65 65 65 65R# 65yhc bop~]K 65A>? 65XS&LGF 9,%   E   ; :   b   E/        en  +0 .   K  0) (   :.!6          vc " !#$# &%(''*), + .-        0/0*/0/0        pIop opa   !  * u 'M]  + c*   '    )   4&# P.  hQghgh21A      XC!   #   :2121:9:9y:94  " 1   */ 0 65  -- 65834          A   (    q )   B   m&b+   g  *      Ly4   @?@ >  .     .--.-.-#0 /w ''           7 7 6 -# w    '    $  &                                *J      8^78786(   T 0/0 0-              &'&'''''''                                      ,  &%,+ (%'('( ( '('( (C'(8 u2 ? # B:'#u( a ^ ]^]J    ( b    : Q''#      l ; oR ( 1#   $ ^ ]^ ]^ ]#^]^]^ ]^]^ ]^ ]?-^]^]^]            #  >  H  9   bO '3   //R   #   ? -       x  (!(     "  :8  !$#I  (! Vx<n   *9<    x   I?        C     4 `Y    #$(@|    I?   x   #   ?-            #  >  H  9   x l ;         xT      _     = J~v[lC#M T c# s0ts tststP  ststst  0 G)  (@i1I 0 P       x    "   78 ^[`_  \e # ' "  OP FCHG  DM  gh .+0/  ,5>  J! 8!78/7878 78R      !   (  x)wx=wx7wxwxXwxwx&wxXBzyzyzyzy  [\ QR  *!$      3M 8  4 5B     $$ 'X$G2C  ,       ]| {|{N  | ots   #X3 & +&=8IDWP  3uHE$!] N ,     A)      pop|     $, CDC:B  D ".|  zyzyzyz yz"yzy zy:9 ,)  :(&  69-8   "  ?zy1 ,1 :l kxyz/yzy9lk  */%+,/9   C        V8  0(/0/0 GF       %^ l  jr# z  Q V$? K   A$ 6 NMc^ ire rIJWIJWIJ IJjIJ IJ,  P U U  U  U 7 + K C c _ )  @% 5 5! 5 5!WW j r@ P  r;x       0/0/0/92 .# +IrqJIp#. Ij" % ' 5rB&( & 2Z )     GD^aVaOGHC&rI JI J > >>#&   C>. =4 9 8 V K V D  = 0 # )- + ,  +   %  !1   &   <D    B   k  N   '0r   # j ZCV5h  nm  ! @c@g6IjT     j     !6r     )+ z         &8,   ! B!6 J    $$ ];" (C (,^ ]^]^] z r\ "  -*$n:        OD  $`   * )  b$& -    l$y Nj  $w  & ,$ M  W $v  "H ' > $W '$) C?$ >@   4    h ghf  $   ####$#V %< ! hghZ     &' 6765"#"!2321:;:9*+ ./.-  RM  D CBK DC@?H $*$">G!V      8&78L         / VUfYX     /YV.e .12"    /*  ?,A10   f9:9:)e         -5*YM%  4/.2!'" ") + ,   -1 7P#,P  FAD9:9:(G% *E ).  #, P OP"OPOPI  t    GDC J GF "1 3   C    7X` 5K1v  $"    _!5SgK1v xwxAwx /  ,.      :/  , P OPOP OPOPOPOP OPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOP OPOPOPOPOPOPOPOPOP OPOPOPOP OPOPOPOP OPOPOPOPOPOPOPOPOP OPOPOPOP OPOPOPOP OPOPOPOP'OPOPOPOP >=         .-&    +6    ;^]NMF    KV    [nmf    ov     {                                  % 0/0/0   "&  J        )D=C)8 % / 'C%    !        ,% e*!&(       B  f8POPO  \    :3!0 ' 7 1  /5 k $pyvk^]^] D]^]JUZU*bFG   B        ?G7   # &F+%LMY, P 4 <8   \  / -xLO^]  `S_`_`_`_`  X WB     + 5 #   B^]   #       ^ WXH  ~w   *    ! 6  .##!&;  pBopO +    @?@?@?@    +7 PSOP         G /% y           *8Y8axxV 0 /0/0x%qrqrr  % X2WX>x@qr$qr qr        69'&@$  6zs/t6 Gr         B /6 G K(z s/t !          :IB,0& / I(z s/t QZ          8L@)/& / z6zs/t& F    |      oO /& F 0/0h                   hHghghp <> 1 $ < Af YZYX>    !D  1fW`_`_`_WXWXWXWXWX_ `_`_`WXW!XWXWXWX _ `_`_`WXWXW!XW5X&W XW5X5WSX2WX W!XW5XWXW!XWUXWX_`_`_X_ yzyE:|>=x   &.5 )       ) "@*0 +3    E  '   <   [|,a,:1>*,=,7 *-      !$#$%('*'(  '&,-.-50.12 4565878!7:;87"        hH   O h\ -MhA                    0/0/0/0h    !  0/0/0/0/0/0h5       :5 ha bab       POPOPhC    Z*   }~}~}|{|{|{3|     .'6  8) .  }~}~}|{|{|{|{3|{ |{3|     TQR.M EF.A'3     8,1) .   .  ,.|     / % }~}|{ |{3| {!|{8|{|{|{ |{3|<{    -      .   0   I  CE' ,1%+' -      .<  }~}|{|{|{3| {!|{3|    . .2   B( ,' .   .  X7WXWXWXWXWX      uJ{|d1|d1|{      96 : #   2 6 ?<;* . P9 P_ &  ]^E \] R+ ,,A X= T 4! 8 0)4'  % <3 P X    ; G  +0~{|VYZ %    K2       3    ) :   Q >EF )  #:   !  f7&  6  I   A  i hijij kle B KL [\[F GH cd WX 3 N_`A ?@STQbghM    &34787NOP CD!#$'(F3;<% V opE +, FC/ (    qh  <G     #0+    ,*N~    /i"SS +   ;A&A&WU @&1 1   . R 5lklk+lk (   B5+ S }~}|{ |{3| {!|{3|w    - .          ! 0   > B' ,*-+ -   . w'.-,+0%  ""$$     *$?'0 popUdcg.-,+%   &5TSTSJ+(]TS^/2iSn aTSbQ. ##%%=:+& Gj!'>!&1$'% 6 -0 &MZ$Rg @?@`&  21    "!* )(-,%$! NM>=<;FIHMLQPOZWb a`ed    6$4 (%;uL^ 2 /A'   ###$ ###& $#[<$C=$?2/A   878&'      !     >(;ds$ 8278(   "1  @H?@(       #2$(        (  ' $%-0/( -, !  F# 45x0/ @j?@Z.+0*     ')   ,,A7Z0 @?@/-.+ .+ . + . +d.+ .+<+  "!(*(*( * ( *%.1*)2/ (* 5*)6(*% f&%WM--     d <,  *,*,) , ) , &)"!*'.*,-"!.*,   p!opmop-            B( 9G @?@!.+ .+3.   *)+"(-.)* +-+- '2 * 1^R 3 @?@3.+ .+U/  " %&,.-//()*   ' #(8G~1 U @?@-.+ .+O0  -/-/' !"  % 68AL+ O d (. + . +:1  . 0. 0 Er(   : @/?@1    /  `_`1         +   . ? @o?@ 2      3P  2   F !   /48.- 4ts ts tstststs ts tsYt2  ..----,,"++,,++++K.?>++X++/.!J4       Y @A?@ X3     /& @a?@5          >4< @V?@ 5     28 XWXQ5 BA(%-.)*!0 AB12783FED =>9J!  )!v=@N @Z?@%.-.-,.- 7  4444  44 D"X%, 44   $ n*   #7 7       73 k",#$ #$ #$#$ #$#$ #$ #$(j         z,       ( , & DBB  BBLJHu tur> :F+l:===@ A@0D> 8 +)-200" % " > "   "   ( ,q $  &  CC N F+DG=0>+%;9#&A" 'q @?@?@D?@3 2 :: ) "d:     =:*  @??@ R343 4    6   !b+i +$2"  XUWXWXWXWX ! (O/5  RQRQR3434QY4     /8 Y F.2% Y !b hYghghghgh  %    ,O/5 mz   1  =% ZYZYX ! Y*` f++29X hghgh  21  $1)%(+%     3$ # /6+    ba   &LKLI $>=>;  (  %&%&# &% $    $ 5     / f  E  k  E  lA$ 5  = (5% !'   XWXWXWX WXWX WXWX WXWXWPWP  &.   $ %212/K,+,)KKKK    ;<  cdH FI FIIc Z)) " )  "  B-2&  !    PWP bKX/    560   )   _ J1- & /  /= JGOM   #%&!#%&!" 2,     O "4   */)-# /=         OM   $# #  G # G # g#DsTuF@##2,  p9opF :     pOop op opETST     ?0E P.OPOPOPOPOP  a@   N      r  .A   K        +A   )   !@R3434*).M1)-)[)+)()# )))))))))))))0' (! 3",9,E9Y)8" +$%) %)           )0/   ,  +  )     T     ) x     )!"   )    )    )|{  )t}xs  )lupk  )dmhc  )\e`[  )T]XS  )LUPK  )DMHC  )<E@;  )4=83   ),50+    )$-(#    )%     )    '         $  .2 _dMJ_         ,2M`#(+   /  ,M`  .$  )       4     H9)`7<;  $      4    )     4     )    :   4    "x   A  !  2    {  G!  !  !  5 9  .  .  .  .  .  .  .  .  .  .  .  .  K  .  "  &     %! ! '  9  >  z(  %  y3  |3  - [*3"% .% G  =!.F(.7"8)8&82' *4.%.%.%.%.%.%.%.%.%.%.%.%./%-%-%W+Z;1D71)G .3 G!.0. .AZ#,#]<.a<.u@   * )  .M1)  -"!)  [$#)  +&%)  ((')  #*)  ,+)  .-)  0/)  21)  43)  65)  87)  :9)  <;)  >=)  @?)  BA)  DC)  FEFEFEHG0  JI'  LKNMNMNMNMNM(            POPOPOPOPOPO!RST.SFE  "VUXY,\[9  ,^]E`_9  baYdc)  8VU"f ijknm+  po$h  eZ  9%r uvw  zy)  t  q  %|   )  ~  {              W       .          `S # #R9'R5+R1/R-3R)7R%;R!?R%, CR),GR  A@MR WRKRQRQRQRQRst _RQR_`C H i! A A~L . MP2<4+0  $'+,)*/'4731o cb_\Y'! f    &%  5wpi  ba z  [6587" -0 %00CD! A     !".-6ABA  => 569:7&%&)*-.12O2/  Ev\:1(2* & B  /?5'eL  .( 2 ( B9c A@13 ]  )J3     +0 0/0/0 /0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0f e!   JIB   %<  +>   $ K( 3.-R; < #   7"   6 + ? , % ! <  .       H      = -- E3( 4  4  4  4  4  4# 4 4TT 4 3!3!3!3R 54gtst  3& !     M&   'DA /Y1 /Y' /xY /nY /dY  /XY /NM /BA.<;.65 /*) . . .   .H.I %  6%#                     '  '               Jt*S_ "Y-,D4131313131 31 6!$12%$15' *+4+ .+1/$121$1,3 6,,7 :,, ,*7F     -- E3 ("!"!"!"!"!"!$%&/% ()*/) ,-./- 012/1 456/5 89:/9#<=>/=@AB/AD.EH.ILMN/MPQR.QTUV.UXYZ.Y\]^.]       XWX$             3,>>.D  /.D  #; 5 , #; A >A  a.     j <   (# <"  #( '(+,+(  &%JI  #      ? @     #      ? @    - M0K0/!0Q4 I,) '"!^/0) aD/1") Y<) ]@U8S2 C$ 93 %0 '07 /,A2 t . s$ B%  %  +!&E$$PB*>GKxlG&< .,     >  >             /"   !&%( '(    '( '      #        ;2 1    54 3  ,6 5    #        ;  Xe #$ " !   #   f "1{/  J*  2  . .  X         F     0o  !      >    /       /        M       /  !        1 $ _ A H 2 1 # H 2 v P 1 # H 2 "3! $## &m% /0 8278/mmR If efefefefefe V  @ 67<;@?DCHG  (fefe                                 VUZY 0,/0fefef   C    ('(?W    6 , (G'('('('('('('('('('('('(p\   EF          3 &  3 . - ROPMNM5 8 9G#   P*OP-OP OP7*R  IT    7* (/'( '('(   1.!A @*?@ ?@G  , '  _      ?2%#I     0   -   (-'( '(J  / , : @%?@      H%GHGHGH    !"%! $6   (4'( L  # <>@BDFJP   \ 2 $!" %NS* ' 2 8"78.   1 b  3    t 0 ")*)  c ^a b   R3     " ,{/s      3  -   H C^     ` Uv !    ) @  7*o(' N Qu@?&  0" 3BP Y} !  8" fR   F!!` 3 W K !   @*?@=L      -% @'?@ gfghk'"  @1?@  !#$!6, (('(     w&    (%'(   \ST@=    @+?@t .&  )<  7>j  J ()*)*)   Ropopo     P:=>>=>: .     w:        Ar( 4O+21, 8  RG# #,$/ !  @%( +,  r  "      * 9 HRGHD $(  'H @56     8  "' hgh   04/0/06^    >&    66      g     l4      dzyzy ? ^43  43   "S    /CV:"84> Yy#  *   } ,!1D#      87878! popopopKopopL K LK5LK  !%M! .2    6 <5  5  \[\qr1[\ qrqrqPOPO  &  G5 1   87878   popopopKopop  !%  O  . 1   6 ;5 x#wx :9:O            N     OU) <       : ;@ )              ; 3,k &  i     ,*:3= 6  k#) < @ y+    `7_`       @-?@ ORUR W^]ZYZ &    $f ]^]           FE :9 ,' 6545- /  5YZ *A %* 7?    hghgh!gh^]f'0e^]`  *                   $  t1)^       [  %       '  +  Y:   popop         POPOPx           *?51 x     (;'('('(/             L-/        2+ %2 / *%&%$ #   B Q V-PD* D <S 5| M Q   #      '+W M Q   v :('(! \,/.[   bv$vuvu v u v u    NMXMN U  N +)*!21 ?   -" ' * ER  Z   ',0/ P b    `d_` _`_` _`_`65jijiji[.   NM[ L\ z* vubu(b a eaUf ef xj str$  [UU $  r o&\ - +KT    8)4IE ( (    U x    P OPl7LKLK     ) !%  7 `-_`     H1GH(GH(GH(GHGHAGH/GHGH@,   &%"! ! $         B "! *@  1 : + P         12  KmR-iO   1O &  Y  #-!   ,     '!5 GNx6EO :G! + XuWX: 9h   6  J h _+ %'  2-_+ YR  @O'0  %'  BO 0w  hgghgh , ;  A sJ         81>J { O V +2!  212k1N21 2     + - )!  ' <1 )8' / !+-N    I1e C ' :&  :'inD/   &" H7/.C'   :  )m    `      ;? . m k,5;")H       -    1    35;"     H     + BBA5 . 7 87   !!!CC B 6B     887+#IDG' & %    7-% B     . D@  % B X   V U (' O O -7  < ;   !1  7 Qd0 /  /  )?d    %   TS bchgbchg vu| vu|   !0     %  1?  3 ? an     40  b  fefe41 P !"ZY 7 NM-. xU:   ( JIJIJIJG - J1 ,$I&5J5J+> G3 $  & !uT;U: =QQ C     +} %:.D  cd    ? @      3%:       i    # Y bY d3  J            # j\# v   A k ]  01#  v4 .   a   -< -: K#- HZGH  JnoD  & x#wx! ! !  . ( GT1#      %&%&%   Rmnmnm$ RMNMNM# Rqrqrq& Rwxwxw  & & &             @*?@?@?@4?@?@  "  M#  P&/")! )"!)l    ; DE 7  U-L#/         @?@?@?@B   ).  v  v    p          % 0 _ R  % 0 m R   y R(           ' 3 q3 P v v    .  $  8    /  c         #   U U    ( @ =11&1 o / c   !!! POPOPA$   O\(4 & # ,<2 3  & L & [     3&  &"' 1  J  F0! ;3    3&L&[ D & -    & L    D&- y 3 . & L &     ! 4+$#3(&  $ & /$#4- !%*  " (8  J  x   ): "3 = 0y3.&L& 9 H   R %A %  ' 9 H F              R  " " D 4      #    0 V , ,F       C       { C  V%5%VU{ UVU { UVU { UVUV %K  o]^MN o]^MN o]^MN  > 8W+ %%     xwxwx X%WXWXWX zyWX zyWX zyW!X %       %=| %    ! & V%5:x   V5:xwx  O  V 56UVU wxV 56UVUZY ZY  +V 56UVUZx V 56UZYwxZYZY.Zx{|{  %7  K{  .             R        //0C 8?    *   $#c")5S>  .g9  3 %    O  !$ #$  #*) ,/.- 214 5+8 78 7>=>=<= @ %& ?*)FE('( ).*   X&x   X% xwx  O  X 7 8WXW wxX 7 8WXWZY ZY  +X 7 8WXWZx X 7 8WZYwxZYZYZxyzy &I  %C   .              R      +!# *   "!F'UV"):G-  .<3* & &   %    O      &% (+*) .-0 1+4  343:9:989 <  ;&%BA$#$ %& ,,,# V UV|{U\vu[V#5u[  V#5u[ !u[\[    m   \  [\#7| #K| 0           B+  R R R  E4] 9 9  - ! ! *>"$ $ !  #  # !&!$ !( ),-, + 010 /m4 58 9< ="  poopVUVUVUbV     2#!Kb , \vu[X%zu[  X$zu[ "u[\[    s \ [\% $ 0           H+  R> / " 9 % - 5PLD" %  $ "  "#" ! &'& %s* + pop \[\vcu     B#1Kc $ ^]^] ^UV5 V#5 V 56UV 56UV 7  #K      P9P9+   #       `_`_ `&W X%W X 7 8W X 7 8WX  ?& %       H9#@>/C*   & %       Y  $ D |{CDUV5 V 56#CD| V 56 CD|{UVUVvuv\vuvJ v\[\[VU Jvuv{|{C$    S7 N7  N7o^MN     mHP #j0 i         !$' * $'(& /238'* ;<;>=> ? $ABABAB U  $F zy EXzyW X 7 8,W X 7 8WX zyW\vuv\vuv\ v\[\W JvuvyzyE$        *          NE^0C9fe           ,   " !(),-214 5878 !<=>=>=> 8H78NU2 "  >% DNWF   NJ" - N`   *  ;?*/jf paopN# & # &0| @ + > 4otq 2   0 N# &# & , +( 4]b[        %< ?  "&O    RxU vTSTSTS2T) )u* )U^  2  2    ' ,  , ,#2 u Uv  <vw    !> XWXWXWXvH  v  ^v W!0 )   ]$6#Wv# _ K7  v !0       #/-  v>h=>h]    / 0.=>C       3837hh  8/78v (     ( Xv  V       z    V /r5Fk:vT STS\>1=k%l>'=>W=GTSTSTS.k%lEJ IJI>=kl& ,       %         4 % %       c&    9SE.   +</ +. &0 f ! ##+Y \1%'WG      . % E  & , v'jiA A;  ! 'A v/ABABAB9:A:$9:  rsxw   8! P;/$ $vjij i j$ijijijiji     # ; @"/  $  Kvk     '\ 1  F     v:9: 9:9LKKLKL K(LKLK LKL KtLKLK4LKLK7LKLK3LKLK5LKL KLLKL KKLKLK%LKLK)LKAB AsK A BdLK LK*LK LK-LKLKCLKA BABULKLKABApK A BULK)ArB A BnLKA BAB{LKA BABgLKLK5LKLKCLKLK6LKLK6LKLK*LK@LKLK*LK9    + 2     "  &" `d 5$U .O 61.  '  $AG   >=        MN   ? @        J              7 8?43!       !*        ? @         "  ? @     $ C `uzy        !+ `AN_ R5      !*   O  Aw              )o     )V > "/  oDOH1 ". EH 4 "E9C"  ! "  &    "  !    ! + #' #5 #( #O . O .  ),2*.*T#.#1$.%/* + * *$+#1!$!'$=AF%" >"AF+D.;F/023/35=8303;0#$#,6#5$#" K (      t  4735 L K%  )"!$% (     ! ( 'd21 21*43 43-6565C87: ;:9U>=>=@?B     = B AULK)N       M N MnXWZ [ZY{^]` a`_gdcdc5fefeChghg6jiji6lklk*nm@popo*rq9 av9JIJIJIk%l   % '2,  %9% yv!NMNMNM+k%l       + % I  %!+% @?@?@?@vTSTSTS  % v.JIJI   QTSR! . kvHLKNMNMNM%k%lLKNMNMNMk%l           % %  7         %  -!I,2 !A  I  ,H%%       %  d   %"!" !"  " ( + a  (  &! 1  %   haghgh  &8  lI VO&   & *  & h 0 j  P *"  "0 t f 0    O %"  0  g2121 2121 21212121 tqtu rors  pqrs%:wg   1Z   :8  ;212121w21   dadu  heB?@ ;8Gbc4V ZG; B  8V78'7878O78787878787878787878787878CL<;<;   @K          M 'R    TBL hPgh   < )   /. &56",;F ab'!" % -9qA8 >NI C%' <L[75212121M212 121 2121      , e$D#$ p             :Y [{g3k5M c  !   *D212121 2121212121+21 ZYfeXWTWXK     !-.$#KL!  WX )  8'/|\w9BjQ !    e          G8 7V      %"'&%&'(  *(CTXFN *DI P vA212 121 21212121 212121"21@2 1212121 2121212121   a `eD]D'%(6534TO D)""    )@   =@  CD $G`!  f   uA        " @        @B?@21!21 21   @ !  *%0T%*)%8 7h          *  &*& +*  &E0   !9%7~ e 434 3'      2    234 34 34 32 3     "  $#$ H       G  "% { | {[|{ |d{|{|{X|{ |%%  + :   ? @   `_+F"%: ? @    #    % 5Y +F?@M% +  X   Y  2L  f .(  $ 0 "   "     d        %%  X  F& " $Q  $   A! ?)1$  F PX]    * + ppopX}    5  H .X< +  6X% x_wx`'. 9     F &. U$`/GHGJIH    5l/    `     !" z  !   `  A'GH(GHt#!0         C      /  7$ 2      D       $(I  hAz <       @ $>@'($!t`   8i78 b~ 9cdc pa    +P0 8?. "   R!'6  FUV        ;# D      :$%""    -4  5Mf9 np   xX*: < C      *&  D 4>bd X$WX+ba+   ++nm 87878`       HAGH   /%-/  V0 G# & ` Gp G     ,   , h ,  %"    GN        !"-% :'   n'mQL !   ,     $$   ) KX'C*,,       ,    $*$&  i AX!C*  ,Z1' ('('"('( '-( 4      ,N" 7- ' " -   ,g   ('-  a a ` @  "$`$ g  -   0/0/0 FGJ X  <   0 <   0    7H    O     &(  ZS 3TWF 3<ETWF-1<   }   }  }  }   @_L/(                ($#  *+78           B 1         {    (  (  R   C                      GG [      #J9 Ggb 1       &#                  0 WF  5 * G<       &  S  X/ g   h CD  A        !B ) &%  :!    n'"?           +                           p            0  %o        }                         }     %&      /0  }  " Q   Q         M  Q &  }   U       }           i)40T;%9 -,+ ) !m              !$#&  ), -,+, +"!" &!2 321216 565: ;:9:9> =>AB       (#             C  ) ,   3            [ D 0   2    8        }         &  }       F@ 2?  6?%#          &            J  ^g @?@?RQTQRQRQ;RQ RQ RR-0   ,ns B9 l  p+B& #@4/     ;   FEf;6  2    J  `_`   N  !,* +.  ,   @?@  (          ~ D  X.WX WXWX    !(  XWXWX WXWXWXWXWX?WX WXWXWX     ,AD    .UH?o 8(787878   1 pop  ~}   rq          dc          TS          BA          .-           V5MQ%                              6.   8/787878     < @!?@)?@   2 ?    @ ?  878  0          # POPOPOPOP    3 POPOPOP   0         POPOP OPOPOPOPOPOPOPOPOP OPOPOPOP&OPOPOPOP :9*   !  2' ( # 8  'B   + "   2/ % :9*   !  2' ( # 8  'B   + "   2/   ('(#'('('(P   =9     % !"  8  |& " c=  hoghigh  V\"()7R U  UVnfVcVV   / * # ; DQ\T2//k*%*:d* 4 * 5UVnfV M V V  xwx wx Ujfu Z t ul]+(/ ~ D/Wh*%Ujfu xwx wx UfF  : ;27 D @j]+W*%TUfF xwx wx Uf,      <TC'%:Uf,  .UVVVU VVfVVV-    4 4'4# &4!4#( %4)4 14 37DQTT7UTQ_TTF04*4*14* 1 * % *4*4*5+UVVV U V V fVVV  R"TTTTT TTTTTTTTTT TTTTd/Q *)GSKO[? OKQ;"c7g3k/SGo++:9.WCs'w#{;F WT[ =Q`RRROVRRRRZRRRRVRRRR4(4(4(4(1( 8 ( 4 (4 (4(4(<(4(4(4(4(8( 4("4!($4#(&4%((%"TTTT T T T TTTTTTTT T"T!$T#&T%(d'/(  VRf        V:Q4'*4%+VRf pop op Uf      <Q-'%$Uf  TTT TTd/    # XRRVRRV+(4(4(8(4( 4 ( %MTTT T T  d /  pop op VR       V:'*4XVRUVf      <QT1'4*%(UVf  TTTd/   XRRRN+(4(4(4(%ETTTd/        UVVfVV     @QTT_T2+4*4*%* 4 * 5UVVf V  V     Td/     TRF'(4(%=Td/   .VVV UVUV VV&f!f5- 73#  /  '&'. ;8 ? -^TT>Q:QXTr{p0*4*4*84 8 * 4 */#*%8*%gVVV U V  U V VV&f!f5  TTTTTT     XRRRRR2+(4(4(4(4( 4 ( 5TTTT T  T    TT"TTTT    # [RlORR2.(4(. (1( 4 ( 4 (5TT"TT T  T     GTT0     R9)0(4(4GTT0   Td/     [hF.(.(%=Td/ pop opd/   TB'(%9d/  TdT2    XR]?+(4(%(6#TdT2TTd/     XRRJ+(4(4(%ATTd/   TT     TR"'(4(5TT  TTTT    XRRR*+(4(4(4(5TTTT      VVUVV    ZT:QT.+*4*44*5VVUV V   P%OPOP ;   " HDGH GH&GHGHGHGHGH GHGH GHGHGHQ     F!Q hOghghghghghghghghghghghgh(ghghghD             <   ,DD 8    HGHGH "   ?- "  H GH4 & X/WX G ( G   H)GHR  *B   PBOP  E        ('($! "%  !   =     HGH&/  H5GH&K       @.?@?@6?@?@L &j   PO : b$ *   &      pPopopopn      R @A?@ $h i    ?0 P#``  #  +4> =Yh$gqnm "h$gnm r mnmnqi #  $   $  % / D      1 P IU t C / Q*, # '/.   #- *&0 $4L $q " $    i &  `hghghghgE. m   (`E Ofpopononmpo      >&4 $Y*$f      BW&%'&&1T  iAnm r qn  + NG R ?DE>,? B 7( ('    * 0   &''''%''    J,;:)  !  % %  A   j i3 4 2  "            $ (>'(no:  8: TC T  iWh$g% +    $ 'M  ,#   W$%3 4        *: **8 (  X      }+%       (~C~h$g   $   '   ~ e !  ),, &3 /*  ~$ Ah$gf   $ N     !A$f ` 3Q3T  ih$gG  +      $  3m G,@!    ]  $ 3 4 AK3Q:T  inq rqh$gDr  +         $    =x N,G4! !    P     $        3 4 P\OPOP OPOPT  ib  +   D ,J  b  3 4  3Odh$g    # $ q  #  d$ H=GHGHz        )5!   . (''( '((    $  6B *)   $#             #$   %$-Y*+i #        :    ("-"  pop T  +03&#&0/0e87f+ 1 #3!8,  `m_`J_`_`_`,           ;1  3      ] H*GH'GH GHh !      XLWX:WX.WX2WX           8  8  8           888 "              s- D   /.  / =7  & 0!/03n  & f 8%)6-V      s1    /.  / =;  * P(OP:   - b 7)-5    4 (4    2  XWX(        #$  ('('((  ('( '( ('"4   " +_/4H   ^ $(2 w        _ $4 h*ghJgh.ghgh?\   *  & ![ -.      /53vr       $)2121213"F   "  P& FK +)3"F Y   ?X WXW$!" o$YXWXWX    Y"pS     C C'   : K,$  f   !G c/  L +#5#$ $<5  $ E  " o $ Y  }*l&    V ao  "?l   ^    lF  ' ,3~       tu   z[ l klWli   FW*<1z ;v%(&* *)    ;  R uv      ULVS@^ _C+!'0J(O4O     ,3g      R ,!%: - )CC2I %)>   &)  #   ?  :  A    $   /   \ / ` ; R J  A     $  = = ).  6 9 @; ] w " pg    9 >9       }$ JI*       M}  | <7 2   2 e E  )    "  7  *  "  ?9   /    C   "  &  ;        Q  < )# ?  :  A $ /\ $!`&#;*'R.+J0/A21434 365$8787:9=<==@A) Q +    $ 9 , 4  I?  ]  I  O   $ ( =    B@QC=9E@S=88ES&-  D     [  U  ^  >  E   Q   u / `!"!"`!"!"m G  _  >   E  ] \ J A A  $   $  ?  ?'      $  $  ?  >  @     $                  ^              _f_ b            }$                      -4- 0                            wzsv    yx              KNG J           c     }y |   H (   ! 6 ) "==  {gA ! % : &'<,&%A+<&$$*<XS@<GZOC&! E +/ -GJ`IK@+ +"I!$8#&+%(+' *A),8+.I-0+/2+14+3 6D58I7-D  [  U  ^ >E Qu $!`$#$#`&%&%m*'G,+_.->0/0 /21E434365]89\<=J@AADEAHGJIJI$LKNMN M$PO?RQ?TS'TUVUXWZYZ Y$\[^]^]$`_?ba>dc@fefehgh g$jilklk `'_` _`*@    sS E*        F9'(  ? X[=3%)      s .*.21%!"$2 12 &  ")>   3 C D$! ## H .%"   ?*L/'($ ?W-*hS   .  % .Qt*h  S >**^  sq     $  '   %   '"$$. * H   hgh*&P . = *)  21 2-.- 253 $"[7'")   6g*  < 9>;     # 7 .   L@% :     : #4/+"!"! "!"!"!"!"!  -  #  :   '$ R  :9*       A VU NM2' ba      E%ji8  }$f ++AH      ZY-'E"fe I     !  ^]    R $lf ='(6(7B6C.h W/B K ?.l   '!& G  !(~<+% :     : #4 $+   "!"!$#$#&%$# ( '*-- 0/2 #3 6 :7: 9<;>  ?'B$A>  >k4   $2           H2GHGHGH4_T   * xwxywx44  ]`_b   F+35 [   4 2 0D$C .        $y 4 "     4  ! & XKWX*4     p 9 o <5*'     0@/0(M$"  %# HGGH(=& (= F  ('('(8L"    "  hcgh482    !3G E 8J ('('(*  `"_`!_`_`,    (B to f]< ( 8U7878,0/H0 /0 l  "    . H?. H  ,-t X;WX7WX!WX,J B  " ""JB D,          )' #  ,    #    '   1    # pWop,M 1 M  POPOP"OPOP&OPOP OPOPOP=OP*OPOP3OP!OPOP,OP(OPOPOP.1 " "  ! " !"!".!"!"  "" ! " !" "Q  :9*   !  2'  ( #8  'B   ?"        06f ='&$:%!1      .   " #&) .-0 /2 14 58   ;8  P@OP4 =  }b    ]  : e Z     .-F?VS. .,-VS}  F#  YFY>)>=   @       HS        HX  ,-VS    D!O h  I .-F?VS/ .%%%%1.-F?VS/ / %%%%;Cp IN"1 !r  R T5 !-i" " &C*  2!   ( b     $#$#]&'& % .-.- PAOP >    --F?VSS- - $$$$     1 / /    #td#-                        .0- I*  ")  6    6 0"- 6662 Z%0;    ]#rOm=?e M4U-8- $ -,a5",;),C/X,B/m>&1, #C C#   A A MG#QTP       D $D _AAA; "      ;< ;<;<;ni<;  &.    !! WZ" """""""""     IL    ?st        &!!.! ! *0G(;= D# /  <"             ;" ! !"!ni"!    .  f8 7187   _      12H  C   Dl N P =2/)D,    ILU @?@?@ :96 7, 6 P*OPOPOP % 5 pop  . ^ 5   h ZT!" ] [ z %)$  %  $  A    %)$ c)!+ ,+        @#!    HWGHGH=,    B*=, &% & &% -! D   ?f  C"    " QRQ  F5NKLK&   # #$  ' '(  ; 0;<p  +  +,   / $/0| N7 3 (34x 6   .   i 7 ,78t ghG \B "32  H'J& ' '@& " ,3A KG!/U3Ki<4X0;3337*7C*)5I  #[     ?     #  `r_`*_`*_` " " r   m"f e"R    &   Y " " "  X3WX@ *  0 `}_` 16$1 ]7< P(OP5  8 f eLKLKLKLI      -0 KF 3KL  )=/CG)G(W   `4_`7_`:_`_`  , , /  * * -&22'  , , /   uL  _   '( '*+,+'9'7 0,8 0 %0 4H_3+B+'L_ | 2" &%1$4*/$Iv   1    $  %  .  $  0  (  /  #  $"$!N X   dc ni 9WX >=~{ K     |"! Om Wi ; FE|y /  `s9H  VUxu  NMzw L$n1  $%.'0)0$< `=  *P v 1   $  % . $0(/# $"$! r(   4  <  F      ! !E             /        &    )"$!             .-*  !!   )XU    : '6$ 5 #)M*D 3 %   !  ! E  /&)$        $# #        ! ># 12    8                 xewxy     9&C  xwx    170O R 13/X  &B:s t  3           .-.-.-,- !"bi\c_  !!                  $%  "#  !                78 &  ( '('(  " 0'/0 .' H%GHGH     6,   HI   FG       DE    ? )*                    H7GH'GHVGHGHGH  )# %)!&+   ! . *%&%  ` c-vuB:{,|s t{9v'uv.u              S =Z(] U-, 9. p  e U/!e jR  B:{U|s  1t     )   13=V4 %X*R U    1 x7wx wxwx wxwx wx wx/wx wxwx wxDwxwxS5          -           rqrqC      &%"  -  *         EB, -    -   " \55    -    C  8 *- b[\_hq    '']"11[: @"!X""!"!"C! ""!"!"C! "!    $P^ XUvq(' #   ^]% e /PP    ^]% e +PP  T   $ d   ]{5H#4Q[D ]a1'  ]W#!?X  >X  |w z ;X  w GOXP  '                   !      e6/fefJ1 +1 (B58U87[ 9%9'9)9v #X % %    }     ,   *K> ;   .  "Q  OS#)K> ; "!  "! 0/43 % 4!           n3 (-D "?3   "!~ "!   6>Lcji`8ct[3BSR $e' ts6L RQ L u2$U)R !!0[L <Ets6L Q  $[L E                  )?= :(:+:;v                   *   .#$   +$!$%  F  a3'C  * !"!"!"L!"! L"!    /0 *  e+,  '@  -&129, f1 y(*%&7+ K  *    L   *   .    '  TK ! F  X3':  * u"! "!  ;  b/9  u   (    &= 6  0/  &#% &#$=>;2/ &< K 28QZ2+=  *&t@ v       5   2 347W4't@  xwxV&      ' M- ;/&             2-&               2& E    JID I>5 3892  % ef  )*)-2 )2 ?2  E2IF   GFW2;( CF f/ ? <15A68_ Xj 69 %q ) O _6+  X%WX&2   r& F  L2/)&   A&"F    0+ 8    %  -+  #&%   )  ( e  !,     (   f  h/ ' 1PD4I?2699 4 %"K) (  ; 6 9   xfwx&W   :W  &!    &34% &  !&   # " &( )"EC: >5) 3   6   &"C     , Y&kZYVY@k&%/". Y37 -= (" "DC'C.'. Y&! ]  % e RQQ,NM M9Y(+ 5#(  (    f%y % ]B0 ' 9M]IM@g9[79AG !,;^86%  *  [6   xowx&L     EL     & G $#$#$! $  !$#$$%  (7@ _   G A&! '!G#"J 5 "!"!H !   ~_l}lk.  41  ?l=$5 *A  ) e l9 l+  #O M I  E%@#&  -  _loR    &  e   ( fNfe5 -/  b2 $ D)=+ Z87=6>'   )*  5 & #7   6$   & *   .'(   /(%JGFCB?()$ F  j3'L  * &!  _  #$-    ( $C:  5 )    6  $&+!G! "B / "!"H !    :9LK:9 4#'  /  ) e  A:+:  ) /0:=,9    &  e (f (fh 2/ 2 % '3c6Xb 8769!+)  )  / & 66    :&   0// $!~  rqx({ x  {=5EI!"L ) 76: 2& "!"M"! R "!"M *[ !"!   0 => / +  e '0  #0 *O0 +  e +0   -( !0"!((+ 3, f f2  l2 T5CA8+ <  * 8+"L 51 +  " )  +  *  "!"6!4 4 J  4""" 8578784L   >'4    ` xQwx9. !) 4( #44    `   @"?@  "     4#  ` XgWX4  !!!             n !2  ` 14  0   H% 2<00&V  0&/0!/0/04Z !9"!: ".@  L  " T -`16 X#WX"?B:]  B:s ^stst]V  8   =  8 X *EO?         ('('(    `&!@ X:WX"UB:]  B:] ^s tst]          Y 4 [zU            `xs             ` h"B:]  B:{     !    ^s tst] 43                      u 4 < /  4       !"!$ %*)( )"! "! ,+         `           `               `       :l(     W hZgh):o6    # I0.9o +:V ( 96+   '6#(/V l2#Ds `U_`#:   "*t :  .+,% #, /#`  )  &F pbop+:    #S P3OP%:d   $ ,/<D<HJLN<<\^`<tv (< :s 0 /tx    5   z        J2     /B:s  t         :9 XW    ZY TS VU   :9 @?  \[  2 : :s  t}t  !? ~}  |{   !       !     &   $*+     (k]   * )*    +m4 +0k] )H+4(  /W"    * 0/ "$5  M,F .M;B/    /W"  >(Q6 (/** 0/ ++( _x   '# ,,C  ,*"!/ _x -("  "?/>  ": 8  "!x s  {   PMjgji    }$@&Q \ o  O5L 3h c@*-8 ='<7%o " 1S $S   9    "J"  "? $ > ": 8  ( _2   '#&C "!, _2 HcGH( T$ # 0&A   (_/ S3`U'#* $  .(#.  ? )14 ' "!;]#!!_/ S3`U* )(L[ ;" ;/"/P @?  '5 .- 5%**  "5n | y #)W#,"!O  "= "4 5(L[ ;"  ;  / "/ P =?(n+*`((     GHG  '#  bIJ N   1+ "![ $n+*`(    ( 6   &  4ZYZY:(abab'9ZY&ZYZYZY[ZYZYZYba:(aZYba:(a :,e ZY:(a:(a2ZYZYNZY$ZY)ZY)ZYZYZYZYbaZY:9ZYba)fC !ZKY<YZY <;<;ZY"De B  /ts -i -e -a    -]H#+H##$$#$# '2  -,-(--  -*  -w !   -&   -;N   -!`   -3 r   -; z   -C+   -.- ;8-.           :!"  ,+  - }F 5 1k14  &[     2N$))&%$  !"!$#) &%-*' *)*)   6 565        $*** *   :.- .-7(# $#F"  ( 8 *  25G "     9( " " . ^bM= A. s{! )  :  , !! $   HGH  M # "!"!"!44:79:AM UXUX YXh_!"!"!487          s,-VSu,-VS                           M#      7"Y        #$ @?@1?@ ?@~1qrqrb  '  ,1|  '   0/0/0~*b a  S X* ~~!   `_`2_`_`_`~    ,B POP OP"OPOP~x     e?) H%GHGHGH~qp '#~qr' ''  ('( t     . Wxt      65/6      5/64 \YZY DA87n $0-  *7J $<g s =  >   &  6 $   $ UtDAJ  * $'*D `$_`1_`_`t !W XWZYZi"< , (7 !tE 'O U t m nm     _!  t     8078 78l,*)*)(2  !  ,( lcdc dcdaN      )1,`& a h/l  -.-.-.- O!0D 8A F    '     5  n $ ## t8" l  l2 LD  "!+Flk$  !!5   )    --)f2`   xwxwx Le=>=>-  8$$$$q(JCH = $>(e- L@   ('('(   popopop0L=>=>=> =>=>=>  =>= > Y'7( %%% % 'ov!)        0L$=>=>=>=>=>=>=>=>=>* <Y'r8765%%%%  (  'lBp;$    *   < 878L dS   U   '~ 4L  , ;    3N   D    ,;  L ,-  ! 7   !  & ,- C 4L h  ! 3 . h 34L Q   3  QL<"]`xL1  PEOPmOPL  ,%'4       )dL2  L=>=>=>E=&@"ELAL5L CD      xUwx wxL'      .'  b   L >      3 -40 >L    L  CD        ` L B      . B  \   L$[       J%2$[  p/opL< LF L*    LH  XMWXoWXL  ,%'<      $)f  L!=>=>=>G=(@"!GL  p>opL+  + xQwx wxL+ % ! $5+L    L"+    "+ ^   L&[       L%2&[  L #"!L CD G H   n L V     , % V    L4=>=> *      g'`4 * 87878L !    ! `W_`L 'CD   &: '     L y    7 % y    L66 '-   "   a1 +G66 "- P1OPOPL 4    4L $CD         P $   Ly          $  %y  |#L@        f:  % 6@ XDWXWXLW ;L 6       B 6 Lr          r ~#LB        h:  % 6B   <        % # ! L :     &+ : mL F&            F&   L86 '-         "    c1 +G86 "-L "     " xKwxwxL Q           Q s L"=>=>               Y(V"  @?@?@L = >4=>     4 (2    8:78 78 78GB     # 04+G H'GH GH    %    PYOP OP OPW!      = 4JW!     `2_`     f  CRdcd)cF*d J     I      +BAB('   eM>i 7G7CR)F*      h&gh;gh53       =53 HGH & %&  4   H/GH&%&%&    >* 8E787878;"%&%+    3  4>;+ pFop$&%&%&%&  OTvuSTSZM:&A$ d,&%-&% &   ij  ip iU+,-  f"eO"%&%"%&%/  4  3 $   G K09JIO/ pop=op+&%&%&!&  12 a?7W+  7o4D&%&%&%&%&%&% &%&  QR  [:C7*)D  &% & w x  &%&     8* 88787878E&%    !*   /5E pFop% &%&%&   ;&B%  ^Z&% &       O+Z  L"X[&%&%1  4  #3 $   >D,#)F@[1 pop=op, &%&! &     @7X,    7i6E &%&%.&%&% &%&     \4D8%*E .         8478 78 78    # */(       POP%OP    (        HOGH GH GH     6  /E             `  dcd*cd J    I          ('    F?c 2C7*        h&ghCgh6 4        E6 4 H GH & % &   59    H.GH& %&      7*      ! pKop% &%& %&       ;%G%   cZ& % &      O*$Z    4    #3 $      popBop, &%& ! &         @6],     7s6E &%& %.&%& % &%&            \3C8%$*E  .    !   !! 8478 78 78A    # */,A     POP,OP/    /   P/OP"   " HSGH GH GHO!         6 /IO!       '      '' d  <udcd*cAAd J          I      ('       J?g 2C!7<u*AA         h&ghQgh6           S6  H'GH & %&    <@    H5GH& %&       >*  88787878E"%     !*  /9E pRop%&%& %&     B%N%   j+/& % &         V*$+/   L "\["%"%1  4   #3 $    >H,')FD[1 popIop,&%& ! &       G6d,     76E&%& %&%& % &%&          c:C?,$*E             #    POP$OP                 `  dcd+cd J     I       ('   F@c 2C7*          HGH & !&  .   H-GH& %&      6*  8878 7878E&%    !*   /4E pDop$&%& %&   4%@$  bY& % &        N*$Y   L"W[&%&%1  4  #3 $   >D,")F?[1 pop;op+&%& ! &    96V+    7k6D&%& %-&%& % &%&       U2C1$$*D -       8:78 78 78     # 04*      XWX&WX         PXOP OP OP     = 4I       h  dcd*cd J      I      ('   M?k 7G9*             & !&          8>78 7878K&%    !0   45K pKop$ &%& %&!    :$F$  !         Q"\`&%&%1!  4    #3 $   CI0#)J@`1 popBop+ &%& !&"     ?5\+    7s4D &%& %-&%& % &%&"        [2A7$$)D  -  # ! #    !!  8:7878 78G#     # 042G $    XWX-WX0 $     +!0 $ " $    !"  P`OP OP OPW"$      = 4QW"%  h787878K"%'   % !0  4=K pRop$&%& %&'   "### ##A$M$  ) /& % &(       # # #) /   Q#"d`"%"%1(  4   &#3 $   & CQ0+)JH`1 popIop+&%& !&)    #$$$  "$F5c+    74D&%& %&%& % &%&)  ! #%%% % !! %%% % %%$b9A>+$)D      )# #)   )     # *$ $*    *% %+   +     +% %+      h  dcd+cd, J      I      ))) )('   )M@k 7G9*- ' '& &-     ' '  - ) ')-  ) )  )-   ++ !.  ( ())) )).      ) * ).  4  --#3 $  ,, /  ) )+++  (+/  * *+++ +  +++ + +++0 0  **** *  0*** *   0 X9WX WX 0 ++++  6 1 1  ++++ *  (?'( '( '( ?1 +++ +     '   ?1  1  ,, ,,,, 5"   Q  YK cdcd*c Jd2 ,,,, ,"   +  ////  ,,, ,   07B H ;ZT6 c* J 2+ +   x3wx0wx@   2  ------- --- @@   3 P?OP&%& % &3  .// /---- . GB   &%3--- -11     3   x& )&%& % &3   ..      /// /.... /N?'& )   p9opopop$opEopop  &%[ &%14   ... .22#  ... . 22 + !2 ;+K)  [ 1%4  - -'%  @PM &%&!  &4   ./000 /// 0aE=!M   55  //// 5/// /  55 0000  66  0000 6 000 0     66  11 1111  Q  ZK cdcd+c Jd7 ,111 1"   +  444 4  111 1  57C H ;[T6 c* J70 07  2222222 222 88  333 32222 3 &%8222 266     8  8   33      444 43333 4 p9opopop$opDopop  &%[ &%19   333 377#  333 3 77 + !2  :+J)  [ 19  2 29   34555 444 5::  4444 :444 4   0/0/0:  :: XGWX WX:  ::5555  C6;;  5555 ; 555 5     ;;  66 6666 < ,666 6"   +  9999  666 6   :<5 5<  7777777 777 = pOop& %  &=  8 8777777 8 X5    (*'('('( &%= 777 7;;  8# =   & )& %  &=   88    9 9888888 9MQ&& )    p;op!opop opIopop" &%&%V &%&%2>   888 8<<<< 888 8;;;; -4 5)?7" V 2>  7 7 @TM &%&% &>   89::::999999 :`H<'M  ? xOwx  ( ? 999   9  (  ?8988  , ? xRwx wx# (? 999   9  L# (@! ( @ :::   : @! (  0T/0 /0 /0C@ 9:99     9 A8C@ b   @  :   :  :::: :5    e  Y_fdcd*cMdA ,:;:;$   +  >>>>  ::::   >IB \ M\f8f*MA: : 3F@  A  ;   ;;;;;; ;;; R@  B hUgh&%& % ( &B  =>> ><<<   < = ]X  ( &%B;<;<@@ ,   B   & )&%& %  &B   <   <    >>> ><<<< >QR*,!& )    pJopopop$opUopop &%[&%1C   <<<<AA#  <<<< AA < !C  K+[) [1C  < < @eM &%&! &C   =   =???=== ?dU@/"M  DD >>>   > D=>==  DD >>>   >  EE ???   ? E >?>>     EE  ?   ?  ????  e  Z_fdcd+cMdF ,?@?@$   +  CCC C  ????   CIC \ M]f8f*MF? ?F  @   @@@@@@ @@@ GG  BBB BAAA   A BG@A@AEE G  G   A   A    CCC CAAAA CH   AAAAFF#  AAAA EE H  A AM &%&! &H   B   BDDDBBB DM  II CCC   C IBCBB   @?@?@I  II xwxJwx ( I  II CCC   C Y!@ ( JJ DDD   D J CDCC     JJ  D   D  DDDD K ,DEDE$   +  HHHH  DDDD  HKD D@   K  E   EEEEEEEE EEE @   LL  GGG GFFF   F GLEFEFJJ L  L   F   F    HHH HFFFF HM   FFFFKK#  FFFF JJ M  F FM   G   GIIIGGG ING G  M* N GG G*G .*  H.GH GH GHN      < V*%N GG G*G  .!*% X;WX WX WX WXN      * = OH H   xMwx wx#(O HHH(H  .#( xVwxwx wx#(1O HHH(H   .-#(1PI I  N* P II I*I .*  XKWX WX WXP            2 W*%P II I*I  .!*% XTWX WX WX WXP      )  ">  QJ J    [  " Q  J JJJ J"J 1  "  hXgh gh ghQ  =   4  !E i$ *"R   JJ J*K  -.$ *" xewx wx wx wxR  ?   A  QR  K K  W*+ R  KKK+K !*+  HGHGHGH6(%R   QP  @6 j*+/S  LLL+L ! '*+/ X7WXWXWXWX3(%=S   RP (   E3= `K_`8S   L L<8  & :# S   L L    LLL#L $& :#  X-WX(WXWXF(%)S    SQ +#F)TM MT MM M*M  xSwx wx wxxT  .   >  6 Z*'T NN N*N   .!*' x]wx wx wx wxU  7    H 'BUN NU NNN(N   xPwx wx wxU  ,   ;  6 Z %(3V OOO(O   .-%(3 xZwx wx wx wxV  4    E $BVO OV  P PPP P"P  z  W  U   P   ] m$*$W   PP P*P  /.$*$    W  ^   Z  'i P5OP* &#( W RPV ]%'   k*&%&'('- ( X  RRRVVVQ-Q V  !'-   pFopopop@(%.X     WU5   5@. c'$&%&'('( X  RQSSSWWWW =LA$$  *& (&%&'('% ( X   Q Q    SSSWWWQ%Q W M|&'& (%   bP(%:X   WV E   3P: :           F?%. A /  +  <~#U"  )"{|{|{ |{|`{x 21..** A "" `:r*l" 3 {|{ twt _`_`&!"!"_      qvuv  _~=      &  ?    >!8       `K.-   KhgXghgT9hgX+7hgX 0  /*Y\ / 5  J6 ;5HHLCK&M!8 I    )!"!"/)|       n]:U   :):="!:A-. 9>=. -> 9>=.-. 9: =:#  C  X  I?D :  8L5t#Z/)|     2 _`_`!"!"]K L1_`_`K L!_1 $       3    1  / 2D4" i  ] 1     !   T X  {|{ t9:wts t   ,  6%          ,   7 3^mA.~{|{| {|{|{| { |{|{|{|{|{|{ |{|{|{|{|{ |{|{|{|{|{|{|{ |{|{|{|{|{|{|{| {|{ |{|{|{|{|{|{|} ~V ~{|{|{| #$ )*'$ " """""""""""" """""""""""          ""t7.                     "!  $ #& #  2@"-.-.{|wts t{|wt>!" {  s  .0!    > ,7{|{|{t{|{|{|{|{|stw ts t3{ Y ))RII\ K "B0 7           3  v7{|{|{t{|{|{|{|{|stw ts t0{|{|{|-y|{ ; ))4++> - -,-VS= B@(7           0-  ~7{|{|{t{|{|{|{|{|stw ts tB!"!"!"/0{ ))   r) 7           B   wr    =  iji j  ijij  'ijijPijiji j+ij+ij^]    ^ ]^]^]f /056     => ~} " MHAB    &=  -      6      7',,    +=0-     /U   8&C F   z,&lWY(\E =     '  P   + +   X9WXrL   , r+   "Cj"!I")-"!5"Cj"!++H"("!I"!j7+8"$+`NL    :9R  C  =bO N  I     #S   Z  C  ~ :9R  C  =bO N  I      S   Z  C  n :9R  C  =bO N  I     #S   Z  C  ,,} JI*@' &  m( ) L  M    ! Z  C   rq:9R  C  =bO N G n #) M"!,, k %B7 6 ?  > k,_!Bi! H!(,! 4!Bi!  H!'! H! i+ 8!# h   J{   $ !  & H?*YN  :9*   !2'( #>'H1"    " &%   7 & '  .  !  . <; ,   !!4'( #: =$)J1$    $X@>)`   8$787878 Ul   / v[i__#b^7   "!* 7: 9:1 2, ?B AB9 :,#" /2 12) *,    ,T4GJ IJA B,% '* )*! ",&4OR QRI J,E @ =   , " !" ,D6(%%"%%5 % %) %?%%>1 ) 7 -  5 @ ( ! )@ 1 , )2  6  D  :  l    ,     `  a  9  b `B_`?   +  $#$ $<78##+$ $6F8     +    HG--VS  ;0(        hXghR   +  ### #\#+# #OZLH    +     ,-VS$9(      h\ghR  +  ### ##+# #TYPH    +     ,-VST 9(      h^ghR   +  """ "% ##########%$"+" "VYRH    +   }G,-VS    hdghR  +  """ "% ##########%#"+" "\YXH    +  P Mw,-VST    hMghS    +  """ ""+" "C\&d    +  H3GH    4 1 ,-VS8 9(       hCghS   +  !!! !!+! !;Z&Z    +   ,-VS    hPgh?  +  !!! !!!   $!!+! !&H!X   +  X3WX$WX F  ,-VS;%F    hugh gh?  "+        stsrm  + L  G+d        +  HBGH* !"  C,-VS "F5      0 <   0% 1%0<    +  H(GH   ux,-VSq9(     _         +               + .2:          +   ,     + (      (((-F?VS-((-F?VS( (^ _           +       (    X. ?6E %  ,        !"!+" !#&'('((  #  '% ,           (((-F?VS-((-F?VS( (. /         X  ,          H/GH"GH _  %#  J   pYop;op7  6<6A*>. # # xrwx?  \+ < %%% %%% .%%+% %NH%T  \+  @N?@?@# N ^] ;:#  8=7878^ %%%%. Gv ;  + HDGH 9 ~  9  29  `R_`?  <+  %%% %%%.%%+% %.Hg  <+  878 1 % 877878 $$%%( / #)  @I?@?@   +,12?0   H+GH8 ,^ N  efD     j7(  6O;     & `]_`? }~} ~}~G}~+} ~> %%% %%%9%%+% %.Hr  G+ 1L %}~}~T %%%%}~l .. )t }~}~}~ $#M  I  z}~wvuvu vabab*a #$  2 F8 * }~}~}~}~} =>} ~   x*wx <('(x  ( '   c ,<  34 ,+,+,+34,+34,+,+,+,+,+,+34 ,+!34,+ 34,+34 ,+3j    56  56 +3 43 434.,+ZH), + !$#~Y AsKmW/b    WX )  X\&    \\& XK  '*R. EX\&&>r\&  <,+%L# ef+Q38 3 2 34+WX QB  i  G<  \g ^ # ,&  '3UD5Y<C#51)          !          .ZH)     <+0/P$#0 /0/0A;0 /A  ?B *$  m*b  " 5 J  -O  ! -9#:+P$# ; APD   ! ($'( '('(P    ^ 2/0)#*'(*'   @g?@*P"  !" )x GH$  VU cdmn!*3)?L$7#       `'_` P%  $% > 1@P    : "  !" / SVUf.-eh   }!"u lkp! k>>< :     / ZPG       (' '@-G n lP1 %&    &  763612-.  U?3&# , ! 1) 4787   .121+       34{!0p  , B "74y Yz8xwx3C3,      ' 8 3 xpwxwx wxz   3       \       5n') 3  ^vz   k l kl      \kl                "  P   (    \ xwxwx$wxz         $       $     0   s8;4) $ z.klk l DCDC   ,-F?VS\, ,7    ('\" .      =V UVU[VU^|  .721    v3=8 =[^ ^<  3[&8] Y^   &*    *'  >/ ,!& f     k    >=     ax$+> :  < 3 [ Y    & S 87%8 787878  '   R       '         8     R$> *% ^G =S        %     8  &8      $$$ +  4 %B+X      W    + + 0 D( B+   hEgh#gh| mnm n(lJ2B  0"   C    v  "!r$ #K#  X~WX|=QR(QRQR +*U =(|2 & r0"|=$>, (   $   ,& 0+ +$, pdopop"|D=$>= ( $  Q =&  "D$= XZWX9WXIWXWXWXWXWXN| '           $1 :!  -   H+GHGH  " :|( | 878     `l_`_`| m n mnmnmnmnmnm n1mn        C      1  | mnm n  $  | mnm n     HQGH-GH| mnm n mnm n mnm n      R        @)|4 (" @?@)|QR< (= 6< ( (|mnmnm n | m n     v   Z         0     #8{#          Z          %          Z(   /0 %  J FCD7 0-('(#$7-.$! &_`73          5% ):   1    9O( $,*"37#*         %Z(   "! "!$#$# &%('('('('*+%Z  Z /. -0 -   +   hLghZY   / 'Z:-0/0/.-.'-   Oo 658 = /k %5$:'  hkghZg/0    pi Ng ZF & 2  Z    KLKLKLKLKL?K #$#$kj ( J            3  Z   (  5 %  '* $ .- 2 %     (,  ZK ;. ZB +%   uZ  VH  1Avv "v*.   vI> 9, !(LvT`   vKp ;!*~    ;v,    ;    ;     ;v#      ;v   v3  vR B5 !1 H5GH GHGH/\M NWMN p      Q  W  (\!0    ) FF" 7\ u\  C  ^  I  O a1O POP.OPOP,OPOPO aMNMNO P#     FE  BE <;  8;      ('  $' ( .1  !   !    '  "   $   '           -? % @   :1 % TF |'G 3=E! ! C^I  1  ., "!"! # H2GH GH\M N MN'MN     $'   '\M N     \F 8 . c  5    * \ ($'('(\7   d8RT  0     $87A @,?@?@ dF & - d - n  0/ "N 6 6  66'!; -  HH  ## +=0        9 I` ?    ! ))) =9A  !) 4 <)-  ('(d  ./ / L        !  (5'( d5     /5d  d st    d gh   dWX*UVUVW    "#89  *%$%     +0   :=; ) d'      *  dB Z  {|{|"(6B Z e2dH# .  "| H# Qd?  0"=$?  .d Z     )-{ &1 # Z x+ df= *0  IZ`f= p5op op(d WX^ ' '='2 ^ d$UVUVU VUVU V= )))-F?VS-.   3 $    =dd!   9ad    ' 14+HH,+2-)               f@ '            POP!f;<-p  .-f,jd^fXR f*Y Z;Y Zm    go20>8_`By C 58?# !  ! ) )    +5  * ; mf$ \fWXWXWX WXWX&WXWXW X0WXWXW X;<1W&Z-onohST $$$$UV[\VU&l+!Bj.3H &     0  1 - 0fWXWXWX WXWX&WXWXW XUW&Z ]^YX=> $$$$?@& Bj%5 &     U   (fWXWXWX WXWX%WXWXW XUW'IJ-. $$$$%/0'B'DW %     U  `_`_`fWXWXWX WXWXWXW XWZ 5612$$$$$$$ $ ?',&      `_`_`_`(fWXWXWX WXWX%WXWXW XW'#$$$$$%  'B'd %       9f8 I(&480K 8&    ) !  = 0 8 xrwxfWXWXWXWX WZ ,, B*   mIf "WXWXWX>WZ    , :+ ">  pAopopopfWXWXWX<  3< PAOP f WXWX  ####    8)7878fWXWXWX    Bf Y ZY Z8   C(&480E 80    ) !  F)0     8 X'WX f        oIf "WXWXWX@WZ    , 4+ "@  p>opopopfWXWXWX<   6< """"   f       w4.&6<"y%   + W 4  fWXW XFWXWX+    "(8  F    +  hjghghghfWXWXFW  MGF !!!!  P 2gfWXWXWXWXWX WXWXWX WXWX WXWX WXWO WXWXWX3W XW """" $ !!3! !-           3  f+  M(&480O    ) !     01+ f "WXWXWXWX8WZ    a* "8  |If :WXWX2WZ  , =+ :2  X/WXWXf55   X]WXWXWXfWXWXW XW  D"  fZ^J ' 8 D  ((59'GZ^J XWXWXWXWX(fWXWXWX WXWXWXWXWX(W' '?      ( P[OPOPOPfWXWXW X%W93 % pPop op4opop6opop,opNopop(opopf WXWXWXW XWXW XWXWXWXWXWX W XWXWXWXWXWX WXWX WXWX"WX1WXWX# & +          (bU                    "1#p      $   p   *        0*/0p=0 1 0/0 p  6       p     <  OPO      p  R     hghghgh p   Z   12+ !  !   %7e!3    P)OPOP p  0         0  XFWX p                    X/WXWX p  <        <  XLWX p  :    0/0    :    BAB   0#/0 p       vuv    v  t  pp  p      0/0/0pE  . p    p   p   hghghghp                 !  !   9_"5!        P&OPOPp        =   p        niA        X,WXWXp       I    XJWXp        G    p          p h@    h Y Z Y  // /     hY Z   h  h8     n    V.e' 64 POPn                    HY < ?  jfN|7QR  '( 7|  0/0/0L  d  d  rd ('(' fe<;!ji ! |{ X!WX|{       &8    !          zy    878z y     H'GHzy   " 8!78z y        * zm      h$gh p op 0/0                     :9Z:\  -g     V:9     VUVSTS' ^]^[\[' 9 *,9    \STaW' 3vA3 "  %:  *  2  "  !& !"!8 (   $ 4      0   , %&%< D?'        :o % % % % % % % % ] Fj!&!{!;!!!!!!!!!r $         1   $ # #-&%g   (('('(  !"!"!"#@+ ()'('(  1212123A, #   0  @?@  L        >      _ G2 50t{  ? .!>  l  0/0x              '  (   @#?@?@  2   *   *   @&?@?@   1                                           v s  `             %      ~ }~}   ('(jk  8'78   (   POPOPOPOP.    ! p?op\ @  .   p(op,opopop|opopopop opop 6g t          3       ,' ( 7) \6g t )P " _ " @ 3"W. 9; L/) K    #     #    #/  ?'' 5 @ !  4%2 %201&E 9    ; L/) K \ I TQRQRQ 1 ( I2 *B " 'P" 1 -T  =>=>>= >#9  1 - p$op8op opv    C f%  = !2       K" = !   0$/0/0/0b     Z6 L d1O~  $/ " !  #        3&  oVNE(--6 L dO#   s t )#   m n  %G0 ) (     >-B 0)   (   7    #D c    FE FCU XWd2# & 1,  uZ    !" )  %  ,+. 9,E,+87 @+: I @?@?LK|('H('%-&#  K, G D E 7    *   -  *$*" . xiwxwx J       E 1   pop of        D! \  $ ,'   T!: !Z:Y G, !:  PAOP .-2165<; 3  ,'  xdwx ,  livS    Vg -$K   MFEPOP ?6E>OF1>Y<  8w788   W ^]`781 2 afef 34- .-.-3T+#$FQ(     H@GHaGH. 3%&  1)(    9 c21$[,   <  hfgh    ;'?5 !  ('(  a< ! XEWXWX  !! @{?@     hr !  6' 8.7878787878       A 8L78     # @!? =   "   & * % T2GN'66   /6)        12]P  ,    wq p&6 J 0  L              '   + N @  ba"9 "   %     #9       '&      STcd =>  *)+   ('   :5    '& >1Q \2:G#     XWXA     6P0   I    !'   G:%8 D  C   4B  /B<  )B6  popopopopP  O  >        !    E88,1 1PO   Y*P    ~~zy jipodel idejk<CD C>#6%5          * & c | NMTSJKR OJKPQDELIDEJK$#>=D C " !       5    /I lS&     5        "& c    0&(*x   *                #< C #%$J /    POPOPOPx[x   3 H4GHGHGHzefij NMNML2!0=    $ 9# zif 0/0/0/0/0z@f     $ `3_`5_`_`z    ?6 ' z A@     %0##|Y2 it< zNMej efef NM)NMNMglP'  & a-,;!0        o)w'T %     )  hMghghz@  &! "!" '$    ( '( '(z$   P'OPOPz: ' m nT bab_ 2    1n oUE$/  < ;- v        itsx'(-4 lkn   *    #  /    <     ; -  hmghghghghghN O     ? @   C  "(IN O          , ba@       % qt   i\ @#A    @  )   ? . 0\/0 /0 /0      * T-2  7 M        !   x,A%e7 M  x0wxwx'          Z'  8.787878(    C      C+(        @   0[   8              vM.%)[    8 A 8  Y       F '&=6Y  , r}r,5 , R "B> H          !@?>= \ pklkjmh( G"K                   tyzyx{vs            ||FR           "!"!$#$#$#$#"&%&%('('*)*)*),+,+.-.-.-0/0/2121B ?      L  @?@   $ . tq & &&  l /    | !"      6 !-(/      pbop*   !"!   1!'*          Zu    cR      rO& 5 /!B    , Y ZW    & X0&  / !  tV  !"%   4'     5!)%B 4 @ Xt   ?'<3    p+op !! !!! *8 , 2121F    $  $ *:'.8  <?       ^  - ! K <    R#J  "^   >9 T 7 6 &;) R J  "  'tststs JnQmn=mn  XW^]d ilifcQ<1 RIJI  @ 6=}B   2 5:L"   B   *% R.        J  Q  =    ! 7    - x$+ ."  , U h    . vuv IDG  ('('( 6   r[ ))     6 7878/:  5@ ;F         - S         ?h =  $P .   ))   ! V   }        b "  & pKopopop   M +  ' <"%* M    3 4 XJWX WXWX    /   # + +! #3 4           "? _ o     #( G    # `L_`A_`  6 /0 587 0 /074 5678 5 '       6 /0 587 0 /074 5678  XGWXWXWX   /t s, +   n#;  / ,3 4 W !   a B  & > B    `_` @ G18    69L$  >= =44  C4 ]#= e#=m#4i#4r    / , $ # "  >= = 44 XIWXWXWX  KKL L  0>  L w+18LKL    6(2 7 8       1(4 %V3 D  !@'3 +(3 D  P1OPOPOPJ    "  Aw70  Lzy44==/; (fifiFF `  #$        &   #4#4#=3333#=#/ %  "     ;<Pw r  C%   ?2+ !@ 8?  "6#@?@?6 ! -   Yp  6   3*< @ B 7!'"Z) %    !  "! $#4& %(-'*  .   2 0 *  S=@?/<.-EHID KN 8." +_b q    C  44="#&'*=+.//;21 434(367:;> =R@?DCDCBFCHFGFE43` `8_`$_`_`fijiE"    L)Efi5  0!/0/0/0$ $ xZwx83       % 3    :U'<3     8M78|,{  * )$ #3  H       @/?@?@?@ 5    9 5 $     $ %.    ! .0      9'"03): $ % %        ('$      1Ux-popo ( `~_`_` _`_`ji  !0  +   >  '$K"   82787878ji*  !0   0!*   847878jivu v  !0    3!    @7?@?@zk   i     WJUZoyZxG!6B<   ( 5      )" (    $   $$$ %W>! RJm " F % J(! ,# C #& )! - 9 ! c o R  % %   2 .   . F E'  c            2   'c           v, X   !  l  (      @@?@        A  2@*      m #' ,Q* R  K' ,S*  :  M' |*c /0'    ? (@c / 2X  $C %%>& g    : $!G {)=W,+,+1 / " >#  0#&    * ,^( 9-1 =;= W e  '  G 2/  &J0"I  43. 12   0+,# #%  $ 4<  "+  N G n  P   _ r 0 #*9 [iR|  @ 12#& / LArSJ C *74G.R &3  <3}0  !A  0 peop opop^9!0.     =#)7^7 v "b + +,H      2 5-B,9 0i @O6 5%    TO % pfopopopop_!0 2   * $I_ 00/0/0/00!0   6#0 =7 6X xwda       h B9d  C  nwx: )1P Q=1.  7  XI%%h  "+03    ,41  $ 6s    #      A  Z  e  H      S  = tklk G>#4ux  T  B^ Y   &eB Q24& o!   " 8  ,!k I O ), M :=.      G+"/    3  4 $ s#AZeHS @ ,=1&%       ,+,+3  P   #=e  a d c f j g he  ( ; "  &  rh 0X  $() =   3P =    %Z       -    -V&)% @-?@?@?@, + $       $ h>ghgh gh gh, +,+S  #  D  2 S   &r       *s " $    &   \ Y        !  X4 /"  5  { &. -.-]    < :   ?g\]\    0  L3 7 )2)6  @   ] p_opop&  &%%'        xHwx wx&a        *  (&        )1[(   4  9&       m} 1&G  7 ~eu v@0 &} ~   A  (Qe @ &u vuv r  *)*)=u vuv1  %   0 ;lA H   '  . j z%  1   r-G`  r  =    X;WXWXWX:WX$WXWX  #7$- 4#+% +3  ) Q 4 55dt')    @Y?@f 5G  +8    ( ,0   '  , 7$  #-$  (_'(B  (u'(6A  ('(@[   P"3f      Q"  7#/? 0       $      #    :  $ }x{| '    -  + n9: ' 0I ^ z y-A0     5  N QC  ]& 8  -0MT&E:)\8'8:  '6  L! ai$  -!V$(+$)",3>3  0       #,  878787B "  &/0: 5 & 4d7 b- ),   I `   1<)7JyYPa  | & ! :   @5?@6w    P   Y )0 % #Xcd_`u #$  4      ,+-PF 1 $  X,  8,  8  5    Y -   1$#2  1 5    Y    !V >yU > C(HT2}GT+X          F          $Y     Y !!4@   >(W>2>@T a T.F       }=  Z  u    `    C   C   C % U    C ; +C)!C)C)I  &C)-5)>*)>& )>"B < *)>  =  Z  u      `  f ="     - "         2   U     p  #  # ad &G-(# .-.-&   +45f .    d 2 2 Ii2,   8   ff  S "K*- " ! 5LI    YHAB=      YF9  F{   C  + 5          W >!^>L C)R;BG(IT$PT=L)># (  0i2          Y  F$#$#& % ('S*)*)+%m E E @ hbgh  UVOP UVOP+,  `N_`_`_`j    %   1 . 6565H   `5 LUZ  '      ( B 3   -<     m9 "$ L!F5 m1       5  B xowx  M   UV  OP UVOP   ,+.   ? *   *   & L*  @?@'$ $ $ $   @?@?@?@?@?@?@?@=\[+^     -4   B-=+  H G D C  adcd      ! 8*B/ #Y     9  \  mx  Z ]   @2 $     B       j@=              5>   < 1                 ,"/ , ) N      %GH   "x.   IYP 8K;V0$B %G |}   @        ! ; j @  < Tl      '.    1      !  -      ( "  / " mAP F  0 \Y    (X,,1P   HO   5  &9r HI @-?@?@   v  3KF&$D P OPOPN 2   WXWZY WX WZY !WXWZY $WXWZY EQc\    +  .  878"   $#  ) ,+  E @ %04 % $ _  ,                 9B S     878578787807878   7U H   #.7K .'*At7GN S  (,+ R"$*248:VXZ\^`bdfjlnprtvxz~ POP b                     6 12121212                          0/0'('('('(                                     @                   HIGHRVV   $ 0J/0/0/0z*   '     enZnZ nm[   EB;   !  cAH5       [ "+ail $!%0'  +,   $    & $2 2      !']B,A*         Qn     # 7-  9B      "         ~ i |}~{ d 9K0   p2op op0opopop1     : -.- 4-S $4   pFop op>    &&1 !  PCOPOPOP+rqrqK    " 7+K `_`_`_`{ |{|{|#0  #wx:  &D pqpmtsjJ8 >D-2' /V" 2  8 r7      !" )* J  N W8 6nZ%5Q +)&JFD  7 '  JE  ( 02/0/0JS  #( 0/0/0/0J+       2 +  J6      ]~J h ghghghg  -  - $  2@[@N%     HGHGHJ% ,% X;WXWXJ1 .1 @?@?@0  : `u_`       :                    6D  .# 3&  " D6^  ST  % f*'.1 25 69 ! *- FI:= "% BE  >A &)NA)++0+++4++0+8+<  ,#'#  1   H 6  E HGHEF     @?@ ?@6,   6 x]wx 6 L   O** ! C-6|{| |{|      |{K| |{|{C|{|{     1/      /  2      +!U!.          K C     @I?@?@l?@3?@?@ ?@6 |{  '|{ <           7 \E,5*   '   <  H?6| {  C|{    ( 8  C       688 (8'(6(       1(  . 6      0 E 6     ;  6    @   o6}   q    / 6/0/0/0!6 /$0 !0 $ x\wx6H    C,  H  !    !     ('('(6&    !& 6        u 6 )      )-   !  ('('(6     POPOP6& " & PAOP6N '    !60 0   $- g    6       0*/0 /06%    ! %     XWXRWX    >; -( 9*#_1  POP  7* '   ;Q"K    2t)~U   VUVvw  },    &/ }k% }k% `Wk0=#kVE+kV= S7f-T/k (! +&c 7   /  " x #v)\Or&     70& "   /"+   `    !_T     VQ  Z%+  A  V ! g $ %(Q& RQ) (Q& RQ 1(Q& RQ%  (Q&rw7X# U C  u!_T  `_` _`&_`_`]       8E ('(_'('('(   &% ~w  &  \?"B    \ `  &% <5FCDC!" & ] A    9r     Q )%$ 1    n   k@ -       U9>ck@ , " < #<  43O )    NT#"'T 6O             J !,$< h0ghgh * ;   /--, . -         _  v           q uP  %||.-          ;   S#AC  ),c "  F  h}gh h             ^ h @?@gJIJA%0                 hghghghghghghgh<6## #G  Kehi K]`a ? KQ    tL!@iLKL!m'           : hRgh<%-     !;% - h>gh<-    !' - 6  <  [XWXW\F 0  <  [PW\@ ANZ<56 565  " +$      , m,    ,m}t}t , mdS     ;I<R;$F7  W             +    8'7878   .&  & 74  H-GHGHGH<]       XWX WX      <+       ,    z [R(7+   /G W [ <   `] ' h ;0/ /(   ;6*%/(A</(GB/(MH#/("!$SN)/(('*YT//(.-0_Z//(5` -%P /     <  1$#.'   $ #    '*OS1(   <- '   &  I I  %%%%%%%%, & JIJ  ;3u                           < 5(6o"  %   K K    $LKL? t M (_    $W <9 % "X <       $> )2 x,wxwx<@    P%OPOP $  Z=<vuvu0 . v :   K   K      .        -LKL .4-:                         -  Q     <      '       #'6/; i6><+ vu+vuvuvu4    I                       +Jj],   s  +      .  94$  08  FD VU>   s trtsv_`_^' w*9 9D  > ('('(F-   @?@?@?@Bp  4   bt !+ *  } 5      !Z5 '  h(ghDgh " '      _5"" ' a.Z YZYZY ZYZY"Z YZ&YZYZ YZYZ2Y Z2Y YZY Z1 }    }t  }t  }t  (  "(      1)G?+UA.  "        (  (     vm             #&2m    xwxwxy (        =   N 50y (                       T3' (% '(         (-3%    NO  a    !  P1 ! 02 a q"D' (A'( !      +* <** 4DA          $ !  x]wxwx 7' ('  '     17 '    Nf '(D'  '(           PH 3! G=   D   r!C' (B'( !       ++ ;*+ 3CB                !  q      <  *q 6=Z YZYZYZ%YZYZYZ YZYZYZY YZYZYZYZ   }      }t      }                  D3=              xwx-wx wxLL            ' A      p3opopop opL,~ cdcf  _XOPeED,  `+_` _`LE   -  H%GH GH   ' L#   X              S #  X   o [L'CDCDb  CD CDP$          efcf ]f  b  F"<-24''b  P       RL"  Y TKLKL   I "  pVopopopopopL~       N!GBBBBB BB BB L,    >9:9      $$$  ; <   ] .!+ " ,  B  5 S L1   #            !         U1  VL     WZ   Y   hghghghghghghghghghgh0LCD    3DCD C D-       CCDCD  K ?      E K K K     LKLKLNe@iL~          -        C   P     >U   ' > 4 53(  XEWXWXl  ](D   TI &$ y1. %<  (        , T                        H ,TT F   @U?@4 3436,5        ; ,              ( X 3       ' 3 a 3    `   .  3 7 9      '   4 7 9 ~B1     ' , B 1    /     [          6 [4 3436,5       > , t    0     s   / 0 *  W              R * W F* 6! *<         <     -!                J #   '#C3  +'#1  h T     g ( T- xt    .   :t <*        *    .    -- L4  4K  ( 4,  , `%_`2$ //! ^# ?  ]  # ? 8C784 36*5      9 *          } `"="           ;<;#2  ) qt}}}t52}t5:  ( 5,) $-"h " #             !"!" '(    * () . /.-.-0  :      "\[,\[ \[     WZ      ",    ,         ^w XWXWXP0  (V'('(P    XWX STSN M^ ]L3 -    hNghghghP 30  K  La." 3 lP   BH    "I)   BPp  X#WXWXP  P^OPOPOPOPP        "4*    POPOPOPOPOP P   <  K     -L.`6   <  Kkno   }  -L POPOPOPOPOPP    <  KCFG K;>? [Zibaba^ U  n-LKL.k9           <  h ghghP4  X|WXWXWXWX P    7 p ?58=r IPWPKL C L!@1J/    7 POPOPP.  " K$! $         -L hghgh   K\YX <E.56569 DE6=>=>A J  1-L = K; dmV]^]^a lm^efefi r  Y-L  R  P -  /21,+   "/ 0)J -   9  P   w ?u v@D1   PUOPOPOPOPP $ #$!   4* P;OPOPOPP    # popopopopopopop P     w     K   L"F     w hbghghghghP O  K L}.* O  P    c      "k;    c      K     -L  K  L XKWXWXWXP 0  K  L^." 0 PIOPOPOPP .  K   L\." .         P              >     : ? ? ?  @?@?@; "F                    >  K  L     h8ghghghPT   hOghghghP 4  K  Lb. " 4 hghghghghghghgh P    K  K K     LKL.D               K  K   L     h3ghghgh  XWXLWXWXWXWXWXWXWXWXP        f    K       -L"R                     f  POPOPOPOPOPOPP      K    K     -L"A             K  (:'('(P    (        heghghghghP R  K     L.6* R   K                       -L h6ghghghPR  hghghghghghghghghghgh(P              w    K      ;        ;      :    ?        ?        ?        K     L!@?@?@;-L.u                       w   K      L   K      ;        ;      :    ?        ?        ?        K     L!@?@?@;-L POPOPOPOPOP P    <                         "^3    < hghghghghghghghghP=              @   ?        ?        ?        ?        ?        @?@?@?@?@H=                    @  hghghghghghP     A   K        K        K      LKLKL.{<           A  P_OPOPOPOPP   5                 y"<)   5   K     L   K                       -L  hghghghghghghghghghgh$P$            a   ?        ?        K        K        K      K      LKLKLKL!@?@r$                    a             hghghghghghghghghghgh/P$-          a           E K K   K K K     LKLKLKLKLN}$-                a       ? @ P!OPOPP      P~OPOPOPOP P      K K         LKL.H+                POPOPOPOPOP P    <  ? =    @1`6    < X]WXWXP 565J "   L/,  " paopopP 565J #   P/  ,  # PUOPOPOPOPP   D  I   JD$+2   D pyopopopopopopP      \     "c 2BI      \ X%WXWXP9   PkOPOPOPOPOPP   ,0       8+w   ,0 XWXWXWXWXWXWXWXWXP         d  I "*)     +JG+oN         d  I "*)     +J XWXWXWXWXWXWXWXWXP          d  I *)I     +JIJK+zN          d  P#OPOPP7  XWXWXWXWXWXWX P      T  =  I   J>~81MB      T X'WXWXP; #  I "*)     +J   I "*)     +J  I "*)     +J  X  P 8    K! 8   <  P    =  >1   PaOPOPOPOPOPOPP  ,>? PBOPOPOPOPPd  1 `_`_`_`_`_`_`_`_`_`_`P             :9 ,+ I    JU_           XvWXWXWXWXWXWXP   s  I   JD2+:B   s popopopopopopopopopop P            >= 0/  "! #    Q\             I "*)     +J  I   J XWXWXWXWXP    565J 2  I    J++6<     2 PLOPOPOPOPP   ;  I   J+)   ;               P                     k      =  =  =   >=>=>;                        k  I   J         I   J POPOPOPOPOPOPOPOPOPOPOPOP P         I I   JIJvb+j         I   J ! ! !  XDWXWXWXWXPf!  3 XWXWXWXWXWXWXWXWXWXWXWXWXWXWXP             +   !    I       +J;w{             +    XWXWXWXWXWXWXWXWXWXWXP             q "        I          +JW\             q  8F7878P   !#   5$ *   !#  # # $  PtOPOPOPOPOPOPP   q$ !!! I!! !  !JD2+:@   q$ $ !!! I"! !"""*)""" """""" "   "+J%   XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX*P                       % """ I#" "";"po""# #";"ba### #""TS"= #" """FE"= #" """87"= #" ###*)#I## #  #J>=>=>;+J+'                      & ### I$# #  $J& #$$ I$# $#;$po$$$ $#;$ba$$$ $$#TS$= $$ $$$FE$= $$ $$$87$= $$ $$$*)$I%$ $  $J>=>=>;+J XWXWXWXWXWXWXWXWX P         d ' %%%%% %%%*)%%% %%%%%% %   % CmN         d POPOPOPOPOPOPOPOPOPOPOPOPOPOP!PL             k( % = %% %%%%= &% %%%%= &% %%%%= &% %%%%= &% % %>=>=>=>=> L              k)  POPOPOPOPOPOPOPOPP           `) &&& I'& &&&&I'& &&&&I'& &  'JIJIJL+N           `  XtWXWXWXWXWXWXP      V) ''''' '''''' '   'c2F@      V* ''' I'' '  (J* ''' I(' '"((*)((( (((((( (   (+J+   XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX(P-                ,  + ( = (( ((((= )( ((((I)( )(()I)) ))))I)) ) ) I)) )  )JIJIJIJ>=>G&-                ,  , ))))) )))*)))) *))*** *   )  XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX4P-8        ,          - ))) )** * I** ******I** *  * I+* ****I+* ****I+* *  *JIJIJIJIJ@3-8        ,           . . *++ = ++ ++>.  0/0/0/0/0/0P        0. +++ I,+ ++++I,+ +''''  'JIJz3+          0 .  XWXWXWXWXWXWXWXWXP        d/ +++ = ,+ ,",,*),,, ,,,,,, ,   ,>G1oN        dRR        R     R     R     2R !    !R    R    R      R             R      R       R        R #    7.  # 8>78R     &      R                    R (  $  (    R                  R      pox   R &  "  &    65>   R       !                       R ,     ,        R                                       J J   $9-4 "  N2LiP ^..         <    "t              EF @ AJ KD E      F G    :               :::::  ::                                                                                                                                                          :  <  v 0::::/G",#&/'!*),099 9  9 9 9 999~ )  ( 5 #  1  3Q %  (e'(rW <   (a'(S  X%WX" H7GHJIJI   "   @(%7i       )   > @   ) & 6 * * <,i        83 m'  PyOP          =/      @?@6?@?@!8  0 !!8:'   N  A!q,,52   :9:9: , $$               V%*  ! xR0 5( )#C   d    )  &'/ 'U C Z%` 0)' #bC Z . ,&) '#2 0_   =   0' HS!_ 3/^K# # /#0 9% 4+(O 0w   '<s ,T9 XWXWX47874 78787.47 474787474747 "   " $"8" >  B  *      ,,,!^ .   2    f L > ?  : 7  C 2=$?*     f ) 58;> (%  2K  L > ?   CVE"E  K "  $ 0   W   3     0 /0 /0/0  .   *  . G           (9$!"! +3x[O.;?$  8 Z!!  @-?@    R"738F    TM1RR Q RQRQOf  6508-.m"@K43     "!]"0; 000'J <+; *  1 A  9 H^"z*+ 0>e&!)7    O   @R/ w qw           SXW(`I -211:99POP$" *a&   d/ f  =) 7$ 'B6/,  8$" / R~   q        Rq  Z   f       Q TS NZ    c fe `Z  $  &5?2!5? *RUJUq   Z     f HGH X)  ts            '   B) ! ,IX  X811  "!  1  R 10! 811X"   "" XX"  p9op3opX  L     !%    L o# X      \1)\[*)*)* 2 1  ] 6  D X    !   C  M  v""   X    i+  ,xS>S         B       B!      B ) )w )$}'" Y=,E= / G=             iX(   popopop F8C   E      J: "  DC7  n#"     K 24="     &  %2&&&' "   7   DC %&% &% &% &FDC %&% &% &POPO 0?+NM     B ]    F 2 M   m %  @% /" 1=594S,X7 ))h?     F     HGH       % A/  -Q! )       Z3     3        ! #  )    ' 8$ G  )  1 4 36^] cd 9       o N   Fi0    W&6!T 3 !a6 . ! 85jZ 3      3       " !$ %( ' jn3       !   )  u x wz 34 /  ;C -   W|%!)' n 3          7y   )C  )    *)*>7 y  r +  #. " )  r 3 4   +  *:  #-"$  3 4 Li  S =J >  4 8 6     0   (  =  PE   ]jW -= {1*," $   %( $3{1  *D " %G^ ]ZY {,    J $7" )  '/)!<3]    { f, +  .x u    %, @ @ @ > A _ O F G 5 /! ; A 8/  7` /  "/ 1  5/7 & .F !'()   0/0 \ [[\[ \[\[\ [             0/0&\\ \[\[\ [-\  2            -  ' UV       XaWXZ,# HGFE=  # X"Z6>=9 (%$ 5A+ <' 9Z<     * /F?      c     W# 9_/D  G\ g\E Z"  z:',/D * _ '  '0+9 *''( A+P+83  Y\3:/ ' %'?:*$W3B ( [ FR>B" 5 *'#    'I'n3'')& cdU  3*%-(  q ;'*+8!  Ts  *9 -r5">    %  i   + !   - +  L" & ;&"? ,!b i sXv$9  8    j!_ T TU + +*       po   ,F=\E4' *  %NI        W !  -   - +  9%9  K+* K&  >    gR   ;3 && ( G$ %  BR&&# 58>5<&$K     8 U     ) $ E  j_d +    W (Z >0&HR$ E   d     0/  8-.i  U T-  +D/ -N  }    +! - +   T`& ; & 4N ,!b } 3hl(a  A       j!_  '   A    9 8     +  AZV)5@?@W4 %RM       W "%      -  - +  ')*G.; $ :)B)   )Y   >      qR    ?''1<,A&( Z<*-  BR&&# ),4)0&&$A! a  A       d      -  +   W  Q%O/P5b a ?DCT+(  N: 6        $( +=+  lI8   I:  ~ e5  -$[       6   *L.  B    -     # q     x.wxwx&  #     &  x # Q      n # G     F , ` # 7 4 "!  , h\      -I  ! ;*  +( 1E  [ #      ?&% &  [  '   ^t 2@J M@?>=>=        2  C. /7* @ V   $&* .  z'    2  M (" !  E           Z (   w  U( 0*/0/0>     !7B@?   K"B       _st~           A'Q g _~   FstH         3Z95FH U.        -    W.  jK jKLKY    \ !:9    X  &%     B    x  D  q > )xS<  *%?S >=6.i =.     Y     R\NMw%%>;,%   " %6, #" ! JO'=Dw       9 < :{L"K     LK.L"K     LK  r q+ x w+ %$h  A-  B ?     < 9 :E))  Z W     T Q R]?1C )/*4D}%*4D}   &!&@<^U,^U9 < :  {          .  "  #& % ( ' *) >    L -  #'  O  3     {NMNM~  3  jKc  3        $   ) - &n N$)  +('  4 + *iv  35   )  n 1   A   )  n          ( H.%  !T5$ _$ ##,  !T! . ).  !Tof:!3=i1SC ]13=iK<&3=i62 U#<O   3      {~   3   #c&( ) ,+, +3. -&0 /2 14 36  7 : 9& % <;<; B2LK'   ) W  '     >  -!LR^B 2 `&_` _`_`_`8_`"H$  !  !2 "H$ (55!XW ? IX "   "( )  "   +  I"   y!.  L9   08  : &  & J :&  'K5! " ^ ? '*!)  z1  jKO         ((n     A    ((n&      (((  @;@A    TO )/    T 0      i!     e(iL<b (i (()R@1     O        (P  [9 yXW$ 9  X ,   " '    B@  ) X  #J )      )  In"6  4*+   ?S9 0   2h*Y&4=#!;S /b MyS %"1   [ 9 y#g$ "  #9& %   $ $   ,      7 jKrLKLKN '   1,+li,  L  4-Y 4U 71 ), #& (43)Q<$)&=)& 7 r  N "      '  AO8$ '( JJ LK  8        W   6    )W   + d >  s    >$;ZR&+ *R1& J        8 >.   CD )   Y  ('('(,   9 H    BN)079 H h8ghgh+N M  +   0H/0/0/0/0& JI(j z ZY s3   NX:! jGq (  : B<. )!'M=(:  q  %UCP!"! "! " ! "! "y  {!<;<    A :n  iT"!%) Qi  %C      y 7 RQ7&T  (       ? (6 )  + " ; F! ,>&  7  7  & QS\    DCB 8'*  G QS     RQD RQ_ w  F!'  RQ RQ    +<?{|&?&|{|{z& H&$  ,kP &Y]   A,2` _%&?M7  +P&)   A^& $, l&d 4X*?*?$x WZ m$    A&   A     A !G*E   )+ )). : )6* "   ()0' ) ", ) #&<#3<A< < "& A<"*B& U?<DA<)$A<       D  _ w F$!'(  ), +. / 236 7 :; =!'   #$ WZ $    Ac6;  ()!=  U?< Q  ='    e@!( E  #  WZ $    A0 &<  ))+ L J U@< "@(   E    RQV  ^ RQa  e RQQ  $  +CDDCDCDC ?@?   , ( %& / J    /   A6* 4ili       AGW  (X, o7      *(''   +5mV +''   A*< * ) )$ D ) ,     ?&5    ! 3 [ ' )&3\JA:A< RA<E;(S8 $*B"&?LA<     V ^  a" #& %('T&%&%&%* +. / 23Q =y jQa   RQ  )D   )B      W    AA>U.    */    *'-0 >Y  ) 0 !!*=+*=# TR 'D< 6, y    a   t           W >A3Rt     c18SQRQR[ \[V & *8[$"90 '3 0[ ~J   Y4 1<*$S  nV /] B3Z-K &F2Q R#QR(!    ! 6-49%lm Xab1*- O         LO B7    {  L  x$& #V( +  - #&  F2 #  (  !   &O(      95"   PtOPT@     9   &' T T*-3 5Bc"6,A  /B# &    ['C  )*-3     T1h    !0#  +  )o1= T6   p"   "        ,%2+Fj##    R^] '''(t  &   3!  0R @?@?@1B   q"D          %% F9   3Bn -t +   "% ]"    f  -   ,             3!  (-0EYA! 3B  F  t +  =^]8    F(;=8!![ ` 3-d c ^]$^]      @@5-  $ "          %$ F8 y+.   -3 -  - a ;! ),  @   _. \[\[-t\[\[     .)  + X  - ; )% 9 ,5-t    $ 3F%  2+&&. , 7%% pop` !"K   $ !#>` !0    .  19+"2  !0 %     / "<(  |  1  +9$5 )S +,  _y + %25.\   .J(   .  0FR Q R Q^]K PO "    #:1R ]& F     K/    t*   " )    )+*  847878L   C  " B     ")- C )Q ), ^   "     !@  C$y     W8$. "7 +   ;H  2    2  2W    NZ1Y &%    1 g   E&N1 > %! " x   % !!  "    !  T@^]    I " @        @@?    @RQp    T@    '   " ' C         (G   6 :  L,,"(P ,    (h'(:0           {4 q) %#4     L E !5%? ( Z{4q 5)333| 333 9   %      x!   )333   7         Z3#!0  3 '  , 80    *  \q+T  ).  ]Z3 _;;+= dcdc#dc`_#=      << 4   9 ,%  '"#7+=# 2'|    ,   s +16++'      |  @ &) } O K&$T@ ;n *       /M    o=2 ;h  *  FEFEFE /F 6 /  N& +FE, 1 J%&  $-  j v\R #3 ('(Gm  ('(N  (o'(=4   %)!0 2##   , E  $ '  T$5"'  m 83363,fefefejiji  Kji#ji     3  3 $   3        >   4     6    " "[ B 83363,      K    #   HZGHGHGH  @ L  S   @  <      3  &L3 Z      3  'M3   PAj4 E`!0k F87 )     ! #$ ' 8 /#4X   {h E -$'%'%$D ( !8PAj 4 E"b T ` 4 *!0 F  %J9  P#4       8lk  { gX .$')'  ! >$, (  4  * !0v   + !   & V9+ 9 )G &3@HP= 4 `_`_5`_`_dcvdcL/!#=#4    A 5  *  c O- L  5 '   8P=4    5      v L 9? t *  !  !Z *  !  -'     N' '~}bonF4popo2tsts9po tsXtststs~V/"ZWXWS    ?!?b/#4Xknmv   KVGJd  rZ'VWWXV'6p@ 9kl}$ *       & /( 0 ;+    V ? ' l  F4    29   X $     .%7u~}lyp}~y~}~}~}~}~ }ly~}zy1FCpopo2tsIpo "t }~} p}~}~}~}~}~}~ } d~ }tststs~ %Z YZYZY         1    !?!< 3$  2I<43 4>   4    *    9#%- ".r 0) .7,5   )  7u        1$#$#&F'*C+.-.-20/I.- $#"2:#69:94  98   =4;4343^@210/0/"   c   ["7W~}~} ~}~}~} 6FCpopo2tspo tsetststs~}%~} p}~}~}~}~}~}~}~ }~} ~}~} ~% XK  6 3463/    !?!<  "  24    v4C$! *   #% 0f;' 0' +   !$#& %!(+M'7W        2FC2  "!e"!  %      (' $#$ %       ( p?op9opM     !  6)+ s_     2"   , ! 0B/0/0    $, RR3       .!%]0    87878%F      Z 14   `_`5 . Q R     5   QR "1  5 . h S ( H    . !   " ! H8GH (    (  `*_`_`>.   BK" jixwP~}~}k #!0 }g)  (( (#   h <-+#  ,X P   k fi qK" jixw|~}\x wI~}j m!0b )  ne( *  (#'    <,+#  + $7W |  \ Ij k|  X[WXWX$|{ ts/ CD  ! / &$ / pZopopopop=!0  4 =!0 [ @      &O!'E[@  @=?@  & h0gh vu    T#jq9ts     E 6 3  ((9  @      33   "R-2~      33  zy   (m'(zz;4 V1  Q4bF   J POP8OPOPOP4BX WXWXWXW     ,(B   `%_`9_` 4  +      5 0+ X9WXWX4 ("   -"(4 K PJOPOP4 ;"    );; 4U\G4_45 ()A    #4  <) 3  3 Q G 0D       7 (   ;4   T3 3  4   ,+ $#       ;D+ lQ  4 J5)8KLKLKnOP OM / +   *Z Y%                                  :9>87              * NS%  G&])"-,g ? R%  )  M / +   * %  |14 &(2    (['(h";     $ +      9   /"%,   H]GH GH GHGH   G!0      4,$@&  G HzGH GH|{^|{ +,+, +,;"    ## 8 07/0/0/0/0/0h    $= Y#=-    $= 3s {  dYl   _- { 0`    .    G"%WE; &(2  B  >O$ +V=E"%- AE * ' & 2N U%H    [` hgh   ( (d'("O& - @  #0   )  9 8{78 | j"   7       r HTGHGH   #"'     ,, X"WXWX#WX31                 k%1   -}4; NWb TS L< E  %     &58:7o0   +e 2 "0L%'0,$4;   !  \J(    -          - *8 (  -     ) @3?@                H+GHGH     " p9opopop     "    0R/0 9       6 9  `  XWXWX!       ,! 87878         /^2]^ W^3]^ W^3]^ W^3]^ Wx  233 3  :#CHHH'%%%%%%%l23 3 3x `)_`Q_`< A    h< A  _  (. +$&#1 " <2L    "ZYZ[ ZY&\[\[\[        `   D~          :4-  i  &%     X  ,)(%$     &!J9F=:      ?Sg5r:\:,F:x:  "7,;:r:S:E:Ma:E:M%  K@.1  />?=<?I@? P.   +   - ."'=P;J$ )=BB!F Ts D! (4[*3), .- ,4/L  " &              o-         ),  _ " ,0" $'-       x` # +  _ p 9   " j  D   " Ln D + | 6  ` 6t   X  &  " hghr       !$    # 66 r& -[FT[CT[CT    L G  !?!<!< { * *   0-D& -FC  C  ;j -%r   ) Th Z Y ZYZYZH&  gpet   *        g KD 541#3   ) T   H  &r*   I5=r  6 ,<#  "  | #  ` # t   X  | #  ` #| #  ` # t     | #  ` # tX  t   X | #  ` # | #  ` # | #  ` #| #  ` #!%  (V'(&2  (z'(0L   (t'(!U 2  (W'(2'  ($'('(  ('(;N  ('('(  64  (w'('("T (c'(14  (p'(1A  (Q'('(6!'  (C'('(6  ('('(  ('( 1' 6'  ('(E[ 6  5N ;'  HGH*@%*      ' *@% po Bs  !0  g hdhghgji (   }   #+6e) B s no pZopopoppoV7!0,   0*!!V5 +J  %0 %$      ###$  . 3 5  8  "S,:3+j  EP ED      CCCD  . 3 U S< T     D  dNyG22$$ .  h{6 O  p\opop>R,7 / $ D > ^ 7`', HJGH GH>`")      '!0>d  )+ , ad]  V     _$06 , O  ($  &XW%  4-   +  #1436  ]F-% 21bN Y,"I  =dEFF '% "    DC0/#? O?   4 12     #J+,.+H.[70 ?,n 4 $#D)-9) ,5@J2E  ?q? .Hv J"/" Wd M0  (4'('('(! B TA>aT!B   @?@B?@2?@ 23F & $ ) # p$op(opZ )  @C?@?@ ?@?@?@?@?@!        !   @?@,?@N -0   ) S !4       OW! #    , +  XWXWX(WXWX'WX WX WX WXWX WX WX WX WX WX WX `   uvuv         Z-%( E     @(?@?@    " h&ghgh   POPOP    @I?@       P<   `U_`_`_` _`D|      @ %$ 878DH  44& &c  G>DZ2  )D  SD/Jkl I!"\  5" / L2  )N  Dmt  $$ C D,    x F@      & x_+j3G^  WT55NS   > [`_  FEB`7 ' E + + >25+6._+j3G @6?@C     j3G \     v   ~}zG ' D + /26)6. j3G  DA ..  K . h r*+Db!0  --         ,,    {  x  f A bAd6z#5r*+        D   hghz =%6-.-.3,3   =(+ z o HGHGH~GHGH k      5   *@O   k wnJEst stststjsts tstst_stst%stst=D           , ++   3++ ++ 5-#  j  B T7$:#N*X0! % *. E j _      %  =D##s t    0#/0o p     P8OPOPOPb         D# H8GHGHGH    J  ' @?@?@<    )) )) r">b U D     !( 2"> 00/0)/0   !"!   !      `%H       N  %H ?8i(  c m!"do r       i  3   !"#$   c  N[      1"0  %(  > N[ @E   .M    "& hZghghm  ;-M     de r d  +'     +      4 76*J)+p;)  e   r    XWX d% d  +" 465     "%  %  @*?@7    h7gh,ghq(    I! 6 k <       c    c % x?wxwx >&    # > 0U/0 l<    1 r/   !n         'T . ! @6?@ ?@     ('( '(x."   dzq. #   `9_`_`_`zTB      XWXWXz  Z     R"P     '*  8T78VN OPU^a LMT  +#8    o1=  %1#=X :      1=  @3?@ :'  (-'('(     Q" xwx  vd       Z                            ~  ~ xwxz!"!"!"!"                  XWX           H%GH;GH         e_ 6 X1WX;WX         qk6                            $   "!&    / 3)$ +)+"             )(              # #####$ )        E A k AHAB;6       " > !! !      - !" 3   (#%52V  )' ;         & B ; # ####j i      % NA  ),/      M@)  B? , 3 ),) snid[   5 BUV     S " ) 5 08mf3! % A ' ### ##" 43  ,rm,|w        +TO+^Y+hc'R  +61UX   @? @5JE*         : ":&% ,'7 ,(#b&&3)6 )/.,-&&(" 2 2n0 0 = 0 5F +$-CC&2    ]          .# )#  $          S :41 S?$  ))' 4 ;5 @ $ $ % %  % 1"      ""!"       ""!"       ""!"       """"      "       "XJJJKa== =    =   > f H%****+0& )            )&) ) ) ) )/. ,-***3       ?% 7/m              pEop:op'  . %'                    $  T  !F*-, % *O  ' $       #$#$       #$#$           $ QKM O:=  = F  A**(            ))) ) % 6 !   w7 H+&  ( (  ) %       %%% %P +:8 89)   ) %%) "!  !                   # $ $   s    'n "%P  -   D*    +  ^d0          2   4lS =  $4f  BO   +  6         6          ]Av**5**/ u    ') )2#   ( ))";L   ,     () )( 6  )  <P    8E.x;\%*l, u      '  #"  "  "   nW9i31Xb6T>!ryn mnmnmn mnmdnmxs04  h0p o  nnmknmnmz (HS   . 0    00    0  '#4 ' ('( ) *440 U j5  4 5    25)k F ?  I  z   \{17& +- ( *   ' !&  0  !  d 04  h0  n k    Z         +"C5         ," ^OPOPO    " ,$ 878t   @#?@?@v    HBGHGH&  &  hc   # '    '          2+   'VF  I     ! POPOP       + 4AF/    +$ 47</                 D    V $!  ?    $ x]wx wxwxwx Z5S \U5e HGHGH "   I49|n M     )    +,' ,+P#  K|RwL>K 3>=@2/ ' (%    (JG O|{R >=  #opmL$  (>Q)         -   t 1 . .  t $ + 0 ) B  . , i)       KR"!"!w.'(WR ++&+#m n*mnmnmnmnmnmnmnmn         ,,;6#  ,  O$   O ,?7(, # )   !!*   `^_`y_`8_` _`p   _ &HE Y    +39,p_ O9    ('$9 h=ghgh#gh     $ , 3o po popopT  .      Zdk;H Ouvo psopt( TS> LE"*ba)   !jM KKK "!"!"!"!     "!        1/      &    0    7    Eo . K&/dM 8 7" 7"73Z_, ?0D HO                           5    Y  @$ S       ) )& .1%  A    3# Y ""  ## P]  .   =uv FEFE %.-E    ! 8  ?:78CR,;  U /  !  ,1Z##99 6,  opo popo.po popo po popo0popopopopop 4  opu  o7#G  %!B     5      !    /+ zudcd+uvuvuvF @  "6]    ` " o1.-0-+       <WVz&%&%/b  $ '*"   '  X+G/zez5  xwwxwx 0,6"% +  S 9*    psopop .,6 # )  O 5(   > i, 8   '  (                1]DQ12B74!* "  >jQ!i 8   '  . .3  .3        "   1]D12B7**  "   2     u  #   #+ P      2     pPopop op op op ' 6 L         2/ ' 6 $    v     $            LMNM   X3WXWX WX    )!      HKFI   !$      * K# 0 T 2   $  _ 0 T 4 p6op+opop#opop-V  /.-0 52   &-(8M 6.@+F           E#W- k(4*6 kJ  : ;  - `_`"_`d !# popQIt !$.  *   & "  $=AQI jc^0 /]0/      & / #;8<^]           7XWXW\,  dc  fS     8   ",9 7\ X   .     A# !;  Q x/wx<|  l '    PPOP]4 fa    %CbH RK   *Hw^ <5     /] `E_`_`"~   #'"#   $'# L 0N N l       OV U   N y5 N 9$   L NN M g             {[K M  9   .     M >K     .     '   *9q.  " $ ''D N  XKWX WXWX lkl  lBd X +,'-VUV4}     , + B   l  l  l l8          0 +.-,4af(_' + ~{ 4QV(w nijg    !  ':    ; #$ &N T       @ X@WXWX WX lkl  l-  +,'4XUb   6  - pjop opopop/ lc- + S\[\    +!2/  ;w3 4t- + u~}~  3 4- +   3 4 lkl`    `A_`_`_`   ! ( #  pZopopopop      !  % # 6 `&_`_`<    `E_`_`_`b   ! * )'1   xwxwxwx7wxNwx  I--  $          '  e b  O L T        )=/)&&[ !/ *I -  -    $     *Q  !"   $ ? x5wxwxwxwxwxwxwxwx wxwx wx wxwx       G! sd  $ "$$ " E^      ]:   "   "'  "$ "      XWXWX  &&    #!&  "   xwx,     K6   3  '6 `F_` _`2_` _`6_`,_`2_`,_`1_`,_`2_` _`1_` _` _`_`            '6:%+%*%+5F $9   gh  : ,       )  [1    d wJ, 02/0/0F  !$-  + `K_`_`_`h  # *!  4   0/0 /0 J 8 5  H[GHGHGH  vqJZ  cC#     Jf +@  ASvuo popo!popvu+vuv urf ,    )  776!E##8' hS ! +   r q6  ;8, )6  popdxF{    !?i /  +/ dF *i 0At s`tsts 6 . ! " 4!"!"yts    ;   y  > po T        )   G sc .W  3 8"A `  .     4    y   "9    )4   `x_`D  *a  )`" )Yb  Y ;       mf ',- .  -       " s .    b  Y O% - ;       U38   13 * z|   %$ 13 1D *     %$  1D `L_`_`a     % x-wx# $%#$  E&  % `M_`_`_`o     #  "  >=<=@ ?@ KD(&c';1  "    vug/hghghghghghghgh /?B;j  A\'(+[8[4hQ>CJ/        pop/g hg0hgh*gh iO  KL  ^(_ 4FK # *           8%78 78>6   !F      e)/ 5< /      1h/5  "K  lkll  +,'@4s    hgh l3 l   +   ] 4  +  W     3   DQ- " 0u/0/0$Dzy?    Q#  l$C l'   Y=b-  \& /+]-- !=      .3 x]wx!2   ='!2    ID{f ?        y8 C{  ab_/?HL     9yH0 X WXWXWX?~  & 7 +88(""&& S``- 00 XeWX'3    4 #O3` <"<0xi/j#  ( '43    /& 3(= =  =&# V&' 1  1 !* ] # ## $ )x/# XWXp "D  !N -6  )     !0$,  " R"> 1;4"r -~}   v  v  >=  21  0>/0* :9  )* 2      .    "%14D     7  #$ '(ORYZ   ?DIm(6W   5  *4 F. @&?@2?@?@     36     EBETMGo    3"  g2 k2  K L *     T>  $    /& 7* 4 & # )          .    > J*  0W/0t *)0     !  8 ' x  1(       }      z}z z}z z}z ! :(           ` 8.7878z78(         C         C+(        @      0[  6           uJ.%([  6 A 8 jG        < 4(G   _      !                                                                            S8   b]\_Z )Q6                tyx{vs fkjmhe             :N!              "!$#$# &%('(' *),+,+ .-0/0/ 214343 658787 :9<;<; >=@?@?S @ ?@z m  N I. `F                 L   82@      ppppnnL VL      /      t>e#           "5  4Hc,:UJ  Rf !  0 !   >  /  0  / ! !       >  $   3 $ L 3 3 $ e AL 2L 3 L 23 $ 3 $ ~ e A3 #3 #  &  =0 `  .    `   `  0/0 b ab ] `c 2` / 9                 D"  \ e              )          4  t' "  -$'     3 (0 @ -: \  \ //        I{  \C    \%  \T G\ \\D '\H +\\i \m !  PCOP\e      ' ') XCWX      \!@ (      @  \ \# # #  \  P#OP OPOP ]  A vNMNMN M4   vNMNE FE FCM/N 6   3)   vN E FMN E FMNMNMN MNE FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNMNM NMN E FMNMNMNMNMNM*N 7   9L 9O   4 'a   c" w   y         $   ) :    ? L           [ p                     ej  kqr u ej  kqr q _d  eklk  MR  SYZY  ?D  EKLK      7  Q,GD                      !"  ! !"!( '*  +,  +*+,+2 14  56  54565< ;>  ?@  ?>?@?F EH  GJ  IHGJ IP OR  ST  SRST SZ  [\  [Z[\ [b  cd  cbcdcj il  mn  mlmn mt  uv  utuv u|  }~  }|}~}                                        *                vNMNE FMNMN E FMNMNMNMN MN MN M N MN             )&W(         vNMNE FE FCMN  !    3  vNMNE FE FCMN      7 vNMNMNE FMN E FMNMNMN              3 vN MN M  vN M        &   31 v N M   '   >CJ   3UD vN M   NSZ   3eT     vNMNM NMN E FMN E F&MNMN  ts    p D#&t       nsz   3t       3          ] lvN M   k j   vNMNE FE FCMN     3  K R    3  + 6                  3       3     gji   n  J =vNMNE FMN E FMNMNMNMN  G   FF?     3  _>zZ_SebVt%v0@?@!?@? @%?@?@ ?'@?@ ?6@?@ ?6@!?@ ?2@"?@ ? @ ?@? @ ?@ ? @ ?@?@?@ ? @ ? @?@ ? @?@?@$?@?@ ?n@?@ ?@ ?J@? @?@?@?@?'@? @?@ ?-@? @ ?@/?@?O@ ?@ ?F@? @?@?@?@?'@?@ ?U@?@?@?@?'@?@?@ ?$   65 0      "65 0 &     65 0    rqfe856    C D WIJ K XJI#jiO w i () '.zV~ - \;dxI[g{+m 65 0  9j 65 0 65 0 %6;  ba \<   9IB 65 0  >V[m 65 0        4`  WR OWj ,  U5  F\ HIT\ sN=!@ KD !  d!/ 9 0       '  5 6   " !2&  '* ) , +./ 2 14 3 6 5:7:7< ; > = @AD C FGJKP MNMR QnV ST  YJTS ^ [\[\[\['\[ bab  _-`_d ej ghgOl kn oFhg t qrqrqrq'rqv uUz wxwxwxw'xw~ {| $W     vNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNMNM NMN E FMNMNMNMNMNM*N                                                                                                          +  y . GD                         "  #$  #"#$#* ),  -.  -,-. -4  56  5456 5<  =>  =<=>=D CF  GH  GFGHGN MP  QR  QPQRQX WZ  Y\  [ZY\ [b ad  ef  edefel kn  op  onopov ux  yz  yxyzy          *         vNMNE FMNMN E FMNMNMNMN MNE FMN E FMNMNMNE FE F7M NMN                  &        3    3      3 vNE FE F8MN     (      3     ( vN MNE FMN E FMNMNMNMN         3     (          3        3      3  kv0@?@!?@? @#?@?@?@!?@?@ ?6@!?@ ?1@?@ ? @ ?@ ?.@!?@"?@?@ ?@?@?@? @?R@?@ ?F@     65 0          65 0           65 0    "!  k   9VOz 65 0 / 65 0 T    -0  6- 0   ujU  @  @ Q  \- _Hk     9IB `,  "VIZ$J0          6   0"#& % ( '* )..  +2 /6543: 7<=@A DER8+H IF  @C?@ ?@v[      2% -v?           7vN   tz B ! )  D C pxop C 3'X POP"fE@  ! ' 8    f         X  ZUE       % N|HK        n 6  5                 ;,  /   6B& % 87878n.     v NE FE F0  %        5      $`;U4 #  0 / "1 /&    ^* ("  % Q 6 @" & hF@ ?@?    q&3F  xiwxUwx   34  &% F ;'! `t_`_`_`j       A <=,"n PWOPOP  Z     @!?@?@  $ H`GH.GH:GH1GH3GHGHGH  ijijij/!#" "/ M7!_&)   Q= dy dyzyzy=4!$  6=    [ + _ 4*%6   +    #4   < - #     Q=       =4$   dy!4!5u +   #4  P 5    !45zc dyC3 4@  +(                 ))U7%*!n ) +  (              B.  0%$              . i$  ;#. y: dyH d0  h  4!^4!   +  4   #4@#4  1Kc I / T%5 C+  5   C' H      4^4  XUWX%WX$e    !  -*  $e XsWXWXWXWX   .+, )  'P     m +  tR  w"E qnqr   ~}      !. "E   ('(Q[   , Ph8   i,        > l-&A.  $& %3  #c j  ght  ^#      < A M/  ># 0!  p ;    0/ 0/ 0/    $ +*   !  a    wd)H 8 W + 2'1Q0!  p ;  9F.  %      3         \ 3   #_LK 1 >= ('       " B( "    $B!9_ 1   p'5      nK+' #   X7WXWXWXr  $" XXWXWXWX  8'") =*33* 3  5  *33*3 YZu  M      !   * !2 ' #' =*33* 3    5 7 L % ?R>J  '        7> +N0M  + L %    R  >     Ym K"      LZa -%f  5 5  5   ,}|srih_^UTO       6 # :  &  $                 +'-   &'&'F'%'&66666663&&4 L Z  a -%'2 2 2 2 2 2 2 2" #f hgh&   #0 !   !  #! #! <    2   >  T('4 #    # T        ,# *!Y"D'F T : !  # T        ,) *-Y,F'F T  ! ##R    (  ,+  B;  (X) n  2='"X R    (   h>ghK "  ##_    (   .-    B"  *N)n'2=/"X _    (%  &  x#@ R     ,  W -'F@ R  |#D R     ,  #W 1'FD R     ,  #'  8k@l ~   )       , &.'$#  ))0$$$$ , O  Z!    :('6)>'t'  8@ ~  `O_`_`#      \#          P-OP  p|opopop$Y)        8 + -0$Y)   e     X: >OS    e q  G   C4**>  G    Js  G   c  CJ >B*KS*>   s  G H 0  ,!' 0   J^ 0  N ,9 )/:= '  ^ 0   C   c  C   C   c  C  ,  N ,  ,  N , x  G   C;*>  G    Jt  G   d  CR >I*:S>   t  G   C   d  C   C   d  C  F   B,)2=  F   Jj  F   c  BB >:)WS*=  j  F A 0  ,!' 0  JT 0  M ,1 )(F=' T 0q   # `%_`)_`"_`2    #0" 6 * $,   8.784      L?CJ   I J  ]  ; H  5  5 5  5    B , /    C    , # : - 1 4)&,@* ?'&'&'''+'5='07>7' L ?  C J   I J   ] " !;  j    popCC  CC  '' %.CC hgh ` _^ ],,%&  0 # ,"   }    [       | "   } 2Gk 23E O`      $ &   B#( 42G k  Q=I    6=7>87 8;  Q=  t  >;s6c WxTwn   (    + pFC LN, *6;6c WTn $  ;"s       %     7C  "s ##g#####l BA 1    ]  '  1            !     p         ~ &E 0 '   %     $          "    N    o / . ( ' L Z    #/%$  & B& R G>8 q U $ 4- + C71l  1    ]  '  1   A1$@e4 =<S#4 #=\YZS !   %A&   f   O @&# *, # %   e4 =   < +/%rE0F E0F  ! % ;    0  0      y%8]33r0 0  ! % ;  `'_`_` -  5 - X\WX#WX#WXi      !N,Ei   tmMj### 9I  C ` <5-   &< 7 $ liv3   -$D? .+   , /@?  ?   '  ]C%j35    y xy       fi&'I C ?   jQ'J$8 5-K$>  ( E b G; (  ;B ,9I  C ` <  5 -    < 7 $     PkOP#OP;OP#OP-OP#OP4OP#OP#OP#OPx U G N      , #           ]JHCrN. &('2ix U G N    xLwxj5y    %D#  A0 5y# # #Mm##O  C c     ! ,2   3 \ )      ,  L '!   ] Q@?8'%8: 0 $ AAPO  C c   %% !=-#= +  -   !=-       %  y j"   LDFC 5 OBD  5 5  5 5" . ,     7   5  5" : 2 4 +) +8 , 0 &'&'0','''*1('&'&'  L D  F C 5  O B D   :9  , 51 !' %' : 9 m9  " "  5&  &&'m 9 Y B , #''  B p ,!  ,!  ''  ,!  r4!C&     F9 5 3'9    ]    YG?<T   ]   J$e    aS >WS   e    Y     J   ]    y   YZSU?[i<T        ]     s     oYTMj    s     J   ]    y   YZST?[i;T        ]                  hhC)        HGHGHGH.  4 stst> &#$!3H  L>L #P   5 5  5  \ Q b  : ,    &'&'*'+ L >  L # P  POPuvuv8uvZ  ~8j   L?CJ   v / 57 5= &5 G 05    B       # : - 1 4)-  &'&'''+'5=!6 L ?  C J     `7g ~75  4-  (@ @ * (  )4'(') 9$ `7  g y    l  Q #!    c  M+Q&>  #) 1WP :y    l  Q  yDz (   9  D6      w>      n S \i     w   B   kR   5   " 'X @ N>4 ''=S   B    k x7wx v ;2(3   z$[ *  '9$["r (    vD   i &!     n W >7   # XS+ P>  Qi)'?S(    v  D  i$  XWX ,     d $A  5( <'  A @8 Yr     $$   ? @    3??  ;    @*8 Y       + 8     " p9op$ $ $ $  ,   $ ,            ,   < 24 0 &= ,  ##             p[opopH % kL > ; $ d 0  % k    $ @l?@ t$      J  t  j   $ b                                 T    NI5IJ GJG7GH EHE9EF CFC;CD ADA=AB ?B???@ =@=A=> ;>;C;< 9<9 :9/l  uli !""O(&b                    T$ #$# @   :                             .1 4            U :=-:       " ( %. +2 / 878 5 : 9   XrWXR: @              U  ,5W": @   K-  .. c 1  E                  $    #,&ctE   $#$  D              RQ 6Q     6)      i         L Ir9i   POPOP#     (   )   F   1     E V#    (       0C/0/06$  H*6 POP'OP+. "*)41  *)41:3 *)41:72/6A<-*+*= :9   4^8P>                            ,                    -                    -                    -                                    ,                    -                    -                    -                                    ,                    -                    -                    -                                    ,                    -                    -                    -                    X (          JQJQJQPQPONONMJM6/0/0/./.-,-,+*+*1*1              )212123234545.5.5.1.   kdkdkdedefgfghkh  ,          --  "!"!$#$#&%&%-('('*)*),+,+.-.-0/0/2121434365658787,:9:9<;<;>=>=@?@?BABA-DCDCFEFEHGHGJIJILKLK-NMNMPOPORQRQTSTSVUVU-XWXWZYZY\[\[^]^]`_`_babadcdcfefehghg,jijilklknmnmpoporqrq-tstsvuvuxwxwzyzy|{|{-~}~}-,--- rx~    "  !"# !       X S&    I< 7R$ @W?@ /8 q    5.6        ^ 6E .  l<$ E 0j/0     "%    -S F  popopopopopop               c      6  ($  ! ! 0G/0 ) J     #:) hghf    .!./ $1 & 1 ! .00  y z     XWXWX    u   ^[\[\[ L Ij7q )u   ,   &3&                       T  "                                 ""!  " $!$#  $ &#& %&/)  * , &%%%((4               T$#$"#     g                        s u w y { }       -6f  &#,)0- 656 3 8 7: 9< ;   XWX9 "&         W.5( 9 "& V  8 < :  I                  $ )2#gI        $ #$          @              * @!"   3:9   ('6UVO     L/  E   0  #&3  $"'@      *        D A9    & `_`3(`    %  W1 (  pIopNopopopopXop               +$w"9A |    dab _`]  H Ei )|  hgh             " M"; H%GHGH8 "    ,a    G   Qn #  XWc[^u   /D`S/%-<( fa      G    Q t +. ('( '(   y         @3?@,  / IL $;+1  / gj  & )   )V X)oO Z # 01c1e/g-i+ %      ) & )   ) )  # -,,.02 %      ) t $    pm n  * /.  3op#$        @2 H&GHGH,   /6  ";> )?*1/  X   ^> .f  EHG P    1;<)> . s    @ I         FW,;@ I U 5!:   Gg ! P*OP% T  %  .     %         *A S?p   v>=fk=@?V"# #J>  #(B93  %     ! #(# &+0+ .3*4343A /     "       7OU/   "  x         DAB;    DC % (( +, 36?'c O?=@x      $  D. q   (,   0   P Z ^ IL   = +   O(  Qv   1!@($(   # # #D   Y SqQ    '4    jJ   (    1ul /  J  ?? D       #!& tb! POP OP+  +.    "  + POPOP+  GJ "  +   & ```     ; >  &    9  4 %   I  2 HPGH  J>  RQ JIH,)E  K 5   O R    < N M0    00 k,%B#5   O   rB% 93       @ < 9 ( ? $";   z * & & & >0             G p  qv   x },e8      &   >4       f  2             - : G F0B+8    E # p   |-  ! # p # P " 6     '( %XOP; g4- 80!# P"   U-  d  PB-   8     k nja} ,++C/ 8       s> 6 A!`h  >  )  b, f   &  G7 f ,9 +)   m,s qr & R7s + 8 B?    "3!{"  !" !N   ;8,+8! M  ~Q;           1     X 0q/0 !"!" !"!!"!" !"!" 0/.+,+,./0-.-.5r   M   #   F+ &   B?@Q 0 36=' $  /TqF+  0-F ,+,QRQ(XOP;#   #"T QRQ6'XOP-" | zw  !# l(';   2  e  Y . Ny " !  j K 10=&!     f4ESL.NCRQ.SCRQ.S@VF      0             2     %        2     %        j c\ RU^UE % fE   L  #C& '*1Q4 7:ACD EHOQR UX_@b cf mr    zy|{~}  c4ESL.NCRQ.SCRQ.S@VF /  <   0 `g    X        2     %        2     %          RU^U       " cE   L  #C& '*1Q4 7:ACD EHOQR UX_@b cf mr    zy|{~} 878V> RU^U^UV         ~5$          M H;G;DPD   ( e   (    e  (    e    RU^U^U    M   H  #G& '*/2 5D8 9< AH S NMPORQ  _4BAR.ACAR.ACAR.ACG E              ]                  ]                  ]         ]      RU^U  # _B   R C" #&+R. 149C< =@ERH KNSCV WZ _ d  q lknmpo 8O78 b]`[^Y\UXSVQTQTORMPILGJEHEHCFAD=@;>9<9<7:58  ,+$!      *  | xqz{j spq` ifgV _\]L URSB KHI>7@A0u J  9     !$#&'*),-0/236587:9< = 0 - # " 9 q( ' ;   2  e  Y . Ny " !  j K 60=& !      f4; UK.N9 TP.S9 TP.S6 ^E     *           ,           ,            RU^U^Um %f;  K  !9$ #& -P0 36=9@ ?B IPL ORY6\ [^    el  w rqtsvu   c4; UK.N9 TP.S9 TP.S6 ^E     *W.5    ,i  v}    h ,           ,            RU^U^U"c;  K  !9$ #& -P0 36=9@ ?B IPL ORY6\ [^    el  w rqtsvu 878 R> RU^U^UV           5          C  9 ;; ;8 MB  1  "   U  "   U    RU       C   9   ;  !$ '8* ),   18 C >=@?BA   a48 UG.A> UG.A> UG.A> mC    ?                W                   W                   W    RU^U^U^UV   $ a8  G >" !$ +G. 149>< ;> EGH KNS>V UX     q lknmpo \ \rmpknilehcfadad_b]`Y\WZUXUXSVQTMPKNILILGJEHAD?B=@   43,)('    *  ~ zs|}livsh qnod]fg\U^_TMVWLENOD=FG6u D  2    "!$#&%('*),+.-0/2143658 9 0- #" x,wx u(' ;  2  eY . Ny " !  j K :0=& !     Z { P  s w P  p { P  r | P  u { P  r | P  u { P  r | P  u { P  r | P  u x P    m       N                      P          C    yr        P/           "CM    fm      L  P          C            P          C                 RU^U^U^U(             - {  !w$ +. 9{< CF Q|T [^i{l sv | {  | {  | x             Z { P  s w P  p { P  r | P  u { P  r | P  u { P  r | P  u { P  r | P  u x P    m       N                      P              C                P              C                P              C                P          C                 RU^U^U^U(* {  !w$ +. 9{< CF Q|T [^i{l sv | {  | {  | x            xwx&  ` RU^U^U^U^UV(&              % "!$#&% Q  =  lT          P  d  P    P    P    P    P   k   L      L            L            L            L                 RU^U^U^U^UV'     #& -0  GJ QT  kn ux                    g H p P  e L  { P  s L  { P  s L  { P  s L  { P  s L  { P   k!                                                                                   !        "  !    ""      ! "        #  #    ## RU^U^UV'( ))))))))))))+gp    L"  3{6 =@ KLN  _{b il wLz  {  L  {  L  {           hygh* ))))))))))))    +}y|wzuxuxsvqtmpknililgjehad_b]` - POHEDC<9870-,+$!     0 ~ t }z{j spqf_hiXUb_TQ^[P YVWF OLM< EBC81:;0)23(!*+ "#u h ! @     "!$#&%(),+./214587:9<;>=@?BADCFEHGJ K 0.      F ,+,QRQ(XOP;B#  ##      T QRQ6'XOP-6 "  , j(';   2  e32Y . Ny " !  j K /0=&!    UGUUG                                       G<= UGUUG                                       G9=  ?1 +  RU^UVF0000000000000000001?              7 ('*),+.-0/21436587( hgh>c2 ,    22,>         % 3,33,4 &&&&&&&&  ,$ .'..(B &&&&&&&  '  P OOOOOOOOOOOOOOOOOO     (Q T nmfcbaZWVUNKJIB?>=6321*'&%   .   v |}l ursb khiXUb S\]LIV GPQ@=J ;DE:3<=,u N   +     "!$#&'*),+./214367:9<;>=@ A 8=78 &:   & & xwx L @A  JT  MF&# P   T   . -. - r 9    3 65 8_        YNMN,'e hg j  K 2 % R .Wd4Is ^9.0   P   T   " #& %( '    ``  "9<;>16AB.       9" . - ),  ("      - /  cdcf ej  !%&#- /  h,$. -   $   T$%,$                          !!)4              "!$# &%('*),+.-0/21436587:9<;>=@?BADCFEHGJILKNMPORQTSVUXWX WZ Y\ [                    YP; V          "!$#&%('*),+.-0/2143658787:9<;>=@?BADCFEF EH GJ I 8<78         $    k   0/0/ 0/     + `     E ; i                               4        )0/"?& wm[        & %, +2 18 7> =D CJ IP OV U5\ a-d cj or ui ` F ' . -Y        &      W:2r?     Y (     /         " ``[\YNKXUJ SPQ@=J ;DE4 =:;* 301&() !     * +     %       !$#&%('*+.-0/21436587:9< ?B AF G JIJ ILK  B      DF+    O  T      ~ ?    " ;@? BADk       YZYZ rq ts v  W > 1 ^ "  Y g5 Kj c920    O T  " #& %( '    `l  ).EHGJ=BMN"   58     . /  s vuz  &#./  g-$    $  T%-$           ]    4   $^"      "!$# &%('*),+.-0/21436587:9<;>=@?BADCFEHGJILKNMPORQTSVY\ [X WZ Y           ]    YY   ?Y      "!$#&%('*),+.-0/21436587:9<;>=@?BADGJ IF EH G         :/%O         "!$#&%('*),+.-0/21436587:9<;>=@?BADCFEHGJILG L KN M h;gh     6&         $$$$   50        $   !   F       0 d                  W      @W?@    8       <J    8 Q J  cT"  'J' QJYTn  # B /    %   $#     XCWX     j   6 )       (  '        10WP_\[ )$K\!# #  '. $#  "      "         {"                "    l i $&: +& $L ffp~ VF+$#  P  T     r 9  3 65 8_      YNMN,'e hg jK 2 % R 7Wi4N| c930    P  T   "#& %( ' $  $  9$"    $- /$# h$,$   $           $        $    t$        4 i      +++$               E <   i 4    )0/"?& m[              &  %,  +2  18  7>  =D  CJ  IP  OV  U5\ a.d  cj  or ui F $'    Y    &      h:2?       Y ($   $"  0      )"      "!$%('*+.-01436587:9<;>=@?BADC ,&: 330& ,L 33 K  F  0              ,# P  T     r 933  3 65 8_32      YNMN,'e hg j32K 2 % R ,Wn4Sq h980   P  T   "#& %( ' ,   >,  9,#   ),  (#    ,- / h,,$     ,           ,        ,    i,        33  ) ^     ???,E ; i 3333333333333333333333333333334   3333 )0/"?& sm{[        & %, +2 18 7> =D CJ IP OV U5\ a-d cj or ui F ,'  Y 3333   &      S:2n?     Y (,!    / ! ,         ,   r,-A#-F 33 33'( 33% s7  8%Y'   !   !% }$ zo { m$- A#-F  '( % y2  C%Y'    !   !% ]j ZO [ ru8   B pu xUwxb RG S h-A #- F      '(   % k-  :%Y'    !    !% ('( ,           "  2 8    O j ,  F    $   "\ _ )*)2$ ! ?G3  %N:    -,-0      #N 0 PVOPOP OPOPOPOP& % & % & %             \       a  b J  # _0Xp       .   0X5C        7  5 -SC         S - N ?RM  "#&+./27:;>CFGJORSV[^_bgjknorsvwz{~                               4#!!!              =6                """"=      - ;:9XOP ! U p  ;ME       > mV 8      T8DB    $ ACESUKYSc]mgwq{(#  "#&+./27:;>CFGJORSV[^_bgjknorsv{ (O       P    xd [v  " !$%*A' .     * J   $%      H@GH. Z   (%     r F ~pr ~f  Z  N ) `bgg ,<8 MX  \   \Y    F  80 G(   )  P:;AA ,1- )2 6   63     `_`[_`_`& %*)*)1   )` $3 1 xwxwx& %C*')O    $7  $ F   2'O o   " M : P?OPOPOP-*)*)& %    %- \       @a?@     4<'*  0?/0.  /1  6 @e?@?@?@^            1B$*  '   @[?@,?@ ?@  !          1g$*6     T   7        d 7    %   @?@?@   a K A@I  i2)      #$ !       . #89   D    Q $          \[6       !%? C)$>U# )   q  8478                E /y" (y#     C    (P'('(%I 4 I  MD S ,#1          {/          ^w #^1X.          8}78 J           1Q$f K u  x  BA@I L  0.'       ~  x   uA@I m  (0#    Z   ba          +"    [            r+"   z   #Y  #U  #U0  *  5              #      >           #                 #        &   *)*  %Z[&               'CCxT9 7T97T9=B z   !          !   !0""!$#$#$#$#$#,$#      Z  Y  Y  F    ! ! !W *I   2; x     A@I     ! ! !  BU3 '' '6u       !       !     !  WEEE*  K    BA@I                  ( '             Sg7 "rF               ,  #&'()*)*), -. /0/j214187870/(!   x   A@I    K  DA@IL    j4) i#      =  HeGHGHGH  K  DA@IL N H\GHGH K  DA@IL9)3 <5   2           xK BA@ILo xK + A@I # o          +  +    +                       <)*        % #    '        272?0 9*O?,,W ,X ,)%t5o %M??)1[    )      !  !$ #&!&%& !( '*!*)* ! , +  !.-.-U0 !0/012143436589:9<;<;>=@?BA 8A >=D !"!FEFEHGJILGNM*  `A_`"              F4    POP A,J,a,|,,0/0/0/,0/0/0   [878788 \[\[\6  8  ZYZYZi2    8    O    j          ]d{   M,J,a,|, ,      ,           J 6121@  ?21@     C   .         I F\ ' # ,_q            : 612$121@  ?@       x   ,$+.- (` + #,x$       ('(6"     F   6T    H(GH:   adcf o t   XWX":3 D  % F         %4V , m W3 D  % F -L   /(    p9op     BAB56AA   \Q Nw %  "   #(X]|=F3)     L"    i E F*E FE F  &               #  v"    i  *   H*GHGH  )  L#    tE FE F!     ?      O%!     %E#    t  !   2Z    !BAB#A  h   #        $ \ *  25  #   & Qr   ," "   ( 7   j         # &%(' *) ,   -0/B  G J7:9 6+  " "JQDKX  6+o  7r    ,    " "    ( 7   t   '      & $             |M#'   $ P#OP OPLE F  '   H*GHGH LT   # p9opL%&;   \Q Nw %  "   #(X]|=@3#       @4?@?@LI # 0 `$_`E_`LE F6   $(B(  6 2IL  "#     W  #        $ ] *  -)  #   &) hghA            # #M";   oL! _ 7  E     ?! _ $LE Fu     J(;<1 u nLd   <!    1d Ntp'P    H    "&K  1      e   'uEFE D4P+!  C-      *# G                     .+!]?#z (*#  7        (    3     H2GH /  &   mnmn  & Q*   pnlj8   *   b '  U/.' V0 * ,    ,5(?   2V0 U0 *     ?   2U0 T1 * %    ,+(?  ,T 1 S1 * KE    ?  ,S 1 v/, _e   .*3  / , tT( '    +  -   M<2                  8 2 2 mW          ZgB D )     W  a [ ^  ADCFE)p G)v8 $  (   `&_` B     (!'('('( .          : %.     |            p   %    '# 0 =       ,  =   XWX     : NABABKT 71'0CF 5)A   e #Td\  f4N UK.NL TP.SL TP.SI m$E    *          ,          ,          |{t R U^  U]   O%fN  K  !L$ #& -P0 36=L@ ?B IPL ORYI\ [^      ej w rqtsvu 878t> R   U^ U^UV2F    V  L ;N ;K iB 5 "   Y "   Y  R   U^ U       JV   L   N  !$ 'K* ),    18C >=@?BA  j4K A].AL A].AL A].AL i C       W           W           W      W   R   U^ U           K& jK  ] L " ']* -05L8 7: ?]B EHMLP OR    W ^ i dcfehgrmpknilehcfadad_b]`Y\WZUXUXSVQTMPKNILILGJEHAD?B=@ 43,)('    `_   4.mD , Fk  -)   #  )Y 4   .   m `| ***$ -g   * '   $#  :/'& C> CD)'P   #::@)=+" !# " !-g *     ;d :    I~ H     @R?@       cv_ _^Yf    "K         S , *     , '  ,   ,1  ' , 0/0/0   ,\  <         $^  # $ A b ;@ }<3     POP/OP *    ib %& 1  *     = ;     &%&% ,G = ; 5v   r  ab      "    $9   r P3OP OPOP  *            3"  *   x$wx 1   A"1  .     #  ) I  1$ .   @#  /   $( /2 / $  P *- 6        9 :         !    #7o 6* " P *-     6 /   >.  '    ) B .  '  =  (   ( (/  (         .      Z,                     (] : G    Z,      0/0  7   ,  'P               9    ,     '6  l                      M ,   XWX4 %%"%"% ! % " %" %"%#%#%!%#?*B 2 9 9 8 9 9 9 : : 8 :  /.)00/00011/19   "                 ? l )             ? D     $    9 \     "          *  6 ,> M'    ' '    & -  )   % A   =$  NCT [   K ?A@I 5    '  K ?A@I 5 (      = %          "   )Y 6 !  F,, =  *+@,-W# !$#i M        & " %( ') +*+,+,+A. -0 / , Xe[Y e     6    )    (    '     $#   $#         B  K JA@I TK A@I      56    * $1+)-6. 4              ! $#& %( 'B"  P+OPIOP OP " i     $ O \- L " i 'E $   &     K A@I  "*)*      V3 4&E  &           Q  !'     &       $# F   K A@I idc^K B@I L _    KZr   *+?) A @ !             F  o  7      +      -   : <     %  ,  NE'++/  - : < `_`^ 7     `_`_`Bn    X6WX>WXHWX$     u   [ klkl    `g6? $    u  J7    J  popQopop op op op   %    0  WM    g ;? %    0  `b_`j    1( ":S     $         g 3 ( h747  %-(       c o  @ f8      E8    &             /   +  !` "Pl<   ;o  @ f8 (A'( '( '( D      +$.$!D n6s;       ^             U3P-'     ^ pQop$op0opopop;  U D BAM   %&   F-7D '    U n[ 1;  +-  k           - * XOP  ,   ;9u ;)d0' +-    !   ,    hZghghghghgh 3Dj        : D   $3D & ( & &$Ea % K 7zA@I -zy K +lA@I +lkK A@I ?K RA@I RQ) K  BA@I BO    S 4 2 l-_1+',1',1416+8F            %$ %$#( /. /.-a2 10      3    a h i p        : " ->     3=3 haghghghgh O       &  %O  '!$%            ` K SA@I STK  _j@I  _ji`K Dj@I Ljab    - 2+11./ (R  !         `M"MMMM MMMMMMMMMMMMMMMMMMMMMMFMM8MMMM %&&&'%(  *%( F&4]@% 3%           &         K /A@I /      K A@I K A@I      K A@I          K A@I K A@I  K A@I      K A@I                  ,,,, o&.1/#,-.+,E .+,V  6+ 6+P"+ # 4) # %         !"! '& '&%%* /. /.-2 14 36 ;<;> CB CBAF EJ MNMP  WV WVUZ   _f   ml mlkpqpqrqrq t  {z {zy~~                      y= &          K A@I )     .-      ]4)                 POPOP )   ) &*     S%,          ,    12&2 ?+         K A@I         7 ,@ 4' ?7-G" S     1)  ) ?  "    "     J Gm) n   %    S8  $ 8S H;<;< A B ?@ =    `&%    S PQOP(  \ukl g  ( %    S(   L PhOP          X!@ "   8l78  [^]    T )U !Z ! N   1  ') 878     ! #  A         #  n8[    q         +c   :  ) '-T'1V 17p (      *r  18!  yg    In 18:G 1F8u& L         - A             +   -     A    Y g   (3(            &  =         56          O        N. - %&/  >:Z4NJ0& N! "!a  - ' 4   V  P       D#/ P ?R ;            /   )* MM&-BJ  ߸ 'w1P 8  +, S1               f    ' #!"     ((  2    '+))3sY'w1   P    0/0/0     %   ! 5    .   &      k   XOP  hu & :9 ! 5 .    ``` 2"    l2          & -!-~2 " %   @ @ @        -,+434   hD%%   1V $ K  3      '$ +    3 8S78 TQR   [    X !A #:  * S  :  "]  7 " Zg   .       "   B ?r!)    Mvd <   :  *  !ps` s  %' 6S" : h3ghn@V   !   !  ,    "   @ = 3$j      $  > B 3$ xJwxZ$               : ^[\ Y JID A TOP M ;      w<$j      $$? C <$Z    n] 0/0n;;$ |(8\X<$t \@  L  80H|lP 8Tld D`p Pp`X@8hT d$4D0 xt  !H!T!!<"," X"P " "#(##t#<$#$ $%X$%$'$+@%.%X/%0$&2p&5&`8 '|:\'p?'A'xDH(M( O(8O,)Rx),S)tU*Yd*\*<^+t`T+d+e+|gD,i,l,n4-Ho-s-lv$.vp.y.|/`//T0P0h00d@11h1h02|2`23`h33|4lX444H55|5L86<66(7Tx7@78h889X9X99|<:4:@:$(;x;$;<(<d<4<=xP=,=H=8>( >D%>T%?'\?$(?(?(@@@)@`*@+$A,pA,A . B0.TBT.Bx.B.,C.tC4/C/D0TD0D1D28E2E(3Ed4 F5pF06F8F 9DG9G:G0<H<hH>HAITATIIIxII0K$>t@ċLCE\FHN<pPHQԍRVlWDa aHblgЏ$h@0A|BB(DPxEhFhJ@JJN lOp@PQ TXTTTU4Wp\] ]lP^_\bP cc0e8Xjkl$Xm`np8q(`vxw\x8yHydz {${p{x T4<X  ȋl|8P\4ԐLВTLD(x8 ܝ\TС(t \x,$@8خP$l44Pdx@ԿP$pXT8h (xd@P$ \h0|4L`\H\4\p\,hHT4\0 p h4d"($L)h)@*+d+,0.T./\0h1l19 =\>?D@D`JKOHOR`SLUddXY@ZDZ\^4T_|`4b HbD$fko,o|qs \D|ԝ,t, \(tȯH l İ H4   \ h  п P    `X  @  TX@X0(hxL(P(x0@4 hT4,|t TDPxhT <P   lLp (!@L"003d46\7L9; ><>@XB,C|DF Gh O HQ!HRX!xS!T!tZH"["["c8#h#j#0k$k`$m$m%nP%p%q%q@&r&s&u'\yX''t'8(((d( )̊X)x)T)@**ȏ*0+<++,+ԩH,4,̮,\$-t-<-.̿\.H..L/0/,/<0001`112,P222@33x34d4|45LT55P5(6p667X77p7p 8Lp8889 L999<:P::0,;H |; ;!<t&`<,'<'<(D=X)=*=*(>\+t>+>t, ?,X?<-?-?.<@t.@.@L/ A/lA0A1B|2XBP3BT5B07HCh8C9C:8D?DDDG(EIxEJE\LFQhF`F`F`8GcGeGhgHgdH С\> > `> |? ? 8L@ @ ԣA `A lA B B TC C C 0C xD D E XJ pJ J D > H> <x? @@ @ \A h= >> >> ?? h?X@ ?@ @HA P@A @8B @B 8AC A4D AD BDE hBE BF C$G LCG CH CI 4DlJ DK DK EL lEdN EN F$O PFO FP F|P $GQ hGW GH\ H_ XHa Hd H l HIm Io Ip 8J} J J $K pKȇ Kd L \L Lđ L @M M M 0Nd |N N O( dO O@ P TP P4 PP 4Q@ Q0 Q $R tRt R8 Sx dS S T PT T Tl @U4 Up U  (V tV V$ W \W4 W$ W' HX, X|3 X= 4YA YE YlF ZH lZI ZJ [PL X[L [N [Q D\Y \^ \_ 0]Pl ]m ]Tu ^v h^ ^Ԇ _ T_ _ _ $` p`Ў `h a Xa̒ ah aȔ 0bĤ lb bt bd Dc c c (d td dD e de e$ e ,f xf f g Pg gg?<>>0?\|??@h@<@dAPAADAh@BB0B`(CtCC DXDDDH4{H@{$K{ L$|@St|S|8[}\\P}^}`}b4~d~d~e hpjkH`4PЦp̪<(܂,|ȃ `\LdH\8ԆX Hp$`P0T@00Ћ pd \H|(HL8|TЏ pH `#$P%T&'@`(D)ؓ(*$+t-Ĕ.H0d23H6T79;D<=>4?AԘ D$DtFęHIdJKKHLLܛlM, U|Y̜[\lT]^ D`\abcLdfj<k`lܠ m,$mpphrs`sXtu<vhwأx(xt\yzz`<{{|L,}}l4ԧԁ$t 4LT4LĪ` T̅x@,ܬ|,xȭ(T,Hܮd dhtPL8Ա  l \@ȴ \4(DD(ܶ($t XpP H  ,xDȺHhh$,(2T2h34P4P?hgDj0lxm0prп| p p\LtLȞ<TСآ(ģt ܥ\Ч(|L4Ȯܳ@d4L,xhȺX L@0L TpPD4H04|4`HH4d4t @ Tp4 `XH P4@D Pp\<T4,!D`"8'D(,(x)+T0d4L6L9T;@>MD8NS8^<^l`o4xt<P$|,,0l,d У\xTlTDTL\0@PD8h0pxxxhHh TpdL$$ l x  Pp<d'x02(3t@5D6 $9\T:;>D?B,I08JJK@LdLMMLHNNO0XP|PQQdXRSSHXTpTU0U|xV(WW`WHXY<pZZ\[$p[h[]^H^_l` 8ahLaaDbHcldd teheHgiP(mm(n0pqDu vly,|~T<<x̐, | (h (  X  | , Xx h 4 T   < (   ,hThL8(8  px0`|-t/|0L8>A4F0IK MpOPRRTS$TT@UV(W,0X|XhYPZd[[]P^``@Xaab`c`,ddeDfij mpnv z\{}<L L  (8!!t!"l"d"4 #\#4##0L$p$̠$,<%%%ؤ &\&D&&HL'$'ȶ'$(l(()X))l)H*h**L4+h+d+$,Ht,,\-4d--.LT...D/(//p00l00`1 T11182, 2 2 3 h3|33@40445X5h5506\!6`"6#7%X7%7)7* 8H,l8-8`.80H9396988:x::P<:(>(;@x;@;\A<A\<B< C<C@=8D=D=E$>LFp>F>G?(]@t]A]B^BP^G^O^Y(_\x_c_4h`h\`i`j`$mHa(oaqaw8bwb`yb|{0c|c@|c$}d}dd ~d~d~0e||ee fpHffąfp4glg4gԠ h(phHhiXiHi@iHjjjX8kkkP(lxl,lmhmmndTn4nn`DoXo\o4pppp8$qpqxq4rP `rd rx r 8sss0"(tt#xt %t'uH*du.ul/v2Tv 5v:v:@w:w>wP? xt@lxTAxB y8D\yEypFyGDzJzKzL4{M{N{|O|(Ph|P|Q}RP}S}T}dU8~\V~TW~4XXhYY Z<[d[̀[[T[T\\0d]|^Ȃx^ ^P^_`$(`hL`0aa4axaa bD0b@b̆PblbTbc$d$Hetepgh\`iti؉hj(jdplmPn@oq܋dr4szԌd|8}P~@<̃܃ĎT0,hTȌ$D4XԒȗ l,LܝP`4̕ H\0ġtܡl|Lؘ d(8P8Ț<\t@؜Щ(xĝ \,H@؟8$p< \ $D<tܢ(t  LXDHh8ԦX$<tħ dP,d8Ԫ\$0LXD?ح4@@`AlB|B,BpBBدF$G|LL QT T|U[D]`b4td|fgPiLLs4w`x0y||̵|hXЩ8İLĸ|Xht0H \D<D40нH plP`$, Tt<+D,-(.0/1H2$GtG@I|J`KLDMLNOQ<|RS$U,dV|WX ? <C E 0G (H x|I L N \P HQ hS L,U V W <HW $Y [ ,\ |h^ _ da ha  b (b <d f i $4j pDj Tj 0k D@k Pk k k \k  l l (,l ll l l @m m o o X4q Hq tq ,q xr r s dt $v ,{ H{ | ~ 8@ < ̌ ,, |P d  d  p L$ 8  (@ xx  H T   T  | $ h   H P  <(   , |   P `  H < p 8 |  8 T H  <   0@ X  h p   `  H P !!4!!!!l !, !  !T ! 0! !8 ! ! !$ !t @! `! T!X ! !! #!D $! T%! &!,t'!x(!-!-!d.!0!1!Hh2!7!8!0:!0!>!>! ? !l?!?H!@!T@T!@!@!"WD"0XPN"XO"XlQ"YS"dYdT"Y4d"Zd"LZ f"Zj"Zo"8[p"[,y"[y" \~"l\~"\ " ]"\]"]"]@"D^d"^$"^",_0"x_Ԍ"_"`x"``d"`"`"La"a"aȘ"0b"xb"b"cl"Xc"c "ch"#t?#uL@#Tu F#uG#u0I#Dv8Y#v]#vh#0wn#wq#wt# xw#lxz#x# y#\y`#y#yL#Lz0#z8#z#<{ȴ#{#{#(|#x|#|#}#d}$}$ $~$T~$~$~$@|$h#$\%$(&$x'$Ȁp+$-$h5$9$A$TD$D$D$4M$(R$ԃTT$$X$t]$e$s$`}$~$ $D($$h$0$|T$̇0$$l $8$ $X $$H$D$$$܊`$,P$|$̋$|$l$`$  $X($$$8%%̎%%hh4%`5%7%TH:%@%)TX@)lB)hC)8 S)X)XZ) ([)l<])_) xm)\r)))L))`)<))), )| ) ) $)h ) *  *X * * *H * D* *8 x* t* *(t*x *| *"*hd#*&*)*X)*+*t,*H/*/*40*82*,3*5*(86*x8*D9*;*hH>*@*0A*XC*F*F*HH*pI*K*8`N*N*P*$q*tq***XL**0*H***8*D**(*x**4*h*l**XX**P*H*8*d*8 *| * $*!*l! *!* "+\"+"+"l +L# +# +#, +,$T+|$+$+%@+l%+%0+&+X&+&$+&&+H'T)+'8+',9+8(9+(`<+(<+()l?+x)?+)xB+*|K+h*N+*R++@T+P+pW++X++`Z+8, [+,[+,$\+-\+h-\]+-]+.t_+P.e+.f+.g+4/i+/l+/n+$0Xp+t0p+0p+1q+P1r+1u+1w+82tx+28}+2+ 3+p3H+3+4+`4+4̎+4<+@5T+5+5+6`+l6+6+7D+X7h+7+7x+D8+8t+8t+49\+9+9 + :4+l:,:, ;,\;P ,;D!,;!,<<",<\2,<4,(=:,x=J,=PQ,>Xd,h>lp,>w,?{,X?,?,?@,H@T,@T,@Б,,AX,|A,A,,B̛,hB`,B,Cش,XC,Cض,CP,DDL,D,D,0E0,E,E,F,lF,Fx,G ,TG,G,G,-WL?-WC-(XD-xXJ-XK-YM-dY]-Y0`-Za-PZ$b-Zb-Zh-<[hi-[i-[k-,\ l-p\m-\n-]n-T]p-]u-]y-D^z-^}-^-4_-_8-_Ą- `H-p`X-`l-a(-\a<-a-ač-Db-bT-b4- cЕ-pcl-c-d-Td@-dܘ-dx- 4> 4> 48? 44? @4? 4(@ 4x@ 4@ 4A P4hA 4A @4B 4TB p4B 4B 4@C h4C 4C h40D 4D h4D 4 E l4pE 4E l4F 4`F l4F 4F 4@G 4G 5G 5,H 5xH 5H ,5I 5\I 5I &5I T-5@J @.5J .5J 85$K @5pK A5K dB5L K5TL 4S5L T5L T58M ]5M e5M df5N g5hN o5N w5O px5LO y5O 45O 50P 5|P H5P 5Q 85`Q 5Q 5Q 5DR 5R 45R Ԫ5(S 5tS ȸ5S |5 T 5XT 5T 5T 58` D8 I8 K8P XN8 P8 P8D U8 X8 _84 a8 b8Ԍ 8$ 08t L8č 08 ̞8` 8 p8 $8H \8 88 080 (8 p8̐ 8 88h 8 8 8X 8 8 x8H 8 8 88 8 8ؔ 8( 9x 9ĕ 9 H9d 9 9 9T 9 9 98 (9 `9И `9 9l 9 9 %9\ *9 ,9 |-9D .9 l/9 t094 49 $:9Ԝ @9$ K9t Q9ĝ U9 \9d d`9 Xa9 a9T Xb9 c9 e9@ < ?<4 C< 0Q< TS<$ xX<t H`< De< 8k<d k< ll< p<H w< w< 8x<( {<x |< < <x < < <L P< < l<( ̢<x < x< T<\ \< |< d<D < < H<0 < < 0< (<\ < << <L < $< <0 8< \< < <h < < H<L < < <, <t < H< P<X $< 4< <8 |< < T< <` < < t<H < @< <0 <| =  = =l = = =\ = = =D = != != l"=` T#= #= $=L %= &= @'=< )= *= L+= $,=H ,= x-= P.= /=T L0= 0= l1=( 2=x h4= 4= <6=d 7= 7= <=8 ?= ,K= P=( Q=t ,T= `V= V=\ ]= l^= X_=D @`= d= Pi=4 j= k= l= n=` p= Lq= s=4 (u= w= {=$ }=t ~= 4= <=` ă= = (=H L= = =, =x = $= P=` = = =D l= = =4 H= = =$ =t = = =\ `= = =H = = =4 = = = =d = = D=H $= = = >h > 0> >X > > ">H .> 8> <>4 => ?> B> XC>d HD> 0E> xE>@ K>| L> P> S>l U> U> V>4 La> b> Hc>$ d>t `h> n> `o>` p> \q> r>H $s> u> v>0 w> z> |>  >p > >  4>\ |> > >D ܕ> (> ܝ>( >l > H> >X Ԧ> > >D > \> ت>( >x > > (>X > > T>D > > >4 > x> >  >p > > >` > l> p>H > (> @>, >x > $>! <>d! >! >! >H" >" >" ># >h# ># P>$ ?P$ ?$ h ?$ x ?4% ?% ?% ?& ?h& H?& ?' x?P' ?' ?' <?<( '?( 0(?( (?( )?8) h)?t) )?) *?) l+?4* +?p* ,?* X-?* -?0+ (.?l+ .?+ 4?+ ;? , >?\, @?, B?, D?D- R?- 0S?- |T?,. lV?|. `^?. `?/ `?T/ Ta?/ ,b?/ b?0 c?P0 d?0 e?0 e?1 f?\1 \z?1 4|?1 |?82 P?2 ?2 Ĉ?(3 ?x3 Ћ?3 ؍?4 h?`4 ?4 Đ?4 d?L5 ?5 d?5 ܧ?46 ؽ?6 x?6 ? 7 X?p7 ,?7 x?8 ?H8 ?8 ?8 |?(9 ?x9 0?9 t?: ?\: ?: ?: ?8; @?; ?; ? < ?l< ?< ? = ?T= p?= ?= @L> @> @> t @@@D @@D lA@D F@$E H@pE F @FL AF xIF 8PF8 PF LRF RF  SFp UF tXF jF` tjF kF kF< |lF lF oF$ duFt xF GP> xG> G> Hy ?Hz ?Hhz @Hz 4AH{ BHP{ BH{ 8CH{ CH4| TDH| EH| EH} L >L\ ?L @L CLD xHL KL |OL4 UL \VL XL$ t\Lt t`L M> M> M ? , Mp? M? M@ T M\@ | M@  M@ MHA , MA MA @M8B MB LMB M(C XMxC MC dMD M`D MD ME ,MLE TME ME M0F M|F MF MG M`G XMG MH \MPH MH `MH M@I hMI MI M(J MxJ pMJ TMK MdK MK `ML MLL d ML ML |!M0M 8"M|M P#MM $MN (%MlN %MN |&M O 'MXO 'MO \(MO )M

MV ?M@W BMW NMW NM,X \OMxX PMX ,QMY QMXY QMY 0RMY SM0Z pVMZ WMZ XM$[ YMt[ \M[ ^M\ Md\ ԥM\ LM] MP] HM] M] M@^ M^ M^ M0_ M_ M_ M ` |Ml` M` Ma @MPa ضMa DMa TM8b Mb Mb M4c Mc Mc `Md Mld Md M e MXe Me Me LMDf Mf HMf M4g 0Mg Mg Mh MPh Mh Mh M8i Mi $Mi M j Mpj Mj Mk M`k Mk lMl TMPl DMl ,Ml M@m Mm Mm M0n Mn Mn M o Mpo No dN p N\p |Np Np N@q DNq Nq N$r Npr Nr pNs NLs Ns Ns \ N4t t Nxt Nt ( Nu Ndu Nu T Nv NPv Nv Nv HNN ,?N ?N\ AN `BN DNL FN FN GN< PHN HNԂ ,JN \JNT JN JN܃ JN TLNp LN MN PN\ RN RN @SN0 SN \NІ ]N l`Nl cN jN kN\ qN xN yNL {N N N8 HN ̉NЊ 0N ȊNh N xN NH N N܌ N, Np N N N\ N ܟN ND N ܨN N, N| N̐ N hNl N N 4NX dN N NH N N Q >Q@ ,?Q ?Q \BQ$ CQp EQ NQ OQ\ PQ PQ SQ< TQx ,TQ `TQ TQD UQ VQ \ZQ( [Qt \Q `Q bQ` hQ kQ nQL oQ DrQ uQ8 vQ wQ yQ$ 8|Qp ~Q Q Q\ \Q R @R4 BR BR CR$ (DRt dGR HR S3 @S3 BSD4 DS4 8PS4 RS05 SS|5 SS5 ,XS6 DZS`6 XZS6 ZS6 [S<7 \\S7 4]S7 ]S 8 ^Sl8 _S8 paS9 (bSD9 tcS9 8Sh> @S> XS? ̋SX? S? S? S@@ S@ S@ pS,A S|A @SA `SB $ShB SB dSC 4STC SC SC S@D XS|D pSD SE S`E SE 0SE SDF ܡSF SF HS(G StG SG hS H SXH X l@X AXd BX CX DXP dHX QX SX8 D_X 8`X `X aXd lbX deX eXD @iX kX (mX4 mX nX nX oX\ tX tX vXP X \X X0 (Xl X X XD X X X( pXd X X X\ @X ЙX XP TX X (XD جX LX X4 Xp dX X 0Xh lX X `X` lX PX XX X X X@ `X (X X dXH X HX lX$ ,Xp @X X XXD X HX X `Xd X $X X@ X \X |X, Xx X X |X` @X 4X XH X X 0X0 4X| X X Xh |X X XX X X ,XL Y Y 0Y4 tY Y <Y( Yt Y L Y Yd Y HY YP Y \Y Y< Y HY Y !Y\ d"Y "Y "Y< 8#Y #Y *Y, 0Yx 3Y 8Y ;Y` =Y ?Y \AYL CY JY MY8 SY HWY ZY( ZYt [Y [Y D\Y\ \Y ]Y 0^YH ^Y T_Y _Y8 x`Y aY aY$ aYp TbY bY cYX cY XdY eYH eY fY gY4 DgY xhY hY iYp iY jY hlY` nY loY pYP pY pY pY8 qY qY rY rYl sY `tY uYP XvY wY wY4xYlyYzYzYd{Y{Y,|YH|Y(}Y}Y,D~Yx~Y`YY\܀YYHY@YYhY$ Yp܅YY(YTYDYԈY8YPYY Yh PY Y YL TY Y Y0 \Y| Y БY Y` dY $Y YD XY Y Y,dYxYYXYLYYY,Yx,YY @YXYYОY pYdXYY8YLYY(Y<Y\YY(طYxY|YYh,YtY,YX8YYYDdYYY4 YYY$Yt@Y\YxYHYY@YYh`YYYLYYY Y\YlY,YPxY,YY0 |Y| Y Z Z@!Z!Z!!Z,"|$Zx"@,Z"X,Z #\3Z\#h9Z#Z$,?Z$CZ4%[> [>4#[?@'[d?/[?2[@x5[T@ =[@A[@dF[4AK[ATM[AN[BP[lBxX[BX[CX[lCDY[Ctc[De[dDf[Dm[Ep[TEp[E$v[Ex[8F${[F4[Fh[(G[tG [G [H[dHؐ[Hp[I[LI[I0[I[0J$[|Jܖ[JD[K[pKȜ[K[L[\Ld[Ld[L[TML[Mԩ[MP[PN[N [N [@O[OT[O\[,P4[xP[P[Q[PQ,[Q[Q [(R[xR[R[S8[hS[St[T([`T[T[U[PU[UL[U[HV[V@[VT[4W[W[W[ X[pXd[X[YD[TY[Yt[Y [8Z<[Z[ZT\([4\h[ \[t\\\P\\\p\\\4]\]\]\ ^\p^\^t\_\X_\_`\_\<` !\`8&\`(\ a|(\\a )\a+\b-\Hb-\b1\b3\$c4\tcl5\c06\d6\\d7\dL8\d9\@e:\e:\e;\f<\hf(=\f=\g>\Tg>\g?\gt@\@hLA\h(B\hHB\0ilB\i C\iHC\jC\hjD\j E\kE\Xk0F\kF\kG\HlHH\lH\l\I\8mI\mxJ\mK\nK\hn L\nL\odM\LoN\oN\oO\0pbX>b>܊b> b4? b?0b?b@bh@b@bAȜb@AbAbA8bBblB bB0bBXbDCDbC$bCXb0DbD\bDb0EbE bEbF blFHbFbGbTGlbGbGb8HbHbHb IbpIbIDbJLb`JbJxbJlb4KbKbKc$L$chLcLcLc@McMcMcN$cXN8cNTcNhc,OcpOcOcOc@PcPcPcQ0cXQDcQ`cQtc,RcpRcRcRcDScScS cT$c`T(cT,cT0 cDU4 cU8 cU< c(V@ ctVDcVXcWtcLWDcWxcWc4XcxXcXcYcXYcYcYc(ZcpZcZ0cZcL[c[c[c,\cp\(c\Dc\XcD]tc]c]c^c`^c^c^c4_cx_c_(c`cX`c`c`h&cDa*ca,cacc0bdcb(jcbkc c$tcpc`cc4c d cXdPcdcdxchT@h`ChKhDQhHYhZh0\h|]h_h`h`oh$shzhPT{hx|h}h8}hhthԁhXhxh$hDḣhԊh$hph؎h hHLhhh8h hxhhhhhhDhh|"l>"l>"l?"lX?"l?l#l?#l,@#lp@#l@#l@#lmf>mf>m(g8?mtgh@mg@mhlAm`hBmhCmhCm0iDm|iDmiEmjPFmTjdFmjFmjxGm0kHm|kxHmkImlMmTl0MmlMmlNm4mSmtm|TmmTmnUmPnUmn@VmnVm8oYmoYmoDZmpZm\p[mp \mp\mDq`mq`mq,amramhrXbmrbmsemLsems`fmsgm(tgmtto4BoDodHo$HotIo0KoKodLoTMoDNoT$PoPoQoDWoXoZo4\ox]o_o$aotLcogojodmo(nonoPPpopoqo8qoroto topuo{o `|o\~o$o|oLooo<0o8ȍo,$o|otoodoTo0oL$ooo4oo\o$otܣooHodxoo oTo,o oDoDoto4ooo$otooodoph?pHHDpDpFp8Fp|tHpIptJph8MpQpRpXTpUpVp<WpWpYp Ypd[p]p$]pH^p\dpdp8fpgphpLjpljpmprpXrp vp8vp<wpxp yp zppzpD|p (~pT L~p p p8!p!p!,p"$pl"xp" p#pX#,p#p#LpH$dp$Ԙp$p,%p|%p%p& p`&p&p&СpD'Pp'ħp'p4(px(p(@p)ԭpd)p)p*pT*p*pp*غpD+$p+p+p,,p|,p,p-pl-pp-0p.pX.p.p.q<TAq$=0Eqt=4Jq=XOq>dqd>eq>dfq>gqH?gq?thq?q,@|qx@гq@8qAlqdAqALqBxqDBqB|qBq(CTqtCqCqCqLDqDtqDq,EqpEqEqFq\FqFqFq4GTqGqGqH,qXHqHLqHqDIqI$qIqJ qlJqJqJq@KPqKqKq,LqpLqLqMqTMhqMqMq(NqxNXqNqOqdOHqOtqOqsp>s>s>s<?s@sԈBs$Csp,UstXsYs` ZsZs[sPcsfsxis@Pks\osDrs0 tsvsЍvslws`sЂss@s|Dsȏsls`sLsđs8Tstsđ(s$sdlsLsXsTаstX>tT?t?t<h@t@tԳAt BtlBtPCtCtPlDtDtEt4FtFt̶(GtGtd4HtHt@ItHItLJtJt,XKtxKtĹdLtLt\pMtMt|Nt@OtOtػPt$PtpQtQt(RtTRtDStSt8PTtTtоlUtUthVtWtWtL0XtXtDYt0Yt|XZtZtt[t`\t\t ]tD]t,^t^t(H_tt_tL`t `tX\atatdbt<btpctct pdtldtpetetPtftfttgt4gtxhtDitithHjtjtPktLlltlttmt4mttntntoth|pt8qtqtTXrtrtst<tt(utut 4vtlvtpwtxtTxtytHzt<{t{t|t |tp}tP~t~tTtHtĀt<`t,tt Ttl ttTtTttt8܇tpt$tthTt0tt<ܪtt̬t(txttXt`ttPtDtضtĸttdttDtLtмtpt(Ttttпt ptXXttt<|tdtt tlttttPttt4ttttdtttHtt$t,txhtttDht(tt tp0tttXtHtxt,`txpttTth,tttPttt0t|uhuDuluu(uXu,uu@ uuPu(ux uu`u\ul!u"u4%u)u)u )uP)u*u@*u$*uh*uP+u+u@(,u<,uP,u,.ud.u0u0uLx3u,4u5u46ud8u9u (9ud9u:u(dwL>@w>xw>\w8? w? $w?&w@'wh@h*w@3wAd7wTA:wAwBd?wBD@wC8AwhCAwCBwDCwLDDwDlFwDtHw4E KwEKwELwFMwdFDNwFNwF`PwDG gwGqwGhsw0Hhyw|HXwHxwIwdI@wIw J8w\JHwJ\wJ0wy?yzTEzhlHzIzDKzT$Mz8NzPzD$QzRzpTz0VzXzиZz `[zl^zl_z paz\8dzezgzLizizXkz8pzqzؼrz$tztvzĽxzyzdzzH{z|zL\}z ~z~z0z|LzЀz|zdztzxzT\zPz@zDzTzz,ğz|z,zz\ȣzԥzzLz|>|t?|P@|@|A|@B|DC|D|0,E|LF|G| G|pH|pI|8J|`J|K|L|PM|tN|O|@O|P|Q|0Q|4R|R| PS|pxS|S||@ h| | |$!$|p!|!H|"T|T"|"|"|8#|#؏|#|$8|h$|$H|%|L%|%@|%Ԕ|0&||& |&|'d|`'(|'|'|D(|(`|(|()|t)p|)h| *|X*ܠ|*|*D|<+|+|+T| ,T|l,|,|-d|P-p|-\|-T|4.ج|.|.|/|\/ȯ|/|/||@0س|0Ĵ|0|$1|p1|18|2$|T2|2h|2@|83|3ܽ|3|4,|h4̿|4$|4||<5|5|5X| 6p|l6|6|7|P7|7|7|48|80|8H|9`|d9x|9|9d|H:|:x|:|4;|;|;l| <P|h<|<|=|T=$|=|=|<>|>|>|,?H||?h|? |@|d@h}@x}@}HA$}A, }A }0B }BL}B$}C&}hC.}C6}D7}PD@8}D:}D;}~hWA~WC~WE~HXI~X N~XP~0YQ~YT~Yl^~Z_~hZe~Zf~[j~T[o~[\q~[Tu~D\u~\y~\ {~8]|~]~~]~$^~p^~^d~_ ~X_4~_d~_~H`~`~`ؓ~4a~a`~a~$b~pb~b0~cХ~\cp~c~c|~@dĨ~d`~dX~,eԫ~e~e$~f~lf~fp~g~lgx~g ~h~Th0~h~h,~@iiHi<0j"j6j7 kA\kDBkCkM0lOlxPlRmTlmTm$VnYXn `nendh@o$oo (pDxppqhqqr@r|rrXshs\st`tPtu\uu@uXdA\B@DE(G(GtXIIKP(LMXN0OxPćR RXSpTU<DVWԉW lXlHY$Z[T\^_<|`a،a$bpc|e$fTftgl<Pry܏z4` D윀ܒd(Tt`hܲD8ܕ(x€xÀЖ̀ ΀xӀȗpԀ ܀pL݀߀DXtܙ,h<@HTܛ`d0H4؝PDlHdH"#4$8$+ؠ-$|/pt01|2T(33l48 55УH66h7>l?\GpHIP@0 B|C?d@Gld> f>f,?$i|?p\>>D?LB|CD0EHТ|p ,tpvy{`~~PP@80 Чx p`ؓl`䖇 P@ 0Ьx pl`찇PчXPx@`0б Xp   `H 0P(@$&,'t(),H. 0ȷX249h9`@\HL IIJ0K|KȺM,?xT@UtVTVW(X X\8YY@Z[L[<\_``d`eeLPj8kp8 qLrw(x|y|h肉TXȑHH藉8ԟ4,(̩xīdhl̹X້‰HljɉΉ8pЉԉ։((ىxډ܉݉\݉PމP߉,|XD<\H< |++ \5p5x<=LX@SU8W_b$cxqHrtluxxT|8  |hܒ0T̘ЛlDD|P4HXܳ`๊4|ؼƊNJTȊ|ȊЊ4֊D׊\ۊۊPߊ8$0dT @D(t\T\l@0x| 8dX8p  p(   Xh  p,x0\T@|PhL 0!t!" `#X%%x&< ' ( ) *l h+ , L-P @. / d/$ t/P / / / 0d p3 <68L8L99A`EF,G0\GtlGJLTPSV<Z|\`,@ah$@\܊,̌|tl  ЙXDH8h4T(8h4Ƌ$΋Tы ҋՋ( ֋t֋֋ @ۋXLދh8tH \ t  0=@> AP>A>D>@?<?dč?lǍ0@@, @D" Ad$dA)AD0A|1LB2Bh3B<6$J?tJAJNKOdKRKSLZTLP[LaL`b4McMdM8e NPhpNhNk Or\OhxOO<LPPP4cPAcC dEpdxGdIePP`eSetVfWPf:i::! 5z;;t)@o L;<e<!V"=0=8=t)@8q <4==!>!V?d?v?D M :?@!2:7:(@Df@=@@!gIAWAaAC Cs G4TAA:B!BCCC Ct G4@nCCD!_EmEE(r G4 :FF!2:7:(@DTG4/FTFF!({GGG,C8C@ G!H~H!rMI[IeI,C8C IIpJ!KKL  p  LLL!LLLx(@dX; LLL!L(@q` L3+M(@q|MBMKM4MNN(@=p4$%N2N5N4lANNN*@=p@UNfNjN4ENNp9Htp$GhNN O88DOROXO@/"kOtO{O8AOOO00 $^OO8?hO00 <OOO8COO002$OOO;?'P5P;P(\)Q4LPUPXP;TvPP(@PP;p+PP(\)`xPPP;IQVQ]Q51,^ |pQsQ;P"0HwQQQ;QQQ5H?1 QR;;#(@(  TRaReR;SSS<2D%! S? !T%< T T#T@~ XT00X'n qTzT~T@TT(@q$( qTzTT@TT(@q( TTT@&TT(@q( TTT@YTT(@q@) TTT@cUU(@q`* U)U-U@o=UJU(@q+ kOQUUU@{[UhU(@q, kOQUoU@[UhU(@q,! uUUU@UUU(@q .)! UU@$P"0q0.;! UUU@U(@qT.M! UUU@U(@qx.`! UUU@ U(@q.s! tUU@(@q.! UU@U(@q4/! qTzTU@TT(@q/! UVV@ VV(@q0! V(V,V@ 2V(@q0! 7V@VDV@JVWV(@q1! \VeViV@ oV(@q2! \VeVtV@#oV(@q2" \VeVV@(oV(@q(3"VVV@-=UVV(@d4)"VVV@=WWW(@59"!W*W-W@9W0006H">WGWRW@UWWW@H(8"WWW@WWW00 9&#WWX@&X)X009a# 6XGXKX@yXX 21:#XXX@-#X000<#XXX@UCX00<#XXX@m"Y/Y4Y00?1># CYMYdY@KYYY4S4PqA$YYY@YZ(@qTA0$Z#ZVZ@[[[Td\ 1#I0%\\&\@2\?\D\00xIG%M\V\i\@>\\\@SR"%40Kd%\\\@\\00K%\\]@f;]H]O] 21L% d]m]p]@|]]81HM% d]m]]@|]]81M%]]]@__,_`qx LS(&\\\@\\00SH&___@__(@\TV&___@__(@qTh& _Y_@Y_(@qTz&_`W`@ aab\u |]&\\Qb@_2\?\D\00 ]&^bhbb@bbb,<d%4$`&\\\@\\00`& cc c@O=cBc(@q a& Uc^cac@TT(@qxa& T^cgc@$Tmc(@qa 'rccc@2ccc(@bA'ccc@j d-d6d9HX rPd'MdVdld@ddd<(@@?1e'ddd@ee 21ph'e2eUe@Feee00Lj'ee@ e00j'eef@3f@fGf@H($#k-(\fifmf@ ff328mR( fff@,fgt`$@qv(g g#g@[[U)g$(@q(g g.g@f[U)g(@N5@r(^4g7g@zh$(@Xr(;gIgMg@hhhxx&9{)>iKiOi@ii<(@)iii@Nj\jL\(7)jjj@Djj11xM)jjk@VDkRk`kH 8`)nkkk@;kkk)lĖ)kkk@ ll00)l-l1l@H[lilol00\)lll@obl00* lll@ll(@qTc* lmm@9msCsFs@cTs[s91Z,bsgsjs@"ps}s(@r, sss@Ns81q, sss@\s81q,sss@mWsP"0D,sgss@zpssP"0ܶ, sst@mt{tty(y#q ,ttt@t uuSKԻ;-/uAu\u@1uuu8yHy#qPS-uuu@eFvTv_vSK" -zvvv@vv00p-vvv@_vv(@q -vvv@$vww51 H.w"w&w@8}/w(@_.4w=wAw@Rw_w(@r.dwmwqw@#"Yw 21.www@<xxx 21@P./x8x@ly~@9HD4 @49H4ŒŌ@v͌(@4Ҍیތ@(@q\4@(@q4 _ @YZ(@4",@HOVd9Ht%45]fp@i(@q+5@v̍Ӎ؍h"0 5@OV]'H(qt;6x@Ž*@t$_6(Վ@6=BS@ by6(Wl@"S@LY6OyĐ@pyy̢"X!e7(@SK!"t#7ƒ͒@00$7 @.1P"0$7 FIP@Iz}00X!qP%8@p&-2,@d"':8o]d@3o00't8@Eu00 *8 @FvLR00$",8cl@^#*1STD%4.8dq@ H T!"018FIZ@00!28@Η412q39 ח@#17(@D q8U9r{@WAN0P"\9i9əܙ@Y@H(:9!+6@HH3v=9Ț@@H(H@90=H@  @H( `C9ś؛@B@H(@D=:+?@Rʝ؝`y K:py}@ 00`qHM;žʞ@c00 N,;@&Rw@H(OD; @F[U,00OZ;1BR@P,@"|R;ɟԟ@~11X"tS;,P@)xSLh];Qkz@lߡ@,"`'< @C"'(@Pah<.;F@* 21$c< @̣H$2A ,g<(4@jHU\ 21g+=gq@z'P1> q\j3>@ '`K(Sl l>Zg@xu~`KT`C$p>ŧΧ@(@"q?*7{@`K$T4 ls;?"^j@3p(@$sY?@?14pu? )5@cS`e(@#K[hs@(@X$>}K@((@$@K+J@(@LC1L @<'PU00$ELlux@y0P"\FL@(@HL#@99NL@2=8TTpPLFSZ@cv{,@%4HQ M@- )@H(8 RVMT`y@O`KTYqVlM 6?J@fm<+@WM x0@5P SDaM\~@D\\00aN¿@00b N @]ku11lg7N@00t$hjN H@0$"4 P@'ft| 218OP@z$,@%4ȅaP C@ 91Eq\PU^u@ ,@%4Q%@l;B@H($QI^@|@NUT+@ s,Q@BPa`KK,Z2Q@00qhQNWZ@tH7XQ@s(@4%țR B@ & \ER@ lR8L@X\pw C#RRk@i(@d%RX@  pS aj@Z*;`\Sz@p& 12$S.@ 21ZhT@<2HJT=@mr(@0xT @-;G`qLz Tu@k(@T.;@vxTHYc@ w|00#U@.JV11 XOU@M@H(fU%;@d]dm 21@U|@Y(@TU@& 21`U@W5> 21q*VMV@@H(0FEV0;@ KP00tZV]k@00D`rV @dOV(\)Vajw@(@%XV @S(@ [$V :M@;z  219 WNWf@4 V(@$GW@@e(@%eW @Ҹ07(@xW>GJ@Ҹ^('"Wclo@w@H((W |@00d W-v@+; 21< "DkX@700HX6@~S 21"dX @(@Y%:_@6 21vY <EH@lUX(@Z_h@{(@ "EZ@_(@%4fZ)25@MZa(@$q4Zls@(@Z@(@YzL+[ @$#(@4J[  @5&+(@D[(6Oc@_(@P: L#[ @ :11[ ANR@ 29l \ @Z+(@T/\@7&00HH\+8G@`W00L\ @4BH(@X%U#|\cl{@& @H(% ]@[lD K (\)(]n   @UAN (@q4>]   @fF T \ @H("]   @  00%$]  y @g\& vD6^w@aҸ@H(L71_w@aҸ@H(T8f_@t00%D9_#@Z@,X=_>@H1 qxA_Wb@00|[C_ @,(@ D_1:=@iv(@qtE`}@21?1G&`@U!(@HB`(18@.ns(@dJ\`z@V (@,Kv`@5MV@l(\M`{@ V@H(@N`@00tN`@00XO`@ e00Pa @/00P!a4=T@00[@Rwa@',00HSaIRU@vPo@H(,Tat}@$i23qVa@00!Va#+@Y_00Yagz@@ h G q^Ib@]`TlTB ucgbMP@Z0#d~b_hs@@H($&Teb@ps00eb@AN00"fb@0HUZ00thcanu@@'i1cD @!!!x ^#rcz"""@Q#_#h#@' fzvc###@ g$u$$@H(dqzc $$$@H'%0%@H(,4|c ]%g%%@"&0&8&@H(; (d y&|&&@&&00 >d&}&@!i&00qZd&''@: '00q@vd%'/'L'@Fv''`KTpd ((,(@$(((Lxtz vd():)@i))),; %4Td*,*A*@n*s*(@T!<d***@*++zzq$d/+8+W+@+++xT@M$9e+++@\,,00@@+e 0,B,q,@ !-/-:-H$2C Ge---@V --`K@Mce..M.@ U..\),̧e..@ 00!8e/*/_/@ //zz< (e$010V0@I 00(PTF؟e 11%1@ ]1d1h31&qH\fw111@ 111 21X&q4uf 11i2@ 333<(@w @f'4=4Y4@i 44500P= fX5a5p5@ 55500&f555@ 6 6@H(&̭f6"6&6@Z+76<600`dFgM6V6Z6@4qx69H"t`g 666@h57C7N7`K@Mlg777@777((g888@9'999xNT\\9лg999@=g:u::<> h :; ;@f';,;(@#h3;N;W;@=&=?=L\l qHi===@/>6>@H(D*iM>^>e>@k>>>(@\qi ?(?O?@@@!@ 21  j@@@@@@A(@T&2QjA(A?A@?{AA 21&v4nj AAA@cAAA(@&j BBB@z"Y5B:Bd1HHjIBZB]B@%Z+~B(@qjBBB@9BB(@q4kBCAC@NCCC2Hq4kD&DD@weEsEE`KlK0! k EFF@Fv;FAF(@`(l LF]FaF@HFFF(@GlFFF@jJGXG_G(@'gl vGzGG@@HDH(@&pldHuHxH@HHH(@lHHH@ HH(@lII/I@3sIvI(@m \VII@II11$ Bm III@JVI00qTmII@IIP"04hjmIJJ@OJJP"0Dm$J-J4J@ |]DJIJP"0TmPJfJJ@KKKzS@DgSpSTJd)q}SSS@^S(T(78++qSSS@iSSH :,iqTT@!I00q -qTT)T@WATFT(@-qQT^TmT@_TT(@ql.q TTT@TT(@t.qTTT@*sT(@q/q TTU@ i=UBU(@'q03rSUhUkU@6 UU(@t'qD2^r UUU@P=VKVWV 21<]z|8ryVVV@ҸV(@q9rVVW@SWW q4<tAXRXX@WY^Y 21 >NuYYZ@ZZLxz\ @uZZZ@ACZx(@Au [ [[@ +[0[(@Bu;[>[@Q00Bu B[K[N[@`[g[(@(Dul[u[[@[[[x(@'xE&v[[\@%%\,\1\(@'hFMvF\S\\@\\](@]hJlv|5]9]@N(@JvC]P]T]@f]?\m]00Jvt]]]@$p^~^xNTNv ^^^@^^00'lOv__)_@N_S_00^@Pvl_u__@)Z+ `` 22 qQ8wS`\``@A a(@L Tdw JaMaTa@eaha(@qTwqazaa@aa()qTw\\\@\\00TUwaaa@$%b3b:b@H(0Wx sbbb@nccc8T ^#p\xFdOdRd@ \d<(@#:]xFdOdad@ \d<(@#:]yFdOdkd@ \d<(@#:P^1yud~dd@dde(@^_Ly!e-e[e@eee@H((\by eee@1ee@H(q cyf ff@9ps"f'f@H(cy.f?fIf@Ckfpf000ezwfff@cDgRg\g@H(4(Xjzpg}gg@Eggg(@ kVzggg@Xh h()qljzhh h@a(h@H(Xmz/hFhJh@hlhyh00nz~hhh@hhh 23 d(pzhhh@ h008qzii+i@iii12!q`v{ijj@L d6j;j00wN{BjKjOj@dTYj00\x]{^jgjkj@mjj(@"8yp{jjj@\j00y~{jjj@jjj00@qdz{j kk@4k;k@k00` {{ KkTkXk@dkkk*@{{pkyk}k@:kk(@q{{kkk@tlll@'> x|m0mAm@pgmomum@H($| mmm@8mm<(@"W|mmm@J[Um(@4k|mmm@q*sm00q|mmn@w_ n00q|nnn@n00qX|$n)n,n@C4n00q |nn9n@n00qȋ|$n)nAn@C4n00q||nnIn@n00q8}$n)nQn@C4n00q)}nnYn@n00qC}$n)nan@C4n00q\^}nnin@n00qx}nnqn@n00qԐ}nnyn@n00q}nnn@n00qL}nnn@}n00В}nnn@n00L}nnn@nn 21D}noo@(Wo00~$o1oDo@"Yoo 24D"Aono@oo(@8Xooo@Fvhpsp\50:^ippp@kqvq\ITl_ܝzqmq@C*sq@T<qqq@[Hq@T<Tdq r r@o=rKr\IUСVrgrjr@IQr(@Ȁ |rr@P"0 rrr@)rss(\) s"s3s@V[lssPlK(>sss@|]s(T(xZsss@IQ tt@',|t(tSt@57tt51W1$́ 7u:u@."0ށFuOuRu@@/^u@H(8eunu}u@Ruu()(خFuOuu@V/^u@H(uuu@rLvZvav 21$%qvzv}v@vv0#|8vvv@vv@H(l_vvv@vv('xrw ww@l-w4wH<:4;wLwYw@J ww@H((Pwww@xxx53\? "ւxxx@x(@yy:y@yy00_yyy@jy(@xzzz@f] z00Կ, %z*z.z@H5z00G n:z>z@n00Pc %z*zEz@H5z00 LzQzUz@#\z00 %z*zaz@'H5z00ƒ LzQzhz@-\z00Xރ %z*zoz@1H5z00 LzQzvz@7\z00 %z*z}z@;H5z00<zzz@'KzzH7PGۄ "{5{{@i[|} y hu}}}@l0}}U UL`p# ! ~~~@.*~1~@H(x76~?~C~@=Y~f~00Fk~~~@k12"ׅ  0@'#it(@("@Aps@H(PF€̀@K00   @U )211$"$ 9BF@i2\?\0009BN@m2\?\00@SVZ@qf00hRk@y&00e,59@*sA00zFRV@Z+r004w@ h00@̂00Lтڂނ@#y(@Æтڂ@00؆  @T ((`4\ '04@M@G(@\D"\ NXf@ ˃փ91""d@8,UP@ JSV@00\`il@]/00x@h00\@lمޅ0$"BD@ 00Ƈ&-@AHM00T܇T^@\50:`9Cp@ `K8U,azv?B@>vv$"0Tzv?H@Bvv$"0)NS@FY00@^gj@L_t0P"\4Wy~@Sm @H(t@_t00dɈ@v̍11alj:C^@11 b׉ˉԉ@  21X("-@Q^c 21$)( v@ي\)H(dp W y@@8DU m$@AF00T)S\_@Sm00 r|@(@G"+.@;psx(@Ӌ6?B@F(@ JS@](7 @~ďя֏00( @ ԋ "Oِ@(@)($ 0Cʑ@ܒ 2p1| )qT[^@Tf00h)ό>skn@cv00@* {@nH(@@+ Г@yj(@)+9@Ҹ38(@t,S ?HQ@#ns00`0.@00.@"Y@H(9/ @ V00\0΍ )2@AN>C00h1lJS@! af0091 mz@QaoP, 9C, o@CQb`{D {=řΙљ@Ms0$">@wl%@H(?,58@[UF00D@KY@LZi`{ D@d10 J@Νӝ00(K@ȞOE@ k00OZH@` ʟH3pHR @ /<A00`SPYn@ HH:)LUԠ$@ ʡҡݡH3p dX*3P@ P"0Y,¢Ѣ@ $"0X)@ZR "@ >C(@)ZdTa@. LSJI\q1>E@_ "Ymx14 ^@| "Y@H()T_ E@ @H( `@ +MXH3$4bor@ 00HbҐxצ@ ɧ<L| 1$f&K@@ c~(@p k. '@ `,{oBƪϪڪ@ vP11oW6@ v@H(qg«@ %b"-`K@M"vswJH@1 Ucd [5@,O00Il$̶@ٷD37 @Qf@2*`:2(@HH#*51|0;Xy@Yҹ3H:,G$@<A00ԝ]LU\@Sv{00s@YgtHPUPZ !V@HH: , jcl@{<(@q“@f (]@b|0<{L{< vtcт@#y(@ȯu@(@lҌS@(@İ)@ H/8h@< 22A Ȕ:@Or{@H(4#ؔS@_(@\@dyHT̬ @4k00 @Hl:`|bп-@c@H(*J @00g @00'0E@@n{00@Il0kvH3 `@00ܕ@00@@00@7DM@H(#>jsv@ @H(XX?@v00r@xBK15\@9x{@/2\@H(@>1p10˖js@E @H(@P7$@H(?I@ep~`KlK h^ @vP,3(-LzT>A@TI@H(N?W@&a(T((ajm@)}00@8ܠ 9ėfy}@ڗ@(@z q 7@23\A  qa?@ @H(0!?@ @H(5!*Q@01(@t E&5@fY`e00D*4Zv?y@005@@H(zv?@vv00T@00$˘@004@00D,@00Tt @00d* @00tL0N@x:H#%4\@vKw~(@ q@ LW`KhU\ Jԙ@m e00P@@H($$x@  Q@l+412t$bQZi@Y 23\@Tp@Y~00@;]\)H($ ;DK@kx\5$2P @00) Ú.@0P"\D ՚,9N@ 21*>@T00 L u@H3 p  #,/@H*sE@H((!J[h@_;](@`L"1@|P\E 0D*-@#O;000j@Mv@7[l0$" 3S@[00 4 -P@00B 6@ V (@\7Λ"1@P"09@)FvRY(@b;@F)H(% > 0=D@b_V["0>" bs~@21@2@BPU("XBFLv}@L(@X*qC[@#LO(@JDm@JBP(@"F~@Y~t81G&:~@2@_`quO@i12d%HQ $-I@MmxHJ*HR @ 21DqxSN @m MV 21Tt(q@/Ygzl|SEtZ@ \d(@[@C  21['$7R@\j|tUlK,{ qc[ @&00@Kh| @[$)(@"j09Y@yr00%0k,@00*kŞ@Y~(\)mמ$19@LQ(@mXa~@(@\cn@.;DHUpgp{@5@'+q@(@qq @CW<(@qr$8@I\e@H(t*sv@S00X+uȠ@jy00\yݠ#-@00@$07(@t >GQ@dfo@H( x@Lx( !@ *q"d -03@;P"0ס>AD@)H00̊KTh@F/((\*x@Pj8UT#-6d@e+(@>@"vP:2@N'@-HO,)@`ȏ` Zc@?21qv >@z # i{<Uy|@ V00բUy@ V00,O@ ()+qԩ\\\@\\004&@x{{ :̮l 5K@x{{\9GT@0i 8\5",:G@UTq<ƣ   @#@ (@q  E @#@ (@q̿u   @   UOD&G4H4   @\ j r (@P+  V _  @<  (@D .   @SU! (@K0J@ N j @r   @'+,%@X]00j|@Q00$@ 00ݨ@MW %004,5X@U#2HPC q @X`s @V00D @+-5::@4+,kDMP@Sgnu<+@T"z@8 "$@Gz̩ܩ`L"8@00N@HO<(@qxe\il@% ~00x @Xi<+@@n<(@dq|@OW\*@gt@ ^00L«@00 @ v00P @/& ELH:tW`m@DH00d+B@R0"Y@ #y()m.\@G00c}N@Y00N@ Y00p @&*Q`{{+"pǬy@wj)@@L۬@c(@%48$@]J00y#NQU@00"  @00`.@00+K:?@ z"00Z  @=k; @ 00Pj Q b f @J  00   @WM!Q!000!!!@v!!00H !""@/"00  " "$"@v>"00!έ(C"V"["@x"00t&ܭ """@*s"00q,' """@*s"00q' """@*s"00q( """@"00qX) """@ "00q*% """@"00q*3c ##@f00\+Ac ##@f00+Oc #'#@ f00t,]\3#7#@%\=#00,p qTB#F#@)TH00<- \3#L#@-\=#00-qTB#R#@1TH00.NX#\#@5d#00t. {i#m#@: Vu#00.Ϯ z#3##@?\=#00L/B##@DTH00/###@IAN##00+0 ###@S#001#$$@]$ $00|21 +$#8$@iP$U$00P3E`$i$x$@K$$00+T5r$$%@AV%[%00T&v07~%%%@"Y%%00&vh8%%&@-& ;&B&@H(&v9W&`&s&@@7&&@H(D':ԯ &&('@X(-(<(8U ?(((@IA)*`{ % D h*q**@Q**UK$,uG"**+@oh+q+XJUȿT,qIL+++@"++(@,qJa+++@PيT,],||'\Lx,,,@c-o-(@ qQ---@//F/dL`~//@$00` ///@//(@q`7///@_0f0(@McK000@ Jp1 100eb?1P1S1@ZIQ1100hg111@HO1(@g112@^b|22d6,T(yS$66 6@BH&6-')hzi,+64686@FJV>6U-u8{4C6O6S6@JvY6UL |^6k6p6@Q6UO?1h~ 666@o/6,T((666@s6-')Ѳ067 7@wc7U-u7&7*7@D7VJM7V7Z7@.7762q&g77@M7VJ"@777@K8LJ"Z 888@^8(|8|?1ti8r8v8@+d88HKhI888@D99:2X,ȋ79@9e9@P*99:2,ȍ9::@\:(@ȑdz:6:@::11tس::@Gt00$4:: ;@_; <!<$x(@>'>*>@/cH>M>(@,d-^>k>n>@<AN>>$(@,qpF>> ?@[@5@8HT E|8V@@@@y@@"0 j@@A@A%AT(H(Dq"{ ,A8A;A@.oAvA@H(@@AAA@CAA00`2AAA@CAA00E|ϵAAA@HAB002h( BBB@nBsB(-@+ķBBB@[ҸBB(@"̸MBBB@+(dCmCLRd"l\\\@\\00̻϶CC@oCC(@,HCCC@vDD13'0\\\@\\00I-DBDED@U[Dx(@s`DnDD@}KEYEjE< EEE@ dF F11 F"F%F@s}1Fx(@TqԷ8FAFHF@ \dTF<()d#:\\\@\\00[FdFkF@qFF(@tq*-FF@ҸFF(T(|-_FG G@k00GGKG@GGG(@F ɸ#H,H7H@! oHvH(@(HHH@<eEIIVV  dqTJ!J@~Tf005)J3JnJ@KKLxT| eK{KK@VLdLqL`qd|<| LLL@;IQ%M.Mt||4(qOM]MM@Zg$>NMN`K(V ˹ NNN@RwNN11 $NNO@OOO4VK O P*P@/uPPITT  PPQ@\QRR\l0 2YRbRqR@ psRR(@@ V RRR@vPRR 21`~RRR@'%S2S;S@H(X-XJSSSWS@H SS(@-qźSSS@`/T5T(@D-qGTTTWT@ mT(@rTTT@TU U23 NqDT2U5U@T=U00=BUKUjU@UUU11lTUUV@Y~VV]V11Nm~VVV@AVV@H( @C H$2l˻W2W@YWWPW00(cWlWW@BPWW`|(XX&X@i'PSXXX1,$) kXtXX@wZ+XX8@V XXX@AX@'L ׼XXY@?YBY$"00O, ]YfYjY@|]xY(@ YYY@'WYYHJ-\ ,YYY@F_Z ZHJ-  K Z$Z6Z@b#^ZcZ(@.q"X ZZZ@gjZZ(@q"4 ZZZ@z"YZZ412l  ZZZ@c[[(@q"D 3[[[@l2[7[(@2p ZZJ[@c[[(@q"H V[i[t[@$[[:Hi{ ھ[[<\@\]]x{|e1 G]_]~]@^^-^xNOt- I^R^\^@v^^^11 :^^^@D ^^(@ T^^^@QY~^<2H?1 s__&_@l___:8tX. rL" __ `@1a?aGa92D 2( aaa@ a (@H* ab b@bv|+ /(b1b9b@ANWb^b(@, Febobb@Cbb@H(t)#:/ ^bcc@.Cc,@"@0 tc,cMc@7cccLV4@.:@3 ccc@*d@H(@5 d3dd@eeeT@#> PfSfWf@of00`? rf~ff@fff 21{A  ffg@.SWgbgH|94$q"D 5ggg@IggH7E Kggg@Qgg|1H rpF \ggg@YcH>T+@HG ngh1h@cҹsh|h@H(.I hhh@hhi(@ vyy@jdyyLx|x yy@800 2zz@00 2zzz@f]#z(z$"04 /z2zXz@zz$"0lf : zz@(@0 3zzz@z{(@ {{#{@AN1{:{11Dq" 9A{J{W{@%Ҹo{v{11Č {{{@.|]{$(@q"X {{{@8{(@@ {{{@C{{11T {{{@N{(@l {{ |@VH+|6|\IpJ-" +{{K|@]|]{(@| GS|\|_|@j}m|(@ h r|{||@|l||Lx|q", |||@ ||11d< N||@t} }11t, {{}@|]{(@ }%}2}@#J}U}pVJ-E| Cb}n}y}@IQ}}HlK < _{{}@|]{(@К y }}}@}}12", }~~@+1~:~126 I~U~b~@$~~|11@2 ~~~@1(@PP2 LXg@j\I|V`\  @ JV(@", .@Y`(@L: L@:/(@z"Ȧ j(bÀ@?3f߀(@ԧ @Pg|1Hq"Ȩ j'*@] 2(@X 7@O@=Uov13\ @"YɁҁH;/̫ @ Vds<L$ @ps(@?1 >Ȃ@(@q ^0s@ |PE t )@Wep}}?1D L{@(;1} Å܅@ z"zVV4+ ĆՆ@XҸ00 <-9=@RZR@E (_m@2͇Շڇ@-@fD 9,@Z)@ ] $-8@sjqv00v }+6@JV('G4 @00h @5 ;HpQ } @U ()qX ,@W07@H(0 T FS@O@L- k@k /400X0 CPT@ps_(@q8 dm@&(@ q` $Όی;@/4BN},}RL @!ΎՎx(@ ܎@D@x(@08 Ώ֏@g PV x 6@2\?\00 VX'6@?Yr(@02 n @~ RV+" ):L@'h32Dq ֑@I8Bh32q Xiz@sSǒh32*\  ܒ@#\ax(@$ 8@=KdX Nl.@Η`\ x ~N͘ј@-Y00 N֘͘@1Y00 ۘߘ@]v00p @d V00 ۘ@iv008 @p V00 3 &+@<4d(@q" Fj@h(@2 Y̙Й@v00 y̙@v00 %)@IQW\00$D cpt@004x @ 00 @V00 #@I00Lg bk@11Rh :Gl@,@x+g)d .2<L@tw 21. Gzv?@vv00h [̝@U#@H( S uzv?N@ vv00C<(@Dq( NQ@1$"0$) )U^o@((\Th* jĠ@ޠ@H(1 + x@/00`+  @(@, N @00L, (14@ZT><(@q, CF@aV[<2HdqX- Cb@hV[<2Htq- 9Cr@oV[<2Hq. SC@vV[<2HqD/ mC@}V[<2Hq/ C@V[<2Hq0 C@V[<2Hq01 C¡@V[<2Hq1 Cҡ@V[<2Hqx2 C@V[<2Hq3 C@V[<2Hq3 &@(@q4 A@!(@q(4 \$@!(@qP4 w,@!(@qx4 4@!(@q4 <@!(@q4 D@!(@q4 LUY@WxT@Mq(7 @!(@qP7 @!(@qx7 4LU@WxT@M$q9 O٢@!(@q9 j@ !(@q: @!(@q(: T@ <(@4q: t@%<(@Dq: ,/@&<(@q: 7@-!(@q$; ?@4!(@qL; 'GN@:Z]<(@Tq|; B9dg@@2\o<(@q; ]Utw@FU<(@q; x@M(@ql< @U!(@q< @\!(@q< @c!(@q< @j(@q$= @q(@qd= ȣ@x!(@q= 5У@(@q= Pأ@!(@q= k@(@q4> @!(@q\> @!(@q> @!(@q> F@z(@q|? /@!<(@q? 7:E@cf<(@@qL@ 79dq@2\o<(@q@ R9dy@2\o<(@qA m9d@2\o<(@q`A 9d@2\o<(@qA 9d@2\o<(@qB @ps<(@dqB ʤͤ@*g00C @b 00.C @P"0#:C <@$$"0C d@$$"0D @$$"0D #4>@HHV(@tqE ]@I RR`J qTzT!@TT(@pJ '0<@ U\a21qJ luy@9(@qA@O$(@T TW@e(@\"DU jsv@US8W1dV 0js@US8W1W N@$"0W gҨݨ@,5H71Z xqT@@TTHx(@lZ qTO@TTx(@Z qTU@TTx(@<[ [hw@"Y$(@qt\ \@\$(@q\ \@\$(@q4] Ʃ@/ѩة\)H(] Kߩ@B[U(@(^ [ \@\(@^ m @/$)$(@q4_ }{03@ V=,@_ BK@[UU8,@G4,` Z]@}gL9H"` snq@{X9HUyU@'00hli Toˬ֬@Mo00j o @3@I21.q" l V_@[U(@l Ҍgj@ x(@l pƭ@ YbPKSo  @HϮԮ00dPq C @F7 00hr N@00r s +l@H: u R[n@;]00v ΰ@C 00@Tqw Ufy@Vv^@H(` qy @S@t8  3Ǵ@t`zL} H Uٵj@hn00 c @ zܨPd. sҌ@(@D ~Ҍ@(@ Ҍȶ@ (@ Ҍж@(@L ضݶ@(@ Ҍ@(@ ضݶ@$(@< @= () x%@Qy(y00t 4/8S@ (@X1S:@ C·ӷ @ @uHH:E X Q|@7YƸ00 f˸׸۸@t@\UĒ *J@͹չ8 @U4@H(d =FO@di@H(  r{@00@| @7!00 x@=xκ00ė 8ٺ@C!00 Tx@Ixκ00 r@Q!$00$/ 5>A@bIP00< U^n@Y@' Ҍ@008 W@&Xۻ00` @zU\)H( @}00   @U\)H( "5@IP00@ /")@C=D(@ MVa@JV{(@T/Ğ % @1$"0 5@/ڼ(@ P@BP]Hv\{L b \ei@\$(@q y \ow@\$(@q \e@\$(@ql \e@\$(@q̦ \o@\$(@q, @(@d8 @KT(@ & \!%@Y\(@ > N-1@^a(@p d N-9@ca(@ N-A@ha(@P ߩIM@m[UW(@vЫ \`@vloy(@, \!@{\(@ @;(@$Ĭ !Ѿ@Ee +x{{ iqT JFSu@hhÿ̿Lx{D,h k&@YHUT\ @00D Ҍ@004 x@00 #@@-`UL 3 @ >C001h IV_s@001$ g@Ҹ00D, @)00  >@e(@2 !@ax{{\~ %4< @Lv2981yr DMk@(H(X2d @PI00 ' @rPJT 8 \"&@\(@` H.<@@gg/$ b$<f@A332X t @ain00/ @m #0: @Cl '*tq" ),@H000 Ί03@9(@ >GJ@(@ ?{RU@ V[(@t ^`mp@d}@H( n@!}00d @*00 @J$H32` $7@C@W_1K ]Yhk@|]u(@4 |@(@t @5^|<(@ j@ 00 @QxX̟z @DH<(TT?1h \@\x(@ *!%@ $"02 =(   Q+ h VAJ t\T ^tta  xu~ h /z  *ҵ=   U U X  b  - x \ u   >< CbJ f $ky&p   6   O /8P cYFb }fqX@`X rvF ~fqh@p( F fqx@ l @ l @ l @t l @H l @ X @ X" @ &X5 @ 9HK Ov @ ({  @ 0 : ( @0x M 8 @@ `! H @P s%7 X @`P ;M h @p Qc x @ gy  @( }  @p   @   @   @H   @ .  @ D   @  [# H0 m '25 qh% uz a(  m   qx$  s$T,  u$D<  w$LL  \  x% l >> | >>  />>  G>>  _>>   w>>   >>  >>   8l  Ht   #X|  'h,  +x< , /L D  3\ X 7l m ;| # ? + C 3 K ; S C [ K a  U f( - _ p8 K i uH h s zX0 } hD  x X  (l  0  @   8# %| $ :$ @ $ R  % W^^%.!$% d06(!P% wEC%P|% UUYN%% iW%H% }b%@% -x!P& $d& & xx& X%& ||(& xx %' !UU%(' 7^^/(%@' LUU;$d' \ MVp%' mlu%( ,( H%\( )( v5( !C) %2FX$ ph) UU][\) xxmd%X) }vn$0p) $0* &UUd* :* J8%+ d^^2%4+ r>K\+  l+ Xat@ x(@x, "%@(2:)@- "%@(5x(@- @x(@T. @ x(@/  #@ x(@/ < ,58@ x(@0 Y]Y;B@MZ_<(@q1 fy&o@r(@1 L@+(@q2 ҵ@(@q3 @00q5 U@$P"0q5  zz@z(@q5 < .@(@qL7 T @#00q8 l @00q ; kkn@}00qP; UU@U00qt; --@;00q;  @(@q= @t(@q>  U@$00q>  tt @(@qH> < H@(@qx? T h@00q@@ m  @ 00q@ y&y&o@&00q\A X @v#(@q@(@q|E d h@A(@qDF /zF@;]I(@qhG P]`@1c(@qXI hqtw(@pJ @+(@M @7(@N (@N  (@$P % "J^X\V FOX^DuH`B3qW X^=00qTX {H^:00qX H^700qY /^400q8Z ^.00q[ !^*$500q[ * :=^kDIx(@,\ ܒv^\x(@U^ ,/^EΎՎx(@_ PS^x(@_ WZ^x(@,` `8EP^gl(@/a y^',x(@X3Pc ]jq^x(@d ^1x(@e < f,/^9;FK$(@df xR[f^M}(@f R[^U}(@ g ^d1H=xh ^`J=Pi H^^(@hi n 3s^xl q4q  j{^(@3qr ^  !21@8s ,3^AMn ܁ ` ~^sc\X\"  ^x(@$ ,"/2^@$"0 LENQ^_r@H( u{^@H( ^*1t)(\" Lj]^ ozt)@"8 ^Q(@|i"p C./7^fA(@" hwFI^patBHH (}^:0#4 N^Y00q o^;%00q *23^6A(@" =FM^V5a(@44 f <EH^X$(@В *23^6A(@"t |ho^x(@D |^(@T ^(@D0x  <EH^Xx(@ :^(@t0 a o^d(@t  <EH^Xx(@ ^^#(@d( ^*1^m(@t@  <EH^Xx(@ܗ :Cj^Fm|x(@` <  ^Q9(@q e\aeg00 qtn e@K(@H | |pQeIx(@d  e,tt Ue<x(@D e,u.5 +@`=pX >[_e5ttfС eaev0NLbM1 h KTw-<A00p xdgw(00 owP(@"P wp:OV$(@ an}wh31$ ) wOn{܌w41"| wh31<  w;NU4SM3 ulow5v00 wC(@$` wr(@4 Mw$(@Dq +:wUry(@4 w(@d1 4wM(@iq ^Ҍw(@ u 9ws(@\j w00t k%,w6A(@T NFuHW t}LJX4d 411   +DK(@1{ 0XjutLoX &uwpHt  j w56 q  td! " $$   wU h q MM 4'* }w  "   00d< $   w   Q $ / xw n    00t  z    ):}s4 l$]|wXG`0G 3 w    00l n !w@u44" %4Sb\,j I!w '   00` !$0CLM(M4-Z ! y 4MpJ-"p N",8Ix!@QQVC "([b3W " kknw(@q< " UU(@` .# ҵw(@qH F# w(@q f# kknw(@qX ~# UU(@| # ^UP(@` $ $(@h A$ UU(@ $ ++.(@ $ UU(@ *% oo(@q @% 11w(@q X% vlEwE4(@q k% ;w(@q0 ~% $(@8 % UU(@\ '& ^UP(@@ t& ++.(@ & UU(@ '>FW(H( '^kn:>H=p /'$I 1& >'(q k)@GO@ ` ^',Z cmx\@O+@ l',}< O+(% z'O\p(6H?1& 's71?1' '^a)@9' '^ah)@ #' 'DR@M #) 'UD"0") 'U#D"0") ( '03u9*@N* /(@IMy\K, :(U 0"09- L(+ KJ?10 c(6?B,G*@"81 }((Nae0,13 ( 8:83@",5 (-<A00`p5 ( *7@O^e3836 (n-<A00pt7 )}2 K\?1,9 )wC ;3\": 2)x!$H00T: M)(FPL0K o?1 = ^)R-<A00p= z)wb ;3\ "> )x!g00> ) l$(@? ) u$(@X@ ).7:@O(@?1@ ) UcTW_mcn$(@HA .*.7u@O(@?1A E* UcT{_mcn$(@8B |* 58(@qB *4*@"C *"%V5(@?14D *"%V5)@"D * :CjFm|$(@DE * l/6*@mE +|(@?1F + :CjFm|$(@$G 6+ l/6*@mG P+|(@?1H m+ <71"I +Pf&): (@?1lJ +?HQ]lq(@@K +z-(@`K + (@qL + (@qdN + \+.(@qN , \+.(@q$O #, CjF<(@O 2,(00P B,(00|P R, Pf&00Q b, * 6 !u   00W ,   c!#!)!001H\ ,9!C!K!]!!!00~_ ,!!!!!!004a ,"#"<"u"""00-d ,"""X#1#7#00$2 l ,G#T#_#n#y#~#00m -l###l#00o - #### $$00p )-$$$7% &&00, } [-^&o&{&d&&&00 e- '4'8'x''(@" }- '4''x''(@ -'' ((((@"ȇ -&(;(>("l(w(~((@ d -(((_()(@2 .).)2)D))h)@2 4.))))*(@"đ G. )) *)*(@ `.]*a*i*'*(@T2 .***Gp+|++(@ " . +++,,,(@2 .,,,99-T-(@qd .\-y-}---00F /-)-'.R.00F /,X.f.v.. //4<}( U/(/^//5 0I0f0D x/000hq111\l@ /122J2m2|2\ww q" / 22212q" / 222!223(PT@4 / |3r%$(@P 0 3)3>37Z3q33|2@ '0 3)33;Z3q33|20 <0 334I4.5L5VT 2 N0 555E666L}\}2 _066667g7v7@615t l0 7777(@`8 0 777Q 88"8(@$ x 0-8:8>8n888(@4 q 0888 K9_9e9(@q 0t9}99;99(@q 0999b:: :(@X5q f1 C:P:S:y::(@D  1:::;;O;W;@H(Fl 1c;;;^<"<*<@H(F4 1,6<Kib<;?=T="p 20g=t=x===dV+  28=>>H>c>V@} 02i>>>H?T?^? ;H3" F28|???}??tJ}$ S24@@@b@n@J v `2,y@@@@@H34 m20@@@AAA1T +$ z2BB"BBBB(@"' 2BBBZSCgCoC(@", 2CCCCD(@+;|3 2D=DADEEiExE:H$."= 3 EEEnF=F(@i}A /3IFWF[FFF(@E C3FFFFGG00d lF q3 G G/G mGyG~G00 8H 3GG1G00I 3GGGGGGD"0t J 3GGGHHHD"0 PL 0 N+H.H"3H>HP"0L 3$CHUHYH(pH|HHVlK yN 3$HHH2HHHVlK yQ 30HHIXIIJJ@DY 34$J,J0JJJ,̪,^ L4 JJJ:JJJ)@ U_ 4 KK)KDKJL_L)@5UPl 4 |LLLLL11m 5$LM MNVN_N@J@`"Tu 45sNNNNN)@v D5$NN OOP{PPܪ" s5PPP uQQQ005Ԇ 5 /zFQ(@q 5(QQ'Q400 5UR'00 5 R_RgR'RRRP"0  6R1R'tR S00 6 SSS'3SFSKS"0 Ў %68RSbSfS'SSKuh 86:Cj'Fm|(@ P6SSS'SSS(@ ̒ d6 <EH'Xx(@h z6SSS,3ST@'Ȕ 6T&T*T, .TU@H(Ĥ 6UUU,HU9\@H( 6A\N\Q\,2h\y\~\@H( t 6\\\,\\00d 6\\\,[](@3 6]4]8],|r]}](@2 6 ]]],](@q 7 ]Q],]](@q 7^^^,F^U^Z^<+@ r S7s^^^, ^^^00!D n7^^^,^^^00! ~7^__,bt___00D3 7___,_9`@H($ 7OE`J`1P`O00 7 a`En`3HEz`x(@ 7|pQ`3U(@ 7^a`3p(@ 7 ```3` aa(@t3q 80a9a9gdd3d,)@ L9ddd39x'KeTe8aT39seee3oeee,)@@l9ef(f3fff9262:gNgVg3g hh@H3?r:$,hEhIh35hh̸ }:hhh3c9iEiPi<1T!?1 #:_ipiti3ii412"`%:iii3a iAH2&:iii3nij j(*@d!2':j$j'j3KjVj,)@ы(:]jjjmj3jj,)@ы *: jjj3k%k*k0(@X6?,%; KkXk[k3kkkA1t!?.N; kkk31(l7lpKpRp3Mmbpgp$(@!DGD<nppp3Wpph)@H]< ppp3tpp)@`Jr<qqq3:qKqD;H"(L<Rq[q^q3hq00L<{qqq3qqr612|O< r&r*r3Errr2H!tR(= rrr3^Ms]sds2H!U=vsssEtKud\fd=|uuuEJvVvkvl"$h?vR vELvv461!z"i?$vw wEwww|\4s@"x0x4xEcYzzz(@| "|@ |pQ{Ex(@@{{{E|8|A|H^6X@V|c|f|E|||11!܄@ JaJaIE(@qTA UU(@xJA ||(@DcA|||Yy|} }((\44A}&})}Y~9}N}W}HlK!A ^}k}}Y}}}23\7ȉB}}}Y}~ ~@H(B ~/~Z~Y~~~|`X7CBj*Y4>00C ?HKYYpwh31!D~YT7=p*DY'.|<H"=p HD05YuG +@=p fDLUY-<A00pĔD eowY р""\D IY1'*@?1ԘD"2Y,?00HDO7>YGV[00$"ЙE"2Y,?00D;E 223Y(@q]E UU(@ E  YQ9(@qE bYe(@qE jsvc.F{x(@ Ec3(@ FVc;(@FcBˁ܁ 21q6F]cK(@4"qkF%.1cWCZcT41D"?14Flucg΂Ղh)@qܢF%.cpCZcp61T""pF1c(@ĤF | oc$(@F c'->(6H?1LGpEpcB(p9p(@HG >pHRpcMmbpgp$(@d"(6P;HNHcJVJ"H ԇ؇cPjv \"(Ic"[Ic$3\;1"0{I:LPc܊W$W"I  c0dJ@Md4Iɋc(412"q"I3D[c*r]0WK4=pJ̌cRR(@`=p(Jҍ c93t.q" JǎcCRY(@=pJhc8HUh;H=pJ$evzc#אt;3"K%ciV)@=pDK c\s$(@p-K{cؑx}{q"H@KGcӒߒ8S0k?lMK3Fc<LZ}}l"<KYchR(@q|6YN " 4 w|P"089Nˠ@H(":N !@*;N(58CNH6'8<NU^o@H(=NH7>O5(H(?OT4=Bi383Py'Ĭ@*,8vQ,5)-<A00pvQ@DQZTt@*4xQ,V-<A00pxQ+D"0#Tz4RDL]<PS#qĀVR&/2UF600XHtRT;>A,?00R BUY}1, "RѯG\d12@@7Su~o@H(4S Ӱ۰'0IPx7<4"#TgWt0 (@|?T00`<TƱұձ@'DT(?ɲ818)vU'F)@2\&U '*sDOD"0ܕ4UTx|ijl2H:TFUϳس۳R;H"TUE h)@vUl h)@4U#&#h)@`U|JMOch)@Ukjmeh)@TVym$NJ\V!'3Wb)'qܡ)Vk}#0Ģ=V8ѵ'298DV4Vn&'9`V u  ^>[b-H($#ԧV unEP"0Vxͷ<+@"̪V+ 004#, W00\ W uEP"006W(58QF|-@"ЬCW(5K'QF|-@"pSWkY\/#0XhVjsv80"0gW(?VxW@yr(xW$͸иKlHuDW$X.lHuxW83EfW|HDW8\nqs|HDW4ʹH%vW ѹ޹-@D#uDW "/:Zin-@T#uX$yYHlX-@uDGRͺкܺ0"0/X Spy;3W1AX;3)vhTX <If\¼;3)v4cX߼l4;411d#qTqX$N^{vԽݽPD@XSpy;3W1X1:Ms11t#"0Xƾ ;2D#"|X &9N]z"0#XXֿD"0#X 'Olq0"0#X &]z"0#X ;1#?1PXb<AD"0#qlYTSpy;3 W1Y<2D#"P'Y  ;1$?14Y 8AeAh31$BYl ;1$$?1PY;14$8`Y<AD"0D$qToY9FcUWPD@)vYwd9>#0T$@YQ<AD"0d$q\Y$u~1t$wY  0}}D$5uY{.5<1$"@YH<AD"0$q\Y$lu2D$sYI 42D$"Z+TOls51$  Z^Ols51$DZhOq51$qt/Z Olq0"0$>Z 7>4<2D%RZ >7>4<2D%fZ(bk~̫4$%pwZ$)FMܫ2D4%Z`;1D%Z;1T%4ZH6?0TPD`q"Z߼\W4;H71d%qZa6?0TPDq"Z$:s`+0t%sZ'co|hRtR%Z7A00" [(?v00[I^00"$'[(_008[(p9(0}E[ 'sKho(<2D%%4X[};1%%44k[1&H!t[AA\&8![ *30u6(@q[ =(@q[ <EHXx(@[DN]|1H%"d \Ed(@8$\6(@%=\ <EHXx(@xV\':00`\?CE[m@H(p\(uW@%? \ u12w \ )@w,\*7;"u@<1#\Ao$hS.#b]$&5-@' s]4<(MaxW@E"]4T EL]ky}a2}~R] GY]}~EU ^ )@"HV6^ R  0+@=pWN^,':>N{\L(=pZY^4O X ؕ_%(@%p1_ 1FJ(@%(i_<U>SPF $_0p4WX9=h_4> DJT5_(/GK]PL(", `^ x(@Թ`400"`q(@(5` i  )H(PC`'03?(@ W`FjjR\s<(Ll#:De`z6,@t`)?<(@#:p`h)@&`'v00l`+GR[;1 yr(` nwz$)H(`4mc(@` (@@`):T+@0`#X`,ILO wQ@<9a,ILwQ@<9Ha, 0Q@<:+a,IL8tQ@<X:(] RP"0&|] iP"0$&;a'03SU008NaJp{00d a:IN00bs}T+@0#b(2Y`,@0# "b u~(T+@4&#1b-T+@/#P@b gb3BGT+@D&#PPbV_bl"0(ebq<+@$b8Y]g00,b0!W@05K<b00OSQ(<d/b "ENT+(T&#b YmENT+(d&#xb4W(06db  w(CH,@0#T c4[nv#,l20:0$c(KX[kzI@#,KW U5q""{d,`HKhI&d  ! E J (@&d(d8U   + e q SLP&c<`0dz   p  h)@X3d   ) 5 B tw6: e(   Ro /Fe 'J1000DJ+eaSg,n<LGejtw)|$(@pM`eN(@:Oe hlv@ 5Ԧ de$oW@=phff$ 5Mg p W=psEfTJQ,?[00&lsgf$bor|W@=ptwf etD6zf?%2<L#}fTJCD,?[00&lP~fMgk@-`̂f w2ir@H(&Tg{41;Ag?#0Jg,$JsR\  5g(u      W@'5g   !!J!P!(@'"h a!d!g!r!(@q6h$y!!!!!!P@$'#]h!!!""K"Q")@4'xh(b"""R#$($ \  #h $X $Sx((th$_b$$)(lh$$%%;%@%((t6iQ%]%h%{%%%1`2D' i$_b$$)(9i%%%%%%1`2T'(Ri $X $Sx((fi %%%'&B&G&x(@{i %\&o&'&B&&x(@i &&&&&&x(@d' i &''f''x(@t'i T!'C$'(@qi zz(@q(i kkn(@qlj kkn(@qj T!'C$'(@h0j \+.(@Kj)'C'G'H(((3|DTj/)A)E)}))HKM"\j))))))$(@'j)))*00|jA*N*R*<**HX0j ***6**(@j **+B+N+P"0j|pQT+X+00 k^a_+c+00k j+Es+Ew+x(@6k |pQ~+$(@Pk++k+12kk /zFQ(@qk +++=u,,,7H,m(,,,A-n-71m$y-----71n ---q..72|n$..../ /@*@6o()/2/7/3c/s/|/86`p////00*@$mq0$0(0&Q0f0@*@ q m0z000072x qr000000(@' r <EHXx(@ r1 115a(@'0 r!151R1A222 T" lrs333333)@'hs)33))4$(@ s4(4/4I4T4[4$(@'sb4o4x4444@*@t44-<A00`p|,ttn442Q44(@ttn449Q44(@ttn44@Q44(@\ t 55)5H5S5\5WOD')v!u$i5r5u552Ds|"8u555C50"04#Tu55556322$tu6"6%6L6[600&u`6m6p6Cm#0qL'u}6666B2D%4(u666$666@H('@)v667$9=@*H)8v 777$:'727H,8 7*lvU97$;o@H(+vJ7[qS7$^700,vi7l7$0"0,,v$o777$ ^8n8v8118w889$#I9h9u9tddX3w"99$>,?00 X4x"99$:,?00 4Ex|99$$"04gx>A9$004x>A9$005x |99$<P"0$5x99$=$"045 y99$>$"0D5>y 999$ ":7:@:]MX;76yT+a:$,?00 X7yd:ʤq:$5::(@L8y:::$G:;(@:z;ʤ;$f7;:(@;=[=`=h)@ CI{u===$P===h)@47tEh{ ===$> )@Z3F{ ==>$> )@Z3F{ ==>$> )@Z3$G{$><>O>$>>>̻B$T0#I{T>>$,?00 LJ|8>>?$ ?5?^jgjnjzjj<7\5("p Qjjjjk k(629?1xjjCk 6jGjNj*@("NUjWkY0"0 #<^jgj]k&zjj<7\5(" ikzkk/kkk)@˔kkk?k)@"`kkkf l (@20vallah)@l*l.lFl}lP81\  lllll)@Z3# lllll)@Z3l> lllll)@Z3Zlllllh)@ &mmFmm(@(lX$m9m poooooo$(@$)@$N ooooop)(@Z3H%e oo poop)(`Z3P& oopoop)(Z3X'0pNppppq̧2=p,AqNqWqXoqvq`(@4)",*}qqqqqDRJMw/5qqrQrzrr\wlw$321rrrrrs|wlw3 ss,s3^sss6~00@c4~ &;@t8\5)qdJ~ G&;@t8\5)qd]~ Z$&;@t8\5)qeqjmq ^7x)@(fyjm^7x)@f  ({27t9"tjɀހ$NRk̛(9FmU*(9F lox ΁݁T413"lq- -RR"rEqTzT84YjD"0sQ=ak h,*)v]kO*dOO00)vtƂς]$"0*w1F#ʃ4=p| @.3)@@}Ĝ |@9<x(@}؜UCN=Y`(@`} |im(@}pt(@~1w{)@d~,фRJ9Pt 2Dž4D"d@+<Ý $'*h80+@"\ם ?Wp;wt9"ԉ Ն YIryQlK="|ч܇ xx3zRJ*=pcq6$`(@"<s )2(@qh 9BqEP(@qԒ /zFW(@q UU(@؞ zz(@q ^gjjm(@qԕtJdpH Oje\00T b (@q0V&+ (@$*"5 2=H Y$(@4*dR Kdoz$(@D*r Ux(@T*4 Ux(@d*X236Ŋ(@ɡʊ͊(@?1,236Ҋ (@#Р^^a (@q)236Ҋ (@#H^^a (@qj236Ҋ (@#H^^a (@q` l/׊)@8 Ѣ ܊ߊ)@4 j+ )(t* #,?D)(*Z39 j+K )(*` T,?D)(*Z3 j+] )(*` f,?D)(*Z38ݣd]ooh)@̨^^ah)@ &CjFt$(@h4 ^^a$(@Syh)@:v0ȋ؋614:236Ŋ(@\ʊ͊(@?1٤ )i7>)@*vGPYgn81*""236w*@v<A܊ߊ*@"dc|V&+ (@*"{ 2=H Y$(@+ Kdoz$(@+D Ux(@$+hѥ Ux(@4+236Ŋ(@0 ʊ͊(@?1`(236Ҋ (@#F^^a (@qg236w*@v܊ߊ*@"236Ҋ (@#Ʀ^^a (@q236Ҋ (@#H ^^a (@q`0 l/׊)@8 K ܊ߊ)@4i j+ )(D+ #,?D)(T+Z3 j+K )(d+֧ T,?D)(t+Z3 j+] )(+`& f,?D)(+Z38Pd]ooh)@̻k^^ah)@ &CjFt$(@h ^^a$(@¨yh)@d:0ȋ؋61: 236Ŋ(@\%ʊ͊(@?1D )i7>)@+vfGPYgn81+"236Ŋ)@"< kkn(@q (@q̩e00 "Ќ 283+"0|'6|00+ X &;Mdm61"|vLK"ɍ<ԍ5z00+ê\V%%V 21   '&^7!(@+(2='6x'JK?1L Žώ֎'J"X<2:?1$EOS'fo{?1!/'p)@\ϫ$'#*?HH?1!_'+)@4do'2)@?1X';ː(@q  'V"5(@ ݪ:='3mc(@@X\'Q(@:Ŭ ϑ'(1(@0Xq` |^a'kz(@, 'f(@,Ҍ'00<N 'nĒ(@,s˒ؒߒ5<(@ !9*9>00$,dϭ 4E9V<(@ sEH<e(@q% j23<6w(@qXZ |X <m(@q8Qؓ\a4P4,XQ2/JW41D,D^QM(@X"bo~QO۔pA3$;3Qn6(@?1hݯQ/JW41T,T'OQ(@hOSfyQ >3y1Q6(@?1=VaQ)Ȗݖ @հg gQGdW$+@-.xQK;G(@N[jQ`ėЗٗpA3T;3<Q !8)@d,Q (=PQBp;2`2\ ØQ+@;2T"Q(@hα&Q(@|@*7WQљݙ lX>{` 3H 9dQ+d,o{,ܲjv}QBʛћ47p t, r$؛QN&9Fb41Q\Q_x(@o,Qd<;d Q(@q$Q$)$+@,3Գtk(09Jlb00'l";(H(,`\Ɲ͝l-Fڝ(H(,,l5#*(@",(3?FlA^qx(@"|rP,',` ɞОry\)',"L!ɞry\)',"8"( r,?D(',q,#?KrP,',$xɞ[ry\)'-"$ɞkry\)'-"% {r,?D('$-q&rP,'4-'ɞry\)'D-"(ɞry\)'T-")& r,?D('d-q*>˟؟rR] (@;"+]7DKrwW^(@t-q-| Uehrp$(@-<- |pQwrx(@X-zr $1v>"X0PcprQơݡ,<<?1 3 ruMdobS ?1d5 ~r.@58 |r!P"06Zr%ӢbJ@"7,r1c~D<?1(;ʣrE (61t<?1t=޸ %29rRUhqB1`>$ޤr[ɥb8 -bE%,800E̺ Qj|ڦ boqDI,)<K6H>q(@:lXdES1ԐH q$aĬɬ(@-"aJάĬɬ(@-"\b[ ݬ.ɳ0HKT4x Qi x̱=p%IUX.}̎q"܅6 ķ`*܎<Dm;T$FsHX4l=pž qTI4T(@qپ չb,?hd Xd4=pX$Xf(lc\O( ]`3H49Hjmv͌(@u0?l`|p"fo~$(@< foǼ,$(@=GZT_f(@@$վ| -b.7DYlu@H(-Lx(@ ܒ\x(@X\ u  38P"0-0W?r]x(@4O $ax(@4=\~[(@d=tfn#(@= "h8=P"0-0DQXdqn8  ""[)@=p*7; 12=p<Wl?qHD%(Na|?1 @j}e{A 5q`(D &-"LJ 7:F(@r>ET`((\H ]Mld q (@q8 07(@X?q\ J[f*XJ@M 6 '3R |E Z X,EO%*h#p'-<A00p$ 2E7`Į4  \ #0dJ@M?I|-<A00 p<1 Zgl0PYA+2 jq12@W|12-n : X-@-'1JiDԂpd3<GN[jo00.h zX(@.  gGZ9, k}dS`Xq"l '+-  ) IS z"08 *- ECH21`q9Q\s [@M=,; -<A00p;N Y00$<&H +>G ,?>`\it (@=H@t%& /z:Ĕ "$K { >C21@q LlVi -CP q@Sru {P"0S  Wh;H$8[~zcTK$."\\ 7JQx(@^^q~SxX`0E_r@H(bP{  @H(dr'. d@Gt)@4."d .NQYfu22D."eo|/AaAI'@"hG<2X@"j$4F=jZmxlB2k,>  DHf5C\`K p& "z$9Feh:x &$tw00 "4  smx(@Ц  +fy22T5"p9i)0t)(\"̪[d{o)@2$  chI\q(0 9!,cXT.?J9Jig)@d 28U[t)@"ٽ ^(@"^$d(dM4 "`s11" &*(@"L^#(@d."d(@t."3v''39(@ ">F;1.\P+2)@@2S`cefq(@"  vxxB4?X(22."H? F9>(@ g5YMV]Kj{(@@g5tOgl(@"$LBH$>a9LW22`7fovj=25 vX q | =25  G  (@0      (@g5T " + . )Y ` (@g55i r u    222J     (@g5`  " ? X c =2 ?x r    # , T42qw0ۼK X [ n 66i '@."p } v    '@@"   , t)@"d     # '@D6"6 S v    '@Y"1<?N IcJHT]`e }22`2|!l  #(@2(4<EH icT2N$ <L]l c4PI LjJSW u4612|| 52q"T `(@j />GH71(Tlw) X?+  t,@>?-  ]@GX>H>?. \ ]@GX>H>?H0  X>H??2  '@ G X>HD??3  j w {  mG  BH6?H6    !!X>Ht??7/ -!6! x!!!t,@??9D !!! " ""t,@??;Z 5">"A" Y"h"o"X>H?<q ~""" &""X>H@?= """ ""X>H.?> ~""" &""X>H4@?? "# # C#R#_#d\Od@?A ~### ###\l@? D $$2$A$J$L`s.?D U$^$a${$$$\|.?F $$$_$%d8@?H %c;%^%c%,,@D@UyIF v%%%e%%$(@J[ *%BEΎՎx(@/K%J(@Ks%%%L%%(@Ly^4g%[(@L]7&eF&(@lM0&/&j&m['''l4 PI q U8(4(h()#)0)s"Y yu))',x(@A[ ])*%*x(@/\( / g,*<*K*P*$(@T],<[*g*j*x***RdM$/q^CD******xcdM4/?1D`aD****++H`dMD/"a~+*$+ E2+7+(@T/b+*>+E2+7+(@d/cL+U+`+F++(@XAqd+++5 (++(@6qf,/,N,A,,,c8Rsj---y.-=-F-d1Ht/"k M-V-Y-k-z--`J/"`l'-/----d1H/" mF^4g-(@$mb---i.~..p.....;2 7hr6..Z/@/E/-@A"sT/]/X@sT/r/ X @Xt /F/H/(@qu i/////x(@@v <EHXx(@hw(/////'@/"xA<EH0(@xX*236A(@\yt 00/0$(@/z0'0.070<0(@/z*236A(@<{C0J0V5V0(@`{_0h0w00(@|*236A(@,}*236A(@} 000l(00(@@l=01171B1G1(@$A[ \1e1t111x(@s^*dm(@/ԁt1~(@/^^a1(@ (@4^*dm(@/Lt1~(@0 ^^a1(@,(@G  Q9(@qLc ++.(@q 4(@q` (@q  l/111q̅111172L2[2T47"x[23;4H667p$ = 888T9`9f9,@DY4g9>dDd@,u999O`:::L*0Qs| :; ;z;D<7|q S<`<d<< ='=+-TAX=a=4>P"0(%e=s===>4>Y |w9;x(@,p |wD>?$(@H |wH>Hx(@dUL>O>Lx(@S>`>c>B>> 21qh>>>]/?L?c?7?1 ???o?@(@A"t#WG@S@(@v9 X@b@@jAzAA 21LO AAABBL6HeC CCUF:CX6H?1y ACJCMChusC|C(@0"lCCn^7C2H?1 CCCtcDuD+@}D  DDDDE2HA" E"E-EEETE[E(@$0 fEoEzEjEE(@ ]EEEG6GTG(<Ac6GGGGGG$"0@GGGH%H(@ |pQ*H(@ |pQ.H(@ 2H(@qEFNHYjZHT4140?1$EFaHYjZHp61D0"4:(mHvHyHI4HtO+(FHHHfHTN@MR,ZHKjHtDD^ HUPHH ut(iHH IHK@M"t$GIT I$ HUP-I.H utH;I? IHK@M"$GIIJT IWIfIUII)@A2IIIsIJ'Jup7?1pPJ]JJ}2KyKK`q,u qP  &LLL(@ c1$Ld2L(@ 7LALELLL(@",LLLLM(@"? MMMSMpMwM(@`9uDTMMMMMM(@W1HyMN(N OaOO hOPP%PPPHuXuyr$)Qh(@p$Xhehhi.i3i(@B Vi_isiiii(@,iijejjj(@Bs] jjj9ijk(@DBst$k&kBk5kkk4*@Lkkl2l7l<(@ sȞ JlSlWl(~l(@sTEllllll(@@Сjlm m "m5m:m(@T0sآ pEmHmKm(@qģ Rm0_m( Uom(@ ݪvmym( `mc(@ }mmm( fmm(@`ܥmmm( xmm(@tBЧ n&n)n( Wnbn(@q(7 nnn( nnn(@Cq|i o o o( Vo(@q o$o'o( m5o:o(@d0 AoJoMo( ioxo(@ooo( oo(@?1Ȯ(ooo( 'p>pEpl1#Ppappp( Appp<|XCܳ qq( j qq$"0@ Nq!q( nY$"0 Ҍ'q*q( r$"0$0q9qLq( voqqqTJCu4 qqq( qrr`B)r2r5r( ;,Er00+)r2rRr( br,qr00ON~rr( 3Hr00`\rr( j00hq\rr( j00Ⱥrrr( err@H(\rr( r<(@q gdr( dr)@" rrs( Es\scs(@dL sss( sss(@$8 tt)t( Ht[tbt(@Cqtt( ttt,)@D5 ptt( !ttt92t0h$uu( *6uIuRuTJXDu euousu( uuu(@BL vvv( 2vAvFv(@0T OvXXv( 9tv(@P --( (@q kkn( (@q *30( uyv(@q~vvv5 v00 "4nww3w5 M_wrwww00DHwww5 :w (@4www5 wx$BHxxx5 ,)@D(SݪEH5 &(@(jR[^5 94h(@q)mv5 >΋311q+($(5 ɌՌ0PsT0(=A5 ׍0Ps$40/8;5 Gqx̺H@-bL6(5  $0pEL9"0QZ^5 9iDJ`-b;60ԏޏ5 $S:CD@M-b@>FDPZ5 q)P\| wMu 5 ^700$1| 8N@$1=5 ٔ,dt8S8L .25 2DgL58^&5 ,VIÖ0041 ^L@̖ږޖ5 z,8ml8li$Ș5 )04HF`o4Qdh5 ;ΙXFhuxt8'5 m2SmH:\9P<& 5 )ޝTdltW=PBCJ5 g^700D1| _4Taj5 @Qd|ܺT1tl,y$my5 i*@F', Ÿ՟$5 /but[%404ҡ5 ")wP:5 VIÖ001  Pٰ5 AQf4C3D!:5 #VIÖ002 B 5 g,)@Q "5 ;X],)@h`jk H _pok UH@_x~k &x"k &hk -H)h k vH{ 5 Ƶ˵x(@2ҵܵl m¶\lXG2T +l y ?ҷl 4-@@2v .l j00d *.l xP\: *l "xP\T:$ *l 3xP\: *Ol IxP\: ,l x(@ R l $71۹(8|dCqx  !l 8_JUbb|C  lul N981`qºԺl X_0dkTD;"KX[l nGm(bJ%4p)(|l ~߿!|D( 1 4 d'T;Hl b' "x0 l dAx2l =I4 )@?13l G)D3t @5 Il kR(@qD6$Wixl l|4$9\l 4bJ4T:$l n#,x; 7Gpl ||;4>' #,/l EC5?YPbql HX{Bfl s ,I%l }GL-@8J _hkl d )@"J]_hol d )@"K s5|l C/@=@Lvl t/@$LSl }"f(@{M^l y#x(@$2M)_hkl d )@"HN{_hol d )@"N s5|l C/@=O%vl t/@$XPql }"f(@{P^l y#x(@42Q_hkl d )@"Qd_hol d )@"XR s5|l C/@=Svl t/@$SZl }"f(@{XT^l y#x(@D2pT_hkl d )@"UM_hol d )@"U s5|l C/@=xVvl t/@$(WCl }"f(@{W^l y#x(@T2W  (@qHX $)00GY'.jN @O(@?1pZA.jT @Ot)@?1ZY(Za q(@d2\[ (@p[ (@[  41]bo% +:)@?1^?KR ]lqP"$"^?Kz ]lqP"$" _&?K ]lqP"$"@l`v?K ]lqP"$"`8a ix(@La \+. (@qa& `(@Db* $)00Gc?Ɲ 1Fڝ(H(t2ldtƝ <Fڝ(H(2dƝ  DFڝ(H(2teƝ LFڝ(H(2e5L#?/ T^qx(@"HgJ$ENQ }AH2ix @H( (mge +d)g$(@"m?gh 2d)g$(@"(n_knq ` (@2"p;( wl()@2"q $? 8IJH"Du  h)@v -R o\L0;"y   .<x71",|3  EZ] ,k)@2~Q ( OHd"l (M k*EWW" Vcf  (@2"<   312" 0HW 32C"x , *qX@32̐; 0 x:t\+  @  85> Y (o m/@CZl   ~]x(@( 0" }+(   ^ |x4< /m}  <(@H !$ !00f '03 %<<(@5| !A +(@" DMP /]:HX  !d 7(@h DMg ;]d1H4 tw CQ11"*  K $cpJL t UQ11"i  ]Qfu\p 3  ^7(@(  e(@?1  Z 00& <+@$3A,H 8l %<W|a(x ,2)@<T[^ (@hbkn  ;HY/? (@"\ (:HXH| 7):?)@43$FSV phw0c@#($FS~ {hw0c@#84 lH 4 K^glHD3xW,r  %5|Psu0v4A y \U,0 ZlG4u @`@) Zl|-_$6HW H=pt/  (@q|0  =7H 8'( f71>Q$ 71A !% 72F$.. ./ /@*@$D0I( 3#,8TDK^QZm *@@M &@*@O )- ^s72PR |l/ :x(@R 6(@T3?1S+:Cj Fm|(@$TL  x(@d3Ts  x(@t3U  (@3?1V:Cj Fm|(@(W(  (@3?10X:Cj Fm|(@X&4 ?(@?1hYKDMX sz113PZm4 ?(@?1[DM sz113[ (@`?1] k/4(@3^;D_ (@3?1` 0 70(@3`F4 ?(@?1Xai*23 6A(@a __b (@qb  (@q`c | |(@,d ||(@d | |(@e(Y5  @H(3fS !+P5 (@Di235 (@"j 15 mh;3\Hmk 5 <23qnh5 al=A I "v 0G5 ;MYIqza 5 O !<234q{ ,9=5 ^q|<23q} Fb5 ul<23q<75 " %<23L 8QX5 ~(@4q9 5 M R q x LSJEqb"4 t Ew Da@}D"  $ Q   @1 =p{#,:T8czܸ1 #,`7NJ l#,@t4#_1d 21h!$<MT(A(1|?1x$_i .`KlKL$ ok:10 3h$, ,5Pa4"d$<IP(du|\aO4q"%0Fq"H%Oeq~4F%$]# J 2\%$p(0dF4%!(Ojw4=p& 3~*haJF?1&(&@JVe@4LC&,lSJps&  Jd3&:$D=p&  24DD$('ENQ-Xsg(\)4})nJ$9hxF8p*je\00Y+ PYdDx85H4+v P/@` ,(d! g!taap . X,UP8 =H{,(d! g!taap .,UP8 =H{F-(d! g!taap ., -UP8 =H{ -(d! g!taap . /.UP8 =H{ .0 & D    @9<|m/+  !k (H(D0  !B)!/dM{0!%!A!Ijn!u!1100 C6 !Gm!)+F10 & D    @9$=1+  !k (H(t2  !B)!/dM{h2!%!A!Ijn!u!113 C6 !Gm!)+v30 & D    @9t=\!3+  !k (H(`"4  !B)!/dM{#4!%!A!Ijn!u!11d%N5 C6 !Gm!)+%50 & D    @9=)5+  !k (H(*6  !B)!/dM{H,&7!%!A!Ijn!u!11-~7 C6 !Gm!)+`.74!!!"!"*",H 0 84!!!"!"*",H@3j84!!!"!"*",H`684!!!"!"*",H88$C"T"v"k"""<Hx:L9$C"T"v"k"""<HP<9$C"T"v"k"""<H(>9$C"T"v"k"""<H@6:(l/a@.@Q:|t/@%4\Ao:Eo/@A:sPf&"f(@B:CjF/@| C:"WO=cx(@C:$"2366a@.8D;"71d )@?1DB;,4"a@_bEd; "!'C/@LF;,l/a@xbF;|t/@%4G; Eo/@/YR&"a !#00dP<>##a -*#9#>#*@4?1Qz>E#N#Y#a By###tU@M4"R>###a C_$z$$\l$q"V>$$| 0$X-@F?@W>% %| <%61"HX><%%O%j%| _%%%>4X\n?%%&| b!&0&7&HJXI]? 6J&Q&| `[&b&)H(50^@(i&v&&| &&&p9$G`S@&& '| 1'@'K'aKTGa@0`'''| ''(LHd>hueA &(| 24DD$lgIBE*(Q| -Xsg(\)5hDn-(| J$9hxG8l8EjD(| e\00mE PG(d| Dx85H$5mEvR(| P/@nF  | Q9(@qDo^> 9B???`(\wL"@/@ p?@P@071LW@Fo@ x@@(0Q,Lo@@ @(@HL@@@ 9AlA}A`ؒJMAAA B&B$+@3AM(,B6BGB .BBfJ3,MBZB kBB 51d5?1MBBB fC}C?1M CnC CCC31t5Ml[qC /^7C"0&N0CDD 8DDLH+XPN DGD TDE<41"N(E%E,E EEELe@3N vlE EE(@qO ER  LE(@qP K(@qQKKK ?LLL22XJpQ$LLM M N#N88K #Q _NlNN NOOD'Q3OLOhO PMP`P @]s-Q jPj 9ijk(@DHsX0TR$PPP 5!QDQUQ,PL \4R/QQ /00<(@s 6RQQQ ( R5R(@s7RnS$}SYS! WSSN@@SSHmS! ST315AS TTT! 'T.T21\5BS5T:T# ?T00BSJTTTXT# }TT@H(G TTTT# (UUVJ"OTDVQVUV# WWKqYTWWW# X5X>XH~\XU]XjXnX# X%YXéc|U/Y(oIV z |[ C  ):}sqLX L[[)\C X]?]P]$RK E+5w\w]C    005wD]]]]C @>^Q^X^8,@d{`y]}^^^C %_%_2_\\x|{_w]C '   005|_ UUC (@@|E` ^UPC (@$}` >C (@}` UUC (@ ~a ++.C (@~ma UUC (@~a >C (@|b UUC (@tb ^UPC (@bV ]_b_C j__00pb$Z__C f__`+0 Rb$___C s_` ąb `0`r`C ```@g)pc$aBaFaC ~aaQMl8c$aaaC aaa@J(64`c$aFbJbC 5ccc6Ԡc$cccC ]c dd)($6"(cx|dC dT+@uHc,dIdUdC dddQ(x[`gd0#en4eC Je}ee,l246dey-eC e9fT+<luHedfzf~fC fgT+hOu@ e(g>gBgC .ggT+hOu;egh hC g]hhhT+,ute8h i*iC ijjD̶e$lKjZjC jT+@@uX fjjjC j kkT+LIuf k/kDkC kkk,@4Iu4f(kkkC l7lI(JuPzfHlfljlC lll,L?uf,lmC "9mhmmmQL`+,f,xmmmC _unnnLl2+!g,o%o-oC qdoooX\gT?+=g,oooC ppp0$El?+jg(q7qC ?qfqmqILdIugqd!qC qq57?1dg4qqrC rrrDv?+4g(s's.sC Qsts{sI(Iu;hsssC tOt]tQQ?1`]h$ttttC A tt@J@D@Xuh( u6uluC ]uAvdvԖD \hovC vvT+(D6_h vvC wAwHw+L_ph0TwgwkwC www\t`h,{wwC wxx`Q@T6_8i&xd!8xC qq57?1?i8Lx^xsxC xxxl7t`xi,xxxC y.y5y`QxQI_4iNyfyuyC yyyp6|I?1P iyC )T+@d  jyC .T+@x &jyyyC Lyz)@ Gj(zEzdzC Wzi{{XdM ]j0{{{C I|||lQ'` j0|||C J}}}lxg]`0"j,{w}C wxx`Q@d6t#k&xd!}C qq57?1 %1k8~~C R~~~l$J`'Ok,~~~C !~<D`QK@H*nkiC (/7p6$?1.k btwC 677 l/kɀC M 82p  C }}s 5rڂC :փ/v:sTvmC =U00:|s"&C o,?00p:s*<SC J݄QKK>tC e00P?u C ;4KQ4Pvt@ku PTdC Dx85Ht6TAu_lwC %,@@vBv ̅C bkQQQK`vEw vlEC EE(@qpF;w YbeC  h(@qG]woC !':RXK8Jw?itC PJKKyƈ͈C ֈ((6Ly$_bC $$)(My$_bC $$)(Nz $X C $Sx((|O6zC "('6(POz)C "('6Pkz2_bC $$)'Qz2_bC $$)'Rz >X C $Sx('Sz >X C $Sx('TzGPWC cz(xQdU{2_bC $$)'\V,{2_bC $$)'TWN{ >X C $Sx('4Xk{ 4C /x(@X{ 23C 6A(@qY{ UUC (@Y{ C (@ Z| ^UPC (@[4| ++.C (@d[x| UUC (@[| UUC (@[| UUC (@[=} CjC F(@qT\]} EsWOj=c(@q\w} EsWOj=c(@qd]} 236A(@q^} C (@x^5~ UUC (@^~ UUC (@^~ ^UPC (@_U ++.C (@` UUC (@(` UUC (@L`[ ^UPC (@0a 00aɂ|pQ $"0aU 00aU 00a;܊ #0 bU>‰ʼn $"00bkUɉ P"0@bU͉ D"0 #Pb|pQщ $"0lb|pQՉ $"0b˃~Fى 516cUI  00$d ~F! 516He"B1 5W<(@e@FSr NJҊ[[KpgNZ E #41q"h`*7 JUjq@l(\`ix~ L00ti `Ëp>3\hjxЋ e00jք؋ ~-4<86pl;Li ÌЌTdL=pmx 00Pn+ )@"oF$A tXLKq`΍׍ -<A00pdr  '.h386s5Z gt~<lzÅR Ï Lُ8[T d|E EH|>8}  E5<)@~- EHN Tx(@@IYl %CSFpe ܊x Th"0"̃ >‰~ X"0"܃U \D"0"†& `8HN& d)@"0Ƒۑ x)l}h | TJ5,UI 000;B O00[΍ -<A00 pTɒ ͒?00Ȍ#ޒ )@$  0KVHQ $6؇_h ͓[O@  ,KR*L7z" Ybm -(\J.ƔՔ  )(\JX@ #/2 n#FP ȗ[Q ^ mh)@"uogw ϕ81=p, 0 h(@qL 0Z[q ^70x(@ܝĈ:Cj Fm|(@`:Cj Fm|(@4 )@5Zz dmx(@N :Cj Fm|$(@f:Cj Fm|h)@" ܊ #0H )@>>‰ $"0܉ x(@U P"0ġ ^^a 1$(@ܡ1 0Z[q ^70x(@lQU D"0>|m^^a 1h)@"܊ #0 )@>>‰ $"0֊ x(@(U P"08 ^^a 1$(@P 0Z[q ^70x(@3U D"0>I^^a 1h)@"bD~v &=[(b<}gj BY)(tT~v &=̯(Ygj BY)(ڋ^^a 1x(@ ^^a 1$(@ ^e nx(@7Щ2u~ )@$7"P$~v &=*(N5igj BY)( Cj F$.@N5"WO =cx(@,"% V2:*@N5ƌ Z[q ^7 $(@H݌YEH 0.@  Q )@" 4 )@81Zz dmx(@R :Cj Fm|$(@<r Ŗ̖ EՖږx(@47 13\D7"^^a 1x(@ Ѝ ^^a 1$(@$u~ )@T7"0~v &=Q()<gj BY)(t9Cj F<.@)O"WO =cx(@h "% V2:-@) } Z[q ^7 $(@ a 4ax(@Lюzf  7H?1D9   ~јژ<41Dyr("/3 *a4Jd7?1* W',l@@vhɐKei lHK4P`v;? 1 &?C  4S@My BZ qpm@ (@X.2 ~ (@<@Ϟܞ -6DTt7Rmk=VZ >˟П8m@7j $ן 3Ӡ#p ll  c)@X0ҡ֡ J`klu) ΢Ң 'lw<41dyrУԣ 7S@Mz2,Τ ƥ|u,7 ٥ ۦPsyrdm,Y j.CLd\^LumG m@2 r8Pd  b  (@qH  Kj(@$\ E3D,<W1d]Y V]00 0bl \˩֩$4AUy֙  o(7>283"XLG q-<A00p=  W(@qc\iԪj8d8 ? j!@*4@(58jCNH6'@U^jo@H(AК0 jdHxN@d+lBߚj$"0|Bj006Bj00B #j 00B&?^jֲh5FA& jF600 Gm'15j(ZvH3L| Hj(@"L̳j-huu}7 QMj,ʴu@7" Tp jC8_f667u|U}dmǵjZͶն&[<j?v}N7y+]œj4ԷT+LJu`Ԝ$&7BjO61@+b`θѸjU@*'td j\1@@H(fGTWjhal+x+7G4g*frj8N7PigĹ%8jLG4Ls *7|j%\)H($4w`uxj6(@`x3uj[(@yP<Լj+v|NL|c4jTh|zH j NlK2(ξj+N^l̥H`f@jNm 8 0<?jITY0+47=pT(`lojyN47d,( j PsL4z )ЩĠjEH644jIqY_İOjx00LD|jq6|008 mnjmVq00| jY)N$(""A"jO,?00h(&F_jDc@t$0|j(C0RHRL85>cnLjVq00H`,Poj$5LfDK)̢,njIK^`R`$8) xjF0+L=p xjF0+L=pD ,j;A@}N(<'j`0048Ld48jm^0|<BcdjFx4PB4zlj_ztA?jIT3ܥD8xR_}j(@H.D"jx(@dzӦ\j)1xEl;MV]jvm('T8 dj^sdpD9"Pfj;v00d8$Ҍj(@$A j(@ , NjXlt8"hjM8Ud tKt8y jaZ+m P)`<+LjN", j !HN"-@*j;00((.s0<CjSjq@8/Lxj;"1˪fj;v008,H2 Eji4 G5&j F600@GR  j8MX\518@Ig _jmjT51|Jy Esj/G$(@Kj5411`qL jC 5<NJ?1DMɫ$OXmjI4O?1N߫ jNOJyrO  jTOJyrQ8&2Gj`av}DJD|R/8&2jfav}DJ DSIjl 5<NJ@?1$U\$ jrTJ`dVq "jxOJyrW <j~OJyrX4vVkjdJr_Ija,)@`=x  pj FRx71_ 0{jCf9) j%*@= +d-@bj T@L@ L)r( , jB;00 x@0 < @ j&H ,H 0O \ l j   <22! T   jJ {  DXvN(%    jV  O\O=pl) ɴ$  - jei   Ps:,    j   37:X.    j'7* )@" / +01 P  j1o CXxXPO )< jd@H(= jb00$> jN T(H(? <(59jc{8)C W,j\h$:)E l +j0b{+@=p0G 0j=O@M)H Ͷ(jFFO@4L)|I *=Bj }071"L j$@l(\dLN ( %j=:IP+@L)vP \[hwjM+@MW1HQ {j JJ4:?1hS %(j<Y`JJD:?1,U  gtj31T:V Z kjj$(@d:W  kjj$(@t:HW ַ j07PPLZ3$Y  Hj07PPLZ3[  dj07PP$MZ3\ 'j071:qh^ Aj&071:q_ \9mj:072da m|hj$"0a  \Vj#oV<(@ # b  |h6j$(@(b  :HLjp|PJd ŸjO\IhIf ܸj(+6\IhI:i  ADjAd x(@4j >HKjC$"0Dj 7>HOjD$"0Tj S Sk`jKpx(@0k j>HujV$"0@k >HyjW$"0Pk g}j[d)g$(@k  >Hj\$"0k ܹ >Hj]$"0k  |hjtP"0 l ju$"0l 4jv$"0,l R\Vjx#oV<+@"l i |hjx(@l  |hjx(@l j$"0m >Hj$"0m ޺j4hvxvo  |hrj$(@o  ANQjcx(@4q jmj(@Hq 3qtj(@tq MNUjxjY0"0 #q e^j~jzjj<7\5:"r yNUjj Y0"0 #r ^j~jzjj<7\5:"s 6j!\)H(Nt j*)N('$v λSxj1QbpL|?,{ fj8;v00:4{ >Ҍj[(@| ` jlgA~ u& *jF600 @ 8Wj+D < qj||̌ [\j(@:, jYj(P4PP %uj151:d :(jC&@P K/<LjKdu~LLP; T,jS@P ]@j\F(@=pp njg2It31=p$  R_cju 218 Ǯ uyj(@" j'11`q"@ + 4 8 jjT Y (@TM=px ͽdl   j!G!T!XPdP$|#Z3 xz!~!j600H !!j!-<A00@p 7!!!jC!!!,383` P!!jE-<A00p t|!!jT$"0 |!`jU$"0 " ""jq]"""XN|  x""j"0 Ѿ x""j"0 """j" #72?1 #C#H#j###HM?1 ###j$$72?1 #$Y$f$j$$%$gBC?1P .!%j-<A00p K *%7%;%jW%p%y%71Z3( c %%%j%%%)@Z3  %%%j%%%)@Z3  %%j&&"&$((\  xz!/&j00 ƿ3&D&I&j&&11 Կ&&&j>']'p'P@) &''jF600` ''j6''*@=p` '''j'((LpP;q ;(#('(j(>([(b(LpP$;q O(#(i(j4>([(b(LpP4;q< dt((jG(x(@D;p z x((jYx(@ x((jaD"0q x((jeD"0q  (((j2)I)Z)$4"8 n)w){)j/))@+ )))j)))'H(T;H Y))j*00 *$*<*j"***@* &**j'F600 ;@***jH+^+s+RDd;\} F({++J,j\$.O.z.0P E@ q$K/|//jf000RT,}X  0"1T1j'2k22pdI 222j 3-343'H(M"h  G3[3jp333)H(  G33jp333)H(  ߼33j-333411@q ߼33j3333411`q "߼34j9333411v 3$4-4?4j?_4t4{4411qH A 444j45'5|PlK" P ;5H5\5j8w55542q"!] |55j*P"0!t 555j,6*6=6M!X6\6j7o(@!e6v6{6jT66<71=p!I66jk|61t;!666j67PJ" !667j67PJ", ! 77H7T7jj77731; !7777jj77071q!27777jj77071v0!N777j77@61!p08 8 8j!18J8dJ!S8`8n8jb88861!888jk8071;!889jx959<9@61;! C9T9d9j~99931 @!0 x99j$(@`!H 999j999)(NZ3T!g::(:jJ:a:h:071@!w:::j::;tNq"!!;(;-;j>;g;l42#!p;;j(@`$!;;;j$;)@qT%!;;;j/;*@"&!;̙;j9m<*@"t'!* <<!<j@1<@<E<+@;)v(!^$L<_<d<jN<<<P\;-!(n<<jQ|O@B`-!<<=j|L=(@".!=1=5=jE=^=(@0! e=w={=j==PP\)v1!(n<=j|O@B`h2!.$===j =;>̦v7!P߼N>`>j333411v8!_s>>>j>>>61DN:!s>>?j>>>61tN0;g;l42$`!'CCj(@`!=;CCj#;)@qa!U$CCCj.D2Dyr(e!mH?DLDoDjaDDDO3i! E=EBEjqfEEP\OyrLm!0EEEjEEH+n! EF Fj$F5Fj((@Ts!]IFFjJk|614<8t!y 77FFj_j77731D<u!$FFjvO?1w!$ GGj /8OT<z!S8*G2Gj88861 {!8DGHGj959<9@61d<`}!. C9^GbGj ~99(31t<~!H x(rGj$(@!a 9vGGj999)(4OZ3!8GGGj#H;HJHv<̄!RH_HcHj4lH}H`(@!RH_HHj;lH}H`(@!RH_HHjBlH}H`(@`!HHjV$"0p!HHHjZHH)@q!G U UFUjU$(@>X!p v|jQU)@! kknjdUoU)@Z3L!Z[qjtU (@#!||pQjTU(@q! v|jQU)@!A kknjdUoU)@Z3!oZ[qjtU (@#|!||pQjTU(@q! v|jQU)@H" kknjdUoU)@Z3"! UUjUUU61"HUUUjU VV61 "r_71j&U5U(@H"tt j:UAU(@?1|"23j6w*@v "܊jߊ*@"H"VjV&+ (@$>"" OWOjGl$(@\"9 ||pQjTU$(@x"\ &CjjFt$(@" ^^aj$(@" TTjT$(@4>L" U UUjU$(@D>"_71j&U5U(@0"tt j:UAU(@?1d"523j6w*@v"X܊jߊ*@"0"~ TTjT$(@T>h" U UFUjU$(@d>" v|jQU)@T " kknjdUoU)@Z3 "Z[qjtU (@#( "B||pQjTU(@qD "m v|jQU)@ " kknjdUoU)@Z38 "Z[qjtU (@# "||pQjTU(@q " v|jQU)@ "D kknjdUoU)@Z3 "r UUjUUU61@ "UUUjU VV61`"_71j&U5U(@"tt j:UAU(@?1" 0Z[qj^70x(@X" 0Z[qj^70x(@"3^^aj1'@q"N x%V.Vj7Vx(@t> "ix>VGVjxux(@>@""2j,?00""2j,?00(""2j,?00",PVjYVQ@h" pEmHmjKm(@qT" j^(@q\"4 |pQ^V #$(@x"L aVejV $ mV5="c+tV &k+12"|+V -k+12"VVV ]EVV$(@"VVV cVVW$(@" W_W l00"WWWW wYYYO0ZL q"*".ZGZKZ $ZZJ4Pq"/"! [0[ u'[210"< 0[I[P[ 2p[u[)@>2"N|[[[ [[[\l>4"\[9a[  \\@61$6"t!\P\\ y]]]up ">"^D^U^ Q^^ _}D"3___ vv```|8 ~PN" `ba b)ax(@O"60a =a )aa(@q"lQ"Kfa`sa aat)@"S"f ata *Fax(@dT" aab ZmdddH(8 4d"e1e dN'@"d"ee ef00 f"f)f=f fff|~"j", ggRg gh h o"hhh mh 2p"hhi 4 jj.jh5ܩ =p,y"+j/j }j5H"y"@ jjj 4kyk,<q~"`kjk FkkHQlK>~" kkk kk51 " ll2l lll@61~"lll ill NhI>"m2Nm )m@m5\5?1"fa`Em aat)@"@"' /zF Q(@qd">]mfmnm BmmmO$" mmm 3mm 22"g *23 6mx(@0" *23 6mx(@Ԍ"mm n n"n'@>"" -n7n;n ?nKn(@qx" pEmHm Km(@qd" lRnYn ^7C`nP"0>" gntn{n $inn (@>""> Lnn Enx(@"_(nnn 8oDoQodb8w"u jomopo (00#Ș"ooo Uo00?"ooo mp00"oo9p Wp00"|ppp qBqJq(@?1l"D lwq~q ^7C`nP"0?"bqq -$"0 "qqq /qqq$+@ 3h"qqq <rr"r$+@@3ȥ"/r@rGr O_rnr{rpb U$?"x"qr _$"0" rrr ass's|b8O38"0 ?1t"({~~~ ~00D";~~~ ,<G|PQ=p"OP`Y [)@"g$ |h{V=p"Z 31"U )@d?$" ]CJ)T(C"& ] ւ=p"O /3 W0Xt?@"bfl˃ 82q""u A  yL$Px" k';̄(@?"|"tӄC ,tCtHt00?"!/C 4)@"$WC 8&<LJ$?1`"߆C E%1:)@` ?1@"W1mC e(@"s4C sXP"0?H"UvC |$"0X"UC ~$"0h"LJC 6El`@MO?1@"\hoC UJ??1"ֈC x(@#%ƉC cwvwUJ?14#KЉ݉C Hgp`KT#j {C ŠNJ(@?"X #zΊۊC 6(@@ ?1#}V0$"h #\_I(@ #g}*q)# <gx4?q .#N ^"0$.#t*E*??1$4# W`me)*H4#_@'5# ϑ7Deoss";#U\(T(|TP@<#u%c]ly|MTP2># Zy&JhI?r5?#s%~V5H?1L@#&ߔܾ " F#& HUP)1811@r5G#a?L[51?10I#Õ"`Ř_   r58Y#f411r5]# ]=̤5h#-HɜCD"n#1D4hCTP"q#E ȝ-X^1`2Dt#[<֞ܤ\"w#u0ݞYO"z#6,^f ?G #er`ǤΤ13x "#oUah (@\TD"`#'ϥޥ55P2#>0*@\c5XP*L#f,z8G(sD"0# l  / ԝD"8#,Puɨ֨<P(@D#D2u@3T "ȴ#M 1֬K5=  #԰X*?1#~"p ľ "#<i!)@@"#(AD2~(@"#ƶ16YuȿM "#N9Zc5p$@$qk˹H&L} DlJ "$ $Aj۽{+ `* $d$-:I`sxH(*XP$!͢00`d$0%׿@*$"ܿ߿',?00h|$   |DEh#$ V3DMM\%$EMZif5(1P=p&$b.&)@4@'$$$9՞?1p+$H;/(4P-$>uTHv04Q ?15$  J՞GMMs9$2R}o, 5A$/;B"dm51sD$xl)@"D$^`(@"D$ ttD@M$7 4,tXQ"8$]nr51$]415" $ "xTPQ$MT_$W0 q t H$1CG'R 2$$-Wdh~`KM$NL(U| tD# `$  $9P"6T@P$ @MVdiP"0d@$4pa_d $oC(@"|$'Ha^h)@ "$EW' )@PR `$c !PSsvS((\ $|Y\|$"0($`ux'@q$h61"$0G]6DtEu%|Yq $"0%Duq( $z%"%1411\%4:d9X: :+h4%rEHJe\ 2p1|`5% c|R`KlKQ7%7 cL`KlKRH:%_D8H 8 d dXRz@%15;()} 21dx`%[ 6YbNQ4d%z w)@xe% HWNLR q"l% 4(,#r8D\@ODo% 4"~`8C О+ fD@%   ? s ~  11Q"%8       t@"l%W   ( Q    4F"%v ( c  /    d $`% 1BQox11@"% yxFȤ% ԰X*?1̬%{x!,L\%  9BEF9g*@@f %h   Q9(@q%  z(@q%  4(@q4%  N@M`d%o NhI%# |l/:x(@`%= mS(x(@@%f <EHXx(@ܶ% 4/x(@% |l/:x(@<% 4/x(@%  7@KkZ_x(@@%0 "%V5$(@%W Tjq'T.T21\@h% 0Z[q^70x(@% 0Z[q^70x(@% (@qм% vlEEE(@q%+ (@q%qzO '84 ?1Ŀ%+ O !k (H(% lV ^7C`nP"0@X%/V !$3:)@A"%D(AV 9q(@%_LY`V B$+@3$% LV Enx(@% sEHV e(@q%I\ E(@9%I\ K(@|%[q\ Z^70(@9 %,j\ `Fm|(@%S-E6\ sEd(@9d%wN8W\ zq(@ %|pQv\ $"0<%|pQz\ $"0X%I~\ (@9% I\ (@H%-[q\ ^70(@9%Nj\ Fm|(@\%r-E\ Ed(@90%N8\ q(@%|pQ\ $"0%|pQ\ $"0$% X\ Y@S % g{\ J(+8%+ )Ah\ \tp %R(6:\ a@D2+%m \ l| "% 8\`\ <(dM|&E\ AE(@AP&E\ EE(@$A$&# \ I(@4A&f3\ MXh 0 ?14&8F\ !!!0c ?1&"""\ #`(@'& 0Z[q\ ^70x(@\(&$$$/$\ B$G$(@DA )&R$[$f$\ }$$(@TAyr)&!0$$\ I4$$(@dAw*&K 0Z[q\ ^70x(@L+&r$$$\ B$$(@tA?1+&$$%\ '7%%(@A?1,&#%,%;%\ X%]%(@A?1-& 0Z[q\ ^70x(@`.& $$$l%\ B$G$(@A/&4R$[$%\ }$$(@Ayr/&[0$%\ I4$$(@Aw0& 0Z[q\ ^70x(@P1&$$%\ B$$(@A?12&$$%\ '7%%(@A?12&#%,%%\ X%]%(@A?13&(% & &m Pv&&&hI 3X8&} W&&m &00S"8&''':'m '''S3=&' (.(m )*$*|A2P 3PJ& 8***m `+++HK -bQ&9/,8,C,v ^`,o,t,(@R?1R&t,,,v @,,l`@M?11~ k1p1(@`qxi& @}111~ D2X2m2W<{@n&a"H222~ 5Z3p33T{r&"3 B(@r&" "% V(@qs&" vlE E3(@q\t&#333 333004Ru&g#444 84U4`4HA4Bv&#g4t4 '74 (@"dw&#pk;4 4$"0w&#444 44H7y&#D444 55 |&$H'545@5 &a5m55xDB&`$0555 S5 13t&$(555 [&6<6Q6,dRq&$(`6y66 t666yr@&$,6 737 7"8C8,JL&%0n888 889PdxR&S%0989C9 999,xRb&w%959 951d&%999 H5::(@R&&0):05: )u?:J3&<&0H: Z: /5al:J3&c&u::: A:::*@TBO3&&u::: I:::*@dBO3$&&):: ^#;(;#0P&&49;N;g; *m;;@ $S&Z'+;  !k (H(Ĥ&](;;;I";;424&(4< <<"<)<|4 tBЧ&n)+0< !k (H(Ԩ&r* (@q&* E4<K< <<Tb\XTq"& + <<< )u<<Tb\Tq"̫&+=6= 2/=<(@x&%+P6= (@"&:+:=^C= G=(@wH&P+L=O= ((@w$&f+ .S=Z= Fd=(@B"&p+ .S=k= Fd=(@B",&}+8<u=x= <(@&+[== &=(@2&+=== T=(@s&+=== & >(@2 &+> >$> =>(@sܶ&+>>> ?*?(@s&+5?>? f?(@s<&,k?:8|? 8?(@2̽&%,??? L9@>@(@24&g,Q@f@j@ @@(@TS2@&,@@@ 3@@AHSt&,AA ?^7A(@2&, A#A OQA(@q"&,VAnArA zAB(@s &, BBB eoBtB(@Ss&-BBB  B<(@2&+-BBB B<(@sT&9-BBC & C<(@2x&G-%C>CBC =CC<(@sP&T-CCC eHD<(@sp&c-SD\D_D  (D<(@s&w-DDD })D<(@2&-DEE n#_EdE<(@2H&-wEEj@ @@<(@S2T&-EEE 3KjEE BHT&-EE ?E<(@28&- AE#A OQA<(@q"&-EFF zFF<(@s|& .FFF kG G<(@DTsP&(.:Cj Fm|(@&@.*G3GBG 9WG\G(@B&Y. kGtGG GGG(@B&r.GGGKHHH@H(&.X=%I(I4>P"0`&..I}7I@;ITI@'&.[IdIhI`~II@H(&. \.IP"0(&. IIIeIIIP"0BT&. \.ImP"0&/0I(J>JJJJJ(`T2u&3/ JJJRJK(KB &L/3KEKIKcKK((\X'v/KKKKL8)(\'/L=LLaMMMJhIS "'/ MN.NNNN(J4J\Fp '0pkNNN00 '0NNN00tT` '0 N'OhOP/PBP<ah'1wPPPQ3QTQ)$G?14'1~QQQ&QQQ(D)̾B'1QQQ!QQQ(P)`B' 2 QQQ8RR\)H("'82 RRRPSS\)H(*'X2 SSSf)S((\(,'s2$ST, @J@ ,'2$ TTT%TLH -'2$ TT,T%TLH .'28TATHTQZTaTh)(\ "T/'2lTuTxT`~TT330'3TT;:h)@" 1''3AT$"001'O3TTɊ(@1'v3AT$"01'3@0 TT}T\H{2'3HT$TTTܽH{3'3AT$"03'4TTɊ(@H4'44>TT$"0X4'`4@T U U(U7UlH{5'4H>UJUMUiUxUH{7'4 UUUUUUppC9'4 UUU?0VAVPV|@l;'4T]VXɊ(@;'4TaVYɊ(@4<'5\eVhVZlVo(@<'65wVzV[V(@?1='U5wV~V\Vt)@?1='r5PVVfVVr(?'5 xVVr"0H?'5 VVv3HV"0?'5 8<VV}V"00@'5^VV00H@'5XVVVWW!WLJCQA')6(W:WHWWYXaX,383`G'D6oXzX͢00d`H'j6XXX*YmY~Y qu'T;b c,cTccc q0qXUx';cd1dddd@qPqq{';,dddee%e(QUY_ ~' < ,hYh]h)qhP"0'> hhhWbhP"0' ? hhhshP"0'*? ݪhhmc$(@T'G? ݪhhmc$(@'e? nhh|)@Z3T'? nih|)@Z3'? n ih|)@Z3|'? ݪhimcx(@'? iiimh31ȓ'@#i&iɊ(@,'7@>*i-i$"0<'^@$41i4iDi[iJ8'@di}iii 21@'@iiiH5i(@"'@(i;jfjWkkk@Q$?1D'A8/lIlYlmm&nLGr_'QA g}nnFd)g)@Mu'tAnIooetv@w j ,Bğ v'8BWydykyyyyJJv8'[Byyy/z+zJJ?1<'|B2z?zPz@yzzzJJW1'BzzzNz*{7{JKv'BJ{W{b{et{{{383 v 'B{{g-<A00@p'C {{{|,| 21v'DC7|D|G|W|h| KK?1']Cq|~||||(@'vC H |||}}~HHq(C;~>~H~00(C Y~n~y~"~~~qq`t(D{~$-<A00p (HD 8~~~3~383h (sD{$5-<A00p (D5FM;ip(@q (DJ+CX̢ܢXV"(E(g߁{\(;E0&^zR4XQPb!?14"(E{ -<A00 p"(E!+200DCt#(E $9u)$KD8$#@'(&F{P-<A00@p'(XF a~Džqq\`+(F7W:Utp%q3(F{G-<A00pT4( G\·$gƈՈ0K|JT '?18(8G{*r-<A00pl9([G ;P_h33\Ux;(tG ‰ω։$(@TC<(G &J3V)8?(G{-<A00p?(qEN3H)@"L@(GtD%z*؜ "I((H{*-<A00pHJ(WH{ -<A00pJ(H+.L`\@L(H[dg sH3M(HhTZՍ܍(<P +lN(H{\-<A00@pO(+Ih bOlqdxdCQ(TI,y|1`&$S(I Ɏ֎e)@T(I >;oqq4UXV(ȈA11  Y( JxLS@t21\t\(mJ`{1E,B\3B "(k(K 'zJ`dU"o(K͔ҔHKTK"$r(K -1[j32qt( Luȕ͕(@Vlu(-L0GL(@Ww(QLi' bh{(qLR˘81- ?18(LIVBߙT(&MDpM[n`Kd (PM'vVs`KlKXW(|Mp `KlKW(M5JVs`KlKW(M_GVs`KlKXl(MDVs`KlKXXܝ(&N0Þ͞tK3(CN4֞!ǟӟߟHC _C(bNDZ`KlKX\(NDȠ`KlKX̫(N2qrC"(N ܡ #13C(O |.2P"0ر() U Ľ-*d~Vs`KlK]@*4dU ((\tD0A*bdVs`KlK^C*dVs`KlKX^F*dUy ((\DF*dzVs`KlK^H*eUNm ((\DpI*LeX}n 23\IK*|e9 !pPmz`KlK^`N*Nw;)@N*e~)@DP*eL p  ?1q*BfU\_x(@q*mfcp$ ( d p *^hL ` b \ h u r8( M *h* 7 TE `KK L*h M ^`KlK_*h. WVs`KlKX_0* i] DVs`KlK_*7iU < ((\D*bi =Vs`KlK_*i 6  ( / (@`*iUF . ((\DD*iR /Vs`KlKX`*j  '  ( / (@`*=j    ; B 23\TI*hjm  Vs`KlK`*j    ( / (@a4*jU   ((\D*jU^  uz 2p1|Dl*k M `KlKXa*GkU  ((\DX*rkU  ((\E*k9 ' Pmz`KlKaP*kUV  ((\E*kb Vs`KlKa8*&l   gi   D1@f ?1d*MlU\ x(@*xl     8II*lU  ((\$E$*l   3   23H * m Vs`KlKb *Dm Vs`KlKXb*{mU   ((\4E+mU  ((\DE+m9 $ Pmz`KlKb+&nS      <`BV ?1l +Un  cF 0"0 +}n^   i<(@?1 +n   q  8II, +nK U r t   (@T+n& 7 D b{  ()b?1+o     8IDJ+GoE    23HU@+|o  >    23\J+o9  lVo(@0+o Vs`KlKc+#p  Vs`KlKXc+Zp< V  ^ r | KQ ?1$+p     8IJ&+pX  23\4KT)+pd q 2! " I# Q# 23H 8+,qUL$  ((\TE,9+gqU^X$ uz 2p1|dE9+q Mh$ `KlKc`<+qU$  ((\tE<+r$ <Y` 21cl?+[rU$  ((\E?+r$ <Y` 21dxB+r;% ~% % !& & '  2R ?1|K+sz' ' ' q' ( 14N++s( *( .( t( ( 21?1R+Rs  (   8IK@T+|s( ( ( @) i) q) 2DfpW+s) ) ) ) ) 24X+t) ) ) * * 2`Z+Vt* ** -* (K [+tv5* 8*  2`2[+tqTD* 4(@$\+7uL* X* [* g* v* 2\+uqT}* 4(@\]+uqT* 4(@]+v* * * * * * KKX$V?1t_+>v * -+ V+ + &, 6, LXC qe+vgs, v, Ci, 11f+v, , , O, (@?1g+#w  , [  8IKi+Nw , - ^b- - - 23\$Ll+w- `Vs`KlKXdn+w- - - h6. E. L. 23D?1Xp+w i. wF 0"0p+x^  s. }<(@?1p+3xgs, w. i, 11q+^x. . . . (@?1r+x  .   8ItLu+x. Vs`KlKdw+x,/ 5/ D/ i/ k1x/ 23L?1tx+,y/ / / 'M0 8IK8}+XyX0 0 0 [1 1 \l?1+y  1 >  8IM+y1 1 1 AG2 d2 k2 23\dMH+y2 EVs`KlKd+z2 2 2 MQN33 :3 23܂?1+Bz_3 h3 k3 _w3 11+lz3 3 3 o3 (@?1̎+z3 3HV0"0<+z^  3 <(@?1T+z3 3 3 g!4 LK=p+z&4 >4 C4 *j4 4 t3"+"{ 4 4 5 B5 5 5 KL``+O{, |\&+{5 6 _6 7 8 8 _|"+{ )9 g9 9 ; ; ; pQ@LD+.|,)< M< R< N< < $r\ h+G|,< < < m)< < |1E]*+`| = = m= L> > > P P P 00", P /Q Q L)S S S S \2,7T PT UT T rrq"4,π T T T sU U U :,U tV V +W !X QX t*t0` J, X X Y ǟY Y (@qPQ, /Z Z Z o\ \ ] Q,Xd, p] ] ] W^ _ B_ xC`lp,^ y_ _ _ `` ` ` |fMw, ` ` a ;a Xa ba L,Le{,tua a a Cb b b hNq, b c [c $Cd qd d 3,@ ,׃ d e 1e ,e e K8L@,.)e .h"04T,G$e e e 2f :o Uo Zo 8)@d"0,m(yo o o Xvo 8`shu,~0o o o 3p )p 8p X4F_, Op Xp \p hvp {p )@V,0p p Jp hL@_,30p p Jp hL@_x,m8p p p op p p Lpsȿe`| ,0p p Jp hL@_,0p p Jp hL@_,:,q q q y8q =q tLT(ȿV*,b0p p Jp hL@_`,0p p Jp hL@_,Rq _q dq q q q ||psȿe,0p p Jp hL@_|,c0p p Jp hL@_8,<q r r ׍r r Q t,͊0p p Jp hL@_0, 0p p Jp hL@_,Er q r r s T41?1,f@ s s s *s L@Ӵ(,L3s ?s Cs Is Xs ̣@ ,L3s ?s _s Is Xs ̣@,ƋHes s s s s ܣ2,,Os s Os )0DF&, s s s )t ((\,Bt +t 7t Ut ft ot LK " ,_ȫzt t F6t 00TFx, t t t t t `4 , u u u E$u 31,Œ+u Vu {u u %v (3\ "`7-k x *у   x(LlXg9-05 T k E ф |`g3<>-?   e&- T@ڋL?-b(4 R p r օ 8W3C-   N9 P Y LLFD-,` $ s |$1CJ-ג, Ň ه L4F)K-T  ' > d=pM-2\G "  Q NJ \ ]-I, E Y o (@DW"0`-M ‹ =͋ 00a- d  00F$b-Гpkq N00b- % N   (@W h-0P Y g P 00hi-\P n g P 00i- | U 'U U|Fk- --(@q l-ǔ ƍ ZZ&ύ (@qm- ?+H9֍ (@qn- Ful/ۍ (@qn-/ , ; D XM8F5p-ZgK g?&h6h>h(@u-$Y f  / 4 (@gy-F W ` t  Ϗ ԏ (@ z-t  f (@tWs}- j j9ijk(@Ws-$k Bk5kkk4*@-Mkǐ l2l7l<(@@s8-zJlې Wl(~l(@sĄ-ߐ  : ? (@`H-ʗR [ g  | (@FsX- , ; D XM8G5l-` 58(@q(- , ; D XM8G5<- LLF (@q-4 LLF (@qč-X J PX +5-,(5 9 e4f00T- PA dDx85H$G4- <M T X] x(@4GЕ- <EHXx(@l-0 <EHXx(@-U <EHXx(@-r <EHXx(@@- <M d X] x(@DGܘ- <EHXx(@x-ޛ?k Q]lq(@(-t -(@̚- }  S x('TG->( EpM@"x-v 0WO70)@%4-(  pM@04̝- Ó ̓ ֓ ۓ )@s-"%V2:*@N5-5 Z[q^7 $(@-Q"%V2:*@N50-k Z[q^7 $(@-d]o|`(@T-d]o|`(@-ԝL " (@dG-9 4*@?`-h UU(@- kkn(@qȣ-<5 C X  z ؔ WK?1-֞   K Z a @H(TN-74|  -<A00p,-S ԕ  Y Ŗ Lx\xT h-  (  w lx ] d @40\ x-w %   t)@"-   3H $(@t-ʠ |pQ x(@-  ޘ  HQtGT-p kn   $(@-+ |pQ x(@-@WH  , MJqP-Yl3 D S  pv XhX"Ի-j `  ( ͙ `t Ľ-ؙ  8: b HKpJ-j cv  _ `q@p-Ӛ   aǛ & M (<@ - t  ؜ 2hC\`-  &  _  |h)- e  ՝ x\G-1 r  "  % `fJG-G, 5  *3H (@H-]A  3 E @<< -vv    ̟ 5H?1-ӟ ܟ   = H 8Pd-c  00- k u  ; (@ql-"2 ,?00- =d G (@q<- C(@P-+ c  (@-@ / 3 ] (@Gq-m Fb   h)@4Xq-" ? C  ܢ (6HN?1- 2N  ( 9 @ (@G-̣ G vHT l } $(@- 2 h)@-(  _c z (@dXv-0 c  4D2-I,  V s X<xGv.j e  $p<DDOv.* C G ݦ  f\OG". ) 5; N D;H" .U g(@ .ˤ Y n ~ 31 .ħ ҧ ֧  ) 2 JKG?1x.E V kn u (@Gv|.+|   Ȓ".`; _ c   + X".yC t x  [ z #.(Ҭ fs  ! PL@X7$.ݥ&CjFt'@T%. ^^a$(@l%. 236Ŋ.@&.$ʊ͊(@?1@&.=\V"%Vt)@&.W^^a(@&.t 236w)@=p'.܊ߊ*@"'.d]oo)@D(.Ŧ^^ah)@\(.4 = J f w | '@Hl).  ̭ ѭ $(@H*. 236Ŋ.@$+.4ʊ͊(@?1T+.NWEHޭ +@=p+.k܊ߊ)@",. 236w)@=p,.܊ߊ*@",. J ! Kp/. |pQ!T$(@0.2 ; I Z )@1.a n r ܮ  5.?$$ > w ) β @ ?14N.9#g MlVm 00N.ݨ vlEE3(@qdO. ||(@0P.r {   @H($HHQ.U lʳ  #ڳ @(\4HHR.  3  i 4e@MX"0V.֩ |  P"0LV.    x(@DHV.=ƴ  $"0V.lɴ Ӵ  "' C O 8I@M$YZ.$j s v  6 7+/@THct[.۪  ; 7H"[. |h P"0 \.4  Rʵ x(@dH\.c 5ӵ ڵ  *6 0@I].   p+3 Đta. P ] a  Hl(o Ԑc.A |  l9i H;8le.s | x$(@e. s  Cö 21\@f.٬ʶ ׶   3 @ zKtHh.G ҡT  x <qk.C[q  ^7 '@H"pl. kn   $(@l.ӭ |pQǷ #x(@l.˷ ط  0  <21q(n.%YH  z  t8HH"n.w$ b4  T c p \H"hp.({   ̸ lm IPs.׮   \ 4HHw.( nĹ   ܹ 4'Fy.-   % , 2H@"z.W5 Hm>  ([ j s 1hC\`{.  R HKK.د     ; +@G4.B GZ[   G4\. ۻ   # : \dq8.EN b f  Y ½  XxH̝.0 b9  M \ e 2hC\HĞ.հ(p jy  T @Mu. Ӿ ׾  g= ;8TYq.' ȿ  ؿ 2V(@@.O0  +    / .8G x  X ,P <.D0  \5a H .t    kz Xhyr(. *   < I ȿH?1.Ȳ.jX  Ftt)@"x.w ^ a    t)@".  |h P"0 .K | x(@<.x(k t {  ) @e@.˳   d 7H". | P"0.  N  3Hx(@$.M  , \/@\.^a `(@". kkn (@q.& kkn (@q`.W kkn (@q. ҵ (@q. ҵ (@qt.   (@qd.5T ?T00.1  C  00T .\  v00T.o ! % @ @'. h7  @'.  Gg t$!Xh0. D H Y ?p9 qP/ι4n  2Fy\/ (- : > ~ 2F/+(  ) 0 2F D /J(K GX Td k (@H /i$r    TZI/  0# x(@/^V( 3$(@/ĺ+ 4 dB (@q|/I V Z  ?2q`/  T h ?2@/+r &n  ?2q/O n  21/r   %m 85Hq/ S   `KjI"/ѻ$ - 0 pr 2H2$Iq|$/ | 00`%/-     $((4Iv&/H8' A E   $ ?$DIyX,/g 8 M P z 11q-/   x((TI//  # m ~ 53dI1/ļ    214/ۼ  %  Yu9/4 H L MP  T@ e?1P/  / < ș@T/W /e L $ 3 }ؙhW/ٽZ {; tho"k/   | / H0:m/# : [ _ N 5H"pp/G u |`" 4H/E Q U  kJ2H/ 8 $ kJ2/1 : = b'i (@"/n w  (@# /+^V (@8/D k (@# G zdX _ 2CpI/h u 8 5tCpO/   ' w (@q/= 5 > } dX _ 2CpIp/Z (~ q eq/ -  < ! p H q/ @j z 23q/ws Ei11/ F  22I/   C Z a <22I?1/|    $"00 >  P"0q0P P"0 0P $"0q00   <  ,'@p0 $   AF *@404e  TF  0T(W10Z$   U , `s0,7 D H [  h;/T0 000    r ~  C3,J/ 0D   u   J(80    N e m 11`40 \   11"l0,6 7 53PW1D0S  fN  & HM"(0/ 8 ; I4M T N@M07a d  5\5J?140Zg g?&h6h>h(@ 0B$Xh hi.i3i(@jl0j Vi siiii(@80i jejjj(@Zs0 j! j9ijk(@DZs$0!$k! Bk5kkk4*@0kk2! l2l7l<(@sx0JlE! Wl(~l(@s0lH! llll(@0l[! m "m5m:m(@Js0 LLFf! (@qL0- #(@q0A k! t! ! ! ! ! 2Cp |0^ ! ! ! /i! ! x(@tZ|0" " #" QN8" G" l|@?1H0WR" _" b" *k" $~4~?1x0uvv" y" f" 8;16H0" " " " D~E4 f0" e"  " R\X\q"0" " " ]# o# \ p ft0}# 4# # "<(T((0"c%# V# *@=p0M# # # ~# # <21q0 # # # $ ^$ $(@`0 # # 0$ $ ^$ $(@T0 # # D$ $ ^$ $(@0X$ i$ l$ e$ $ )@Z"0=X$ i$ $ e$ $ )@Z"0f$ $ $ Q$ $ x(@K0$ % #% (% x(@[0 8<=% C% $(@0$ $ J% Q$ $ x(@K0$ \% #% (% x(@4[p0R z% }% F% $(@0y % % % % % % (PhX$K0$ $ % #Q$ $ x(@4Kt0$ & w#% (% x(@d[L0 ,& =& [& `& x(@[<0<u& & & F& & |1Hq"0b& ?& A(@q"0& & $' ( 0( >( T~d~2,0$y( ( ( ) ) ) ,1(* r ** Kj:* <?11 A* ^$R* bj* t~~?1p15u* * *  * + + Xh\["1g.+ G+ K+ + + + LDK" 1(+ + + 5- >- Q-   f?11- - - _- . . x"19/,. /. tdC. J. (@q1U. z% b. |Fv. {. x(@[1 . . / 0 1 G1 F  ̻?1((11 ?1 1 61 @H(TK(1"1 1 1 \)H(\)11 2 "2 <2 3 13 @v 11, a3 + v3 )3 4StX,31d3 3 3 3 3 HK 513 3 3 :4 F4 U4 dKp71l4 x4 4 4 4 ̬Xj(:14 4 4 ';5 V5 =1q5 5 5 5 5 5 `KX 0@1(5 /(@"@@1W6 6 0$(@w A16 i$ 6 1e6 11wB16 5 '6 >e6 6 22?1lD1~N6 `6 22PE1 6 6 6 y6 7 t|~?1G1P ,. &7 d.7 <2H?1XH1x`57 87 C@7 KX\?1I1I7 R7 U7 '7]7 XX\I1 ,. f7 d.7 <2H?1XJ1`57 n7 C@7 KX\?1K1#I7 R7 v7 '7]7 XX\K1O ~7 r 7 Kj7 7 22@$M1} 7 7 7 q8 .8 LhdO1 O8 V8 j8 q8 21tKP16x8 8 8 8 8 <21K"Q1a8 8 9 #N9 e9 n9 XOj"S1 9 9 9 2n#9 28 U19 9 9 G9 9 11$\@V189 : \: : 11K0W1wM#: .: \: : : 51T\4Y1: : : : : : Lܬ `Z1u ; ; '7%; .; `KpJ[1E7; A; L; ; ; ; (PDI\\8^1r; ; ; T; < `q~jt_1< < *< d< < < (PX \a1fE< < j< < `q~k0c1 M#: < \: : : 51\4e1?= = &= 48= C= \;1"f1fL= U= d= ?E= = V@M"|g1= = = L= > > \]?1i1$6> ?> N> jI4j> u> 23\j1s> V{ 21(k1s> V{ 21k1.> > > s> ? ? 2p1ȿ$n1dd]?? J? \? k? r? 13\Kn1s> V{ 21$o1s> V{ 21o1F}? ? ? @ A hA `P. =pl1#A A A  B +B :B ~~\D]=pH1JMB VB  lB wB X,XK=p1t  B B 4x(@1(|B B h"01 B B B B C (X1C ,C 4C |C C C SK?101RC C C KI4C ;1?1$1,C D D <oG G H P5 3 ?11MH H H H H `KpJt1H (@̦1H (@$1I I (I yI I I Lx~1)I I I HI J XkĬ1Y'J :J _J TJ J J |"1K K K ui)K 2K ~pK"19K (@1AK (@L1AIK RK UK xeK vK Lx~1s8K K K L L L 85T1L L M XN N N (M ?11*O 7O FO uhO sO 11?11sO O |CO O 12?11*O O O `uhO sO 11D?11sO O <CO P 12t]?1l1'4P BAP  ]P t8H"1G fP xP |P P P \IX"1hkOP P dOO00K81P P P FP 11\1P B P P 11\1P Q  Q Q 0T,X=p1#Q *Q &?Q FQ 1H "1 OQ \Q oQ Q Q Q ]fl1CvQ Q f" 8;16<1w Q R R Q)R 5R Ŀ1HR QR TR ]`R `KM1iR vR }R oR R 21@?11 R R R yR R R 4KUy1? S {S >S OS H@81q dS {vS S S 1 S S S T T Hl81)T 5T 8T ZT oT HQ  1zT T T U U 7U 8hl? <4P1<HR QR MU `R `KM1YU fU xU U U U @ ]f1vU U 9f" 8;16`1U U U U U RJL"81AvV V Pf" 8;161t" V V W" D~E4 f15V BV V  jfW W P5\?102(W W X pX X X 24X #X  X Y Y \k?1 2o^(Y +|-@" 2,Y /Y QY \Y 53\`?1 2 mY  vY Y Y KX\T 2Y Y Y /00( 2$ vlEEE(@q 2R vlEEE(@q2x 236A(@qt2 <EHXx(@2:CjFm|(@294(@H2l Y Y Y Z Z %Z (@LP2 ||(@2 ||(@24Z gk0028Z QZ UZ gZ Z ԕ?12*[ y&og;o(@2[ \V"%iVoV(@q$2 \V"%iVoV(@q2 y&oi;<(@zH,2,zidW(@28lEiE [ o@!250>iLM@ -X2e y&oi;<(@zH2,zidW(@T28lEiE [ o@!( 20>iLM@ -!2 |pQ[ jx(@!2N%[ j'[ )[ x(@!2CjjF*@,"2"WOj=cx(@"2 .[ ^UPj7[ (@q#28 bj (@qt$2t4>[ G[ l4L[ a Ca x(@tLE2HNa Wa \a ha a 00G2h(a 9a a a PL@7 I2a b b Id d d IJ TL4 "xX2Je e e /e f f :\2og.f Rd)g$(@\24f Af Rf \ (of zf kX\^q"<^2f 7f lf f kJL`2f wg H5g kX\q"a2 g *g Ug g g g 00& d2X=-h 0h Z4>P"0d26h Ch fkh h h =1L?pf2 h h h x(KTh2 h ch h x(@i2<h h i i i i ȿ "dl2^ai $(@|l2gi di )@l2i i $j Ej W"|o2Nj vHWj I4wj 22pp2 ~j j mj (@Pq20j j *hj 22qpr2Wj !j BUAk (@t2Hk G ]k k[k k 8H?1w2 k k k k $(@Hx2,k l l m m m ܯ/ 72 Ln ~n n p Ap kp $̅ ?1d2hp 2q q \u u $v  \l ?12v w w F:w Ow Zw K4P4^"2'(gw w x X| } X~ 4 C -2 x G  T 4S@M2 I  z2  6Z k z zpqd^2  i   >2k2N_b: (@"2bT l y ч LE<2x& F600X2, Ղ ؂ n# 4J02 E Tx(@2 .  Ftx(@P2    L3 PD 24  |< ? &$(@2[ C P W ;w \)H(L42x   Mjփ H.x+l7l2  N  @H(82  0 ? `5ar w (@^"2  nQ (@ 2  }FƄ ˄ '@L"2(  ք .  H2   : , H,8 72 U3 97;o@H(29 6 9 ^7A (@@2 6H 79=\)*H2Y   : , H,8 72 U3 97;o@H(2U qTK N 4T $"0$2u Y ņ ۆ b x$Q"P2  K q$(@2   6  ̈ \3V , U Չ \\H3y: R u ي ,<\̆ 3< N s   L\\3; H k !ό ă|3 , 9 \ )?n Í 9HtQ3&  ( 1ė 9HQ3@̎ َ ; l|\P <3v  O b  (ȿ$ #3d q đ ӑ ڑ 9H d%3   , 3 >3\ &3(B O _   ( \\^*3H 8 S  a8l, -H53O? B 0053 F S V 5j <2d73 C , 3 9HXlH:3hX q V % : 80RS -?3'O? f h00P@3T j w n ȗ ח HZTL8B3r ~|+ 2 -@@  -C3 Y? B J [ <2D3b {   4 T@T,dR/ -`I3O? [ 00I3 Y? _ J [ <2J3Og n f~ T.@LFK3>  (@^M3W   A P \dN3qY r Q ] j (\hI<"R3 Л L   83 ` U3$+ 8 G  4\J dX3$ ɜ ͜ J ]30% > B 3  ~) f3 2 9 6D jU 00LTg3_< \ v z  ȟ XTt$_qMPr3 2 ? D jU 00Ls3K \ _ ! @\KM2t3 |Y 6x(@t3   _ $"0Mu3E g  (@ G `K@MdMv3 N [ _ pq `K@MtMvܕ3 N [ zq `K@MMv3 N [ q `K@MMv3 N [ ̦ q `K@MMv031 ަ ;  6 ? `K@MMvt3H F S V b (@v43] u  G(@vL3r ç է  `K@MMv<3  0 C (@v,3 H U a e(@v3 t է  `K@MMv3 VoV(@vl3 ¨ `K@MMvT3 ¨ `K@MMv<3 ¨ `K@MNv$3'   ¨ `K@MNv 3< / ¨ `K@M$Nv3R ? ¨ `K@M4Nvܱ3i O '¨ `K@MDNvij3 _ 0¨ `K@MTNv3 o 9¨ `K@MdNv3  B¨ `K@MtNv|3 ! L$"0v3 ĩ Xi  (H( 3 5 @ 3 ê ;Hl"3 [w JTT_3 « ƫ   31,3 4 A r ԃN"L3& F600X30 ʬ ߬ )@"3U   & 51N?13 - F J 2 $(@ L3 έ խ (@N3=ܭ ^7 h)@N3   7 > p\JN=p,3I S   22"3$\ e ~  ʯ 22_"<3C    22N"X3b# , C m z SU_"|3 H @_3  %VoV@|3,Ί  %,9 |\@@ 3( Y ? \ m R"3 ³ Ƴ  (@36 & ^ ]¶ I Hu `g46 ַ |߷ (@q4Y b 9  $+@N4 : > =9 7G` 84"(Ź ٹ ݹ   7i44Z$$ " &  û 7i4& ˻  74iL'4'$. ../ /@*@`)4A+(  3L ~D`-4.ν ڽ 9 R X * P04[0k x | & Ҿ @*242 پ # \ 74i643 h'7A(@q743(e r v  & ̰C44 > : > =9 7ܰ tM4K5(X l p  7lX45$  V 7]46 ^ w {  | 7|e46$. ../ /@*@t`g4V7( 3  $ `k48] ڽ 9 R X *) |n48i v z & @*) q48 ! Z 7t4F9,c p t  $ ̰O`4s9 *30u< (@qt49 C L VO (@q49V ] Մf h)@N49 "%V5x(@<4:|m t (@OX4#:}  (6H`?1І4E: 4 E J (@a4k:܊_ ߊ*@"4:^^a1h)@4:|f m  (@O4: z '7; x(@$O4: -  $(@4O<4&;ʊT͊(@?1l4I;܊_ ߊ)@"4r;܊_ ߊ*@"4;   )@DO4;"%V2:)@"H4; Z[q^7 x(@؋4;"236(@|4#<l/(@(4K<"236(@̍4n<"236(@p4<"236(@4<"236(@4<|LL * (@|4= h'7A(@qD4*= Ful/ۍ (@q4t= h'7A(@q4=/ < Y  8&& 4.>[X \[(*H<4> ] H,8 7H4>U ^o@H( 4-?$ *- *8 33Й4=?A K s   R d 8Pdg4P?4 <;  H@`@ 4}?   A' @H(4? A t)@ "p4?YR A t)@@ "4?  , A b g t)@` "\4? A! t)@ "4@  A"b g t)@ "4=@  0 A#b g t)@ "\4^@f o A$E t)@ "ȱ4@  A%n#B G t)@ "84@f o A&H t)@ "4@ A'n#B G t)@@ "4@ , A(n#B G t)@` "4Aj s A) t)@ "4'A  A*  $ t)@ "44IA5 > K A+g l t)@ "@4kA} A1 + [fȿh4AR A  ܽ`l4.BB AF   8)'m4NB& ; t A< H7Dȿ 4mBn= @ AJ P,@TOP4BQ b i A $(@ 4B AR  ff@4C() w AX  ( Tdt܆ q"4Cu A@ p4 D J* A41 )@4+D6 A H AQ l q *(dO4fD x  A&; <(@tOh4Dk A>Ft <(@O4D x AD; <(@Oh4D x AV; <(@O47Ek A\Ft <(@Oh4vEk AhFt <(@O4E AdU )@Ol4E AdU )@O4F AdU )@Ol4cF  AdU )@P4F  AdU )@Pl4F^  A`(@4$G  4 7 A#71L \8=4UG$U y A0O [ n ;;< 4G A  D;ܰ$P 5G   A< O JJ 5G_X [ Ad_ )@ 5H d A( < t# 5CHg A[d d1H,5tH A QJ5HS AQ h)@5H a e A #&5I [ _ A[ N d1HT-54IV c f Av *@@.5eI_X { Ad_ )@.5I  Aa t#85I * . A F d1H@5IO \ _ Amo 8)@A5/JS t AQ h)@dB5WJx AZ #K5J # ' A ? d1H4S5JO \ _ Amo 8)@T5JS t AQ h)@T5!KH AZ #]5ZK # ' A ? d1He5KO \ _ Amo 8)@df5KS t AQ h)@g5K $ A #o5!L # ' A ? d1Hw5XLO \ _ Amo 8)@px5LS t AQ h)@y5Lx AZ #45L # ' A ? d1H5M A *@5IM_X Ad_ )@H5oM Y ] A t#5M S W A[ F d1H85MO \ _ A^8)@5MS o AQ h)@5#N a e A #5SNs A[p d1H5NO \ _ A^8)@45NS o AQ h)@Ԫ5N a e A #5Os A[p d1Hȸ56OO \ _ A^8)@|5dOS o AQ h)@5O   A #5Os A[p d1H5OO \ _ A^8)@5PS o AQ h)@457P a e A #d5ePs A[p d1H(5P  4 7 A#71L \8=5P$  A0 ;;< 5P  A P X <ܰ4P5Q  4 7 A#71L \8=45HQ$U y A0O [ n ;;<` 5yQ A  D;ܰDPL5Q  4 7 A#71L \8=5Q$  A0 ;;< 5Q  A P X <ܰTP6'R  4 7 A#71L \8=X 6UR$a A0[ g z ;;< ,6R  A P X <ܰdPX6R$ " A0 ;;<p \6R A  D;ܰtP(6 S - ] a A  ;P8/6xS 7 F u+o 0 P16S4u/t,@yrh26TZ> } fz0(\)@36WT } CHPyrD46T 4  5 D ]76T$- 46 % B Q (nM`96U\ #   (@ "(=6U% J Q m (@P"`?6U oQN  h3<\d,A6V * o s #C ((\E6V | 9x(@ E6.W(b   JD8F6fW  ' cY p u (@ hH6X$   lW(\?1J6[X(    0D@ ?1L6 Y(0 M j  \HS?18P6Z( =   W@?1TQ6CZ( 3 h    $ ?1TU6Z(C V $  #  $ $?1X6[(\ =@ \ i  $ ?1]6F[( ` c   s8U ?1@k6]< h  j@?1pl6F](       $ ?10r6](* a   + 6 ġ ?1{6^(   a   \HTS?1x~6^<    j@?106_< U f  Xl4a?1(6f_(  '  %s?16_<R v R n(\da?16`<  # h   XP?16`. C G m } 4D126a(     + 4 %  ?16a(    W r z a?1X6>b(   b   ` Y ?16b  00x6b U  006b U  006-c$   G lW(\56]c,   2 > 1"6c,E t x G   1` "6c, E % X@"6d,* C G s  1"06Md0     R@"X6d0   t   R@ "|6d <EHXx(@6eX= =4>P"06# 71\q7i]# j# # Q# # # pYklqP7'j $ "$ 5$ hL$ Q$ x(@Pp7jjd$ n$ t$ $ $ 00 7j$ { $  ч$ ((\" 7j % _% f% r% {% )@$b"7ek% G% @T% )@"L7k(% % Ne& & F"T7k@& ]& & ' (k@"7k4' i' m' ' $( .( <1P"|$7Pl7( y( }( ( ( ( ((\Tb"L+7{l) &}) M8) ((\" -7l) &}?) [8) ((\".7l) &}Y) i8) ((\"07ls) V) {mG) ) ((\Q"27Rm ) 74 N4 Y4 !TQqp7rw4 4 4 J4 4 tN!?1s7r4 4 5 [l(T5 Y5 x((\Dpu7sV |5 5 5 5 5 @-@dQ?\v7ds5 5 5 \C<\@w7s5 5 5 5 5 L`hy7s6 -6 ^6 6 6 6 TdV "(}7Mt97 F7 ]7 7 7 /@?1\~7u7 7 7 R8 ^8 i8 4kDI\ r7\w,8 8 8 98 8 @k@b@7w,8 9 q9 @: : ;  7Ox,; ; ; [< m< < qq7x4< < M= > > ? T W 1H7y,rl? s? 3? ? @k(tQ,7Hy,? ? ? ?!@ 1@ ;@ dei87y$d@ |@ @ YiA A  Lkd?17x >A EA |QA bA gA P"0Q7*z .nA qA wA A P"07]z A A A %B ?B LB Xk W\S rd7z{B B B  LC ^C \l\S r(7 {zC C D 'E `E E LĆ r7C{E F iF G (G 9G $4 r7{G G G 2G G G FlXm rl7{G H 7H <H H H Fl rl7/|H H I M+I BI II FHm r47m|XI vI I [I J J Fl2i r7|>J KJ bJ qJ J J (0(\ rD7|J J J /K ?K TK dkK\$ rD7"}lK oK wK 00p7I}K K |L N EN N  $ \p r7}CO PO uO O O O D rx7}(P P %P ZP eP `TDT r7i~0yP P GP pk@b#`7~,P #Q Q &fR R S \4 $ 7~0S S "T ZU U V X #8|V V V UV V t)@b"(8W$W W 0W  B jW sW |kKm 8$W W W W X %X tT 4 ? 85X >X AX KX bX d@8kX xX X X X X t?c&8X Y Y VY !Y 1= 8P *Y 5Y Y  fz0(\)8$ Y  CHQyr8bY Y Y Y pZ 0! 8z vZ Z Z Z Z d!$8Z Z Z ?[ ![ (6H?1,%8˂E([ +[ y3[ D[ 51?1P&8K[ T[ k[ G[ [ (\)P'8h[ [ [ P[ \ \ () v)8&\ 83\ cA\ (@x*8ǃF\ M\ X\ ppH\ \ \Ik@,8\ \ \ ] ] %] x((\`/8Z$4] >] T] ] ] ] @DcwK38] / ^ 1^ X^ e^ ~tQ58l^ x^ }^ ^ ^ ^ tȿQ78 ^ :^ ^ _ %_ ~Q:8Q0_ :_ B_ _ _ _ ~|tcD>8_ _ _ m` ` ` |nD8` ` a ^Ya va a 88 Xn5I8$a a a ma a a X W\RG4K8jb b b y8b Ob Zb X W\RG4XN8cb {b b {b b b kkhn#P8܆"b |,?00P8#$b c 1c c c c  rU8I,c c c pAd Jd n%+X8t_d d d 9e ce ue ȿ r_8 e e e  e e k,gȿ$R ra8.e e f *h.f 5f *@o?1b8QLf f g 5Sk k l 8\X r8m m &m VTm [m hkT08Ĉvm m m 6n Bn [n @0j rL8n n 3o jq q q L r08,r ;(r `l(r (@̞8Kr r Us nDu u u yY r8wUv bv lv +H(p8qv 4~v v +H(G4$8v v v &w Dw Uw \j\8( xw w w 'w (@v88?w w w 22w (@08\w w x O Xx `x $+@4Ryr(8tx x x u5ax k8yrp8 x x x x (y 3y L<DRq8Ҋ>y Wy [y y (@88y y y z +z 6z xu8j Jz z z { !{ '{ (@TRq8 /{ @{ C{ D{ { { 2HdRq8ʋ{ | | m| | | c88 } '} *} D} U} ^} 2HtRq8 e} } } } } } 2HRqx8Ռ} ~ !~ &~ ~ ~ 2HXo^#8u I M y  2Hc^#8& L P  2HR8 Հ ـ > V ` 2H8v   % (@8S9 _ g > 2Hd 8 w  r> O X (A3\R9 _ l o E x(@q9   2Hq9   $ + HY ` (@qH9v  $ q HY ` (@ q9ݏ "  (@@9 ( 5 < v 2H`q 9r  8kÅ (@ 9ʅ G" (@9͐ 3 7 dOU (@9Z w z y (@(91 jۆ (@v`9p i5(@`9  1 J  ҇ ؇ (@܉q9  / t (@ou9& Ɉ ؈  7 > 214d?19RQ b  n 21?1%9 ݋  u (@q*9 ߌ (@R ,9b   n#- (@|-92 C F p u (@R.9ܓ  (@R?1l/9  ō ȍ ' (@R?1t09:  5 5 ǎ ώ (@u49l = k (@ou$:93 a A M W 2Hpu@9ڔ < H T 2HDuK9/ Ó ZN Z b (@Xp?1Q9h R8  (@R?1U9 = g s (@L?1\9ѕӖ ܊V _ 2HS?1d`9m z 8 (\)SXa9XSŗ ̗ K֗ (@$Sa9T O (@Xb9Ȗ   T5a$ + 14Fȿ4Svc90 9 L ^z kkdde9 p o՚  . D P\  k ޿ 9 ] 01$d0: /$ (@2:+ @ D N 21S5: q 1 : (@qB:An {  # 8!J:[ # . V` H(, $eP"0; !G   lf4Pr;V h* 7 D !PZ u ~ X\|Jdg"8;n4!R-<A00p;0   !r>  " PYhYl ax;1 !  (@@;j !|p*)G4;δ b !e RlK";   !   D k\";b4 !-<A00p8;   !D jU 00$T ;¿ ! 00x;}# 4  ! ( )',;µ - ! Q (@";ݵ3 !'< !D S ('; X !Q (@"$;^ g !q  (';  !Q (@";n  !  8)T(|?1,;& b !e RlK"$;9 ?+H!9 (@q ;M UU(@D;r H Q8f  $(@4T;   SE t8H";϶5  S.C t8H";  *6 S<t   TWlKDTl;6$   S   >$$V;% . 7 S^ e (@TT<n x  SYg   KlK?1 <ַ   Sa  61\dT"D<   Sl , 3 (@tT<&: / X S~   $(@T <n   S / 8 (@g"@<E R Q S!a  @tL<^ ( S3$(@<Ը    S   0T<|l/S:'@"<4   S  <1T"<W "%SV5x(@,<|! , iB U 00<b l p i5  @H("< 7  iT X q"><2h" himh 2?<" " # ibt# # # 411lC<# # L$ im% % % $ 0Q<ӺP& i& t& i& & 4SLPTTS<& & ' i' ' ' @6CpxX< ( E( ( i6o) ) ) D` H`<* .* 2* iR* * 11\rDe<=* * + i+ + + @MXZ Aq8k<a+ , i'-<A00 pk<~J7, , iL", 9, 00ll<>, W, |, ih, , - $('tVp<p(- G- }- i. . @. 0|0 A=p w<+ u. i-<A00@pw<ػ¿. . i 008x<P. . . i"@/ T/ a/ h` M{<kO/ / i'dOO00T |</ / / iO'0 :0 G0 \Its3 </kO/ b0 iTdOO00T<Ll0 y0 |0 ii0 0 @H(<^0 0 5aD"P"\<{0 0 +0 1 )@"<b1 1 900P<Ǽ1 ;1 1 I2 2 3  ?1<\3 h3 {3 3 3 3 HTl<H3 4 m4 )s6 7 C7 ;H̢<_7 7 7 >7 8 8 8$`< (8 &}48 Z8 k8 |p`x< v8 8 8 [8 8 x(@TT<Ƚw8 8 h8 8 (@\<8 8 8 w89 U9 d9 ==p|<:m9 Yz9 9 9 (6H?1d<c$9 9 9 @: c: v: [VQ$<ƾ: : : : : : VlKU<: : V(@?1H<!: ; $; b; ; ; KKU<@@; ; ; < < < d8P[ << 5= >= E= E1 =cO= $(@$U0<V= c= f= cv= = 00(<п$= = = A> m> > \gQ$<> > > > > (@Xs?1<<7? ? .? f? }? ? (@s?1<h? ? ? U? ? ? \5E4U<? @ @ bd@ v@ @ Xgq$<hlhmh 2<6 @ @ @ @ @ @ 31\DU8<U@ @ A A (A /A (6HTU?1\<r LLFQ(@q < .[ ^UP7[ (@q< b (@q<586A (@?1< l/6*@mH<|(@?1<C;A DA MA hA A A @H(s<A A A g9iA (@<A B B Z4B EB NB @H(dU<]B fB mB @B B B \)H($h<< B B B C C p61yrH<gC C C C D D :2Th3P<%D 3D 7D D D D 21yr$<#D D =(@"4<@D D ?D (@w<^D D CD (@w|<|D D L(@"<D D D N'7%(@wT<D D UD (@w<l, D #^7C"0<gD D *d)g$(@<E E 'E tE F %F (@?1t<<1F >F BF .F F (@<eF F F OG ,G 5G (6HtU?1@< >G KG NG cXG oG $(@< tG G G oH H >2<H I `I  K pK K \I8R =6K K L oL L L xNT =tM .M oM N ON ]N xNDjpl= N N N N N N h31U=O O O hO O O $iKUq=< O O O CP tP P dW"=|/P P dOP 00= P P P !Q RQ ]Q l U=fQ pQ }Q 'Q Q Q H78U=Q R R %R 0R 00 =1 kkn(@q!=U:CjFm|(@!=u5R >R MR H>bR (@Ul"= qR zR R R R (@UT#=:CjFm|(@#=R R R eR R (@U$= qR zR S R R (@U%= LS S EFx(@V&=: &S -S x(@V@'=`4S >S _S S S S H1t)= !@**=(58CNH6'L+=U^o@H($,=  !@*,=,(58CNH6'x-=MU^o@H(P.=pS T T S0\ 6 >W h { 9 <(@@" >  Ā  0 R u"0> 4L Ȃ x(@`>' Ղ ނ O   (@V">U 4 ? r X6H">ƒ   ˄ RJ"">H 5 9 "r ʆ i8R .> ! ; ? i ̈ 4D=p8>N{  q| | (@"<>{ |$"0=>q} !E} (@?>$߉    B cJB> vlEEE(@qXC>N O V _ f 21\VHD> TTm 'T.T21\V0E>5Tv ?T00xE>{  ̊ @H(K>  Ԋ    12L>D. > N  H[ =pP>?\ v DȌ ׌ N4PjS>   1 H1U>X=< ? 4>P"0U>! B K V #w <1V> 2 F ] El2oLa> $  [ = D )@Wob>K R lVf (@WqHc>0m v y  H$Wyd>/8 T9  h@ݒ`h>e O ] u  + < X4j?n>z3 66)(\"`o>  !/ vS((\ p>G  4o |hR\q>~ Ē f   <1qr>V (@q$s> y & N q x ?djou>ai  œ ʓ (( v> Փ I4  $((\jw> 4 M  Ք j?1z>   0? D $((\4W|>I K d { R  " $(ܧd>Q aI { > Ǘ UPԗ  )@o>  ' U f o 33\j4>+,~ ͘ X@5|>Z4  - J H?1>$R _ v   lz$k>ҙ  1 ƚ PhXW rܕ>9ݚ E 8 i@(> ě * 6 AH?ܝ>H> A 3(@>D Q U @ ˜ ڜ x{ Tkq>"$  f x2(1oH>a# 0 3 tK Z c H,XDW> j s z mS x((\TWԦ> $X $Sx((> TT 'T.T21\dW>W pEmHmKm(@q> vlEEE(@q\> )ry&o; (@qت> H =f  $(@tW>\ NН  `>  " 8 G N $(@k>Y f o  $(@k(> ̞ ۞ $(@k>OP < d  ? i L>  ͠ p\T=pT>A֠ ݠ  (@W=p>r   H` >* < W [  ˣ X , > T X <> g  Τ ڤ tXM`Xux>H  : .Х  <\|ެ>*9 K S . æ (@u>ئ XC (@`> ! 1 aħ  l?1> % > M  Ĩ NhIDl>@Ө  + K4h\?1>i g6 d)g$(@l>> S b O (@tl"p> ~v (@q> &CjFt$(@(> ^^a$(@@>9236w*@=>j܊ߊ*@" >^ #(@W$>^Ʃ ͩ m(@W<>236Ŋ(@>)ʊ͊(@?1>ZWEHޭ )@=>܊ߊ)@">֩ ߩ   @H(>$ [ 1 Zu pl>Y Ū  $i UWq> 9 q( $N0i>3 c g  H["P>ȫ ۫ w ˬ \Tu?8   , \ k z L l ?O + ĭ )@h ?) Uϭ N#0oMx ?_$Nӭ V3H٭ +@c ?4ޭ  _ H6 ?4 mx!H Q 8X? pEmHmKm(@q?@d]o(@H?$:CjFm|)@'F?$|d k t y +@W'Fx?$  EEW'F?+$   & P"00(?X=M U  4>P"0(?X=M Y  4>P"0)?X=M ]  4>P"0h)?.X=M a  4>P"0)?Be i  FW(H(*?Vwq y  [ (H(Wl+?~X=M  4>P"0+? Ų    3H:W,?   3H P"0X-?X=M !  4>P"0-?X= %  4>P"0(.?X=) -  B4>P"0.?1 ; @  Pp ϳ @H( 4?׳   H3;?#  ״ @H(>?7 ,  D \JG4@?N,M ] h    <B?˵ c|ݵ    )(D?0 ?  з ] P>04 R?T  X  Q (@"0S?o   3' B >'|T?I b k  @ 5Hq"lV?( ع  _W ̺ lPT`^?  0  li t HL0 4m`?   !@*`?0( 8 CNH6'Ta?[U ^ o@H(,b?   , @H(b? 0  {uƻ @'c?ϻ ۻ  o߻ @'d?   4 ; 5H"e?) >‰L  00e?> P ea   u $(@f?R |   PҾ ` x \ /q\z? - 6 A  i} \lX4|? T  R ?00|?2     ) | qP?s 8 F j   / 0a$\v ? O \ c  46q v 8)@X?1Ĉ? (}  ] D v)?  Z   & - 12$XЋ?, 4 9E  c | ?1؍?M  [q  ^7h31h?o  V   Q LSJq?   G d1Hdm=pĐ?   / :  lT a ~@d? l }  I 00?  @  x X 0T0 d? 8 M Q   t~ܧ?$    # pT p ؽ?v   X  Q (@"x? 0 I  s{ dx "?    5 H O (@mX?  o\ _  (@,?   Kj 4124X"x? v  00?$   00?A    9 I X ̱l DX?Y   X  Q (@"|?~ H` c  5 (@TX"?   1  \JdX0?   C  Ms \Im=pt?   (@"?   Vw(@2?    nh)@2?(  (@"?B  Vw(@2@?^   nh)@2?y  S k @6D`? P   H 7q?   ( 5 DXm?4H  O > E tO /?  w[ v 8\X?ȫ  v 6 00hp?  ,K R 61TX?i   ?n PXO$q"@ 5 M   ܱ Z3@J *   Hh\ q"@{ " :  2t ܱ Z3t @$ ,  G  $ t 0H@o {  i T+($n#@  m H W xX6<@p y  sL 91tX@,    ) 2X0H@ 1 z  j p6XGG\%@%  3H D"0%@>)r   ;00H&@\)r  ;00&@z % )  ; X )@X(@_ j t   @*@     ?1W1+@$+ 8 =  O r 66 X.@$  ' 9 F (<hz"2@7 g   ( <@R) -  D(@?1@<@s$3 ? I  K XA4>@  r 00@@l  +@G4lA@  e F@  R  H@4d]! %  \]00l K 4TvIa@!$h ~    . : DJY5-@" f    * L Z ,t4@"0 l    &    L-0F) Iq|@#  X  Q (@"@#  X  Q (@"@$  X  Q (@"\@I$  X  Q (@"@|$"K W  Y g | 00Yt@$    4    TT R`@2%G T   = e dTDm@%   (10?b@%  4  w `xwA@%&a  F600Xx@&$   c 0wDowA5&  t  + 4 @H(8AE& I R V  d\ P"0Af&U a  g )x.bA& 4 n  K Z ((\A&x |  6v͌(@A&  g T41Y?1A&  #  pQ n w zZH A$' c  ~6(@?1 AW'0   t]G(Az' |   x(@DA'   (@XA'   $"0hA'   (@|A'     / (@\A(4 = A  F(@ A9(E Q U  y  pG q AV( H       :83"lAv(   -<A00pA($  !  7 F M 283LA( V  -<A00 pA(g |      $]|J@?1A(   "-<A00`phA!)l    @; \ c =3 3 3  )4 ^4 w4  qAv>4 4 4  5a4 4 'T( [qA>4 4 4  5 5 5 |w"A> 6 26 x6  -8 9 E9 vN dAy?D4: G: ^:  r: : ; 8@A?; !; 5;  ; ; ; ]T$[A?; ; ;   < .< 9< .@4[%4B)@\V G<  Vq00B]@K< U< Z<  < < < 24D[B@\V <  Vq00PB@@< <  = = = 4ܲ T[w"B@"= ; 5=  e= x= xU  B A&a =  F600$ B;A = = =  &= )@q"4 BaA= = =  )> F> S> Є,Dd[BAa> m> q>  3> > > t)'ht[u4BA > = >  => > > (@[DBA ? ? ?  Mm? ? ? (@$q0B0B ? ?  l&&"&$((\BSBߩR ?  m? O? 00[@BB? @ @  u3@ P@ ]@ [?1DBBNd@ h@  @ @ JJ4BC @ @ @  @ @ A \"BKCA KA zA  B B C @ ?10%BDuC C C  iC D D ̍(BkD ?D RD ^D  zD D D ?, TqZ3t+BDD D D  E _E pE x7q/BD E E E  E F F ]yZ3 2B)ED D *F  E _E pE x7q5B`Ex ZF  v͌(@6BE / bF jF  F F F ,t 7BEF F G  MG lG yG <Xy9BE)r G  ;G G @H([@:B.FG G G  G G 21;BUF G  G (@q;BFG H :H  H I BI hqxCBGxI I  ?V(@?1DB+GI I  C)@"DBWG(I I I  HI I I L1qFB}GN J  `J /J 6J 21[GBG=J NJ SJ  J J J ?>[q8JBG J J J  _K K K 8r4PBG\V K  Vq00PB/H K K L  0})dL oL nq"SBRH L L L  LL L L \[UB~HL d@ M  bM (@VBHM 4M DM  mvM M M U[YBH M  x(@YBHM M M  <M M )(D[BI M N N  CN )N ?l2Z3\B,I0N = =N  KF:h)@L]BPIGN G TN  SE^N 0(@ ^BuI cN d@ pN  ZzN 0+@n<_BIN N N  O TO qO Th@fBIO O O  O O 0\q"|gBITl O  ,?00|gBJϳ$ O  )@q"hBEJ O O  O P \kBmJ)r -P  ;00kBJ)r 1P  ;00lBJ 5P  ;;P t)@qlBJ @P MP YP  bmP P P :83`"mB'K P  d-<A00pHnB\K P P  hP P P d1(1"oBKc P  iP 00oBKQ Q (Q  wDQ WQ `Q H`W'pBK kQ  z-<A00p|qB5L|Q Q Q  Q Q 21rBfL Q Q  Q Q H$2\TsBL4Q Q Q  R #R \Hv\tBL| (R  $"0xtBMU,R 0R  =t)@qtB8M6R GR R  R R R 82=pxBTMS DS mS  cT T T 0U,  * ?BMU U /U  #]U lU uU 15\Dr$BNU U U  4 V :V FV ]V\"BTN$^V  sV  b*V lHc4B~NV ? V  qV V V @P$\" BN0W /W 7W  ]W mW xW HU4\ ETBN$ W  W p*@D\"BOW W W  Y Z Z ̗> LQ 6BO"l Q[  ,?00BP   (H(BNPV[  c[   [ [ [ `KM$7BP[ [ [   \ \ \ 283BP *\   -<A00 pBP8<\ O\ \\   \ \ \ yMqBDQ \   -<A00@pBuQ] ] ]  C 7] J] Q] 283trBQ `]  E -<A00`p4BR4s] ] ]  L ] ] ] 283B>R ]  N -<A00p$BwR] Q ]  ^ $^ )^ (@T\BR4^ @^ H^  e^ ^ ^ (xQr$BS ^ ^  ^ ^ 283HB)S|^ ^  6|00d\ BZS^ _ _  ^7 +_ (@t\|BS6_ F_ j_  _ _ _ xN]BS *` 6` H`  M!x` ` ` |liy"|BO YR` `  [!` ` $(@\BS` `  b!` a 21\BTa a (a  !Ca Va ]a 283rBT la  !-<A00pBMl a  !,a t)@qBTa a a  !rc c d `p?P^ ,BU&a d  !F600BU #+nd  "Cd d 9H\hBVld ?e |e  "g g h G 5B:Wf h  ";00hBpW8h h h  "^i xi i YqBWN i  "3Ha(@=p(BW i  "-<A00pB=X i i i  " j /j 6j ?#B`X Mj Zj j  "(l cl l | "LBXl NJ m  E#Fm mm sm '' qBX$m m m  `#m m ]BX`m +n n  #p p )q `Ut HR qdBY q  !$-<A00@pBY&a q  #F600XBZ&a q  #F600XBBZ q r r  ;$r r r ]4Zoq4CZ r  ?$-<A00`pCZr r s  a$bs ss s isqC[s s s  $s s s ?@\`C?[  X  Q (@"Ct[s s t  $t t t `KdAq, C["l t  $,?00 C[t t u  $[u tu u x{`ZUC["l u  $,?00(C*\= u  $&u ]8Xs8CJ\u u v  $?w w w $_ 8C\%x .x @x  %sx x x @P)\4sC\"l x  $,?00C]"l x  $,?00tC8] x x x  !% y *y ?y p\\"C] Ky dy iy  :%z z { xFnh+C^7{ X{ a{  ~%{ { { q.C^^| X| |  %m~ ~ 6 ~D @C8_  X  Q (@"@ACx_ c   % -11AC_   H& Ȁ FC_ J  j&+ a r ̳ xMC'`   &-<A00pNC[` ׂ  &҃   xU,4RC`[   &  G$h q_C`< I U  :'v zds7q`C`  D'-<A00paCalɉ ډ  W'  # 383cCKa .  Y'-<A00pcCaB O a  p' ͊ 7HDq(Cf Ƒ Б  (    \?1lCJf " / 3  (B Y $(@8Clf^ g q  (k 12\ o | ܳi`@oCfg, Q  A)ה ^( ECgܔ  X)G ' 62 !CgX=M 6  )41 `(@ #Cg>= A  )00ChF J  )(@2CIhjO S  )^7Z ?H?HCphUN a  )l 0TJ"Ch >= u  )$"0qCh z g  )w 5=0Ch Q  ) ;H]"Ci U  )(@qC=  $*$"0qЛCIk  /*, 8 E 0@\Z"Ck$n "  K* 7a-Ck >=  e*$"0qCl ӗ  j*e& 3 0@\s" CDl$L " \  |* 7a-Cwlq }  *̘ ۘ ] ^@!=Cl ^  *00*,Cl^  *00q"DCmva   *Õ p-@=p̧CGm  <  *Ǚ ә 4U$[_ rhCcm&a  *F600XCm8 ( -  3+ D,^t[Cm՚  j+bh   8^T$]|Cm ( 5 9  v+J [ d1(1ȿ"شC nb {  + ɛ қ 444]qCPn ߛ  -1 p } HD^\D]#Cn  -ǜ  21T]q`Coy  .$"0apC:o -  .g ?1[Coȝ ݝ  . & / l]P^`!Cp< [    : x- < $CNr u  13H'@"C p z  : t8Hd]"DC7p  6P;HNCYp Ο   / @ `t]qCpP c   2 G X{)v Cqf {  x'̡ ԡ (@\=pCqq   B 4 9 P"\"sCq .L P  kFtx(@Cq T ] a  oe (@ S \ (1?X]D7u  g  > S \ (1?X]D\u  Ʈ ۮ (1@ȿ"TDu    & A N HXTtTDu$[ h   32 "Du ̯ կ    x(@]Du    2 (@L Du7  D  "FV 412!D v] f  Bt L@H(!D$vX  9 00]"DDv |3  P"0"Ddv հ ٰ   * JJ?1%Dv ݪ3 6  mc$(@0&Dv< U p     d\+Dv 5 C P  /Ͳ  # `7tt2DvA f z  Zij  @"7D7w,  E* '@"p8DUw] 1 8  F K (@]<9DywR _ f  9x } (@]8:Dw   (@^(;Dw ڴ  +71  (@\o 22]D)~  MB X w i|E"D|~  O 00D^D~K[   $ ) (@tuD~"D P  b u (@#0D~   283D1   00uDD   ) : 283HDo"TA  ,?00D1 E   00uhDY b r   21vDh    283 D&1 *   004v̖DY > K S  i x  $(@T^"lD     t T ?1D~  HĬ(@"XD-  Q z L\`p?1DS &  @t $(@d^|Dz  `   , S - >"(D   @'`D    ht T`t^D-,  + T a LJTX|DEx  r wLqD4 ! &  R t^D   ~ d h  ?1D > O  ( # . ^^`^ q"D y  <_ ІD"xI  xV(@?1 _ t 7,dvDy   (@^D   B $ ) (@vD8 <  v͌(@D D H  '7b h31D.i r v   (@DJݪ   (@$Da   12DD  &  Iz pV|MwD=  o^7 `(@5,D  { ) <(@HE׆ .    p @GlU "E   h7  !E^   s.@$!EB    u+ B .@wH"Em^  )@`"EI g    7` "&EJ S ]  o `q#'EJ     ^Mv')Ef  -<A00#p*E1 > N  p ,383vL,E  -<A00#p,Eډ0    283$8.E   -<A00 $p.E'  ( ,  @ S *(\q"x0EA X i m   <((\t2E]X=)   4(@W12E|  !    \86E ΊT0  6 ,4 )@q"6E9 G  c X z jHPa !\?EΊ,   ;(@W1?E  %  E r]\ g 4SLP@$AEt  [  $(@`$BE(  f HP $qhIE?     $q"\KEf4 8 X   |K E8OE  ͢00$dOE   j8 = (@^"QEϋ J ] x    4\]SE6h h mh 2TE   ͢00$dXUEΌ    8 W h $wW1XE u  9   (LlMZE .  < -<A00$pP[E*? H b   22}q]EPP   a `qpܐA|`E  -<A00%p aE   4SH PbE ,   qT  P"0bE ( <  D Kjl s 11TwdE+  i v ({"@lE&   F600lE    y dO00DmEȎ)r,   p ;00mE$ 7 ^   D^)qE^$ 0  V e l (@X}sE֏{   63t^݆uE  & :  H5l q 11wE    xT|J^4yE1 4  -<A00 %pyE] s>E Q  'o 283@%{Ez  )-<A00`%p$|EÃv  B (@wt|E   N / (@%v}Eʐ: C O  [e t y )'%X~E  X  Q (@"~E  -  Q (@"E6  f p97w`ED  X  Q (@"E_  -  Q (@"Ee   (@ E    : W ` (@%E sk y  | $((\%LE   - > 8H}>EF^ [  .@WEk_ k w   .^3HDEr    NJ^VX~"Fژe 8\@&vF #:G`&X"FlRcq ?=83&?1#F A-<A00&p$F? I&QHs?1'F[[hz ~(@&(Fz 2  $d.F <az  ]MDxU1F-% -<A00&p\2FOa 6D  283'T3FnV -<A00 'p3Fgt  283@'4F -<A00`'p5Fݚ 283'q6F$ -<A00'pX7F,5BF Pa(@8FEf S^_"X;Fa! 67H88@4F  Y5L12@F U^b k ~^JmAFۛ I<`~xIFCt }L\b 8PFɜ  X  Q (@"PF  $  Z i n (@LRFN   ; (@RFl    ! !:2~"SF$!1!9! -[!j!q!'(\'qUF !!! 5!!"HQ<`tXF|""B# F$+%~%Xd DqjF<e&& =U00tjFb\V,&0& Vq00kF4&?&C& Y&j&^^2kF~X6s& (@?1|lFǞ T{&& ,$(@lF&&& &&&R4P4_oF&$'\' (''(X`G4duFJ2(E(g( d(((hxXUxF(( f-<A00'p4G4$@)EOF(R4 >-<A00`)pFc4o44 Q444LHdqFU 55 y(@FХ55"5 T5q5x5(@)F#555 555(@)0FP,Z55 Kj66\2D_)|Ft,06>6X6 !7|77XP/aĻFǦ(77 4f00,F778 >8o88̴xx)q`F(8 !-<A00)pF<858 <888(@T_qFi$899 ?%9@9G9HH=)7F(R9 B-<A00*pFڧc9{99 J99XJ4#q$F D99: ai:::XPd5aF"(: g-<A00 *p$FS ::: e;;; 8@*I(Fr;;; T<(<8^`*dFqa=<A< 3HZ0P"\F0I<<T= @ATB$  iF"{& C ,?00F"{&C ,?00lFҩC-CEC KCCCP0j؀=pF"{&C L,?00FACCC C DDx{*0Gf)r D ;00G|#D'D 1D(6H`G6D?DaD 5aDD_Jd_=GҪ DDD EED@1\G EE E,E210G$3E?ECE KEl8 cHG3VEcEhE FEEE(8t_?1 G~lEE VF'F.F 22 G a 3KF _333383* G(]F a-<A00*p GnFwFF fFFF 22XG  <GGG m0GMGTG:83*"G3(_G o-<A00+pGdlpGGG wGGG`K_ +'G(G z-<A00@+pGɬ GH3H HHHHXȿ }lGH IuI WKKL( @2 J'G8LLL > LL[M(G_kO%-L 8 dL(H(`)G"{&L ,?00)GLLM )MBM\I_\+G٭ %-KM dUM@H(+G \MuMM t MMMhx"D/GE  X  Q (@"/G(NN.N NNN$`b5GO+O7O  YOjOqO(6H`+?1h6G |OOO  OOh35\7G<^-O ! `(@"7G`$OOO % P'P8PTG_W,;G@P 8^P *PHܴ5 b>  =9 7ܰ@,hGw(X bp   7`GҾ$ b   V 7G2 ^ b{   | 7pG$.b. ./ /@*@yGU( b  3  $ yG] c  9 R X *)`,pGdi cz  & @*)G c  ! Z 7G|c%c :,c'@$`"G/ 3c@c  Mc<1,"GI ZcX  $Sx()lGm <EH Xx(@G fcoc~c ccx((\4`Gc c(@G c cx(@G ccc ccc2<\D`G,kkn .@6wG5Z[q ^7(@GY(d]o |(_@6w hhi '7Th(@aqH]:Cj Fm|(@dHzhh#i fh$(@aq4H T8iAi 'T.T21\bH 0Z[q ^70x(@H JiSi\i einiHQ(YbH ui~i _ f 21\$bH0 uii _ f 21\4bHb uii _ f 21\DbH uii _ f 21\TbH$kkn ,@zHHZ[q ^7(@l H d]o |-@zH!H$ l/ x(@!HIdd d(@db!Hr$kkn ,@zH"HZ[q ^7(@"H d]o |-@zH(#H l/ x(@#Hdd d(@tb#HB(kkn T+@a,$HhZ[q ^7(@$H$d]o |.@aP%H l/ x(@%Hdd d(@b&H iii 6ii(@bW1&H/0ii 70<0x(@b<'HL\V"% VoV(@['Hj܊ ߊ(@'H3ii /i(@b(Hei j  j(@bL)H!jl -j@j()?1L*H EjQjZj FijrjHQX_b+H <EH X$(@L,H?58 6A (@?1-Hk :Cj Fm|$(@-HPf& ): (@?1$.H0Z[q ^70h)@q.H "% V5$(@@/H"2 ,4 (@/HG^^a (@/H|l/ `t)@qx0H*yjj jjj@H(b1H Zz dm(@q 2H9ijj 6mj)@b"2Hf jjj jj(@cqL3H58 )@"4H gek V5{e(@cq4H|l/ :)@"@5H  gek V5{e(@$cq5HMk #kC )@"6Hs ge6k V5{e(@4cqH7H|l/ :)@"7H geAk V5{e(@Dcq8H*23 6m)@"$9H- geLk V5{e(@Tcq9Hm|l/ :)@"\:H geWk V5{e(@dcq:H4 /)@";H bkik  ;1tc"H| (@?1?H \ rk{k kk21c?H*23 6i(@W1@H kkk kek$((c4AH"kҵ kk((W1BHP"% V2:)@BH{ Z[q ^7 $(@8CH"% V2:)@CH Z[q ^7 $(@TDH (l/ 6@_@HEH4| (@?1EHa"% V2:)@8qqq.r,rArmm`-Fx\H]rorvr3rr(,dH0r9 rdr,<t$,H rrrls8sCsL\dH30Osmsxssssld$,H` ssss t|0H b (@qHt't6t'QtjtqtC83-THGt5)-<A00-pH lttttu up-{|HEtu-<A00-p H_+u.u'dHx)@ȟH:O1u (@PH 4u@uSu0+)"XH b (@q4H] ҵXu(@H_uFW(H(Hfu%d(@dHEFmu)YjT41?1H8EFtu.Yjp61"@Hg N{u83Hx(@Hu<(@ĦHuFW(H(H s5ufCu)@/DHݪuuku"0.W1H9 uuur9v^vsv;XA2H"vx,?00, \Hvv*wF#xtxx<V H0y%y/yTymyxy4eeHyy yy(@ .H yyy;zjzyz$z"|H0 zzq{4}}}`0 KxH  4~~d13\",H- ~~~8[j"HO)aHx 9Eh:Ӏ؂"H jIj) ;=UH0=PJl(HCpHfׁCHZ3H,ށn$DWH+-9T]v|TzZ3HCۂ'hm;Ho"_p}ĂX"H  Cp, ?H9 f %;N^q(x.HkzQ60"0edI]̈5H?10Ilӈֈmiވl71$e0Is: vV5H?1I| zAJUe^(4eU"PI]fi{uH?hI12ډ8NzIYg(@DeW1@ I$<)@ I js)@l I$$<#)@ I=$+>IezBch Ig͊L؃?1|I01O`njЌt^"xIGhs|w\I)`$da|%IBbsCp1ȿ'IU '<?s(@)Ik z}KP"0*ISW,@ɑl,I$ %8 0c4 #t1IQ_cؑ\";Is֕ݕ8)(TeDI/3:L;CLaɑNI 0×,@ɑOI#ȗї՗>:CPC1deɑRI8ȗїbG:CPC1teɑUINP!PC1@.ɑXIbȗїD]:CPC1eɑp[Izȗїk:CPC1eɑT^I$șՙٙy+ZfL̽eɑ(bI$RZSMp$ɑm08tI @ʝΝQuee`.#ɑyI $4ɞڞHCzI)]v(8zq~I8 ҵ(@qIQ4)@4Ioǟҟ NhI.tI <EHXx(@I 4/(@ĂI۟Hkq(@e(I 4/x(@܅I 4/(@I   Ǡx(@e`I! Π٠2DexI9 ,00ITj!(J D"0eI"88EL0"0DIt2 700XI8Tah9R@."4I_ȡN (@b"@I #09$JQ (@.0I6EsZh)@̎Ifljmh)@xIXh)@XI|ch)@Ikh)@LI+Ȣˢh)@IX+h)@HIlJh)@Ibgh)@Ik2h)@Ah)@IEO`k*@61.8IuDãڣ(@,IߣJ$"0nh)@ؚI HK}Wh)@4<2DfI (bӬ̫4f|I9 $)FMܫ2DfIV >Q;1f It $yqs`+0gsTI \'"dI (\H tI \&'"I  *30u6(@qI  =(@qXIK  |X mS(@q8Iy  771(@qI  |߷ (@qI  .[ ^UP(@qtI  ĭ(@q@I+  4ɭ(@qIY  236A(@qI  ЭLLFQ(@q\I  vlEEE(@q0I  ٭(@q8I  b(@qI=  236A(@qIk  !'C(@qpI  4(@q$I  (@qI  0h(@qI  (@qIP zz(@q8IyE].300gI ҵ](@qIQ:`g00\I@S`d x$<P LIL CX\`+s<2xI(n `6Q\da@I(`25Я,1bI(`. DO8Lr{I2r}`X t"Il(°԰`]HMT0fbI |< !`%x(@I |< 5`)$(@I ux`-m}51IW `;wx(T($gI ıױ`HH5 x('XI  '`b-x(@I x4(`f$(@IN7Le`HNJ Iϲ`s413\ (I`CNY8DDc"Ia t`!I4ʹ<((\̔I(o`*:Dl$3 'F0 J (9`߹t_ 'FDJ[(Vj`̼;84 'FJ(X`5kV 'F,+J([6`E{H 'F;JB(`jl,X 'FHJ|(Q`(^(Y 'FHUJ(P^`*BQܻ r Y_J!B` (@q"Jc1`/I\a +dM4gJp h`<_Hf^c?JH`W"'Tf@DgJH.;F`_\cJTgJn`h,t(dgJEI` 8H "Jx^at`$(@J(&x`:F(0tgTJ b` (@q0J! vlE`E3(@qJe # qt`w(@qJEsm ((\@/JY n@H((J F72g"KB&GKw$4"Kw" ,?00h K @6<$ gK#03.*HPW" K\Sel?;D0g KKL^dЗr"4K_42g=pTK>  "0W1dK  02tK: $)<<\"@Kh^26$`(@"XK9BJIXX`/XK YT`8K1Ll8yT` "(K,;,00KXD} h31\XKxNY,X@K   f\53/!KM u '@""K t8H"#K  )oh5d4d"P'K !YJg r)K! (9=md-@+KW!0"$8gvv.K!( FJah,Hg9,0K!oi-@yr|2K" D[xt/6K"n{~u<1?17K"<Ld"AK_# *<@pH\duDCK#,mTh\ P"0K)T/x(@ԡK@)  /ITHQ@M 0\Ki)gp/(@W14K) t/p\K"LK) */ p\`N"K) "/]KR(D1@0+\K*_/S9NXhTh"KY*n/dh=pGV8gx21`0 Ku, F~00ĻK,7F!(H(K,F\)H(0K, N[)@hKA-$14N`EDK51h?1K- ߩRUNjd)g_x(@hpK-afN[n})@h K-N`51i?1KE. vaNjÕ x(@iKh.fN[n})@$iP"0K/X=UXa%4>P"04K/]fja@H(DK/>a*##K0 X aB6$(@KF0hAaF7~\ Kn15|aD[0 3K&2a;@H(0K`2>a300(K2xa4#09HK2Ta5<@"XK2`o0a6<0"hK2a7P"0xK3aQQp{0?1Km3XaW  TiDK3d a^JYdX~Ps؄DlK3 ݪ}apmc$(@K4 X=a,4<+@#@KB4 a291di#K4 X=a<4<+@#K4 aB91ti#@K4aN @ 5H?1LK15E N U aat   >l2'KZ5E N  ait   >l2X'tK5m  aq (!-!.('K5$@!M!P!aul!!LH,lK5jt!a!s.@'K 6jt!a!s.@'K66jt!a!s.@'(Ke6!!!a!""5H?1K61"C"G"a"""0qHK6=##a>2 .@'KJ7 ###a^7 )T(|?1hK7g##ad)g`(@K7_$#'#ad/#,@#K7X=6#a4,@#K8j#>#a^7F#,@#KD8M#V#c#a|##,@i#xKr8###a#)@?1K8$##a # $$\HivDK9$$$a# $\HvK+9&$/$2$a>$)@?1Lb9X=Y$a*4,)@=pPL9&$/$a$a0>$)@?1\L9m$v$y$a,$$$\)H(iL8$$$aQ$)g .@,L:$$$%aWI%j%y%D,Lm:$%%%afg&&&L, L:&&&a''')@ih L:#';'?'a'''T, i?1\LG; '''a.T9'\ho Lk;(*(A(a1(((H>< L;(((a]() )=11?L<))ay;:)@"<LS< #= )a}^7 )@"L<,&)4)R)ara***5,L< (+:8+aD+P[d(K\.L<M+_+r+a(++H>H0L=i ++a- ,,",(@ 181L+=l-,6,9,aU],,(TK;$3LR=,,ah^7,(>H3L=,,am^7,(>HD4L=W,,ar,,<H4L=Es,,av,4>Hh5L>8<,,a{,2H65LH>W,,a- -2Hi|6L>---a*-1-2HiH7L ?kO8-;-adE-2Hn<7LS?\VL-O-aV]-d-2Hin<T8L?\VL-k-aV]-d-2HjW18L!@kO8-y-adE-2Hn<`9LQ@U--a---(@jl:L@ ---a...\8H@1";L@%.2.9.aQ.b.m.l|$jX=L A Ut..a...KJ4j"t>LUAkO8-.adE-4>H>LA .a..@>H?LAkO8-.adE-2Hn< @LA./I/a///("CLTB:0G00aW111"xHLB12>2a222vKLB 33N3a3338Hd?1|OLB'4444a95t55Pd =ULTC # 56a F!6(6(@`1\VLC 76A6l6a666x{uteXLC 77V7a(7778H"t\LC /8<8{8a/89!9Xhmt`LUDf9q99a6999+($Z3eLGENX:c:aJ3Ha(@6 fLvEUcg:j:aL(@W1fLEUcg:n:aM(@K>fLEUcg:r:aN(@6dgLFUcg:v:aO(@W1gL> z:::aPd:(@"xhL}>U,:aQ (@(#hL? qTU:aR4(@XiL?qTU:aS4(@qiL:F\::aT(@q jLkF\::aU(@qjLF\::aV(@jLF\::aW(@v@kLG::aXlVo(@qkL5G::aYlVo(@qkLiG::aZlVo(@TlLG::a\lVo(@qlLG :::a^::;4S\[1nLG;!;$;adA;`;i;21Dj8oLSHhv;; <amw===`0 DzLH >>>a???"LH@*@o@a@A1Ae  LH |AAAaAAB{"pLSIB&B1BakBBBx{?1̋LI BBPCaPDDD6Le vLLI cEEEaq EP"P"\dLI cEEEa EP"P"\|LJEEa;0"0L=JEEFaFFF;1\1?1ԥLJ{FFaF7H"hLJ FFa$(@LJ|FFa00L KFFFa)G:GMGhp1L*KJ v `Ga-oGGL_KGGGa5GGGh[KTjXLKGGGa<GGt[J8LKGGa?HHt[J,L1L#HHaB"H3H(@6LeL8H;HaE?HPH81LL= kgjaHWHhH21LL;z_oHaKsHH21lL M;z_HaNsHH21n<DLDM kHaQHH21W1L{M;z_HaWsHH21n<LM kHaZHH21W1LM kHa]HH21K>LN\sHHa`HH(@6HLNN;z_HacsHHt[J LN$;z_HafsHHJ@ ,LN;z_HalsHH21n<иLN kHaoHH21W1L!O kHarHH21K>pLWO#HHau"H3H(@6(LO kHaxHH21W1LO\sHHa{IHX>HLO = kIa3IDI21"L6PKITIWIa}IIIԂdj"\LpPIIaI,9 21vLPXIIaII 21(#LP I@ IaJJ 21"L#Q I@ JaJJ 21$L_Q I@ $JaJJ 21XLQw#(Ja,JCJ 21qLQw#JJa,JCJ 21qL R I@ NJaJJ 21LERw#RJa,JCJ 21qL~Rw#VJa,JCJ 216t@DLZ23a66t,@LZa Ot,@L[WEHa)@lL@[TaT)@Lt[\V"%aV(@8L[܊aߊ(@6`L[WEHa)@L \TaT)@\L^d]*OXOas:O(@jL^AOaOaQO(@jW1L_d]oas(@+LG_a O(@n<TLz_d]*OjOas:O(@kL_AOsOaQO(@k6L_23a66t,@$L `a Ot,@\L@`23a66t,@Mt`a Ot,@8M`d]oas)@M`a O)@Ma l/a|O4*@M?a vvOaOO4*@MqaOOa^72 O(@$k8Mad]OOasg(@4kK>$MaOOa^72 O(@DkMbd]OOasg(@TkW1HM;bd]oas(@+Mlba O(@n<MbOOa^72 O(@dkMbd]OOasg(@tk68McOOa^72 O(@kM5cd]OOasg(@kW1\Mjcfy&oa;(@MMc^^aa(@vMcWOOa -(@kc>M dSPPaQ4P(@k(#, MDd -P%Pa.P1-(@k= M{d 5P>PEPaNPUP11k" Md &CjaF(@[T Md ܊aߊ(@| M$e\V\PcPaVlPd-(@k* MYesPzPaP11kq Me \V\PPaVd-(@l[, Me PPa^72 P(@l Me&PPaFP(@$l*@M/fOPPa P(@4lqMcf&PPaFP(@Dl?LMfOPPa P(@TlMf&PPaFP(@dl*XMfOPPa P(@tlqM5g &CjaF(@[dMhg ܊aߊ(@Mg&PPaFP(@lMMgOPQa P(@lvMhd]oa|)@=,M9h܊aߊ)@"TMph &CjaF(@=Mh ܊aߊ(@"MhWEHaQ+@EM iTaQT+@Z3MBi l/a.@)Mzi vvOa$QO.@mMikO+Q2QadW;Q(@l*XMi&BQIQaFRQ(@lqMjkO+QYQadW;Q(@l?\MPj&BQbQaFRQ(@lMjkO+QkQadW;Q(@l*`Mj&BQtQaFRQ(@lqMj &CjaF(@[hM&k ܊aߊ(@M]kkO+Q}QadW;Q(@m*Mk&BQQaFRQ(@mqMk QQQaRQ$(@$mpMkhQ^UPaQQ@DTM0l QQQaR'R.RKJ 2=Mel ARTRaqRRRS4P@2"MlX:CjaFm|@D`Ml Zzadm(@vMl :CjaFm|$(@d MmRoa})@?1 MAmd:CjaFm|$@D|!Mjm58a)@"8"MmRRRaRRRLS@M4mn<P#Mm RRRaR SS[[ Dm$M nC\ S$SaZ\ -S(@Tmq(%M6n?4SQa]lq(@`2%Mhn=Sa-(@2|&Mn :CjaFm|$(@'Mn l/a6*@m'Mn|a(@?1\(M%o |l/a:$(@)MVo aFS(@?1)MoKSXSSTTThЌ\r0M4ptTTT#USUt4dmެ1Mypt"U.U5U&P"02Mp] WU[U 4E(H(3MpYRfUjU@-@? 4MqvUUUU@-@?4MCqUU6U@-@?x5MnqUU6U@-@?6MqUU6U@-@?6MqWUUU@-@?\7MqWUUU@-@?7MrUU6U@-@?8M6rWUUU@-@?89M]rWUUU@-@?9MrYRfUV@-@?l:MrUV6U@-@?;Mrn)V"V.VAV@-(?;MrWUFVU@-@?MsWUvV;U@-@??MsVVVW&W5W|BM$tLWZWW-XXXP3 NMt XX?XX(@NMusYY+YW(@\OMKuY+Y3YMY^YeYl4t mPMu¿lYpY{|Y(@,QMuYYuY(@QM vYYc(@QMHvYYLY(@0RM~vYYYoY4YSMv|YZ-Z@MZjZwZS@Y4|7pVMvZZF͢002dWMvZZZ6ZZLYlK?XM wZ[[L[$[)[)T2"YMkw@4[F[Q[Zz[[[f\Mw0[[[c[#\(\XYT2q"^Mw41\]<^b/fSfS ̗ =pMI}hhhG"i.iEi  ԥM}`i4mif)yidY\Oq"LM}iiimii(@mM}iiiyijjpY|Y3HM+~ j&jo9j(@d|MMO~ FjMj~3HYjx(@ 3Mr~bjojvjjjj5H@3?1M~cjjVoj)@|M~jjjC6k]khkXF4|M~kkkkkk<p1m"M kkkl l 52m?1M>l!l$l6lQlXl 51m?1M]_lblllL1H|M}d]slvllL1HM_llllL1HM_llllL1H@M_ll llL1HضM ݪllmc$(@DM ll%m!xEx11$n"M $xLx>xEx114n"M $x]x>xEx11Dn"M܅Dnxwxxx11Tn"lMDnxxxx11dn"TM0 $xx>xEx11tn"DMZDnxxxx11n",MDnxxxx11n"Mwwxw11n"M׆ $xx>xEx11n"Mxyyy2y9y13n"M/Dnx@yxx11n"MX $xQy>xEx11n"MDnxbyxx11n"MDnxsyxx11o"MهDnxyxx11o"N58)@"dN1C\ SyZ\ -S(@$oqNU :CjFm|$(@|N|"%V2:`(@"N Z[q^7 $(@Nň l/6*@mDN|(@?1NWEHh)@NF \+.(@NpxyXY,XN&yX)@"pN^a X`(@"N* lyyX$^7C`nP"04oNegyX.d)g$(@"NyLyX7Fy)@"\ N݊^ayX?`(@"t NgyXId)g$(@" NZ yyXHQ(YDo( N yyXEՖyx(@To Nۋ "%XV5$(@ N Lz zXEnx(@3T N[ zXx(@doN z#z.zX9z>zx(@toNٌ "%XV5$(@N IzXx(@oHN\ vlEXEE(@qNRzgz[GzDRJNǍzwz[9zzRKN sKG z[Cö 21\NEz{{[ ~{{8)@\Np {{{[R{|$|)@o"XN ,|J|N|[qj||12g5 NɎ$|||[*}>}H}3tEoyt&N' l/[6*@m 'N]|[(@?1'NUMc(@"'N`}m}~}ckl}(@}")N- }Fb}c>~~~\"0oT+NU(~cZ00+xd+N ,~>~Q~cc~~~h"0df+x-Nz$hde~cn~~@J@o.Nܑcr(@.N9 FcP"0/N}*?Bc%G[0P"\0Nϒ`uxc4]@(\\2N cP"02NS cP"0<3N c)P"P"\4Nғ  cO *P"P"\L6N  /LPc'q((\48NǔcX0P"\؆t:N  cb0mG00},;NVd{cjƁсT}"=Nەcl-<A00 4p>N& <EHcXx(@,?Ne:CjcFm|(@?N  &cqQSg21ANc(@o`BNC ‚΂c*AFx(@DN qzcx(@o FNΗ ǃcEd҃x(@oFN ݃cEd҃x(@pGNT <EHcXx(@PHN <EHcXx(@HNј~ &0(,JNʊ+~$00\JN9t .~)00JNqt 1~.00JN |pQ4~300JN7IP~Un T+(~#TLN0~^70(@pLNUwE EƄ(@MN˄؄*5;(@D~PN N`[>n}(@RN؛ |pQN(@RN3D2F001@SN ƅ˅(@$pSN*@ԅȆ 210sV\NϦorh(@]N% "1<fl`NA(J\i*ڈ(@X5cN !%VHB14prjN8r + V:(@@4kN I_,)@` qN!P&En>IHJxN$ |Bl((@DpZ$yN͍wH11\{N*,VO;eĞ\lN ʏ׏~OpwKKg"N]  (@TgHN 9jBJ(@"̉Nxpk;[ (@0N&ag(@ȊN((lvHuI4(@5N~58(@t~xN$"0N>$$"0:GN ˑӑqH,mTpN Pf& !(@`4N,$"0L#NL,0=|ǓLHT 1ON GTc(@dpNm LFɔ(@NΔה$(@~N@9K(@ܟN, PGYTs(@NzƕՕ(@c$Nݕ !j2HDqܨN 5X G@TƖ(@N"͖ږQO exܡ$,#N ʗ"9A(@N\jݘ(@؇N#*">UbxttphNi{ u6чS NH004NÙؙGZ_t)@g4N(@ dN ,>|(@gNߛ6m|AH N&XɜΜ"(KKpN 5>BZ(@DhNҝܝ",5KKp#J(@q N H(@qPN Fbon(@qN R_b."̓DXN34Sb6X@H(lN 9j_b<J(@"Npk;fb@ (@TNH&lbDg(@NkOrbHdx(@lN }bLS(@qNw(ΊʢbX,4 (@5xN$Ңb^$"0:GN0֢bd$"0L#N,ڢbbj8m@1OUbxt$qO 5`b>(@q@ O>Eq4(@vT OJOSq@ )@ OJO]qG )@d OgjpqNF)@ OJzqTŤDm ($4q O n X qQ (@"Or|̤q`OJ"O)|pQql(@Ojˉqp+00O0(Iquet0P"\OWyq (@DqhO  i$ qeҥ(@q`OEGۥq m SPm@O X=-4q*q1 ?(@TqO X=-Fq6q1 ?(@dqOO\{qE 21 vtOAqQʧܧLx|Pg O' 4APqdk114Okh |qvLzO$bըq00vdO$7q00v O0xq+(x. On ҵq(@q!O  q21tq#O MMvHq(@q$O3 ҵҵq(@q$Oo'.&=B"04%OM- )(\q*O@ &4!o{|$؈-O 3Ǫx(@x.O23̪5(@"/O2 ѪcHi4@4p1Ou x|O"01OzQ(@"2OU"Z$"0 2O>>‰&[$"002O |pQ*\P"0L2O x|.]"0l2O U2c$"0|2OV>‰6d$"02O |pQ:eP"02O x|(f"02O3 K l>niDP,X3O} x|Mr"03O |pQQyP"04O x|U}"0$4OU>‰Y~$"044OU]$"0D4O h'7A(@q 5O* ajGTm(@qH6Ok ~j tmSx(@4(7O *236mx(@7O,pA\ p gFO(zɌ". JyrKOkyԱ )(@q`UOز̴մ(@h _O5(@XtaO(@aOC "Fy_vdlK2fO(kX6  JyrHhOķз!>Ҹٸ(@؉qlO (*NvRk@DdyqOPҺ5*EK(@qtO(=x'4Jyr`wO ػ^dt52{O(ȼ˼(e4Jyr|OY1CV[(@ 5q~O|6(@@58OFXzIݾ@61O&  1>M j12q2Oe (9\Hyr܇O ӿ (@qq,O ( 1@tqyO) (/4JyrOj O!(@qq|O 0AT"(6H`5?1DO) (6G\syrOk w(@qO    m"pO ,X(\$xO+ (4Yp'TuܪO= ,*N7NQbl2S8O 0iv}Z \OqxO ,ll2STO0!6zd<$|5S,O(I7 < '7xW@yrO+$"0qOq0-flR@2O'0a)z"(Ool]%(@5"O00IQ"8O# 11"POUܗ?1lOQ*; Snu71q?1O |)(\57O( VxW@yr`OU$"0qtO* HxWLfO  JlKq2,OG(9\Hyr(O (@rqxO 0Hc1152O( !\Hyr,ONDE)(@6qtO(6C\ryP(U$RU$bn\Hyr$Pu0 (@$rqtPX dt2| P("5J?@\ 6yrP PN>]c(@qP+ J8R@62TPg(09<!O4JyrP7Ve)z(@4rqP(4JyrP/Y$"0qPu(4JyrHPY$"0q\P(I7  '7xW@yr$P<)$"0q8Py¿zv  00P$& %rX=XP(Ybe9s ~\Hyr( P,I](@qd$Pp 1M j12Dr2%P(9\Hyr&P (@Trq'PL(/LWPL@`62*PD.2dr,P 091162\/P$(@6q1PD((\Hyr2P "=1162@5P( \Hyrp6PD((@6q8Pa(L}\ $ y@P(=KSY \O7yrBPv"=C(@hqEPQ'JP(@IP@61trLP( 6C\ryNP!(U$/U$bn\HyrtPPh20 (@rqQPGTW`iz72yrRP ujI| , hP @m yr8pP!$!rP$yP`!<b! @d$ qP!,~lW@rP"" 7H?1Pz"(9< T;<\?1P" _lp. ]L P#87Ud 4D"Pc#0#@Perr-bxP#v }00ȨP$O (H(PS$ =7H 7dP$(8D71PP$$OY]d 71P*% b@!72ĻP^%$..../ /@*@t@P%()/27/3c/s/|/8P&6?R*@@74P0&&*@*@PX& }72 P& 11(@qtP& 11(@qP' V_bep(@qPO' pEmHm(@qP' XNli"(@qP' )3:7(@q|P(?PSl$"0P;(DRLzOZ MP(.H?P( H5(@q$P) vlEEE(@qP%)< M,v@'DPR)h|pQ .Vm0D`P)$|pQ.l\"01|P)(|pQ.`+0)cP)|pQ.P0kP'*||pQ.tI0kP[*,|pQ.>(0P*,|pQ.T(0P*\|pQ.k\G0k$P +d|pQ.<0k@P>+|pQ."0\Pn+4|pQ.'0xP+ |pQ.P"0P+X|pQ.@F0kP,$|pQ.\"09P9, |pQ.)h"0"Pi,|pQ.?#0 GP,kn.kT%@ HP,0|pQ.)0ddP-|pQ."0"P@-|pQ.#0Pu-|pQ.2"0"P- .0P"P"\HP-^58. $(@`P. 0Z[q.^70x(@PW. 0Z[q.^70x(@P. 0Z[q.^70x(@P. 0Z[q.^70x(@P. 0Z[q.^70x(@0P5/ 0Z[q.^70x(@Px/ 0Z[q.^70x(@PP/ 0Z[q.^70x(@P/ 0Z[q.^70x(@pP$0 0Z[q.^70x(@PW0 0Z[q.^70x(@P0 0Z[q.^70x(@ P0 0Z[q.^70x(@P0 0Z[q.^70x(@@P.1 0Z[q.^70x(@Pa1 0Z[q.^70x(@`P1 <HO.Xglx(Lr8P1 0Z[q.^70x(@P2 "%.V5x(@TP?2 0Z[q.^70x(@P~2 0Z[q.^70x(@tP2 0Z[q.^70x(@P2 EEH.(@qP#3 s .Q(@q@P]3 s .Q(@qP3 w.H5(@q$P3 B }.(@qxP4 &\ 58.(@q4P@4 pEmHm.(@q Pw4 kkn.(@qdP4 ַ |.(@qP4 EEH.(@qP5 V_b.ep(@qPI5 ַ |.߷ (@qXQ5  .6(@qQ5 XNl.i"(@qQ5 Ybe. h(@qQ*6 vlE.EE(@qtQc64lV00rQ64P(@<Q6,4(@ :GL Q784Z>mvlK`7he`Q-8pk4 (@Qy84g(@\Q8(4(@r5 Qa9 U4(@rHQ9 | 4(@dQ94D]b(@Q';$471(@h:G,Q[<4^x 21L#Q=$4u(@h :Gt!Q> w4/6(@؊`"Qf? IRY4@l(11ԁ#Q@ 44(@sL#P&Q@G4*3PJs'Q)A(:=4DS00P(QgAXad4&s(@()QAx40(@+QA4J5H(@ -Q5B kOV4\p(@$s.Q? |h 4l(@/Q{B 4;(@7/QB&Cj4F00T0QC w5+4 (@q1QOC 4(@q4QC 4(@q5QCX=O&4>P"0$6QDoO;:(@6Q_DO,9(@7QD(53O6(@57QD O,9(@,8Q8E\#O lVo(@8QE$H!O$(@:G$9QE%(O(V(@L#9QF ݪ/O0(@:QnF ݪ6O<mc(@:QF ;O;:(@;Q G@O,9(@x;QXG(5EHO6(@5QH,6lO/8m@1O>Q(I ݪsvO7(@,?QyI ݪs}OCmc(@?QIORq((\\BQJOzl ((\CQUJ +.OV](@4sEQJ,dO[gr2H7NQKO2(@OQK O+(@PQLO,00PQgL  O;=NW`K@MSQMpy|O($"0TQM | O(@,TQ3NtO(@`TQN 1O=(@TQNOD(@UQ2OOP(@VQO$ /3O\h$ \m\ZQOs|OA((\v[Q=POT)@l$\QP 9 Oi܊  (@D `QQ   O    `K@MDsbQR > R O/   `K@MTshQ>S   OV5 G P `K@MdskQS] v z O{p (@nQS   O  11\#oQDT  . O3   514DrQoU$   Om) > G 1tsEGuQU R _ b Ot   21vQ(V   O  (@swQV   O71%(@syQV2KOOqxNT#8|QCWOh)@X~QW 2WZOP"P"\QWO0(1x$dQY<0O}(]@]|X]\Q Z)PO!95\,-<A00@8p-R`556D"6;6D6`KM`8p0Rk]5O6F-<A008p1R҃_6q66R666`KM3R6]56T-<A008p4R 77%7fE7X7_7383t6R]5r7h-<A008p7RT 77718;8`8sМ8Z$>Rp8y88e888 22 @RgFL979no999 22XBR 99xV(@sBR  6> 99}I499(@tCRc99 :(@9(DR$:6:F:p:::`KM 9dGR::-<A00@9pHRu t:::(@t1k1p1(@9q~R(@f;s;;R<f<{<W{ȃRdH<<=8===xs|{R(Q>>0s3(Rʑ">0>8>.>>>G2tt?1R$> >U>> J3HR0NH>\f>HwR-O>>>S00R`$?k? *?9?D @M1PR<B?N?]?'??hm@ttR n?,s/@/R0(??04T?(@tpR“N??I?(@t(RWD???M3@D@I@HtėR nT@Xs/@/XR\@m@~@((\R+@@'@@PshRi@@@9A/A>A98RՕD KAN$"0HR{OARAOɊ(@R>VAYAP$"0Rl@Th]AR(U7UlH{`RH>UyA|A^iUxUH{RDAAAFHBBBpT`X$}$RTBBBiFCyCCH`$}R<CCC'DBDMDh|Tt$}Re3 TDWDwDD('TxRΊ D,h)@hRDDDDD$"RR EE*EE@EGE4S4PtXRVE57 cEC3H(@uRmE EEEJtmudR+(EEKF(GdGG0L1DRTGGG3Gȕ)(RHHH<7HTH]HQmt?1R4dHqHGI4H$(@vRHXHQHHLPsuRHHHapH%IL7R-2IKIaI}IIIT p] RНI JJOJaJqJ tu Rn|JXJJJ(\)RJJJKL*LhT$jPR{LLLMMMTtj8R LNYN]N*qNNz rRVN,Y N8NN(@R5X NNJ OO#O(@u8RN1*O\2Oh)@R1;Oc2Oh)@RW1 COjQOh)@hR7`OcOtkOh)@R1tO{2Oh)@RТW1 |OQOh)@RW1 OQOh)@(RkOSOOOh)(XRlOOP/PFPKP%x:RbPoPxPPPPHNTuDRxPuh"0?1XRPPh"0?1lR PP"0|R+ |?F$(@Rl |?< $(@R PP\"0Z3R PR\"0Z3R9 P!\"0Z3R{,PPPPPQ,<\$uHOR0 Q8Q/+QS(~XXXKXYYt ]X n<!Sd>YcYYXZdZwZ ]\j?1(SZZZyUZ0@L*S$ZZZ[%L?1p,S8$[*[.[+s A[K\?1@.S,L[p[[7[[[,%\@:?1,1SϯX=[\4f \00du1S\\"\_\\\ 2p186SL \\\~\\\ 21tu8S ]]#]5]H] ,@u r9S U]_]d]v]]m81@S]]]]]mX\@SױN^^?(@uBS)P.^@^E^k^~^@%O^sDSmP^^^___|X^s8PS<```'J`O`hm@uRS/V`c`g`"}``L$`SS``.(@SS~```>aEaTa 21D,XS"sa~aaSaaa(MTuDZSj`af(@XZS nCFajs/@/ZS nCFans/@/[SL b (@q\\S >s(@q4]Sҵ LLF (@q]S V_bea(@q^S^ vlEEE(@q_S aa bg!?bDbx(@upaS_bebJmbA00(bS$jbJbbb('utcSm,bbbJccc1tekNk]kJwkkkl|`:yrSkkk:"l=lDl21̛pSnelnllgmLmQmP"0 Smmm_nn11dk2@S~DnMnPn"anrn(@?1`SynnnCFnnh)@Tv2$SnnnI3Hn(@?1S nnnCnyn)@dvZ3dS nnoLnyn)@tvZ34SH nnoUnyn)@vZ3S} !o.o6o]FoWo\o$(@vS colopofooC1Soov00XS^^a1(@pS ^^a1(@S20"%V2:8d@S] Z[q^7 $(@S0"%V2:8d@0S Z[q^7 $(@S||pQoU(@ܡSD4R"@" SJ "!'k)@Z3HS~D4R"@" S "!'k)@Z3SD4R"@" hS! "!'k)@Z3 SZ||pQoU(@@kxfā1:S сf*"0"S@ԁf800S ׁf9"0"SR ځf1JRh31\؏$Scptf;"2 LS$(48f#e"2,/SCTXfQn#y#h)@XS]4nfcÃxXS$" f.GL(@XT) YkpfɄ҄3vT ݄f1RY 2ܿ:Tly~fڅ`q(P4 TR ffnvw,Tf@mdžt8Hq TΆfJph8Lvq T<Ňf.]ܤ<\(T.mw|f(\)vlTf9 2!T@IMfd}(\)wQ\"Tfĉˉ(@;x#T$։f0ow(@ ;'T f͊(@@;)T  |afaP"0)TD ƋfT>̑< L, 8T {͎f׎008T ܎f;8uY(QJ JT<?fR;G @H(KT+I\f>דHPLMTs*3fA-<A00`;pNT([Df<4f00OTxTH[ff (dtQT@*˔f-<A00;pRT~ >ܔfV (@,ST 0=Df]Vej(@whTTqfeі(@l` XT>K^fӗ$w \T<f;G @H(\T@0ff Bai hPcTi". f,?00cTg*fn#ۙh)@4eTfڛ g$ dkTPaf#4]`8=@MyTTٞ&fYn PeMDT lxfۡ1X"TT!*f^7?D004wTT Mf(^ǣP x MTU!f+^7?D00DwLT`04f{ؤi$ GT f>g|VT?H˧f,y˨  ؼT(%fv@;udT %2SfڪHZ;"TOPqf/>hLsTTDGfŭ,kT8MZf}Hǯ,gȿvT@ Jf0@xT$58fH5L(6H6$TSf|fDTw0TG"V-+f ?NW2\5;q Tdqtf'@dwq@TfP ̲Ѳ'@twqT@زf3 !('@<qTw1F`fMч(@ą6$Tȳfg&+'@ <qpT Y>Ef{Ujsd1H@<"@T u~f^7d1H"T9 vfĴd1H`<"ThϴҴfAHBT jw fC(@TT 2=f jwq0UD". f,?00( U<f00 U̶ٶܶf F)@U f Nu(LDq U2}f= 8g(Z<q<U>Nf[ z0<qUȸfy [`Kf |Udܹf '8Gh)(\<UV˺f 6 . (Uf {|wv,UZf. )Pe 2Ufv Jq l7URf '3@DgPg;U,Wi~f  $D=UXf 8hqHl)h@Uf  l`pJĮ 6$|EU 4GQf& Xlؐ"dJUf |L\gTDMULf =THHMRU1hkf lVow(@w`RUhf :HwRUd]{f  ;HwBSU af (@OTf`.@U5  f7-DK 283U n5_f?-<A00@=p|U  0wfCX\M`='"U* n!fE-<A00=phUl PfYp tc U 8f9^\0PU( u~fX-@BU] f7@g^ؒBU  IQ`f~(@U  f-@I14Ui,fyf@w`qXU'nf-<A00=pUknf-<A00=pPU |f(@lU fe|(\)|Un$f (\)xU |f(@U7f1(@xL#lU 8EJf$(\)="U: f.$(@"UsT5BPf8\X$}V fI4 %+@$x $V ,59f+@ $V8?_f}0$ sV8-f/ <Hx V("fRY,x$ wD2V]lf 4x#d4Vl)-f3J4lD5VpOhf@ZXZ>,:V H,fE@ GVH7IMfKcvIVGPfUJV@f`L\'lMV@:hf|[pZZl'XV ,+fnt4_VH(4QfnDDfVt#Ff14ؓV0lV-FjfF$XsVBNRf^x072uV@Tfu 3oleyVBglf|VTfw,oHo<fhVtDfB\ tVJ fxTTqV8 f"$Vo f"0"4V 0HfvTdTx"Vft=pԷV 4 fU@>VNf-<A00`>p@Vf6WdLX3qVPf-<A00>pV Lf&,383>Vf(-<A00>pV6  f8"0"Vz  f:"0"V  | fM(@V  #=fTDm?1V`!ҌfY00TV! 8  f < [ H=`t/ ?1V"|  f6|00dx \VV"   f  =83?1V"Ҍ f00V" @  f Ehdt|4 ?1V"| fT6|00tx hV3#f-<A00>p Vs#fd->G`KQxV# R\vfs(@lVY$<E_fĕsmV$fDU^5H?V$aqfĕsmV%27fev})@xVc% pfD83 ?7V%f-<A00@?pV% ,fQhqEH4nZ3V"& fd1Hn"V_&fNWrS_#V& {f"0" V& fgpJx"PVl' {f"0"`V' fgpJx"VD( {f"0"V(  f+V](@x" W)4er~f/ZZ`?W)#;CfImԕ~xlWl*0fb KW* fkd D,@W*"fp(@4 W*$fx&/gJxc, W.+ 6=fTG$(@x\ W]+ |] Nf$(@x W+ R^af2|27h$ W+lfB )@G4$ W+fF (@ W,e fJx(@ WO, fN(`=|y/W,"!fO,?00(W,e%(fn2(@W -(9<fBh,`L(W5- |fV(@DWg-8f]oq?1W-Ҍfb00W- 0fkrx= ?1<"Wr.|f6|00y "W.fm-<A00?p#W.$f,3x72 %W/Jtf$0841n*W/ Wmf85MZVlKܞ#p/W0 f]T2HD0W0fg@611W1  fqH _ j 2Hؔ4WK1   f$!;!L!f_\ 7Wz1}!!!f!!! 219W1 "-""f#$$L\\ CW1$$$f$$$(@XCW(2 $$%f$?%R%Y%(@`EWb2l%}%%f1%!&.&(AHlqHW2 U&f&o&fQ&&&D83?dJW2&fS-<A00?pKW3 &&fvQhqEH$oZ3DLWY3 &&'f>'W'`'d1Hto"MW3 y'''f4(K(V(d1H0 "QW3 (((f))*d1H0 "WW4 z***f+,+7+h;H@x"ZWK4 j+w++f+++h;HL"\W4| f$"0]W4x, ,fP"04]W4,,f;;P ,p*@$y"]WN5 $,',fV3,$(@4y(^W5 r :,f3HF,$(@Dy^W6|M,P,fX,i,(0@2d_W&6dp,},,fM---T?tfW6"--f,?00, fW6"--f,?000 \gW%7---f#.!.`qL#TiWR7"-..f$,?00iW72.?.C.f6.. 2lW7...fM (.tgM"nW{5 -/f^,9$(@oW7 //5/fe///Td6D <==f=3=Lq-r8WF>"->=f,?00< W>@B=a=k=f= >>̄tyB|W>"-)>f,?00< W?@->L>f>f?>>>doWL?"- ?f@,?00< W? ?f??f@@@)@ "W?3A6AfEAVAHQhI@W?,DaAsAAf!AAA 2,@ԇ'xWB@AAf#-<A00 @p@W@|f$"0\W@Rf00lW@!f00|W'AxAAfP"0WWA Af+,4 ,)@WA AAf.#y(@dWA Af/,4 X-@BWB(AB$BfF|BBB@yLWlBBBfc;D"0#HWBp BCf]NCeCnCH :W&CBCfV;D"0#WQCp BCfPNCeCnCH :,4WB xCCfl7V(@yTW|C.CCftFO(@?1WC.CCf}FO(@?1\WC.CCfFO(@?1WC pkCCf(@DW,D pkCDf(@W\D pkCDf $(@ WDBDf;:)@WDBDf;:)@WD9d DflVo(@q`W6E pkC(Df(@WlExA0Df#y(@WE$j8D;Df)@WE ADNDQDfi_D (@WF fDiDf2:)@Z38WCF fDoDf2:)@Z3WyF HuDxDfDD)@Z3WF ODDfD(@" WF|D f$"0(WG06DDf*DD1LPWBGD E.Ef@EE FT@@WG /F8F@Ff\rFFFyhWGF#if=(@WMH Y FFfTFF)H(WH Y FFfKFF)H(TWHF#if=(@WI Y FFfCFF)H(|WTIFFFfe G=GFGR|VWIcGpGGfpGGGJ|Vؖ"TWIFFHf{ G=GFGR|VWIcGpGFHfGGGJ|VX",X-JcGpG|HfGGGJ|V"XfJHHHfH IIh)@XJ I)IEIfyIII(@`@q`XKIIIfJ0J;JSg\4 XRKJJ[J_JfmwJ1Hq XK~JJJfEJ1Hq XKJJJfK0K;KSg\dXLJK[K_Kf*uK8HXNLJK[K|Kf5uK8HXLKKKf@KK(@@qXL XN LLfJiL(@"XM#L0LfVHLaLhL 283@X:MsLLfX-<A00@pX{MLLLf3L M461dXMHM*M?Mf^{MMML`@XM4MMMfpeMg@XN|MQfz(@X;NM NNftNNNoy$XgNMNNftNNNoyL,XN5OCOHOfkOOww.XNr|OOfOOOH$2A$0XNтOOfYKhK00x0XNOPPf P'PpYJq"1X+Os0P8Pf"EPNVP@H(y@2XbOOP]Pf*P'PpYJq"P3XOs0PlPf,EPNVP@H(y4XO(yPPPf4PP)@ A"H5XO PPQfBYQoQQ :XPQQQfKlsQ@H(y:XFPQQQfSH5QR@61z3RfqJR11>XP6SRWRfL6[600l@XPRRRf(RRw؈AX"Q7VRRf+R~ R@'zBXUQRRRf3RRw؈CXQ7VRSf6R~ R@'$zDXQS SNSf>SSH1ĈdHXQSSTfQTTU4H"QX3R5UAU\Uf^UUU`ؗSX\RHUU`fb`y``K`X0X ```f``3BX^X```f00pXXp```fa:aAa 283AXX\Laf-<A00ApXY ]apaafb`b{b`"X3YbbfF600D @XiYbbf^7bb11TzЙXY bbcficccvpX"XYj+ccf-cc((TXZ@c)dXdf3dAe^e\ XZ\eff-<A00Bp(XZ@eeefe*f=جX6["_Aff,?00< LX|[Efdf}fffff\lp?1X[ggfVq00X\@g(g3gfSgfgog|0GP BdXD\(zgggfggg|q@B'Xw\\gf-<A00`Bp0X\($hh hf4hGhNh83BxlX\\Yhf-<A00BpX&]jhshhfhhhg^_`Xc]rhhf i%i.iH^ؘQlX]<?iQi]if{iiipB7PX]\if-<A00BpX(^iiif!j6jAj`K4YxX^^$Rj_jjf,jk+k$$,/X^ yLkwkfEkkl`4XXC_ 3l(@qXc UUw(@$XVc Ful/fۍ (@qXcl< lwll(6H#XVd lllwmmm=HT1 =\X i=nFnJnw^nonvn6D3 dz|Xj }nnnwnƅ(@Xvkئ nnwCC`(@#X@ll< nwPll(6H#X m nnnwZdoooxZ8=|XmoowAFoZX\@Xn6> oowI4o-@#4Xko oooww,?00h YKzvv wwshwww ` YzwwwwIx';xx,"HYzJxTxYxw"xxxKKzY{Dxxxw"xyyDZzPY ,y6y;yw"jyyyZ(Mz{\Y8 Ful/fۍ (@qYf ҵfy(@qY --f(@qHYÀ kknf(@qY yI f)y(@q!Y) Lf]y(@qd"YS UUf(@"Y-yw(@z"Y-yw(@{8#Y-yw(@{#Y  yyyf=zzz7HC*Y(zzzfG{S{710Y$^{h{m{fs {713Ya {{{fZ7|728YH$.D|.f./ /@*@;Y(I|S|X|f3|||8=Y|||fg!}}*@ C?YQ'}+}f&s R@*@\AYt R}`}e}fx'}72CYO,32}Q2f222X@C6JY}}}f}$~*~(\)5MYf,G~a~f~f~~ X`C6SY"*/fo(\)5HWY f*<YdD`CEZYqufE(@ZY2y}wx(@[Y^w#(@${[Y_wd)@TD\Y wA^7 x(@\Y H wyĀ21\4{]YJˀҀf^7 ۀ'@D{0^Y{ ~f|$(@T{^Yˀf^7 ۀ'@d{T_Y ~f|$(@t{_Y f^72 O)@{=px`YR ~"fsg(@{" aY&CjfF)@=paY ܊fߊ(@"aYD+EHfQg@TbY&@TfQTZ@bY]&7BfFS(@CcYO`gf t(@CcY֞#fC,EHCXdYfƁ8E1DBeYW\sӁځfDH D>eYfF41@DfYȟ&CjfF(@z"gY ܊fߊ(@DgY=$'3<fGN2{,/xhYy^U^fm(@{hYgpfyT41{?1iYݠxf(@{iY xf7V(@{jYV(Â̂؂f)\)`D?$hlY$-6Hfp3H2DnYǡ lf˃(@DQloYlԃ݃f(@DL#pY4\V"%fVoV(@?$pYs܊fߊ(@pYx f(@{?$pY x%f.(@| qY" [ y&of;o$(@"qYU [ y&of;o$(@"rY("%fV2:^@rY Z[qf^7 $(@ sYأd5fAXhO`tYH]wfihOuY3<4fR"h@XvYd "!'fk)@Z3wYP^UPf@wYŤ4ҵfh@xY 0Z[qf^70x(@lyY) Rof}$(@zY^ 0Z[qf^70x(@zY:CjfFm|(@{Yƥ:CjfFm|(@{Y Rof}$(@,|Y-y&of;4-@||Yl,zfdW(@(}Y"%fV2:P,@1}Y٦ Z[qf^7 $(@D~Y"%fV2:P,@1~Y6 Z[qf^7 $(@`Yh,P 58fh@Y$fP@?1܀Yǧ(4fR" Z@Y "!'fk)@Z3HY,(4fR" Z@Ya "!'fk)@Z3Y(4fR" Z@hYϨ "!'fk)@Z3 Y,P 58fp (h@c܅Y5$fu[@YeL"%fV2:@(Y Z[qf^7 $(@YL"%fV2:@DY Z[qf^7 $(@ԈYdP 58f@dYC$fP@?1PYr`4fR"@dY "!'fk)@Z3YӪPEof|@dPYsPf&f(@qY8`4fR"@dYk "!'fk)@Z3TY`4fR"@dYի "!'fk)@Z3Y TYEHf@\Y; fQ\dh)@YmplEfE [ @dБY0>fP@+YάdP 58fp @ddY$fu[@$Y' 0Z[qf^70x(@Yca23fS<00RXYfȄτ11DYխ23fS<00+xY P 58f ,)@dY@܄fq000|Yf00Y, /fB00EXYi \V"%fVQ"0Y^V_f#00$|Y \V"%fVQ"0Y( hfs00Yh&CjfF600,YkOfdOO004|Yd]ofeD"0@Y{bfÅ00 EY\"2f,?00Y kknw(@ОYܱ  w(@pY ҵfXu(@XY΅߅e11\Y. " $ >G2Hؙ"8Y kO^e,dp(@D|YIw_!x(@@EYɆ_),$9(YߴANu_/Çχۇ`K@MdpY, +_<N8LyD\Ywň`ш_)H(Y4_'L\`EطY1ۉ_ErlE=pYw_]D|Y׋_dv|EY2_ʌ(@E,Y_' fm(@p?1tYՍ_.LZHE",Y0o_ڎ1<\g58Yp !<))T|Y UCLV(@FY_fq(@d|?1dY? X=x4(@t|Y #)(|Z3Yֹ_'q(@|?1 Y OʏՏ+$(@ FY^ X=x04(@|Y 8)(|Z3Y <2:)@Z3@YA |pQ44h"0\Yx |pQOh"0xY|pQi#0gGY|pQ}#0gGY% 0Z[q^70x(@@Y_ 0Z[q^70x(@Y 0Z[q^70x(@`Yؼ 0Z[q^70x(@Y vlEEE(@qYP .[ ^UP"(@qY .[ ^UP"(@qYǽ   1 H1YX=< ? 4>P"0Y'8G Cfoie@F"YD&Y "F#F600XlYҙ  1 ƚ PhXq r,Yݾݚ E 8 i`FxY< ě * 6 AH?,Ym vlEEE(@qY )ry&o; (@q|Y׿~?T00Y{*H3Z !/vS((\ZJ4{ ȓ_,d@|?1Z4!>n K|?1Z4I͔  J?1!Z90: 1ct23|$Zh} L_FHh%@,Z ^4g=$(@X,ZLBDTx2H\3Z  NК2Hth9Z,eC~&̛X@5Ze ^ ^ ^ =^ ^ 00|,?Z^ *_ E_ U_ _ _ (@"CZ^ *_ ` _ _ _ (@Ԋ0Pj 6,XZ 4L Ȃ x(@FYZ Ղ ނ O   (@}"ZZƒ   ˄ RJd"PaZ 5 9 "r ʆ i8R @mZ| ! ; ? i ̈ 4D=pwZ{  q| | (@"{Z{ |$"0`|Zq} !E} (@}ZE vlEEE(@q~Zo O V _ f 21\$}Z5Tv ?T00Z{  ̊ @H(hZ Ԋ    12FtZ\ v DȌ ׌ N4PĈZ *3HF,(@4}4Z  ,+<A$(@D}|ZpH4Y; B vNJ?1XZ TJ,9$(@̌ZtNJ?1ZŜ|^72 ؜((\F(ZDx~00|Z &jF% $(@Z |J+ '$(@Z H(f2<\Z7 BS 4^@Z/AIxgn@\UT}ȕZ(u/Ng< Zڠ&+4<1Fq"Z \48(@qHZT @^ *?  TZly 283GZ¢΢-<A00 Gp(Z\ޢ  H@GqPZF>fl0zqZzǤ٤Gl$8|dEZ4"9=H,?00Z~XAKxgzHsd}?1HZ ƥ.CZ8`G)kTZ)rSW;00дZ@[tʦ4 @ ZN !5kx`x_Z&F600t}` $Z 4,<}Z"AcRɩ٩hċGqZfT;v00},lZ "+DtoL\$qxZ: #êu^7 ͪh)@G"Zx ֪ݪ~3HF,$(@}xZ %8? 283$ZNW-<A00GpZ*gt 283GZgN-<A00GpZ `ƫ"Ǭl\LoZ1f;v00},tZ /7ʭ߭D$q,ZH ,3HDE}ZEf:;v00},Z DQU;}@hJ`Z ?SjTd\Z  :;V(@$ZE n#ѯ51\Zuzܯ$(@"Z)*\|Z7DH!U)(\Z^bg)"0Z5\VưʰVKb (@ZuEհٰ&(6H?1Z,(@Z':6:^H"Z(tx7H?1Z]"C7H?1@Z('/e<X [˵ݵloT?1[(,6.x!`o} [4vCǶڶ7H}?1 [k     ~?1 [ ݪ#'%mc$(@\[ c,0d x((\[  |3w$(@ [?T7˷5"tƹ{#4#[N+c 4\q@'[}$d/[1P[Lh[~"2[Ǽټ#2GTTqx5[&(o5qE =[U0 +d\ 0A[ÿ,TwXeXhdF[60E +K[ ݐ   dhQTM[&$+48)WlphQ,N[_,w*4Kؚ0P[,lA7,(KD0xX[K^;O00$~d X['/:Kf004~h X[6B9-<A00 HpDY[)4Qc DD2 Vtc[  8U^xD~=pe[eo (@T~=pf[}#@d~m[v/?th32p[ Mx(@p['QQ0Tk q$v[-6D{^u?1x[ T41t~?1${[5H|('?14[-Oa(M8@k qh[ l^7$(@[&u (T(~ [gli/6(T(~ [ =O]#z2̽"[ 0=Oh@ؐ[# ϳ[t )@Z3p[f ϳ_t )@Z3[0HQJ[7A(@0[ .L HFtx(@[N )(@$[~#.8HW^(@~ܖ[Pev|h_~'qD[",?00l [8 @t=|qȜ[I\Il= q[X/O.;`@H[fLV2;v00~,d[`mq i{H:d[fL!;v00~,[^T8h~L[O P00~p ԩ[^fL;v00,P[ 0%:DRz["T,?00h [4$%D\R  [D.7EIEX_*@`HB[TjnSx2HqT[hc 4| q\[p0*H'4[ `t ["$1=[pu4<1Hq"[nÿ,TwXeXh[~`$Sq,[)r;00[pk(@q [y )AXcHW1[valx1@H(H[ d8:83X"[1:-<A00Hp8[~ "/EFi:83q"[ H-<A00Ipt[] U$(@ I([ "Z(@D[~",_BS\Hs4?1[ "gg(@t[`~"ylBS\HsD?1[4283?1L[W-<A00@Ip[8 4t"[cI>Vk=Dr?1@[w('T?1T[ ݪ/mc(@[ (@d?1[ r 3HF,(@t[6*1mbp?(@?1[ r F3H$(@d[ r L3Ha(@[ r T3Ha(@D[n ϳ\t )@Z3[ ϳbt )@Z3t[ ϳht )@Z3 [1n|'Aa@2q<[u6]3<@2`Iq[S@0X|=ܲ T\ÿ,TwXeXh4\ "<CJJ?1 \h NNY"0t\NNRYh"0?1\NNUYh"0?1\ NNXY\"0Z3p\9 NN[Y\"0Z3\v NN^Y\"0Z3\ ak3HF,$(@\ at 3HF,$(@\# }Zd\  l^7$(@\Ef\ TQT)@Z3>\F T?(α?\ i5)(Z3t@\ T?($αLA\ i5)(4Z3(B\b @xh@JӪHB\ U!V(@ JlB\ T4v ,@α C\A ܊ߊ (@HC\ LS,3Q <<@DαC\ "CJ66S)@TD\u </ZadWOh@dα E\ jqFRQ(@tqE\F LS,zQ <<@α0F\ "C66S)@F\ XsCEnL@αG\l $P )@HH\ @O *h@ĀαH\/ V0g(@Ԁ\I\ <"%Vh@I\ Z[q^72 (@xJ\ <"%Vh@K\0 Z[q^72 (@K\g <"%V2:h@ L\ Z[q^7 $(@L\ P4R"\@dM\ "!'k)@Z3N\1 P4R"\@N\i "!'k)@Z3O\ P4R"\@] T] !] ] ] @ԍwKy\ ] / ^ !1^ X^ e^ ~tD0|\7 l^ x^ *!^ ^ ^ tȿTL~\Z ^ :^ !^ _ %_ ~d\ 0_ :_ B_ !_ _ _ ~|\ _ _ _ !m` ` ` |\P xw w w !'w (@v\g w w w !22w (@܍\ w w x !O Xx `x $+@tyrԐ\ tx x x !u5ax k8yr\ x x x !x (y 3y L<q\ >y Wy =!y (@\+ y y !z +z 6z xuJ0\ Jz z !{ !{ '{ (@q\ /{ @{ -!>{ { { 2Hqh\ { | k!g| | | 4h\` .GJ!bs2Hq,\ e} } |!} } } 2Hq \ !2Hā^#L\0 !g2Hԁ^#t\f !*A2HX\ Kpt!2H\ !j(@\ !#%HR2H@\G  w Z!W> O X (A3\8\q _ l !oE x(@q \ !y 2H$q\  $ !HY ` (@Kqx\1  $ E!HY ` (@ Kq\  s!"  (@@K\ ( 5 !v 2H`Kq\-  !kÅ (@\\ ʅ !," (@\  3 ;!IOU (@\ Z w Y!^ (@X\  !{i(@X\!  !i5(@X\V  1 ! ҇ ؇ (@\q\   !t (@Xux\  Ɉ X! 7 > 21d?1\ Q b !n 21$?1\ ݋  P!u (@q\  !ߌ (@4\!   !n#- (@t\@! 2 C !p u (@D\!  ,! (@T?1d]!  ō @! (@d?1l]!   d! ǎ ώ (@Ku]"  !I (@u ]P" 3 a !A M W 2H؜u ]"  H!< H T 2Hu]"  !8N Z b (@?1|"]# %FS!bR(@t?1&]N# *! (@̢?1-]# Ӗ s!܊V _ 2H?1L1]# m z !8 (\)@2] $ Sŗ ̗ !K֗ (@2]V$ T !O (@@3]y$   !T5a$ + 14Fȿv4]$ 0 9 L !^z kk6]3% !o( T $_ $D]% Û ϛ қ ! `КE]% (  !5a36 1Ď3F]& C L W !H5s z ,' Ă k E!޿ 9 ] 01$ L^6/  !/$ (@^h/ + @ D !N 21^/ !q 1 : (@q^/ n {  !# 8!^0  # . !V` H(, T$^*0   S !~  t ( =p|1^f0 R k ! @ c 8^0  !  " + h32=^0 7 O S !2q F3 / 8 ; ! (W (@2}_2> ! x((\T$_a> :Cj!Fm|(@_> 4!(@\_> !   (@d_> 771!(@qH_> --!(@q_p? YFH!f* (@qp_? ---`- ..00Nd_? .#.J.cX...@H( X_F@ .../00`_n@ ///9, 00_@ ///p0003sq _@ 000,:1]1E3q|_A h1y1w+1111_NA 112wB2M3{3`@d_ B $32N3w`g31_TB 333w444412tԞ_B +4U4i4w5<5_5<~\"Ĥ_EC 5/5w5h)@p_C %5wV5$(@_C 55w5(@?10_C .j5w FO(@?1_8D pk;6w $(@_tD |pQ 6w$(@4_D |pQ 6w$(@P_D 66w)(Z3_7E  &616w@6S6)(NZ3ĩ_}E  &6\6w#@6S6)(NZ3_E k6Ex6w+E6(@T_ F 66w;6P8Hyr0_OF 666w$U7{77$(T(_F g77wcF h"0"_G 777w7771_aG 777w&8 8$(@д_G '8@88w? 9M9b9  Pm q_H 999w\97="_JH ~99w]{8)@_H 999wf:62_H D ::,:wpB:U:\:383ND_0I g:s:wr-<A00Op_I :::w#::x71_I :::w4 ;(;4h_J ;;D;H;wPlVP;$(@$_!>ȠY"0_P 2>>>M>9'n>y>8Y\ă_Q 2>>>>5'n>y>8Y\ԃ_oQ )ro>1;00l_Q 3>&6>@'_R )ro> ;00_lR >>>+>>>=l_S ???00?G?P?$=l,_TS hW?j?n?M??0@X["_S ??S00$_S "?~kR,?00_HT f??Q;00_T ?>?_?XJY|#qH_T /@@adOO00_MU p@$@1@lj@@@LxhX#vP_U @@o͢00`Od_9V @@@KAAA  'F_V AAAAAh_W (@qD_cW 0h(@qd_W wB '==t31"l_W &jB -F600_7X BCBB 1BC^CC ,"_{X CCC }D3DE+E 'n>y>8Y\p`WY 2>EME 'n>y>8Y\$P`Y )rooE ;00`Y Y LsE FE@+`IZ )roE ;00 `Z EEE hFFF5P AW1`0[ (%F VI@L`[ G G GH0=<`[  G*GcG  GG(@ `.\ GG H2H 21`w\ 7HCHFH bH<= 2`\ mHzHH "HHHO`] x|H 0"0?1`j] $"% V2:Y@oF<`] Z[q ^7 $(@`] $"% V2:Y@oFX`7^ Z[q ^7 $(@`^ $"% V2:Y@oFt`^ Z[q ^7 $(@`_ 84 R"Y@O`Y_ "!' k)@Z3p `_ 84 R"Y@O$!`_ "!' k)@Z3!`?` 84 R"Y@O"`` "!' k)@Z3H#`` 4l/ 6Y@n#`a | (@?1$`ca EmHH I(@O"%`a Iq(I)E;I\8H=p&`a BItOI4F^IeI8;H4q"`(`Wb pIII;5IIđ=p+`b BItINF^IeI8;HDq"-`Oc lJJ JUVIV`Qq<`y sVVYV Y`V@H(؂`Dz eVhV *mV~Vt)@"`z gVV +dVV"0`z \VgV 0VV(@q`{ lVV 1VV"0Ą,`j{ eVV 6mV~Vt)@"`{ `VVW 7tWWW83: ad`| T_H@ <,?00؋`L} ~W!+WWP"0l`d} WWW! WzX@H(x`|} WWX! WzX@H(`} XXX!YY%Y1h@̛`F~ PY]Y!oY~YY(@Ԅ|`~ jY!FYGH r`~ YYY!5aYYG3\Q rH`~ YYY!YYG3\ r8`~ YYZ!5aYYG3\Q r` YY Z! YYG3\ rp` 1Z:Z?Z!\ZkZrZG3\Q r`5 ZZZ!ZZG3\ r`L \s8Z!(ZZGH rT`b ߩZ!.d.7 GH rԤ`y ZZZ!A [$[+[,(\T#Ȧ`  /8[!P@[4n8 rt` >I[R[!Vb[w[~[GHQ r` [[!][4n8 r` [[[!f[[\GH rh`1 \\.\!v\\\@nT H  r`H \3\!\00`\ \\ ]!39%].]9H?1`v ?]L]W]!;z]]XnJ$?1` \\]!M9%].]9H?1` ]]]!U^$^,^XnJt?1ȵ` \\C^!f9%].]9H?1Ķ` _^m^^!n^^^XnJu?1`% \\^!9%].]9H?1`B __._!Y_n_u_XnJD?1`_ \\_!9%].]9Ht?1`| ___!_` `XnJ?1d` \\`!9%].]9Hԓ?1`` ;`H`S`!&u`|`XnJ4?1p`ˁ \\`!9%].]9H?1l` ```!w``XnJD?1` \\`!9%].]9H4?1` ;`H` a!&u`|`XnJT?1`7 \\/a!9%].]9Hd?1`R LaYada!uaaXnJd?1`m \\a!9%].]9H?1` ``a! w``XnJt?1` \\a!9%].]9HĔ?1` abb!#=bNbYbR?1` \\hb!29%].]9H?1` bb!:bbXnJ?1`3 \\b!H9%].]9H$?1`O ;`H`b!P&u`|`XnJ?1`k \\b!^9%].]9HT?1` bc!fbbXnJ?1` \\gi!`(@ rD` Z ii!;i(@"` Li_ici!!iii$4HԅKt`k `ii!#ij00t ` tj+j/j!2{jjjT8AHE` `ij!7ij00tX` $jjj!M7k[klk0&D&ԖG2T` `i{k!Oij00t`C kkk!dkkX93\uu`c $kk l!odlllpnX&v2` ll/m!pnnnOhx r a4 ooo!0p_p~p؈\ܥa] ppp!Pqqqex @R2las qqq!q rr41`R rLa r,rAr!rr42 ra {rr! H5rrLn^4 ra# r s's!kwssLn^Tv ra? sss!5sst(P4P$!a[ t$t-t!?i^tktDTȿؠ r#a} zttt!Qt-uJul&xRq +a Tu]ufu!puuu((\Rq+a 4uuu!|v$v3vd0D.a( NvWv!-<A00Rp.aO hvuvv!vvv|nMv7W0an "vv!,?00p1a vw9w!@wwwd t W15a x9xGx!]xxx&&v :a% xy y!/ydHut6gy)(\X"D=ae zyyy!yyyt\4)v ?a tyzcz!J{{{  $4 #?1Fa '|0|!-<A00Rpٚ!'n>y>8Y\ b9 2>ٚ !'n>y>8Y\ b )ro,!;00h bا Y L0!FE@+, b% )ro<!z;00 bw 8@k{!,D$W1xb >JU!sHx=\b &!@l(\`bX )ro!;00b T!,?00Pb 3!6>@'bI )ro!;00pb ˜ޜ! 7L(8G4hb _l!#X( S b EPW!71q|Z$Zć"h"b !} L< أq"%bK 9tB! U000'bo !,h)@'b !"412(bլ ݪvmʟ!.mc$(@,)b ݪvmϟ!5mc$(@)b2 \ԟ!<&OfԇKq" .bY kOov!FdOO00.b  ՠ!4 /q"T8b kOˡҡ!dOO008b $ۡ#!;Ld?1@b< d ?!mOH,_2 Nba kOˡ!dOO00Nb !4S!ťܥh)@$Rb® $7!}(@X2Tb OWO!Gl$(@4Ub ||pQ!TU$(@PUb@ &Cj!Ft$(@Ubm ^^a!$(@Ub T!T$(@$Vbɯ UU!U$(@$`Vb _71!&U5U(@Wb tt !:UAU(@?1,"@'n>y>8Y\Tib 2>ݧ,"<'n>y>8Y\djb )ro,"8;00xkb2 / vH,"-I4 H0=llb )ron,"%;00lbѶ *-,"Ra|7qnb Tܿl,"!,?00obz Lo,"/ۨT0)xrb· ,"O6E`\tb V T,"4Q 00tb^ 4eh,"^t \vb ,"qѩ8xb ,"a%@-\ zbK ,>B,"L1l2qL|b b," (@q(}b XNl,"i(@q(~b* l7l7]"008~bO ]"W t"bu j" t0q"b a0l"ax(@b |pQ@l" $(@܊b$ 5>Al" &H71 bV ^kl"׬tNlT b U"l"x(@0b %>Zl"ح "|"b N^ql"'P"0c |h "G0]c0 "Zx(@c\ |h "^P"0c "jx(@c |h "nP"00c "wx(@Dc |h "{P"0`c7  "x(@tch |h "x(@c "x(@c |h "P"0c u"x(@c |h "P"0cD "x(@cp |h "" 0] c 4 &)"K Z ((\$c 4 &7"K Z ((\(c 4 &E"LK Z ((\,c' 4 &S"iK Z ((\0 c^ 4 &a"K Z ((\4 c 4 &o"K Z ((\8 c 4 &}"K Z ((\< c 4 &"K Z ((\@ c, 4 &"K Z ((\Dc\ "zx(@Xc |h "P"0tc "fP"0Dc  "%*P"0xc 1"x(@cC |h 5"P"0cn 9"x(@c F=H"lx(@Uc {"x(@c |h "P"0c ".x(@cF |h "2P"0cq "ex(@c |h "iP"0c "vx(@0c F="zlx(@Uc "x(@cE F="lx(@Vcp "x(@c |h "P"0c "x(@(c |h "P"0Dc "x(@Xc= |h "P"0tcg  "& 21\c ""x(@c |h &"P"0c *""x(@c |h ."&P"0c= 2"2x(@cj |h 6"6P"0c  :"*P"0c _EI"LdY<2Hq(c ^k"z<ؤ"cR %2\"tD<W1c BW["Ux!s0@ȿ"c ~"wwp<}"h&c 'I" <q*c )."mNh)(\,cC T"E?1cc "W,X=pdc8 7U"0%<D(jcg i8P\"A 21 Vkc "M PXK$tc $" Z*@`c " stP"4c: " +T*@ ci [ d" *@Pc  " 21c  " 21xc "0 rll\$c " 21@V`cH '1Y"  ,421n 8c '1["  ,421n c  "O e NX"Ğc " $GO21Xc _iz"  ;C21cB S]n"  21إԫcn #,<"D t*@حc  "[ 21c "u /fD~`c u~" 21c " 6p\"cA ANt"  #+1"2c ^gk" 21c- "[ 21cY   "n :W21c ^hm"| PXKlc " +221`V@c CG"Xih)@c n"x(-dc0 2"4 (@"c "Z,`Vc "M"Vcf ";@(@XqXc Mcg"P"0Lc "L$"0\c ""P5H?1c" "U11VXc "Y3HtN\c U"$"0lc Yns"$QX\?1c ")@O VcK j"3HtNd{ "$"0$d "$QX\?1d "'ud 4AN"H$dl "$"0d "Ez|x?1 d "9\Wd ,:"t`Pr<*d 9"$"0*d =gr" \4?10d .k" j"< 8dY "'3^pd?d "`wHQ(Y|@d "d(@@d "h8IlD\Bd )."uJg;1\?1,Ed0 x"\;<qFd "Tcj\;<DqHd ${",( ^ 8/ "ГdE (q   "   x@ht$$(d D z ";$  "Dw"|dn r"JV\P"0Td dp" '< Wq4d dp"# '<@WqXd q"(( x $ qd" "0"0dXdv (" A T  $$e* '!3!7!"5C!Z!~",ed '!3!g!"<C!Z!~"e s!!!""#$$te Fbo"Sb(@qe ,$5$8$";$(@H e  "Q9(@q eG CCj"(@ql!et @$I$d$"F$$x(@"e $$$"($x(@$e <EH"Xx(@$e %^UP"Yx("%e4 c%"%"ccc2<\&eg c%5%"ccc2<\'e c%H%"ccc2<\ĉ,)e c%[%"ccc2<\ԉ`*e c%n%"ccc2<\+e> c%%"ccc2<\,et c%%"ccc2<\-e c%%"ccc2<\0/e c%%"ccc2<\$d0e %%"Ed҃x(@481eD "x(@L1eq 0Z[q"^70x(@1e 0Z[q"^70x(@l2e %%&"C &x(@`W\3e <EH"Xx(@3e6 "%"V2:)@"4ej Z[q"^7 x(@5e +&5&: "p9&(@q7e "E`@&[#E&X&00 8e ŧHm]&[#z&P"0 9e, &D&[#-'R'X'$(@DqP?e `'n'v'[#Z'(#()@W?1 Ee 7(H(O([#(n(((31TFe (j([#a((((6Hd?10He ((([#)-)4)<HW"LIe I)Y)])[#)))pD3\W"LKe3 (j)[#(((5Ht"Lem )))[# **#*(@\Me **7*:*[#N*_*f*(6H?1Ne m*V-v*[#p**@"`Oew |a*[#(@|Oe ***[#'*++((\Pe. |a++[#F(@ Qe` /+8+;+[#vQ+51P"0Re X=]+[#4>P"0 Se X=`+[#4>P"0tSeP X=c+[# 4>P"0Se X=f+[#!4>P"0DTe X=i+[#"4>P"0Te X=J[##4>P"0UeH X=l+[#$4>P"0|Ue X=7u[#%4>P"0Ue X=[#&4>P"0LVe X=o+[#'4>P"0VeB (r+w+t#Q400\Wej |+++x#+++`,Ye ,^ ,x#,HTYeP ,^ ,x#,HTxZe ,^ ,x#,HT4[e (|@x#`+0LP[e $,(,/,x#0@,R [,.dMԙLH\e (h,t,,x#f,,,TdئLL^e< (, --x#]---̿nbe ---x#+.j.p.*@W`fe (|...x#..@J-heW ,...x#.//PLL"ie 0///2/x#T/k/p/Ċ=pke YFHx#fw/(@qleQ ~///x#///( ne 0Z[qx#^70x(@ne Y X x#$Sx(-|oe ҵx#/(@qdpeE ///#%000(@X"Xqe &0/0#E0V0]0(@ X24rei j0ts0#000(@"Lse> 000#0 11(@"8te -161E1#{ i1p1(@w"ue 1c= 1#9111(@@X2ve( X 1# 11<(@Ԋ?1vea 111#2(@"we 12 2#4111(@`X2xe) 52H2#[2l2s2@l(\Xye 222#223T+< wu{e 8343E3#b333hnX~eQ 333#4&4̓ܓe 54 >4#!G4^4<q" e sk4n4##Y`V@H(e 0u444$z44#lrq̅e8 04,4$4l@|xhes 444$5"5h32e 8<,+5$N<15$(@Xe 8<,65$N<15$(@Јe x<5?5$\"0Z3eV x<5C5$\"0Z3e x<5G5$\"0Z30e K5N5$$(@Xe  R5Z[q$^7KU(@qeD _5k55-$v555P@MXȋe[ |pQQ-$z$(@es c15-$d5(*@e ^a5-$0(@e 556-$[666,`e 666-$ e7t7L<p Le 77-$'77 +H(=pe 777-$ 38t88u`$e 888-$" 99$9\ j4e< I9V9-$3d9t)@qeW k9W 9-$>99|L"ew ::":-$S?:F:3 7Xe W:&d:-$nn:$(@e  u:::-${;;<N4xADe fo:<-$;00e o><-$;00-$} x(@De >>7>-$>>>\l eH ?*?.?-$r???|h oqeg ???-$???@H(Pe ? @@-$_@|@@8IKYe @@@-$@AA11de #A0A4A-$mAAAxxv Y?18e ABB-$۔SB^Bp@Ye( oB|BB-$BBBuw`YeP $BC C-$CCC> x4ee DD2D-$oDDD412Y|e DDD-$4XEEEt Pe EE-$00e EEF-$$F;FLFUhIYe' b-$ (@qe> b-$ (@qde\ WF`FgF-$I4pFwF21$Xez "%-$V5$(@e &Cj-$Ftt)@1he ^^a-$x(@e Ful/-$ۍ (@q,e vlE-$EE(@qe# Ful/-$t (@qeG ~FFF|$FG[@Me %G(G|$e$(@e |,G|$u$(@e --|$(@qTeh /zF|$0G(@qxe 5GNG_G$'pH/ISI$#اLe dImItI$IIIZJ4`e: III$I JJl8#Dec ,J 1J$CJnJ \Y|f IIzJ$I JJl8#Tf ,JJJ$JJ \Ytf JJ$4KKR@M` f "K.K=K$XmKKKHQ dd fH KKK$KKHK " ff KKL$OLLLL#df |pQL$$(@f (LLM$^DMMMILuf @MMM$M:NCN,f= ,RNkNN$N;ODO`Q|fY Pf cO$sOO`# [`0 ft 8OOO$ PlPP\ Y'f 0PPP$PPQ  8Y.z)f @ QXQ$*5QLQUQ<t#tۺ+f <\QnQuQ$7QQQNhO#Z.z@-f QQQ$HQRR5 ?1/f ,T R#R$UTQ@#.z/f7 ,)R6ReR$\RRSQL.z2fV T/SASHS$}XS{SSLL44fr TSSS$SSSLL Z5f TSSS$T3T:TLL@Z7f TSETLT$SSSLL`Z`9f TSZTaT$T3T:TLLZ;f oTTT$UkU{U|H@Z"Bf6 UUU$UU0GqCfY @UUU$UVlxQۺFf TVV.V$VVV\tJf $ WW$zY(LTf] YYY$YĭY(Lt#Uf~ Y_b$$$)LVf YX $$Sx(LWf |l/$:x(@LXf ,YY$YY(0"#Yf ZZhZ$ZZZ`\f6 [5[:[$pHU[12_fc ^[q[[$5\P\X\1 "Xcf \\\$ \383`df \\$ jU 0D" ,ef \\]$7]I^c^`Hnf s^^$ZC$(T(dof> ^^^$a^^$(@Dpfj T^^$f,?00 pf ^^ _$j__`t$yyf &@`C`$F600 zf- &@`G`$F600 zfa K`X`\`$ki`XD1{f p`|``$q``f4P}f ```$&abaa4Ěf_ aaa$aaa\ċ"Xf bb b$bb&c(0W1f 6cGcRc$~cccLP [?1f ccc$BdddT<$"f% dde$.e]ede@@[ u+$5LWLX\g? ,d h$PpЃ J< A0g)A $R-<A00@]p|gA $P=4{tg}E $ч7 ="gE $008gE $$*[Ps=g>F (f$? pg~F I$kR(@qtgF \V"%$Vs(@qgF $-(@qgF Ful/$t (@xgHG !'$C4(@0gG ^9<f%?#(@THgCH Uc@Cf%JY-(dgH `l$ѳ޳8=ة$gXK ¿$|Y(@ʶf%'n>y>8Y\Ԍ|hU 2>f%'n>y>8Y\\hV )rf%{;00h_V Ef%p 00thV d  9=f%yiOhW Tķ߷f%)HWPhTChW "Qtf%,?004xhW xf%ظ 8 ~\ !hDX )r'f%;00!hX s +f%Vq00"hX K9f%#0$"h@Y =Jf%Z8)@""hY  f%Q9(@q`#hY &Cjf%Ft$(@#hZ ^^af%$(@#haZ |pQ)%!$(@$hZ aVe_%" mV5=4%hZ +b%$k+128&h![ +o%+k+12<'hd[ V|%ZEVV$(@`](h[ V%`VVW$(@](*h[ W_%i00l-h*\ "n%"/O0Zb q"H9h\ .ZGZ%!ZZJ4Pq"=h] [0g%u'[21>hI] 0[y%2p[u[)@@h] |[%[[[\l`Ch] !\ǽ%y]]]u "Kh5^  1%GϿQh$_ Lj%lb>HX\DHYh_ fa`x%aat)@"Zh_ `b%b)ax(@\h"` 0a %)aa(@q"]h_` fa`%aat)@"_h` at%Fax(@`h` !%-up oh'a %$<O"$sha x%x,ܰPp zhb kj+%_FkkHQlKT{hb /zF%Q(@qx|hb *23%6mx(@}hc *23%6mx(@}h`c -n7n;n%?nKn(@qhc pEmHm%Km(@qthc 9BG%Lj00ԁhd  ]%('>M8|e\5hd kOx%2dOO00$xhd `%00]$hme O%$1 lx(@he x|%("0̇he %FLrԊh f %%_m+P,Xhff b% (@qhf 4>D%J}00z؎hg t % 00 hCg %^(@4"Lhg 4%t5^gG2]hyh r2N%(@D"hh %:)@g5h%i @_ D% (@" hai  %'(@"xhi ./;%HipP,@X?1h~j %d(@Thj %%0P"\dh*k -0%00hik 8-M%T_P"P"\hk d u%P"P"\hk -%00 Cj%F<(@mi "WO%=c(@PiŇ |l/%:x(@i 4C% X]x((\4$iM l%(@Di MVu%5ax((\TiЈ %(@di 4%/$(@iQ R%}(@tdi %3V[$(@i҉ 4%/$(@i 4%/x(@@iS jq%/z$(@i %:(@`_iي j%/zx(@@i <EH%Xx(@i[ %(@i <EH%Xx(@$iڋ *23%6A(@i LL%Ff! (@qic Ful/%ۍ (@q8i b% (@qi؍ \V"%%VoV(@qij *&4#.`T8RX\i= bOV*&B`00Ďi gx{*&11"`iÏ :&00Ԏi  :&/(@ ?p1=pi5  Ho:&rMDLM"$i| :&#4jlK iɐ ;H[:&s0Di ":&u,?00hih :&`p ] "i  :&^0xz"j "-:&͢00_dHja =lp:&  4D=p j :&.x(@_P j  (GT:&;L\4U" j6 ":&A͢00_d0j :&G{#42L2q"<jԓ <Dc\:&"j ":&,?00hjs <Dc:&"Xj ":& ,?00hj X:&GxH\y"P"0Sj֜ X=Kj&H4>P"0Sj &! 0^_2WjA 2;>&6G00qWj} 3E L&2Wn$GGLYj sv&* 00Zj  &T @G2$]j, &i00q ^ji $x!$&e0GG]1_j sL&] 00H`j \c%j00```aj %@H(ej5 %Q`(@tfjg %EPH%`(@$Hgjǟ ,?F%#f}Pd`Pjj7 %- ,njs $H ! $ %:+ < 61]1nj ^ A %8H ] ?H?ojܠ ,PVd %?p lHpj @^j8w %Kp l@HqjY 0   %U  %  $ `tj ,8 i  %F   0T#T{j" <   %X g v #|j <   %[ |{ȏj Dp%5$\" j <*A%CZ|A\ j ,!#!&!%i2!Hdj5 ,9!W!g!%!!!rrĝdj̧ , "%"9"%x""" #djQ """%""$G2j <## #% 7#F#Y#4 8`,dj 4b###%# $%$@{Jxj 4A$K$O$%0k$$\D Jpj $$$$%8%.%9%$]1dj W%c%o%%V %%lR42j9 <%%&%(()Q)\ȿ% ,Lk  **% -*th=p kC J*[*^*%)q*hSkj |***%B***8\Dk ***%S+&+K+xTk $S+`+d+%zx'|+T d ]1 kv +++%hp +r1k +++%,#,,,;1ث͛!k C,L,O,%X,i,^J#k& r,{,,%o,,lJ`P$k ?1 ,%"N00$kˮ ,,,%,<(@&k ,,,%--dSD^\(k &-)-%$3H٭ `(@)kT 0-=-%v<+@)k F-W-j-% --<+@T,+k ---%5---ܛ<d`-k  ..%9/$G1.kD .&.-.%AM.^.l8Iz0k~ i.|..%M ..0@D|d3k ;A /(/%^K/b/k/lJdt5k $///%a//a]17k- /0h0%`1110@ dCk 125+:2& C2o\O0Ekٱ N2~22&T445e@H{ /2t_k 5;(5&pl(5o\OakJ 555&x7 88 X # kƲ  999&,S;y;;<)LL 3k H<\<i<&l<=C=XB|ܧk ===&===P"0tk =w=&H5=h)@74k ==>&,>Y>h>8p\k) p>|>>&\>>>4D aku >>>&dmGP"0lF lNMWMZM&[~MMH^8 'cl MMM&y$N1NK@Muxlɻ |pQ&l$(@l U9N&m"0lE >‰=N&n$"0l AN&o(@l ENNN]N&swN|Nx(@l |pQN&tx(@l4 >‰N&u$"0lw |pQN&|x(@l |pQ&}x(@l %N&~NN$(@ďli UN&N$(@l UN&N$(@l UN&N$(@l" UN&N$(@,l` ΊN&,4 (@W1l N&"0"lۿ 0NN&%OP&$OaO$(@b!l [qNP&%OaO$(@b|"l U^P&,N$(@"l= UbP&-N$(@"l~ UfP&.N$(@"l jP&/"0""l ΊnP&0,4 (@W1l#lB rP&;(@#l vP&E(@#l zP&F(@#l ~P&G(@#lA P&J(@#l oP&K+PPx(@ԏL$l oP&L+PPx(@$l -P&M(@ %l vOP&S(@p%l -P&V(@%lQ >‰P&`$"0%l P&a(@%l IP&bP(@d&l YR&P&cP(@&lI PP&dP$(@'l PQ&jP$(@(l  Q&p(@(l OQ&q?$(@0)lD |pQQ&r$(@L)l |pQQ&s$(@h)l Q#Q&t)Qh31P*l |pQ0Q&w$(@l*lT 4QjAQ&zSQbQh31+l ΊiQ&,4 (@W1,l mQ&"0"(,l qQ&(@<,lQ 3uQ&6A(@,l U{Q&N$(@-l ΊQ&,4 (@W1x-l Q&"0"-lM &(@-l Q&(@-l Q&(@-l ,Q&QVQ(@bD.l ַ Q&QQQx(@.l ַ Q&QQQx(@D/l" |pQ&(@/lh R/R&"-R(@cl0l -:R&(@0l UHR&$"00l> >‰LR&$"00l x|PR&XR(@1l >‰_R&$"01l UcR&"0$1lA UgR&"041l ,kR&QVQ(@ c1l Ƅ8{R&RRR$(@@cp2l cOR&RRR$(@`c2lV UR&"03l |pQR&$(@$3l cOR&RRR$(@c3l+ cOR&RRR$(@c44lm ΊS&,4 (@W14l  S&"0"4l [qS&OaO$(@cH5ls ΊS&,4 (@W15l #S&"0"5l |pQ'S&$(@5l1 |pQ+S&$(@6lo /S&(@6l 3S&(@,6l Ί7S&,4 (@W16l? ,&"0"6l ENNN;S&/wN|Nx(@t7l |pQUS&0x(@7l -YS&1aS$(@8l8 |pQlS&7$(@$8lt pS&8(@88l ^atS&9m(@P8l >‰~S&:$"0`8l. SSS&M S4,S|6(1 'c"UGU  $EClf DNUaUU&UVV`^x^ [dHl 3VlVV&xWWWDTc "Nl% 8X'X+X&`XXX4<dcRl hXXX&_f\\\d2 ;?1,kl ?t]&aVq0004pkl' ~]]]&]]]Kpe\ d?1nlq $^^0^& ^'_@_جOul $W_e_v_&@aaa  !OTl6 $b1bAb&bbbLd?1Ԇl $bbc&cc d$ 4 O l kOkHHl Xk_k&Vq000Dpl( ikvkk&llmOpH'<yr\lk k k k&'7A(04'$l k k$k&>kOkHHpl; JmSmZm&:mm\I@MT"Xl $mmm&ennn4}ODl k k k&'7A(04' l7 k k$k&>kOkHHXl nnn&&qqq|$yrHl k k k&'7A(04'lU k k$k&>kOkHH\l k k k&'7A(04'$l+ k k$k&>kOkHHpl *r3rBr&UrrK@Md?1|l JmSmr&j:mm\I@Md"dl+ rrr&'asps `d"lw $sss&uv+v2\ Om k k k&'7A(04'Lmg k k$k&>kOkHHm vvv&w:wGwLd?1< m $[whwzw&x8xQx}O|m\ k k k&'7A(04'Dm k k$k&>kOkHHm. ox|xx&"yAzbzPAd yr(mv k k k&'7A(04'm k k$k&>kOkHH<"mP zzz&O{{{p\'yr)m k k k&'7A(04'`*m k k$k&>kOkHH,ml ${|>|&nV}}}p'`l OT8m k k k&'7A(04'9m k k$k&>kOkHHh;m +~t&(@|;m  slsl&}(@qmw ΊqW&Z,4 (@W1>m +~Q~&(@>m A~J~U~&70(@q8?m9 Y~f~i~&~~(@dqh@m Ί~&,4 (@W1@m6 ~~&&~"&x((\dlAm{ ~o~&~~HH\Bm ~~~&Q00qCm +~ &(@CmT  &(@qDm `!&H7>((\dqDm KkT&pHH:Em Ί&,4 (@W1PFma +~&(@dFm .~7~&dm(@qFm d]sl&X6H"xGm$ \V& V(@qHmi Ί& ,4 (@W1xHm ~&&~"&x((\dIm &:H;Mm< +~B&1(@0Mm DFO&2SbZ@qMm ~g&&~"&x((\eNm {&̀PUSm\ $&L()@"|Tm &(@Tm -0&Fm|(@qUm (58&CAX6H"UmE Ίa:H&%,4 (@W1@Vm O\&)&~"&x((\ eVm ku&* HH:Ym c&?(@YmE .~$4&Bdm(@qDZm (5:&ECAX6H"Zm DQ&K[(@q[m Ίa:`&Q,4 (@W1 \mL Oh&U&~"&x((\@e\m y&VAJHH:`m AN&n(@`m -{&qFm|(@q,amT (5&tCAX6H"am Ίa:&z,4 (@W1Xbm O&~&~"&x((\`ebm ku& HH:em^ &(@em -&Fm|(@q`fm (5&CAX6H"gm D &[(@qgmR Ίa:&,4 (@W1͊Њ&#$"0`m >͊ӊ&$$"0pm) K֊&%"0mk Kي&&"0m K!&'$"0m ^܊T&)$(@m> K~/&*"0ȕm xߊt&+dD"0m xߊV&,dD"0m xߊ&-dD"0(mQ xߊ&.dD"0Hm xߊ&/dD"0hm &1D"0=pxm& K&7D"0mn Kd&8D"0m >͊&9$"0m >͊&:$"0m9  &;%*$(@Ġm{ ^܊9&<$(@m K9&=$"0̗m xߊh&?dD"0mP xߊ<&@dD"0 m xߊ@&AdD"0,m >͊D&B$"0͊T&K$"0|mR >͊ &L$"0m X&M%*$(@xm ^܊r&N$(@m- Kv&O$"0m} >͊z&Q$"0m &RD"0=pm KP&XD"0Йm] KH&YD"0m >͊~&Z$"0m >͊&&[$"0m1 &\%*$(@$mv ^܊&]$(@m K&^$"0m  >͊&`$"0$mX xߊ&adD"0Dm xߊ(&bdD"0dm xߊ&cdD"0m4 xߊ&ddD"0m xߊ&edD"0ěm xߊ(&fdD"0m# xߊ&jdD"0ml xߊ&kdD"0$m xߊ(&ldD"0Dm &mD"0=pTmG !'&C4(@q m 6ċ9a& Nj(@q4m 4&΋(@qm \+.&(@qHm> I&k=(@qLm{ "%&V(@qؠm 58&Ջ(@qm Cj&F(@qm7 ?+H&9܋(@qmy |&+x(@0m &(@Dm &(@XmD  &Av)x(@X`m |:&+$(@|m CJ&S^$(@ؤm  |el&x(@fmJ |&+x(@m &(@$m &(@8m  &Av)x(@@m@ |:&+$(@Đ\m| CJ&S^$(@Ԑm |el&x(@ fԦm |&+x(@m9 &(@mw &(@m  &Av)x(@ح m |:&+$(@ &(@m  &Av)x(@m |:&+$(@$m CJ&S^$(@4xmK |el&x(@`fm |&+x(@Dm &(@Īm &(@تmK  &Av)x(@Xm |:&+$(@Tm CJ&S^$(@dXm |el&x(@ftmA |&+x(@tm &(@m &(@m!  &Av)x(@m;! |:&+$(@ܭmx! CJ&S^$(@8m! |el&x(@fTm! |&+x(@pm6" &(@ms" &(@m"  &Av)x(@خm" |:&+$(@m2# CJ&S^$(@đmt# |el&x(@f4m# |&+x(@ԑPm# &(@dm1$ &(@xmw$  &Av)x(@m$ |:&+$(@m$ CJ&S^$(@m6% |el&x(@fmu% R&}$(@m% R&}$(@`Hn< Ҍt'Y<(@"Hn = Ft'ZFtɟ)@" N_lt'`((\X #hNn> Nt'ʠ`((\ #OnQ= Fנt'Ft)@ #Pn> ݠt')@Png?  <gt'ҡ d t X#Un@ ;Slt'Aʢ x,PqWn`A  t'])8?983Dt'4F(@5nDN <KTWt'9_\HenN Tz fit'>wsHHHnN "z}t'Dd)@/GLnN T mt'QF(@5n1O <KTt'V_\HenkO Tht'[hHHH nO (t'ip=p4nO t''74(@*n&P 8!.?t'bh v\gϓniP ,t'|k,HnP t'xE<2HHtnP  t'dU<2HHn&Q ,ű̱t'ޱ0s n_Q 8 t'+BIn@ϓȳnQ \gt'Q <(@dٟhnQ 4 t'o \O2nR <߲t'"=F  h؟n7R (Qt' n=pn{R Nuxt'3H(@*hnR 8~qt'G=o@ϓ(nS ,nt' o@nYS nt'; (@H`nS wt'ה ڳ<21ģHhnT ,t'JW hn_T 8ft'ܴp@hϓ`nT *5t'FKP11$*$n$U [dyt'ŵp\pJd!Yn^U 8t'']izAt~6enU <Ŷt'<5D^رnU ]jut'R&WpJ4=$nV KIt'_QN22~5nRV <)<t'j5^ e0nV Tθٸt'6E ,`hHhnV P]`t'Gp;2/GnW E wt'225XnSW <йt'p,;A$enW TNlwt'Ժ LhHnW (t'p=pDnX Nu?t'3H(@*n\X 8EQt''7To@ϓ|nX ,nWt' o@8nX n]t'; (@Hn4Y mY ctt'p\pJXYnlY 8ͻ߻t' $1'l6enY @Dcvt'ż^ز«nY H t'2;;<21DH\nZ ,FS^t';71 KTn[Z 8˽t'I|1hϓ4nZ 8EPt'W]js(H2d"nZ  U~t'(@tHnZ ,t'L o@n3[ 8t' ؾHϓnh[ t t'@(@HLn[ ,lt'Ji" o@Ln[ '.t']:(@Hn\ ,HHAt'df' o@\nF\ 8M^mt'lȿͿHϓTn~\ ܿt'(@Hn\ ,Ht'91n\ 8 Kxt'JATϓng] t'(@HXn] ,t'G<ClKĔo] JS`t' :rw(@h5$o^ <t'HԔeoS^ Tt'(GL@hHLo^ ]f{t'722i5o^ <t'A#Ae4 o_ T0Ttt'L5DOH oF_ dqt'22X5o_ <+t''eo_ Jt':r(@ i5o` <t'#*Heo<` T3DKt'k@Hov` t'22@i58o` <t'2APAeTo` TY}t'"1O`iHo/a =J]t'*225!oqa <t'9DWh'eD%oa -t'U(@$H%oa ,HHt'[f o@l&ob 8=dt'cHϓ'oSb t'(@4H4(ob ,&t'8 o@<)ob =Dt'P(@DH)ob ,NDEWt'Ec o@l*o5c 8hNyt'Hϓ<,onc Ct'(@TH,oc ,K lt'i1-oc 8+:t'&Adϓ|3o[d l5@t'*f(@HP4od ,ut'7 B lKt,6od t'P(@i5P7oe <'t'U:MTHe8oKe T3D]t'\k@H<:oe }t'z22i5of TY}Lt'"1OiHBoBf t'%.22س5Dof <EWtt''DedHof 2t'$(@iHHof ,"-4t'FK o@Io4g 8Rcjt'Hĕϓ0Kokg Wt'"(@jHKog ,t',8  o@ԕLog Ja t'?(@ jHTMoh ,$-4t'F,\F o@DNoQh 8M^it'NHϓ$Poh t'q(@@jHPoh ," t'z 1Qoh 8Ijt'+`pAtϓWo;i t'(@HXozi ,t'}'.lKZoi ;DQt'gz(@ԥ5\oi <t'H`jex]o/j Tt'!<A@jH_okj JSdt'225aoj <t'#AjeLcoj T,P`t'.OXHgo*k +>t'hy225jonk <t'w<Wh'demok  U~t'(@H(nok ,t'L o@nol 8=dt'HϓPpoUl vt'(@$Hpol ,t'k o@qol 't':(@4Hqom ,HH t'f' o@ro;m 8hNt'Hϓtoum ܿ@t'(@DHtom ,HRt'91uom 8ht'#KAjϓ{ofn t'h(@4H`|on ,t'uG<ClKT~on t'e *(@j5$oo <5>Gt'ZmtHde|oZo T}t'@tHoo t'.722k5oo <HT]t'~Aeop Tt'GrO kH0oUp t'2258op <(Et''dȅop -t'2(@H$oq ,>t'8 o@oGq 8  t'@-DHϓto}q IPt'``(@Hoq ,g0tt'juj o@oq =t'}P(@HTo'r ,k t' o@0o_r 8nt'Hϓ$or Ct'(@ĖHor ,A{t'#R 1o s 8*Udt'HXAԖϓos l5gt'f(@Hos ,ut' B lK\ot t'-(@@k5o;t <t'2:MTHeܣout T t'9.IN@Hot U^ot'W22`k5Hot <t'a!4CAexo,u Tt'lOkHolu t' 3<22ش5 ou <Set''Ħeou 2t'$(@kH,o(v ,l)0t'I4@E o@$ o^v 8L]dt'H4ϓov "t'(@kHDov ,t'  o@Dto w Jat' (@kHoBw ,rt'# e,1 o@To{w 88IXt'+ Hdϓow t'N (@lHow ,t'W  1to)x 8=^t'a '\lAϓoex t' (@Hox ,t' }'.lK$ox ;t' gz(@T5t'v  o@oH{ 8 t'~ -DHϓ$o{ It' `(@Ho{ ,g0t' uj o@o{ =t' P(@Ho,| ,k $t'  o@oe| 8n0t' Hϓo| C\t' (@HXo| ,A{nt' #R 1`o} 8t' oAlϓ`o} l5t'E f(@H4o} ,ut'R  B lKėo~ t'k (@l54oI~ <'t'p :MTHԗeo~ T:t'w .IN@H4o~ U^^t' 22l5o~ <t' !4CAe,o> Tt' OlHo t'  3<225o <SeLt' 'elo ^at' <(@Ho? ,~"t' & o@ow 8Xt' g@ϓtp t t'3 (@Hp ,%2=t'= 5aej o@$p* ^aut'P <(@Hpc ,<yt'V u o@4p 8t'^ HDϓpځ Ut'w (@Hp ,&5t'~ Gmr1T,pR 8t' K`sϓ p 2t' (@mH| pт ,t' e:AlKd@ p Xt' P"05T pO <\ezt' H mep T3t' @@mHpʃ {#t' {(@5p <-9Rt' A$`me pL Tt' hO`sصHp gt', (@m5pՄ <t'7 at'mep ^at'O <(@HpR ,~"t'U & o@tp 8Xt'] g@ϓp t t's (@Hp ,%2t'} 5aej o@8p9 ^a t' <(@HPpq ,<yt' u o@dp 86t' Hϓ p UVt' (@H!p ,&^t' Gmr1Ęt"p\ 8t' ``sϓT'p 2t' (@mH'pه ,t' e:AlKԘ)p t'P"05)pU <\et'Hme@+p TZN]t' w@nHP,pΈ {t'4{(@5,p <-9t';A$ neh/pN T $t'F~O`sXH$3p gt'l(@@n54pՉ <t'wat'`ne6p ^a7t'<(@H 7pO ,~";t'& o@8p 8X_t'g@ϓ8p wt'oY<2HH9p ,t' ,Hn,;p. ^at'<(@HD;pd ,<yt'u o@Xp ,&lt'Gmr14h?pG 8t'``sϓHDpČ 2)t'4(@nHDp ,At'>e:AlKDFpB t'TP"05Fpz <t'YJnetHp T%t'`A\a@nHIp {pt't{(@5tJp, <zt'{ ^$oe8Mpk T"?bt'OضHQp gt'(@ o5Rp <7Ift''@oeTp3 ^at'<(@HUpi ,t'n#*H o@TVp 8ċS^t'vg@dϓWpڏ  Ut'(@HWp ,t'g! o@tYpT ^at'<(@HYp ,bt'HFK o@[pȐ 8Vgrt'Hϓ]p Ut'7(@H$]p? ,t'>G&+1^p| 8:dt'H;H`sDϓ\dp 2et't(@`oHdp ,}t'~HlKfp> t'P"05gpy <#8t'{Hoehp Tt'@oHLjp {t'{(@5jp4 < %t'~A$oempv Tt'K v  O`sHrp g t'(@o5rp <   t'A T c 'pe vpG ^az t'<(@H8vp| ,~ t'n#*H o@ęwp 8ċS t'vg@ԙϓxp  U t'3(@H yp& , t'=g! o@zpc ^a t'P<(@Hzp ,b t'VHFK o@D|pՕ 8VgL t'^Hϓ(~p Ul t'w(@HL~pJ ,t t'~G&+1p 8   t'   `sXϓpÖ 2 t'(@ pHp ,} t'HlK$pE Q t'P"05,p <#U t'{H@pe$p T t'@`pHxp { t'{(@5 p7 <  t'~A$pepx Tt'K v  O`sH,p got',(@p5p < t'7A T 'peLpF ^at'O<(@Hdpz ,t'Un#*H o@4Ԙp 8ċSQt']vg@Dϓp ivt's<2HTHp! ,t'},Hpp] ^a*t'<(@Hp ,b.t'HFK o@d p͚ 8Vgdt'Htϓp Ut'(@Hp@ ,t'G&+1Сp{ 8  t'   `sطϓPp 2St'(@qHħp8 ,}kt'HlKpy t'P"05p <#t'{H qep T>t' @@qH@p) {Xt'4{(@5ԭpg < bt';~A$`qep Tt'FK v  O`sHp gt'l(@q5p, <  /t'wA T c 'qepr t'(@qHpp ,t'L@Mغpܞ 8t'5Hϓ$p ,:JUt'QNqzzpU 8*t'4Jϓp t'(@qHpҟ , t' 29@MĚp ,DU`t'~zԚpV +t' (@rHp ,t'E@MppƠ 8&}t'!D4Jϓ0p ,M]ht'2s zpE 8Lt'=4Jϓp Wt'Y(@ rHpġ ,+:t'bl`g M Tt'/4@`rH$pz <=OZt'HrA44e@p Tt'2rHp t']&-22r5ppG <8ETt' ~tlDep Tt''KrHpȤ  t'(@rHp ,t'L@MTdp0 84EHt'"`}pϓDpf ,t'7 B zd p 8/ t'BpϓXp &t'[(@sHp" , <t'e 29@Mt`p] 8VZgt'qpϓ4p ,t'z@p 8a t'$Apϓlp( WJt'(@ sHp` ,+bt'l`g Mp 8t'pϓpէ ,t'"+p 86Qt'ipϓpb t'(@X5p <$t'ScpPste pԨ Tt' hI@sHp  t'T c n SLP5DqL <   t'&!!"!teq TC!X!a!t'1!!!8t`sHq˩ ,!!!t'o"""s=pq _e "t'P'7"11*qI 8"##t';V#i#(Ԩϓq ,4&~##t'8#,1qͪ _e #t'5'7#<21Hq ###t'\N$q${$Fqr D$$!%t's%/&E&d q Dn&&&t''(%(s(q DM(y((t'5)r))20q 8)))t'J*V*g*OTOeH4qM 8***t'(e*($(|Oe6q **+t'*$-8-G-8Pdl q>qӬ ..F.t'E...8twTAq ../t'^ //Dl0Eq8 /0L0t'm0 1!1$!8(q 4Jqq p111t'|k2w22 ,XOq L22B3t'2455T7 p$ dq' (61646t'J6Y6H4Hqeqv b6e6t'k600qdfqŮ m_z6t'iV"0gq m_6t'fVD"0*gqc 8m_6t'cV\,0ϓthq ,688t'%s;=`L(=pq R=>>t'?i@8H|q$ |@@@t'5@)@=pгqZ @@@t'YABBAx0=p8q cClCCt'CCCoDO?1lq] DDt';DNDSD+@q BjDmDt'dU*@Lq uDxDt'$(@xq# uD|Dt'$(@qb DDDt'EE&ELH(1D?1|q 5WEjEt'EEEXHHq BjDEt'dU*@Tq1 uDEt'$(@qp uDEt'$(@q EEFt'YFhFqFLH(1?1q FFt'FFFXHH4q: BjDGt'dU*@tq uD Gt'$(@q uDGt'$(@q GGOGt'GGGLH(1?1qD 5WEGt'EEEXHHԂq BjDHt'dU*@qе uD"Ht'$(@q uD&Ht'$(@qQ *H3HdHt'HHHLH(1$?1q FIt'FFFXHHtTqݶ BjD-It'dU*@q# uD5It'$(@qc uD9It'$(@,q =IFIiIt'IIILH(1ă?1q II Jt'%JKKKLH(1!?1Pq KK Lt'D.L=LJL$oJظq BjDYLt'MdU*@q& uDaLt'T$(@qf uDeLt'U$(@q iLvLLt'\M#M.MoDO@?1q eMnMMt'eMMMXHH$"q1 BjDMt'hdU*@hqv uDMt'o$(@q uDMt'p$(@q iMNt'wN*N3N0oOě=pq/ DD:Nt'EE&ELH(1?1Xqs NNNt'NNNXHHTq BjDNt'dU*@q uDOt'$(@Hq9 uDOt'$(@tqx OOROt'ROO l?1qH PPPt'QQQT^0 r URfRRt'C4SGS,\D rֿ SSSt'SS$(@ԛ( r C St'6S$(@ rY SSSt'STXh=p,r T%TGTt'nTTTxs?1 r TTTt'& UUXHHsDr #U0U@Ut'.TUU\U9Hr_ 8gUkUt':pUU32r UUUt'>UUU32tr UUVt'G>VUV^VLH(1 t?1|r# uV~VVt'NFV*@@rj VVVt'RVV9Hdr "VVt'^V$(@ r CVVt'b6S$(@r4 VV%Wt'kGjWoW(@rp WWWt'qm<(@q` r pTWWt'w)W`(!r WWt';W$(@T"r.  WWt'XX(@@t#rn 3X=Xt';:IX$(@$$r PX[X`Xt'XXDT0=p&r XXXt'XYYLH(1`t?1x)r. uV.Y2Yt'%FV*@<*rq V7YCYt')VV9H`+r z:XY`Yt'5dkYrY$(@$,r CyY}Yt'96S$(@,r/ EsYYt'C=cY(@t4-rj $/YYt'KYXHHh.r $YYt'SYYt'$(@Zr aUeYet'\6iepe$(@tZr aUe{et'_6iepe$(@X[rA  eet'hee(@\r eet'n;bA $(@\r eeet'| f2f:f 2ܲXtw_r |Fft'00x_rj JfTft'~-<A00up``r xdfhft'$(@`r lf~fft'"ff0wbr= ffgt'-:gKg\g< uery |9t'N$(@er wgggt'u@hLhohdt4Hlr hhht'iTiki@uqr9 iiit'ij!jAxury ?jLj\jt'=jjjt|9yr j kRkt'k'lDlt(`hq |r }lllt'Kmn&n2rF bnfnt'#0N5r bnjnt'#0N5ȋr >Tnnt'$"0N5؋r >Trnt'$"0N5r] vnnt'%*(@dN5Ԍr ^nnt'(@N5r bnnt'$"0N5r3 bnnt'(@N5 rx >Tnt'$"0N5r >Tnt'$"0N5,r >Tnt'$"0N5Tnt'$"0N5lr' >Tnt'$"0N5|rx bnnt'$"0N5r >Tnt'$"0N5r >Tnt'$"0N5rN >Tnt'$"0N5r >Tnt'$"0N5̎r bnnt'#0N5܎r bnnt'#0N5rc >Tnt'$"0N5r ^nnt'#0N5r bnnt'#0N5$rA bnnt'#0N54r bnot'#0N5Dr bnot'#0N5Tr" bnt'#0N5drh o ot'#0tr o)oKot'+oootX"Гr goyt'Idi (@=Pr1 goot'Ldi (@=Дr| ot'O#0=r oppt'/p>piHo`u"r MpZp]pt'$fp*(\=pr9 mp~ppt'0qAqXq=prx qqqt']rrrBܬ=pr ist'qms0H(اr l$s1s:st'PsispsdH83u=p\r= ysst'-<A00upr ssEtt'~vFwwH 4 =pr +xr' ,{{{t'&|8|I|(L\3 r^ 0Q|^|e|t'|||L\Ĝr |||t'Ɍ)})r F}1iS}t'o]}`()"(r 8Td}g}t'QF`()"rO ^m}p}t'`(@"r t}}}t'3H}`(@Ԝ"Pr }}}t'mG~~loUDr5r 7~t'3H t)@|%r5 r` %x =~H~t'C[~`~t)@ur5r um~x~t''7H~t)(\r5r ~~~t'@~~t))ĩr5r t' 3H t)@|%r5@rb  t'D"0]Pr >*it'#0y`r t'f!t)@y0r $&/6t'FU\t,@yxrZ $ct'f!(@zHr $it'"f!(@yr uot'+D"0r5,r st'.D"0t'(@sf (GJt'Y61s Elot'v61s ^3t'$(@s xt'((@sB (Gt'/Y61sy r|t'761s ^3t'=(@s xt'A(@s" (Gʇt'HY61sZ r|ڇt'P61s xt'V(@s ؀t'Z(@s ַ t'aF61s9 r|t'i61sr x t'o(@s ؀&t's(@@s ַ 0t'zF61s r|@t'61sT ^3Ht'(@4s Ί9Nt',a 6Hs (GZt'Y61Ps r|jt'61|s: xrt'(@sp x{t'V6H(s ַ t'F61s r|t'61s t'(@sU 9\|t'(@ s Ɉ̈t'܈61 s t'61"s ,7t'7O`i2D(:sJ vU>Et'QX$(@T:s |] t'$(@:s # _bt'v(@dqsG qt'0"0>s qt' 0"0>s ^t' )@>s  t'&H+@j?s8  -t'&H+@j@sv L9ELt')i((@vBs Ďt'Ҏ51Cs Dt'6\  $,UsC Lʐt't?GdH`vtXs S\gt'<21Ys t'Ǒx(@ Zs9 Αבޑt'~(@Zs bt'xx(@[s D$1Ct'Ғ'ػTcs( ;Net'(vqfsg דt'FYj\t`(v"xis }t' ɔԔ0T(ĝ"Pks ߔt'$=O|(Lԝ\os Witt'- `)"Drs_ Εٕt' )'" ts +Jt',Ԡvs |Ԗזt'$(@vs4 ȫۖޖt'F$(@lws t'@Lzh8"s ,t'HЂs t'7(H(sC m%(t'4VP"0s m%-t'1V"0Ds m%2t'.V"0s {7:t'+?"0lsO m%Dt'(V$"0s lIWgt'@Ls {7$t'?P"0đs j*-t'^73P"0TsO 8Et'|".ALs t't:FU"(s țt'i9F|"$s qt'`' vlsS :Lut'Vb@vD#Ls d+3t'WXXs {7t'?P"0аs ڞt'&/4So#s ̤ݤt'/})4;h314s YbNt'+G13w sE qt'Ѧ@B) Xs d&3;t'] hP4s {7t'?P"0(s j*t'^73P"0sJ ȧt']>G4Sods htt'f% Ш\s t'")h31Ds Yb0t'G13 wtsV Sdyt'Jȩ\IfĬs Pߩt'BQĔp@wjs \rt'13\$ls  IZot' 11sJ ̫`t'Q]e(@"0sz ʭӭt'^70$(@`ws ʭt'^70$(@wPs  t'$(@ws9 +47t'I4<h32t| ENWt'Cgn$(@wt {t'21$Tt Ӯܮt'(Fm|x(@wtQ $t',tTq t ʯt'B]|("t +t'Kn#TcX"tK |t'TȰ$(" t ݰt']'4( t |<t'fȰ$(" t _h{t'51D|tJ _ht'ٱ21t?1`t ^t'#(@Txt Ut'p$(@dt Ut'p$(@tt pk t' $(@$t. $14t'uD318tz JKRt'^eh31xt "nt'R121 xHt ^t'#x(@`tj βt'g~Lqt dzܳt'!|D"t z6Ot'| 4"t@ մt' $Dػ"dt /8Mt'x4Dt t' $DX"$t ҵt' #51tc ҵ:t' C#21Ԯ?1t |`it' v(@@xt? xt'd00t ^  <t'>(@t,@ t'D;o$(@*\t t'Md;H=tC Ƕt'SӶ)@=t~ ض۶t'tx(@t ض߶t'x(@t |h t'x(@t 9 t'o(@q4 tC t' 6Hq!t d'48t'mdw$t t'$Td=p4+t >=@t'%$"0D+tC 1CJt'aZox(H(Ğ,t Et'00,t Et'r004-t 2H@t'00-t^ t'Ƹ˸'@Ԟ*d.t ָOt'P"0x.t ٸt'3Hnx(@.tO >t']P"0H.t ,|a t'`)0/t >t'P"0$/tc t'z(@q/t kknt'(@q(0t ZZ[qt'(@q0t)  t'Q9(@qX1tp Ful/t'ۍ (@q2t  t'ė (@q4t vlEt'E3(@q5t8 bt' (@q6t{ bt' (@qx7t 0t'h(@q8t # qtt'w(@q9t7 bt' (@q:tv :Cjt'Fm|x(@;t Rt'}(@;t S!(t'kek$()Tt Rot'}$(@>tB Cjt'F*@N5T?t "WOt'=c(@?t "%t'V2:*@N5h@t2 Z[qt'^7 $(@@t "%t'V2:*@N5At Z[qt'^7 $(@Bt- YEHt'*@N5Btv  t'Q\d$(@PCt "%t'V2:*@N5Ct Z[qt'^7 $(@lDti "%t'V2:*@N5Dt Z[qt'^7 $(@Et "%t'V2:$.@N5FtB Z[qt'^7 x(@Ft Cjt'F*@N5(Gt "WOt'=c(@Gt* Cjt'F*@N54Htw "WOt'=c(@Ht Cjt'F*@N5@It "WOt'=c(@Itr Cjt'F*@N5LJt "WOt'=c(@Jt Cjt'F*@N5XKtV "WOt'=c(@Kt Cjt'F*@N5dLt "WOt'=c(@Lt= Cjt'F*@N5pMt "WOt'=c(@Mt Cjt'F*@N5|Nt "WOt'=c(@Ota Cjt'F*@N5Ot "WOt'=c(@Pt Cjt'F*@N5PtG! "WOt'=c(@Qt! Cjt'F*@N5Qt! "WOt'=c(@(Rt," "%t'V2:$.@N5Rtv" Z[qt'^7 x(@DSt" Cjt'F*@N5St # "WOt'=c(@PTtR# "%t'V2:*@N5Tt# Z[qt'^7 $(@lUt# "%t'V2:*@N5Ut/$ Z[qt'^7 $(@Vt|$ "%t'V2:*@N5Wt$ Z[qt'^7 $(@Wt% "%t'V2:$.@N50XtW% Z[qt'^7 x(@Xt% Cjt'F*@N5DYt% "WOt'=c(@Yt3& "%t'V2:*@N5XZt{& Z[qt'^7 $(@Zt& "%t'V2:*@N5t[t' Z[qt'^7 $(@\ta' "%t'V|*@\t' Z[qt'^72 (@" ]t' Cjt'F*@N5]tB( "WOt'=c(@,^t( "%t'V2:$.@N5^t( Z[qt'^7 x(@H_t$) Zzt'dm(@_tq) :Cjt'Fm|$(@L`t) :Cjt'Fm|$(@`t* "%t'V5$(@\at^* :Cjt'Fm|$(@at* :Cjt'Fm|$(@dbt* "%t'V5x(@bt@+ Zzt'dm(@pct+ Zzt'dm(@ct+ Zzt'dm(@pdt-, Zzt'dm(@dtz, Zzt'dm(@pet, :Cjt'Fm|(@et- Zzt'dm(@tftV- Zzt'dm(@ft- Zzt'dm(@tgt- :Cjt'Fm|(@gt6. Zzt'dm(@xht~. mvt'1Fx(@Dit. Zzt'dm(@it/ :Cjt'Fm|$(@HjtV/ :Cjt'Fm|$(@jt/ :Cjt'Fm|$(@Pkt/ ߌt' x(@llt/0 :Cjt'Fm|(@ltw0 :Cjt'Fm|$(@tmt0 :Cjt'Fm|$(@mt 1 [ y&ot';o$(@"tntV1 Zzt'dm(@nt1 mչt'1Fx(@$ot1 ޹t'Մ(@4"|pt62 ޹t'Մ(@D"8qt~2 :Cjt'Fm|h)@"qt2 YEHt'*@NXrt 3  t'Q t)@"rtS3 7t'k411\Tqst3 Eot'|P,@>tt3 sPf&t'(@q(ut'4 Cjt'F<(@"utj4 "WOt'=c(@4vt4 '.t':?$(@xvt4 "%t'V5$(@pwtB5 *23t'6m$(@xt5 HQXt'a$()dxt5 |l/t'N(@"yt 6 |l/t':$(@HztT6  t'h)@"{t6 0WOt'70x(@{t6 Zzt'dm$(@"|t7 mv}t'F$()t|ta7 *23t'6A(@}t7  t'h)@"P~t7 |l/t':$(@~t)8 0WOt'70x(@tr8 mvt'F$()Ht8 [ y&ot';ox(@qĀt8 <EHt'0(@`t?9  t',@,t9 [ y&ot';ox(@?1t9 |l/t':$(@Tt: Nt'C$(@x tO: "%t'V5$(@t: 58t'(@qTt: 58t'(@qt; :Cjt'Fm|$(@tO; :Cjt'Fm|$(@t; ,ȺLLt'ѺY e@3܇t; d]ot'<(@qpt< 04t'o@$tU< d]ot'|`(@oHt< WEHt'g +@)Tt< bt' (@q0t= 't@H(tO= |Ի'y",H8 &ܪt= f3o' 6(@wt= ,u'Kj`@_O̬tN> ,'"oٿ޿`@_Ot> 'm!(@t> 8l/'׊n@t/? |'L[ (@"Xt? 8l/'׊n@t? |'L[ (@"t@ 0YEH'n@Pti@  'Q )@"t@ 0:@=(lH1ضt@ =(  t ĸt9A =( t tA pk;B=(54P"0tA K1T=(;]puP"0ğtB ~O=(?;"0DthB o=(C%"0tB UX =(G00мtC S =(LQ(H(ptUC UP=(^11TtC T=(gmcx(@tC Z=(m1D,tzпt;D S O=(zQ(H(ptD U^=(r11XtD T=(mcx(@tE 0=(,tztjE "3=(6(H(|tE U=(r11dtF T=(mcx(@tJF 0=(,tztF "1=(d(H(tF U#=(%r11tt5G T7=(.mcx(@tG 0==(4,tztG "1S=(Ad(H(t)H UY=(Xr11ttH Tm=(amcx(@tH 0s=(g,tztI "1=(td(H(tbI U=(r11tI T=(mcx(@tJ 0=(,tztWJ "1=(d(H(tJ U=(r11tJ T=(mcx(@tTK 0=(,tz$tK S =(Q(H(tL =(V'$"0xht_L 0=(w?T00tL 4GO=(x0tIԟtL %x !'=(W#00htMM (1<=(GZ$(@(tM enu=(d~x(@tM =(62tGN :Cj=(Fm|(@0tN <EH=(Xx(@tN =($(@t5O z(/9, 00tnO jjz(j)((\HtO (0Jo9z(->t8X[cxtO x% Gz(tMP,X`tDP Vz( \IhIxptP 'z(h % =ptP 3?Qz(>}Lg$TtQ (z(+@x,tZQ (#5z( C+@xtQ (z()9I\ܿxtR woz(:k42tPR (PKAz(Mh"0xtR z(m,5S$T4?1tR (HYz(0kjDHxt.S qz(>?hzY|durS m*z(Vk-004qhuS m*z(Sk-00DqDuT <'z(y'}PXud$uXT (Fz(D =xuT z(1T|$?1(u3U xYz(MP,XuU z($|q",uU )5z(2j yuV  z(Q9(@q uTV  z(Q9(@quV z(HQTPuV z(H5 21\du-W yI z()$(@q usW 4z((@quW  z(Q9(@q`uX +.(700uX JT`(T9)H(ؼql!uJX jG(^00"uX 7]I@(41Xq%uY (VkpJ3)u&Y v(00)uH}P"0t(,uܡpt()TCu\ ()@xt?1GuL] asw(K]DOo\ԇNu] =(_A|-@dRu] (}D$%_u] (#6=l44 yq`u3^ R0\((@w duK^ k(:x(@@ydun^  (&w +(@`yqeu^ *23(6m$(@pfu^ *23(6i(@gu^ O <(_ f 21\hu^ ENY(9pu(@yqiu_ *23(6m$(@iu&_ *23(6i(@HjuG_ O (_ f 21\$8kuh_ ((@yqlu_ :Cj(Fm|$(@lu_ *23(6i(@Dmu_ O (_ f 21\44nu_ (AZi NY\yq"|qu_ z(' ,W1vuw` Zhv(=1=S, W1u` <Z>(s<1pu` (12yUbxtĢ=v  u&/)(\Ԣ8?vڅ gE36 EF D"0?v+ A< ]^7CP"0L@v| O B _ f 21\  (@\xv    )N) : E `K|_Xtzv f o | )Q)  \IpJĈL|vK    )a  (@q}v{ $  ")rnUU|$!ɽv E)]00@v "^){,?00 v 0)Fo|\'FxvK : |)e t y )'|vr  X )Q (@"`v  - ) Q (@"v ) $]|J |?1v 4 ")-<A00@|p@vG 3DO)i| 283`|tvz 4 )-<A00|pv () 283Xv 4  )-<A00|pv '0) BK51|$v7  T)h$ r 8)vvo d])(]00 Tv d])']00 v )r );00dv2 "^),?00ءvu ".5)9OXH64Ԣv _w):_IȿDjv _w)I_IȿTjv &1)Xo{%v "2),?00v &Cj)FP"0v WEH)|*@P"0v ( c*O-Bȉ\a(vӐ Oaec*gs$K?Xv c*u$K?v5  c*2QZLpJdvg Haqvc*S\lN\xv c* *hJ vߑ 3^qc*  Hv +CHc*f{JvŒ Pc*I`pv d49c*6`p,Xv, }c*=(E.tvl LS_cc*pk~|@v c*xJv c*[#@?|7"v .9c*]-<A00}pvK Itc*k| }"v . c*v-<A00@}p,vȔ 9@c*2`g*(\"$v nc*283`}"8v .\c*-<A00}pvS <c*29,383}0v| .Dc*-<A00}pv @Tc*+  9j`ؾ v <Nc* ' z 8  nv &7C`c*F600XTvI L  2!c*!!!$RPs qw )r<"c* ;004w / ""c*@I4%"x(T((w ,">"B"c*N"",<" wF """c*c""22} wq "##c*t0#?#J#S_\ w 8U#n#r#c*8##Vlwdw <###c*\($F$[$V0@w e$~$$c*$"%E%Ixxw 8Q%_%c%c*%%p\0\w5 4%%%c*%%L7F wZ ,&!&%&c*W&r&V $w~ &&&c*&&)@&w &&&c*''8)@'wΘ '7'?'c*i_'''8Jģh*w '''c*x(((d@3w1 d).)3)c*b@S)W$`:d7w] @h)u)z)c*L))؁$d/:w H)))c*a )Hw4 vlEc*EE(@qd?wd **X c*$Sx(0QD@w 6*MvHc*B*U*)0Q"8Awɚ PZ*23c* 6\@Aw f*FHc*r*>6x(0QBw& *MvHc*B*U*)l"Cwa ***c****1ԣ"Dw **c***(@qlFwЛ **9c*q*(@qtHw *+bS*S+(@q Kw. vlEc*EE(@qKwW Ybec* h(@qLw՜  c*Q2b(@qMw O71d +(@DNw4 O71d +(@Nw^ ++%++2A+n+s+0(l`Pw| `++',+K/--.@ K  gw I.]..+/00Xx`qw 000+ B 0H1qhsw 000+ e11x(hywQ 111+'222@S,Xw "3B3}3+v34%4T0 \W1xw N4o44+555t W1w  C6]6{6+E777< \q@w 88+-<A00~pw7 X/8I88+9S::  : 8w ::+(@"Hw ::+;;(@w\w; ;Xk';+k=;D;(@ ~w0w W;h;k;+ (;Ti`i]غwˢ f2r;+;00 Tw ^V;+`(@"lw1 P;;;+#<<=XD D&w_ 3=<=+N=m=00q w 4+(@qwǣ :Cj+Fm|(@Xw r={==+}==11lw" ===+>'>,>(@wP "%+V2:)@"Hwz Z[q+^7 x(@w "%+V5$(@dwդ O71d +(@ w O71d +(@w) 5T;>Y,?T00wG A>K>O>Y,c>>8tRxwk >>>Y,.G>>P"04w l[q>Y,H^7>P"0wǥ >??Y,AR?}??tUw$ ^a?Y,$(@wN ?@@Y,:BBB0`e ww HCfCxCY,uCCC`[Xwk <EHY,Xx(@Pw LDDY,LLx(@wͧ "%Y,V5x(@w D'D.D,RDcDhD00|wE oD{DD,)DDDHEDhw EEE,:EkEvEw@~F,FFF00w FG G,LGcGtG`|`~,w0 GGG,y;HKH$+@3lxS BZQH,kBB 514?1@x l[qmH,)^7C"0xͫ ,sHHH,1$I4I X@34 x (:IFI, (nIuILe@D3x1 LEI,EFx(@Tx\ X=I, 4>P"0x| X=I, 4>P"0xx X=I,4>P"0x X=I? ,4>P"0Hxܬ X=II,4>P"0x X=II,4>P"0x X=IK ,4>P"0x< X=I,4>P"0x\ X=II,4>P"0Px} X=I-h ,4>P"0x X=I1,4>P"0 x X=IL,4>P"0x X=II,4>P"0x X=II,4>P"0Xx" X=IU,4>P"0xC X=II,4>P"0(xd X=II,4>P"0x X=IZ+,4>P"0x X=I]+,4>P"0`xǮ X=I`+,4>P"0x X=Ic+, 4>P"00x X=If+,!4>P"0x* X=Ii+,"4>P"0xK X=IJ,#4>P"0hxl X=Il+,$4>P"0x X=I7u,%4>P"08x X=I,&4>P"0xϯ X=Io+,'4>P"0x X=II,(4>P"0px X=I[,)4>P"0x2 X=II,*4>P"0@xS X=II,+4>P"0xt X=II,,4>P"0x X=II,-4>P"0xx X=II,.4>P"0xװ X=II,/4>P"0Hx X=II,04>P"0x X=II,14>P"0x: X=II,24>P"0x[ X=I,34>P"0x| X=II,44>P"0P x X=II,54>P"0 x X=II,64>P"0 !x߱ X=II,74>P"0!x X=II,84>P"0!x! X=II,94>P"0X"xB X=II,:4>P"0"xc X=II,;4>P"0(#x X=II,<4>P"0#x X=I%I,=4>P"0#xƲ X=II,>4>P"0`$x X=II,?4>P"0$x X=II,@4>P"00%x) X=II,A4>P"0%xJ X=I) ,B4>P"0&xk X=II,C4>P"0h&x X=IM ,D4>P"0&x X=II,E4>P"08'xγ X=II,F4>P"0'x X=I7,G4>P"0(x X=IKj,H4>P"0p(x1 X=II,I4>P"0(xR X=II,J4>P"0@)xs X=IJ,K4>P"0)x X=IJ,L4>P"0*x X=I ,M4>P"0x*xִ X=Iu,N4>P"0*x X=I J,O4>P"0H+x X=IJ,P4>P"0+x9 X=IJ,Q4>P"0,xZ X=IJ,R4>P"0,x{ X=IJ,S4>P"0,x X=IJ,T4>P"0P-x X=IzT,U4>P"0-x޵ X=I"J,V4>P"0 .x X=I&J,W4>P"0.x X=I*J,X4>P"0.xA X=I.J,Y4>P"0X/xb 2JN,rNNNxWxη $l)O>OBO,TOcOjO,,@4~'G4YxJ )ruOyO,;00Yx} (}OOO,PrPP؜d)vx`x/ PPP,PPDd0bx~  Q.QEQ,QQQdttqfx QQQ,9(R?RNRliS?1ix˹ ZRgRqR,QRRRt8H~qtkx RRR,aCRS(61?1`mx5  S"S2S,@KS|0*nx_ kOZSbS,dOO00ox kSSS,!TTT((xx # U#U,!0UKUt)@K>yx+ PU]U`U,unUx(@zxN uUUU,KjUx(@|xr UUU,9UU(@Ĥ }x UU,LUU$(@Ԥ}x VV.V,ZVVV$txx VWW,w!W 0WP"0hx# 7WDWMW,_WrW{W(H(xE WSW,Wx(@Xxi W,Lx(@hx WPW,QqWPJpx BWW,`dW(@x ,^ W,f)00x NXW,kY\"0yr\x1 W%X)X,!pX|X"0lxR XXX,L{YYZ\x "1Z@Z,fZmZUJxؽ |ZZZ,)@x ZZ,$"0x* ZZZ,ZZ[5H?1xT |[ ,x(@x~ Z [,$"0x $[V[[, y\\\<L hxԾ \],],F]]]xi\O?14x ^^%^,ig^r^PKؿx, |ZZ^,)@0xV Z^,$"0@x ZZ^,ZZ[5HԱ?1x |[ ^,x(@0xڿ Z^,$"0@x ^^,m+P,X x* ^^^, 1_8_)@~HxP G_T_l_,___)@~?1hxx Z_,$"0xx  __,1`6`)@x M`n`,``)@T?1̷x ```,``$p<x Z`, $"0йxC `a, &a%a N@Mx r|4a;a, GaXa_a51$?1 x faoaxa,aaaHQpJ4x Za,#$"0x& `a,$&a%a N@MDоxM r|4aa,%GaXa_a51T?1xv faoaa,'aaaHQpJdx Za,;$"0x `a,<&a%a N@Mtx r|4ab,=GaXa_a51?1x faoab,?aaaHQpJxA Z9b,U$"0xm =bJbSb,Xqbvb)@|x E}bb,abb)@?1x sb,o|x(@x b,(@x bbb,5c@cHQpJxE `ec,&a%a N@Mĥxn r|4a}c,GaXa_a51ԥ?14x Zc,$"0Dx ccc,'7cc)@ x ccc,I4cc;1\?1x0 cdd,jd2<\8xc Zd,$"0Hx ` d,&a%a N@MXx r|4a6d,GaXa_a51?1x BdEd,Id21\Dx ZPd,#$"0Tx> r`Td,&hdwd\Hxg dd,.edd11$@x ddd,5ddd5H4?1Dx Ze,E$"0Tx |[ e,Fx(@px B8-e,Hdi )@x0 Y,e,IeT5H?1xY +e8e=e,kwe~e$(@Dx ee,Tee00x 0e ff,h4hFh& cx $hhi,zij-j2x] (EjZj]j,jjl1xxz $jjj, k!k'kW@&tx $@kQkUk,kkkW@&x (}kk,llf2x= ,lr&l,9e4lJ0xY 4;l_lnl,Clll|l2Tcxu $lVl,]lm@J(2x 8 m4mo^onoxH y (vooo,8o+p8p{>py @pRpUp,qepp)@?1y# ppp,чppTZJqyv qq1q,:bqkq:H E|y |qqq,(q(@y qqq,?rNrWr21W1y ,rrrr,O ss8X0y- (Ksiss,_ss12ys ,t@tt,yuuuHt 0$y (vv%w,w>xFxPL@u 2,y xx,(@-y (xxx,,y3ylH@/y <Bylyy,FTzxzzp127yl <zz5{,fq {{8;y &|/|6|,\|o|x|11`",=y |||,|||11"d>y8 $||}, }'}@J@Ħ2?yZ $6}C}R},Gt}{}d@Ԧ—|yyv ψ҈,i܈@H(qpzy ,,(=lKw|y 4FSV,i/19y}y (nψ{,W@~y ,&ЗsyryY (,؋2dy| 89Z,/?$i2y 4y,"p+ wыy3 @;EI,4})HPy{ ߩ,F00Зy Ɏ֎,K5GXp8\y |,W$(@xy y,$(@,y ,7Ϗ8 P"04y1 pkޏ, x(@yV >,$"0y ,"72 xy @Lt,# NK|ġy1 ̐А,%00q`yb ڐ ,/EVa)@?1ly ^x|,G(@y ,^$"0y ,`ߒt0f y p,Γٓ NU $y, ,+FQhlK$?1ԲyT kX\,(@yy f,$"0(y Ujn,0"0Ly r,P"0\y >v,$"0ly5 z,Q8)@4?1 yf ,$"0y ,$"0,y N,3Hx(@y ÔӔ,)@@?1\y E,.)@Dy& ,@$"0yO ^x,A(@yx  0B,CU NUd\y ȕ,O xiT`?1,y /AM,\2̽y ,$"0ܽy$ Bʖ,Ԗ)gx(@T\yQ ,(@py{ ,&a%a N@Mdy r| *,GaXa_a51t?1y #,$"0y ^x8,(@y% <IY,ч NUyO ȗ,E`mxiT4?1y{ ,2Xy ,$"0hy ߩ#',d)gx(@y +,(@y" B#/,di )@|yK Y̐3,eT5H?1yv ;,B(@,y Ί?C,C,x(@y G,D&a%a N@My ],E(@y r| a,GGaXa_a51?1y; o|,YƙיH$Ly_ =,x D"y ,Sei,%P>&y ˛,>/@GiJX&Ty (bor,O,Hyrhy T,WĜCHyrXy? ˜؜,pEUjhyc 4,̞&c\y (,8G,eiLlIJMy 0Ÿ, scy 0 *<,ؠpPy $3o,E%144P"y5 AM\,"(' y[ ע,(@T ?1y ,(@?1@z ,W,¦8H?1Lz pkN, x(@z( ch, x(@XzL P ^ ,/ 21zq L,8+2p1z P ^4,B 21z P ^8,J 21lz  <,SBQP4Pxz P ^\,] 214 z! P ^b,g 21 zC P ^h,q 21 ze 6 n},|PK z 6 n,PKħ z .sƧ,@̧x(@X z Lӧ,+2p18z 6 n٧,PKԧLz P ^, 21z7 P ^, 21zZ  ,BQP4Pz| , ,*:|z XO,Sb210z k;,| z _l,%2z ұ߱,B5MD[,TEz |,X lHz0 O.1,KZIzT gp,d1H@DKzu ϳ,dsp$Mz 6 n,PK8Nz  ,dspPz  5,BQP4P$Qz AMb,~H `Rz& , zMpTzL 4,jvp, DVzt ,9 ~MXz ,YzMtZz P ^!,f 21`[z %2Y,uöֶt@, ^z. r},HMd1Hl_zP \h,ӷppazz )D,~TX8dz Ƹո, 53ez Z%,O?P8IJgz AM[,~H iz .sw,@̧x(@iz0 {,zMXkzT ù,*Jahpz ,ɺغ\ qz X,+Sb21rz ,4-<MP$tz CSh,Blvz$ ,Q-<MP4xzG 6 n,_PKDyzi Xһ,iSb21zz Xֻ,qSb21H{z ڻ,|!(PT T|z a,,n021\}z a9,n021 ~z =7F,JY23`~zA P ^b, 21zd P ^f, 21Lz .sj,@̧x(@Ѐz nz,L<d|z ȼѼ,d1H z &,zMԴtz! JW,&qtxzD ao,FRr0 \zj M#,%H(@@Pz Yfu,.P"00@z '4,NjvT(h>,z ,,\d@0Tz ,,<Ht0z ,+F,xi@`0ğz7 ,,#.>Ei@0z] ,^j( ,3)00,z~ ,m,7\d@0z ,z,?H0ȣz ,,GENH0ԥzI ,u,WEU\\d@0zn ,u,kEU\\d@0z ,(q,\d@$08 0` { ,z,HĨ0 , EHyr|d ,x(@| ,x(@| ,x(@,| ,x(@@| ,x(@T| ,x(@h|< ,x(@||_ ,x(@|  ,x(@| !,x(@|  ,x(@| ,x(@| ,x(@|: ,x(@|_ ,x(@| !,x(@0| %,x(@D| ),x(@X| -,x(@l| 1,x(@|7 5,x(@|\ @,x(@| 9,x(@| =,x(@| A,x(@| E,x(@| I,x(@ |8 M,x(@ |\ Q,x(@4| U,x(@H| Y,x(@\| ],x(@p| a,x(@|  e,x(@|, i,x(@|N m,x(@|p q,x(@| O,x(@| u,x(@| y,x(@| },x(@$| ,x(@8|B ,x(@L|e ,x(@`| ,x(@t| ,x(@|  ,x(@| ,x(@| ,x(@|B ,x(@|l ,x(@| ",x(@| ,x(@| ,x(@(| ,x(@<|# &,x(@P|E ,x(@d|l ~,x(@x| ,x(@| ~,x(@| ,x(@| ,x(@| ,x(@|B ,x(@|e ,x(@ | ,x(@ | ,x(@, | ,x(@@ | ,x(@T | ,x(@h |< z,x(@| |` ,x(@ | ,x(@ | ,x(@ | ,x(@ | ,x(@ | ,x(@ |6 ,x(@!|Y ,x(@!| {,o d1H$!| {,o d1H4D"| u#.,'7BI(@D #| ;zT_,d1HT#| B,-dW(@dd$|% ,2Ui@ t`%|E vU$,:1DBd1H&|e {Q\,Botd1H&| ;z,Jd1H'| H ,S(@L(| ;z ,Yd1H$)| u#/,_'7BI(@)|  ;zC,ed1H*|/ jfq,n^7KUd1HĩT+|N jf,w^7KUd1Hԩ+|n B,}dWV(@d,| B,dWV(@,| B,dWV(@d-| W,d1H.| {Q,otd1H$.| J 4,q|11/|5 ,d1HD1|Z {Q,otd1H41|{ u#.,'7BI(@Dp2| {BI,o[d1HT3| Bb,dWV(@d3| Bp,dWV(@t4| u#~,'7BI(@4| H ,(@5|8 H ,(@d6|W H ,(@07|v H ,(@Ī7| _3 ,w  (@Ԫ9| H  , (@9| H ) ,(@:| q= H ,mj q (@;| B| ,$dWV(@ <|7 jf ,+^7KUd1H$<|Z vU ,11DBd1H4P=|| H  ,9(@D>| u# ,?'7BI(@T>| jf ,E^7KUd1Hdt?| c !,OV!d1Ht@| ;z"!,Ud1Ht@|. H B!,[(@A|N . V!a!,a&w!~!(@B|m jf!,i^7KUd1HDC| ;z!,od1HD| . V!!,x&w!~!(@,E| ϩ!!,""&"d1HԷLF| u#=",'7BI(@īG| jfQ",^7KUd1HԫG|5 _3 e",w  (@H|U vU}",1DBd1HpI|u u#",'7BI(@8J| jf",^7KUd1HJ| I"", "#UJ$K| jf #,^7KUd1H4L| . V! #,&w!~!(@DM| I6#A#,Y#`#d1HTtN|; jfk#,^7KUd1HdO|\ I6##,Y#`#d1HtO|} vU#,1DBd1HP| B#, dWV(@Q| c #,V!d1HQ| c #,V!d1H4R| c #,V!d1HĬR| jf#,#^7KUd1HԬPS|B $$,M00xS|k ^$!$,&00S| %$2$p$,%(")6 | b,e(@qh| +&5&: ,pn)(@q| MMvH,I4M(@q| w,H5u)(@q$|/ LL,F|)(@q|S \+.,(@qH|u U2N,)(@qT| \+.,(@q| pEmHm,(@q| pEmHm,(@q| \+.,(@q|% pEmHm,(@q؏|H ַ |,(@q|l ַ |,(@q8| \+.,(@q| ַ |,(@qH| ַ |,(@q| j23,6w(@q| j23,6w(@q@|@ Fbo,Sb(@qԔ|b B,)(@q| V_b,e)(@q | V_b,e)(@q| \+.,(@qd| LL,F|)(@q(| !',C4(@q|1 )2N,)(@q|S LL,F|)(@q|t ַ |,(@q`| ַ |,(@q| ַ |,(@q| ַ |,(@qp| V_b,e)(@qh| ַ |,(@q|= LL,F|)(@qܠ|^ **,*)(@q| !',C4(@qD| ַ |,(@q| ַ |,(@q| ַ |,(@qT| XNl,i)(@qT|9 ַ |,(@q|\ ַ |,(@q| ַ |,(@qd| U2N,)(@qp| pEmHm,(@q\| V_b,e)(@qT|  MMc|,71M(@qج|0 LL,F|)(@q|Q \+.,(@q|s qqt,(@q| 4,(@qȯ| ))a,)(@q| pEmHm,(@q|| =d,G)(@qس|) pEmHm,(@qĴ|K >,)(@q|o pEmHm,(@q| V_b,e)(@q| )Nx,)(@q8| pEmHm,(@q$| Fbo,Sb(@q|! ַ |,(@qh|A! >,)(@q@|c! ַ |,(@q|! pEmHm,(@qܽ|! ַ |,(@q|!  ,Q9(@q,|!  ,Q9(@q̿| " --,(@q$|K" --,(@q||r"  ,Q9(@q|"  ,Q9(@q|" <EH,Xx(@X|" ^^a,1x(@p|# ^^a,1(@|0# ^^a,1x(@|W# ^^a,1(@|{# ^^a,1x(@|# ^^a,1(@|# ^^a,1(@|# ^^a,1x(@|$ ^^a,1(@0|#$ ^^a,1x(@H|F$ ^^a,1(@`|f$ ^^a,1x(@x|$ ^^a,1(@|$ ()lE,E)Le@yrd|$ )* *,*/*6*CHyr|% dA*l**- +'+>̰x|5% \mEO+-a+p+Np|[% {+++-; ,,;Hz =p|% T,e,r,-G,,1H=p|% ****,(@ql|% ,,,*N---@h8P|!& `.: .*(.K.U)|[& `T. y.*1...D)|' P./%/*JM/v//HI\4"|Y' \/V/*Z//$|' \// 0*eH0f0u0 I8I|' \000*y01\|( X1/)1*U1d1s1Lj|K( |111*r222{g 6|( 3&3S3*333P (|( 404?4*Q4d4m41h@ "H|) x444* 4 55SU "h|R) s!'75*C}$(T( |) vaO=5*C5'@"|) H5*#U'T("h}* ZN5*'&V5__,x}U* ,_5kk5*8{58u}* 555*G 55`(@"$}* 555*U56X6P7, }+ o68${6*r66Hq }f+ D666*e661 }+ +66*"A+n+s+0(lL}+ 7G7t7*20888t$}<, 8819*4:::78<v&}, ;%;P;*;;<@P.}- #<-<1<*<=T6}N- (`=*yTQ47}- N==*3Hx(@@8}- ===*>->:> x":}- b4A>J>*\>k>r>,383@;}-. {>>*-<A00`pP<}p. !>>*!!> 283D=}. {>>*-<A00p=}. $>>>*":??d_\X?}#/ $?B?F?*0s ? W1B}X/ $???*r @-@F@hj0$MwG}/ $R@s@@*AABT( ?1T}0 ~9BFcF-n}I2 tFxF*~00 o}{2 p|FFF*FFVJxo}2 pFFG*GNHzH6 hp x,}2 pHHI*pIIIhRxP}53 III*#JFJUJȎ%t}r3 @^JqJ}J*-JJJ̵ #"̏}3 JJ*/͢00@dt}3 J KK*;HKmKzKܵh`MD}/4 JK*=͢00d}p4 |KKK*EKK|t@x}4 tKKK*EKLtLJ}4 pLK0L*J:LUL}5 4^LqL|L*YLLL d}M5 LM M*sM;M)(}x5 @MSM[M*~qMMM 4}5 MMM*MN4̢}-6 $N7NEN*hNNNԷ }m6 NNN*NOPI@}6 HO;O@O*OP!}6 ~= Nc[cgc*ccc8A~1> ccc*c)C~t> Dcdd*8+dRd˜E~> [dyd~d*-dd;I~> dde*KneeeL\\$" N~!? eee*p ff "P~Z? "*f4f*DfKf411\t"Q~? PRfdfif*ܢ f$TT~? Pfff*DgggYp]p*<kp~p412"~>E wpp*Ippp,)T(~E (ppp*OH5ppP'Fؓ~E (7Vq q*YfWVqWT(~F sq(q*^CEn2q*T( `~PF ,;qGqQq*cKjaqhq$4@c~F qqqq*gqqj~F D rr%r*Orbrmrj0`~F vrrr*>stssD`0~*G  sX *Q (@"Х~lG  sX *Q (@"p~G vass*C5*@~G .ss*Ftx(@|~H sss*5a tt|pt"Ĩ~H ,!t-t7t*VtttQLl`~H ttt*tt(@X~H fEt*;00 ԫ~*I ttt* uu$uHDԭE~]I  sX *Q (@"$~I +uhuu*)uuvH+~I kOv$v*1dOO00~J 0vUvcv*Tvvv};"p~PJ kOvv*[dOO00~J vvv* ww\)_Dx~J "wCwyw*-w4xWx.X} q ~K xxxx*b yKyZy܀q~`K by}yy*nzzzX p; G40~K M{f{k{*{{I\l?1~K {||*}~@61  W,~GL *XDQoL az*nd __"HL ȀH*Up?|(< VW1<M ς#*ȃDŽ0Ph L""N 5\*;z p L6N ɇՇه*݇007N  *Zވp, Yq"ABO  :*J_vH7DBeN t*_`CO ĉ*rҊ)vMO $*Lci)x$qO9P q~*a)@qxP{P *Nj؋yIqRP *j*d ǯ* 4ShVl #dAKe $ *Ke VlK\Be i&:*^{De *ΰsEe  *%4A8(GAf  sX *Q (@"Gf  H*%4A8XIf  sX *Q (@"Ig  \*R%4A8KUg  sX *Q (@"(Lg px*%4A8ĮMg  sX *Q (@"XNh *7%4A8ԮOPh  sX *Q (@"Ph *F%4A8Rh  sX *Q (@"R(i ?+H*9ı(@qSZi 58*˱(@qpTi 0*h(@qUi 4*(@qDVi vlE*Eұ(@qW4j  *Q9(@qWlj 4*h)@lXj Xױb*@HYj Xױb*@$Z%k X*8KTDX[\k Xgbe*s'\k Xgbe*s'^k X*ɲDl_l i*6mjx(@|`Hl "%*V5$(@a~l d]o(@al I*k (@qbl *٭(@qc.m oZ*k(@|eZm O71*d +(@$fm O71*d +(@fm O71*d +(@tgm @!FU-ʳ ln \׳-=%Xy,($PrXn $Ĵ-PCd; Teyn t-R-<A00pzn D}ȵ-yDk_G4o )r -;00Do ,-p:E@d*zo ,bu}-ηٷ X$o 4-6T'Fo 4]-JEd 'Fp ^hl-p p(@q Hp w-b@(@q윀hu 23-6A(@qu vlE-EE(@qdv ]`-x!(@qTNw  -Q9(@qw P̹ .S-Ah MDw MV .U-<A00@p` x ,fӺ .tWƻ4 O*hIKx )rS .;00x 3 .gp31ܲx 4 .ܼ'F8x 4V .,0'Fy ?+H .9ı(@qBy p 7c_.0[\$+kDx€py ty_.-<A00`pÀy p Ӿ_.GS\4SD̀y tӿ_.I-<A00p΀z @$_.IzhyӀDz t_.-<A00ppԀ}z @H_.Yd3G4܀z )r _.;00L݀z 4_.9!@̶'F߀{ 4G_.J!@̶'FH{ $o5_.c(@qXu{ Ybe_. h(@qt{ (j.*<` lH$ | )ron.F;00?| =.^7l (@"~| 4 |.yJ  l 'F<| )rot.;00} =.^7l (@"H[} 4x=./vlp 4 'FT} )ro.;00} =.^7l (@"`~ H.5(@q~  .Q9(@q0~  .Q9(@~ |pQ.}x(@#  ,.' Ll=EW14O |pQ_.$(@Py cALu.\l4W1D }.(iK=p a1.ax(@H |pQ5.$(@d> 9KO. 0\W1" "6.JP"0D#Հ ."Sb00T4$ .,QKP"0d$  !.@_kihItW1+: .X_p@-b .*p\iW1|/ . \)H(t0 "+2.jDMh311Ł YFH.f* (@q|2 Ful/.ۍ (@q(3  .Q9(@q3D *23.6i(@W1l4j 4.)@ 5 <EH.Xx(@5 "%.V2:$.@N5H6߂ Z[q.^7 x(@6 Tad.,;H"7; |u.P-L xŷ>q l.R-<A00pl? |Hu.u Gl,x >ŷG l.w-<A00 ppH) =.=^7 )@IZ .B ܶ@q3V'FY` vlE.EE(@qZ U\.1cx(@į[Ȇ jsv.:y(@q]  .(@q^. ;.(@q@__ H.5(@qp` [/I)(a [/R)2QKԯ?1c ER][/ 5`2`e5 [/283"ft [/-<A00p\g \[/3HO283W1h X[/-<A00ptiA ,h|[/,UL $0 xELp 8[/%Ou\ xڊ Wl/6E83+  /8-<A00pDd /cChu|=p䑁 /?l[6x(@ɋ /T q /:1D엁 /'EF2a p6:/]0l Ppz/ tIq@ ݪ/#=U00/ //@dOP P"0@q,^ +4</AHW00"ԣ  ^X /Q (@"tэ b7߅/ek(@q8 V_b/ep(@q0" b/ (@q I .[ ^UP/7[ (@qu H/5(@q LPuz/00ǎ .c|/\5H: /000+ 5FbB/`jJ"Hd /T(/ȿ$ 4Zp/k`< ;z/  T(H(41 !</ ?np}LȿD{ uUP/T(l(Ő /T(H( ;z/ T(H(TÁY  l-/1=N071ā ,U f/CPsB`ŁǑ 3/k6tGHKƁ / \51dȁe s-/ $((\ȁ A/N/Hf@l(\,ʁْ mHz/fh/@ʁ /e "ҁz /'_.@tg#$ԁ *9/BY\I "ց \/uȇ @qd "/,?00(\ O/ HH: 2B/=t4H4#"ϔ )ro/>;00\  Hm/R4 5H"Hy ܊/D"0pÕ ܊/D"0 "23/6|*@K<9 "71/d )@s "23/6|*@K "71/d )@0 "23/6|*@K "71/d )@|S 58/$)@8 Y0#n#/jlK"Ǘ $8PTY0*s oH\x $zWY0x!Hh@  Y0j<] $8Y0`s oH\˜ Y0~]+j4h\ 4~=Y0E)@?1S NVZY03Hx(@ $`x}Y0>X ߙ Y0lj<] % $ Y0^x!H_ ,>BY0VVj<]h (_w{Y07>Idޚ ,Y0Gч>) $Y0b P)D_ $zY0Xx!H4 ,6:Y0uVVj<]қ $8LPY0Fs oH\ lpY0e]+j4h\S (_Y0OT I Y0SQ8Ld. 0]|Y0 +(@ ud3O $tDuY07fDCu9 (Y0@H(: Y0Q Uy>2 $z48Y0Ux!H@l ,TXY0yVVj<] B $8lpY0Ss oH\Cޞ Y0d]+j4h\Y0(@qB **9Y0q*(@qć &0 Y0:4 4(@qƨ  Y0Q;(@q B71Y0dO(@q\S oZY0kV(@q0 \+.Y0(@qʩ ]j(Y0n(@q 4Y0(@qhE vlEY0EE(@q< u&}Y0~(@q yI Y0)$(@qt yI Y0)$(@q앂: YbeY0 h(@qu HY05(@q8 knY0(@q,ܫ yCHY0(@q vlEY0EE(@qE Y0Kj(@q؝| oZY0kV(@q }Y0(@q 58Y0(@q 58Y0(@qxX YbeY0 h(@q Y0(@q0ȭ ҵY0(@q **9Y0q*(@q 2 WtY0F(@qp oZY0kV(@qX HY05(@q YbeY0 h(@q# YbeY0 h(@qO vlEY0EE(@qx wY0H5(@qش yCHY0(@qd߯ FbY0l(@q **9Y0q*(@q G MY0,(@qy vlEY0EE(@q /zFY0I(@qܰ vlEY0EE(@q YbeY0 h(@q9 vlEY0EE(@qti hY0'7A(@q<‚ **9Y0q*(@qDĂɱ WtY0F(@qł WtY0F(@q ǂ" ^gjY0j!(@qDȂS wY0H5(@qɂ YbeY0 h(@qʂ HY05(@q˂  Y0(@q,͂ ҵY0(@q΂Q HY05(@qDς u&}Y0~(@qт 2(2/ Y0((@q<ӂ YbeY0 h(@qXԂ HY05(@qՂG vlEY0EE(@q\ւ **9Y0q*(@qd؂ a!d!Y0g!r!(@qڂ vlEY0EE(@qڂ I5$8$Y0/(@q܂C vlEY0EE(@ql݂w vlEY0EE(@q@ނ WtY0F(@q߂ҵ YbeY0 h(@q knY0(@q; HY05(@qg u&}Y0~(@q yI Y0)$(@q u&}Y0~(@q u&}Y0~(@q l/Y06*@W1HP 6@I0tz |0COwԑSŷٷ !0E-<A00p$ |0Z V|J ŷ,I 0\-<A00@p 4/Ba0$X'F 4/B040'FH h0'7A(@qA ;0(@qti EQ VVl| ?1 er !|j" U )@ #L;  C؉88 8   (:A283`q̺ LBV *-<A00p Ub .&&"&$((\( i lq~ /H:7 L 1-<A00pP  $  BAVL 0d U*TTalK ux b|@+ n X|h)@" 0 }S8 HԽa-8 %  4f00P. G G@/  $NhX"<1ھ *5 O_fx(@@3" u @2q"5k  L3@i7  'JT>H q": dqt ~22;G  L3@iD=  $(@@>   *q(@İ"? 58 )@d@i [l=/ $(T(԰G  &=L[ 0*@"28"M Ujm= zpO ,=#` \wQS =,U8S )8=-Qhu`t `hUc =%U8W )=&Qhu`t ,Y u=9 \=pZ 2>=?'n>y>80`\\S 2> =;'n>y>80`\^ # *.=C`x(@_ g=.B w  df   =R  31pgD f =X;00 g  " =\   km    =dA ^ q $(qoI @|   =   +)W1Hx   =J   P\{ TD=,?00 {f   =-<A00pt| $   =&GRv$ fe=;00 ,V P i=CwX0tq =Vq00 F ݪ=_=U004 =E(@DW1L =W 071ԏ" '8=oPaP8Hyr\f jw{=t,@yrL =V(@"ؒ v=(@TG4$ v=,)@dG48k =06A$J)v4/ JW=D:2+"Зz  $.=\Vm|4tq =t)`u4DЊq| "=,?00 S = 3ܡР :RW=uT(W&4 =]<`X褃 =00 `o "=,?00ԥ f=;00 P ?=?XJY|#qZ /=dOO00 &3i=-0 D,vx T^s=$dqȰB  =,D ,'48=L]h yI =)h(@qഃ 2(2/ =o(@qV = (@q Ybe= v(@q$ =(@q, vlE=EE(@q` ${=($x(@@ OWO=Gl$(@ȼ ||pQ=TU$(@伃$ T=T$(@h UU=U$(@ıX _71=&U5U(@ tt =:UAU(@?140 T=T$(@Աlu UFU=U$(@ v|=QU)@EX kkn=dUoU)@Z3L Z[q=tU (@*, ||pQ=TU(@qH v|=QU)@E) kkn=dUoU)@Z3<v Z[q=tU (@* ||pQ=TU(@q v|=QU)@EƒV kkn=dUoU)@Z3ƒ  =UUU61 à U=U VV61@ă3 _71=&U5U(@Ńs tt =:UAU(@?1Ń 0PV=P@'Jƃ 0=%OP@+ƃE 4= /@@ǃ (!*S1;DtPɽɃ KTWS1J4P"ʃ% S16%ATmq΃j )r,\S1?;00σ (`:mS1OtJɽLЃ (S1CsN@ɽуX S1t@J҃ (S1 o3Hɽԃ <ITS1,9gn62Ճ& V_bS1ep(@q փj 23S16A(@qփ  S1Q9(@qP׃ yK1'Td4"pكE )ro13;00ك 1*3<:1$q"ۃ? Q\e1@s`q݃ t1Mw11ރ &}1QP,@q" Ful/1t (@qLC Ful/1t (@q Cj1F,@5| "WO1=cx(@/ $l/16``@7{ |1(@?1` Cj1F,@q "WO1=cx(@lw $l/16``@B. |1(@?1" ^^a11(@q ҵ1(@q 1w8Pd 1<7@H(  1-@H(< 5LB1QuP"0\ 1YP"0X 5L1uP"0$ 2 1P"0 J e y } 1 !!"!411" w!ҡ!1< !(@" a!1Gax(@` zf!1 7H,?1Xd R"1~јژ<41-yr ("/"1=a4J4?1# $"0 #1Z&#W#4 v V *`#1j',l@ v &?#1 4S@Ml# )$*<$1`$$$?D&: @Ϟ$1-6DTTRm() =V$1Q˟П8m@dj+ %1v)@,; ΢!%1'lw<41d-yr2 Ucv%1|%0+x3$ z3%16%x(@3U ,Τ%1ƥ|uX: ٥*&1ۦPsyr? ,Y&1}.CLd\^XuA5 0&''1[();)0 > -R- )Hm)1))x(@tSg mG)1m@2 U )?)1 * *)*P$4W @*X*\*1 ***8R2Z )Hm*1/ ))x(@[: mG*13 m@2\k )Hm*1J ))x(@] mG*1N m@2_ ***1| +++| ܳg ,9,p,t,1 ,B-Q-1$2xr? --1 J-HQRtw (--1 O.z..Xx ...1 ?/K/X/~ L} ///1 0:0I0 d2P> z3o01" ^%x(@t z3y019 ^%x(@ 001] 9i002$@ 0701r "1HQhd ($1C1G11~ 122`TJ @2wL21 H5^22$ g2t2~2122 3X c $312)3x(@ .3:3=31lTO35$<+ 5X3e31uP"0^ 331P"0 ,3!4`413555$ %t` b1 (@q< <EH1Xx(@ب, <EH1Xx(@t[ <EH1Xx(@ <EH1Xx(@ <EH1Xx(@H <EH1Xx(@䫄+ 66&61/6'>6x(@IJZ 41/x(@h 581˱(@q$ LL1FQ(@q讄 $E6671 888t8i FÄT )ro, 1B;00Ä ^9p91c99<4p"<Ƅ ^991r99<4p"|ȄE  1Q9(@qɄ 9 :*2 :C:L:@H(Բʄ [:^d:*29o:@*Hx˄ v::*2::H,8 7P̄. U97*2;o@H((̈́ :::*2:::'H(΄ ;; ;*2 p i;z;8m|ф T?;*2*,?00ф@ i;;*2"i0j, +uׄy "^0*2$,?00h|ׄ ;;;*2Q3<V<^<<(@"Dڄ W<<?2<<0#$ۄ 8<k<?2===|܄ g'=?2 d)g`(@4݄ 4/=&}G=?2m=x=|ބ g'=?2 d)g`(@t߄x 8=J=?2===8j@8 ===?2O=#0$ 8 >d>>?2%??@L` 8W g'=?2 d)g`(@p e@i@?2gCEn)'( Shq@?2Sy@$ @H(#kO@@?2@dOO004Hf@@@?2AAAq,/BDBhB?2BBB[ľO+d"VC?2#C@H(54CLCXC?2xCCCH :DCCC?2CDDpY@M"x&D*D>D?2'D(@$.2-4DDD?29vFEGG| `GG?2HEH6X#HhH H/H?2HHHTâ]OHH?200|HH?26|00d  II?2Vq00D& II#I?2H?INL"f"HILI?2,?00, <`PIpIzI?2IOJnJT t((n~wJ?2 |O@B`)!}JJ?2$7H~ @.T<ԼKK?27+v|NL.L14KK?2GTh04HKK?2SNl$27vU,L8L?2 GLVL[L#0q\8#4fLLL?2"LM(M pĒ=g'=?2 d)g`(@=/(DMhMtM?20MMM>B`AjP MN?2<lsN@H(B N{ (N?2:NKN?KDZNfN?2~NN8\@F |N?2NNH3 GC NN?2NN$?K8$I N/ O?2!O0O8\J |N?2NNH3`K  >?2c(@q8LO =OiOmO2 P:P $(T YPPP2R8QaQ $\  u8$Q2QQ^7 OQ2v00^ z#.Q2\00<_ QKQ2Q R`y\a9/RR2dOO00au+R6R2'7UR\RP,@q"bgRRR2%:4 RR\K d8bRR2:wSS;1ij fu+R&S2R'7UR\RP,@Գq"fgRRFS2_:4 RR\K@$i"bRvS2twSS;1l W^T2T-T3$2mQ 6T2;00 n9T]TlT2TTT a,aUp)r T2;00lq.TTT2*Aa,U5Ul41tEUcUsU2KUUU q,yX,U{ V2$.VEV8+T{,RV_V21knV̷H+X|uVVV29VV WDX$"kW$W/W2OuWWWRS W2gQW8HqS W2lQW8HqH1܊W2sW0"0qpz܊W2wW0"0q,WWX2_XXX,kl\TWJCXXX2+X0Y qAYJYNY2=gY@'AYJYnY25gY@'$WYY2QY)@q gWYY2VY)@q YYY2YYYPs40 JYZ2#.ZEZNZPsD8,"UZYZ2.ZZZܷTWJZZZ2>LZZ$(@d[[2FE+[2[$(@th =[a[y[2o[[ \Hk" +\O\g\2\\]dk"РX"]']2X0Y ql7I]U]Y]2q]@,/I]U]x]2q]@,/ĦW]]2Y)@q`#W]]2Y)@qk]]]2]]lx<}qW]^2!Y)@q\W]^2&Y)@qA^ ^?^21p^^^l`@MX?1Ԭ,^^-_2E_`(`k@) m?1R"z`2W,?00h ~```2z```383\``2|͢00d: 4 aa$a29aLaSa383P`\a2͢00d ja{aa2aaadJ@M$ t b!b+b2Obxbb'Z3 p`b2͢00d t b!bb2Obxbb'Z3@ `b2͢00 d迅r  t b!bb2Obxbb'Z3t… `b2͢00@dÅ! Wc$c2/]=c22`|ą`!Nc>_c2EccJJ"Ņ!ccc2TccH"ȅ"$c dd2kd2?1ȅK"$%d6d:d2tZdkdJ|ʅ" ݪtdh2mc$(@ʅ" Exd|d2?P"0p˅"#|d2M$"0˅q#ydd2UFy)@"d̅#^ds2]`(@"|̅#8ddd2ae"fCfXx ݏԅ$offf2fflxwqօ$fg g2uPg)(\qۅ%$Xgjgg2gg8.߅a%0 hhh2 3hPhkW.l%chgh2@x. &uh~hh2h@/f&uh~hh2 h@/T& hhh2*hhhPR$?1' hAiFi26ij=3\yrDb' X=EjIj2Oj1 $(@'^jjj2Akck\qX'vkkk2 kk<1"p:( kkk2kk̊w(vkl2 ll!l@H(((l5l?l2$NLl(@|$)Sldlrl2,lll "Xh)vkl22 ll!l@H() !ll2vS((\)llm22mmmD/"@=*m n+n2Rgnnn܊\*nnn2aoAoZoL`qp *qooo2qppqb8q+VqZq2W0"0q Z+C^qwq2D3D8/@d^@2X`@|e}_O2=c(@fy`2x(@fxa,2_!+LYhtb|&.2v(@@8hxc:CS2x(T( jd,>2J!+LYke02R8`DsVhЁځ2!7pd{vSo$2(``$yr 2I4} +x(@4ys 0Z[q2^70x(@zms z:I29z>zx(@Dt{s "%2V5$(@|sT2Tt)@T"8|Jt UU2U$(@dt|t$_712&U5UL@}ttt 2:UAU(@?1P}6uT2Tt)@t"}u UFU2U$(@}u(v|2QU`@t~-v kkn2dUoU)@Z3~vZ[q2tU )@2Hv||pQ2TU(@qd-w(v|2QU`@w kkn2dUoU)@Z3XwZ[q2tU )@2耆1x||pQ2TU(@qx(v|2QU`@x kkn2dUoU)@Z3:y X2UUU71"yUi2U VV61 y WEH2)@2+z^^a2)@qxz WEH2)@2\z^^a2)@qt{$_712&U5UL@[{tt 2:UAU(@?1P{8PV2`@hu{02%OP@+dQ| Tz2'T.T21\L|$"%2V2:Y@oF؈| Z[q2^7 $(@h$}$"%2V2:Y@oFi} Z[q2^7 $(@}$"%2V2:Y@oF} Z[q2^7 $(@@~842R"Y@OT~ "!'2k)@Z3 ~842R"Y@O "!'2k)@Z3xj842R"Y@O, "!'2k)@Z3䏆4l/26Y@nF|2(@?1@ j 2mS x((\  <EH2Xx(@2 20+@=pH 2`4Pĵ=pف b2 (@q  b2 (@qld 42(@q ނ l/2z11q̗Z | F3P"0藆D 3$"0ӃO3OP"0  |pQF3P"0@U3$"0OO3OP"04e 3,100Ե8FV3@ax]q3܅P"0w¿3 00,U3%00<Dž|*139B00X? |pQF3P"0t|U3$"0†3I36~P"0(|*N39B00D= |pQF3P"0`zU3$"0p1V3deP"0[di3t00x*c|3Ć@o8 Z3Jy@mt k39և݇32"@#t t3;,tCtHt00ܮF23ʈވE2H3Di3߉X<2!?1̶U43$"0ܶ383(@71<3L(@^[l{3يl`@M?1Ⱥw3H5*UJ?1 ۊ(33o<2Hq k3Ďʎ)@l Ɔ8;3<4P"0Tdža|39B00$pdž |pQ3P"0džۋ |pQ3P"0dž |pQ3P"0džWˏ3Y_004 ˆ m3%3H x(@|ˆ r3/x(@D̆Y$4 @H(4͆}$4^(@dqpφw ~$4(*TІ$4@H(8ц$4o   u1#Ն/   $4   ݆dv   $4x  (@ p߆ΎP4`ȝ J7n4Ŕ"0"D3Ԕn4 OP"P"\ ] l/n4/@|n4t/@%4hEon44-@֍sPf&n4"f(@+<EHn4ex(@0`"23n466*@m"71n4d )@?1|א$4n4"a@30  "!'n4C/@F4-00Ds$.I4Ǖdl@H(0 ^ 4!P,@՝ ɑ "%4V(@q  I4k(@q , 44(@q<^ 584˱(@q4f (@DU4<(@՝4(@( "%4V5x(@xY4Ӗĭ<(@T՝D4(@d&Cj4FtP,@՝ OWO4lx(@ U4d0@10O4(@D ^^a40@1\ ||pQ4x(@x#,4Ӗĭ<d0@t1D4(@L &Cj4Ft0@1~ OWO4lx(@ 8l/4m@|4t/@%4|$U40@E4(@{,Eo4m@4sPf&4"f(@(^^a4m@ ||pQ4x(@G$Cj4Fm@x"WO4=cx(@ 4"23466n@"714d )@?1X!<44"n@ V "!'4C/@$#,4Ӗĭ<0@4(@`(&Cj4Ftm@  OWO4lx(@lT U4d0@d|4(@$^^a4-@d ||pQ4x(@ #,4Ӗĭ<d0@d 94(@Ķ`!g$&Cj4Ft-@d! OWO4lx(@l"Ě?EJ4P00"en4H500@8$ "P5P`O00$@U5ܗ00%hbU500 &[I5V~II@H( (Û[ 5c&@H(+$S5, @J@ + $ T5%TLH -Q$ T5%TLH  .n5|h)(\Զ".lTǘʘ5c~TT33/1ИӘ5;:h)@"l0aq_5$"0|0٘ܘ5Ɋ(@0q5$"000@0 5}T\H{2nHT5TTܽH{ 3q5$"003٘5Ɋ(@3+>5$"03r@T  5(U7UlH{H5H>U(+5iUxUH{6 GPS5yPjJ8 P5*yƙPs$:O Uљ5B0V'|`<٘45[Ɋ(@d<à٘85\Ɋ(@<\<?5]lVo(@$=;CF5^V(@?1=uCJ5_Vt)@?1<> xN5u"0\>١ ZR5y3HV"0>  8<\_5V"0D?= ,hYh]h5)qhP"0Bz k|5UHP"0|C hh5ohP"0D5+2l2hyrE <Țݚ5 7=9 7`ڈ`(3Gݹ 7  7$LY& 7 û 7+ ^w 7 7$._].7./ /@*@TTf(| 73L `T&7*,9| 7& Ҿ @*t >Q 7# \ 7hQ V`)7d(@qD V`)7d(@q kx8P  !Q=`@tOߩgk4t0$"P}z9~00 HHq R{#m@qN3Hd#0"0''00 :+0'09" ;fu,6q'UcB]HD"0( M_{311\*]r1(1q$,+0Pg1(1q0. p}_"5j6.Bܡ>41 ?#JP"0?1T@Wp0  $q,{ ܛ U]t @' tV9">Z,?00VuSAP"(WBgNdVP"0(X #I^7P"0XBgDdVP"08YQ."&?FP"0Y.",:FP"0@Z2>5AP"\"[DP0AP"h"[-)rVZ#;00<\i^w|0h_Vq00`` l^7d1p1q"`4,Qp4 Dehh |11=pe0/>H @Pjh J|11=p8k Ts?pG"F600 q"+/GXHI\Lra?wE+/]00xIGX5O`HI\z"yi Lp`N| @Yf\piq-LpN肉18= '`Լ1Tb IVf* (@ # F(@Xȑn*$(@k`p"H1Bq藉 )=PYIpdq1)A  !4=1 ĸ"ԟDQclpH{4 =PYIp,dqD2)̩I =PYIp īdq 2)d  5!4=1 Ը"DQClpH{?  `!4=1 "l{DQn lpH{X̹lpB@້8Wj3)7$lpB`‰y(8Wjd3)lj2lpBɉ68Wj3)Ή? @291pЉ~DQoD Id{$4)ԉ L1"։ -?P^},IP(ى7΅ e11\ډv8IDI\܉U  11݉^0(@݉${0$"PމRi-D<(@?1P߉ t K^#%t4  ")r2r\?;00X)r2r 4;00'qa h$V300D:DSoe8PIvH1=#2}T@H("yPH#Y%c ,\IhI"H{GK90$"RM|X3@DqI A $7\t H'T9 @  d 9 q|+(x|  tI0+s % ^   3 e0#\5[ _ !lV?\0054c   I @ P p3d4x</k x  w    (T(1=y   ~ IIqX@eM|@ qSw 1(1qUiPg1(1qW-U6II4q_!]] $qb\VaVq00chFr) qq=d]]00Hr  @ q"t'CZa 214uOl~41e; xJP"0?1x  )bq j J@l(\)",?00|e%I=p *4,Tw\@58D/ %08`| ;MRmGc|ppq"ܒ v @292=p@D10zL"IPɽ̘1>PPmI{)ЛT"IP)l=$X%DS$$uD} s`I{B| #dXw,$BPqIнDW1HI 5FJ{C}(@ߩ%-`t0$"[iu00x#P"0?1ܳ'b}P%`Kߩ't0$"๊y,004@~V 4'x(@?1ؼ .Aj: G B,vƊqWk U  H$2NJX" ~kR,?00Ȋ)rW K;00|Ȋ p   g!m!!8D5/2Њ !!!~"@"Y"XT \֊F)rWp"u;00D׊t""""""pCT\ۊ{""0$"ۊ"" #+#Z#a#( X?1ߊ t###(#$$$p L5=$F$P$:k$$$@ILd$$$@$%%p4Lt`(%%8?I@ %'%[%E%%%ܡ0{&"&0$"0!)&2&<&G&\&c&((\?1Vj&v&&&&&It(&&&hr'''30<%((1(5(A(V(2H2fV](;00 P b (@q Ful/ۍ (@q a(j(s(z((22 "%V5$(@DK \V"%V2:$(@ \V"%V2:$(@\  (((($(@Te \V"%V2:$(@ \V"%V2:$(@l \V"%V2:$(@K \V"%V2:$(@ x(($(@> x(($(@Ĺ ((($(@Թd \V"%V2:$(@x () ))$)$(@ A \V"%V2:$(@ \V"%V2:$(@8d]o(@5 \V"%V+)"0Xv \V"%V2:$(@ \V"%V2:$(@p  (0)9)&$(@  \V"%V2:$(@   B)K)(($(@ c  \V"%V2:$(@(  \V"%V2:$(@  xd)m)$(@ d]o׎D"0h  yCHv)(@q (  $o5c(@qps  Ybe h(@q  236A(@q0  vlEEE(@qJ  V_bep(@q  =(@q  vlEEE(@q b7߅e})(@qTT }(@q vlEEE(@q| vlEEE(@qP" ~vE (@q_ WtF(@q ַ |߷ (@q ER L)(@q vlEEE(@qq vlEEE(@q WtF(@q  (@q!3 vlEEE(@q!z vlEEE(@q" 236A(@q`# )Nx)(@q%J ַ |߷ (@q% ַ |߷ (@qx& ƍ ZZ&)(@q'" ƍ ZZ&)(@q(l 6ċ9a Nj(@q) vlEEE(@q* vlEE3(@qh+C wH5)(@q,  Q9(@qL-g MMvHI4)(@q@. b (@q/)y7?T00d/t/Ҍ)@(@/$KA)@$00/IKA)@$00/n)){7)))000 )* *{7%<*W*h*`J q"p3 )*s*{7F<*W*h*`J@q"<6***{7***00`8 *OA+{74q0084X=+~ 4f00L9Z!dt~A)@9$+$++~E, --Jܻ ?1A1--.~Y..)@L ?1E"Emt.~|(@F9qa~r/~3H$/\)H(,GQ+/./~(@\G:n~$"0lG6/?/Z/~///l`@Md?1J0)0-0~=0P0UJ?1L3$]0j00~111(@ P&232O2~P22(\)?1S33-3~V3b3g3P"0V!z3337"pX=4E4$7HlZZ(z444744/@-b|\4457555eK6"`fX=+ 4f00@a559+BB()X EE8(@EE;(@$s( E>q(@EEET̞ EE(@\gEEddUE(@$?1܊FFFex!UF^Fl`@M?1̌2iFrFyF{ (FFT41?1teFFFqt)@4?1FFFG"G+GUJ?1:GCGGGqGGG41D FGGGLHTH)@?1}lHyH}HH2ЙHHH$HHI"0D(III2GIpII\T/N IIJIII(@d?1H I-II*@t IIJ.J=JFJ(H(8 X=]J7 4f00!dJnJrJ7Pp+J(@D!!J7)@4{!$JJ{K7yMMMJ ?1!VNlNN7OOO)@P ?1Q O7P\)H("7(@(E":P7$"08x"PP,P7zPPPl`@M ?1"P- P7PPUJ?14"DPP?Q7 RRR(@< Ƌ+#S)S]S7`sTT(\) ?1$΋W#TTT7UU%UP"0ы#X=9U74f00 ҋ#@UJUVU7/UUUjO@?1Ջ#?U7KV(@?1 ֋%$NRA7OɊ(@֋O$NU7PɊ(@֋~$UUU7R?VQVTt@ۋ$dVwVV7FVV\NLދ$VVV7=WaW4% tWWWmW483{h=%EWW00w%WWW76HXkXXPl!!|H% lXX79^7C`nP"0%XXX7IXXX(6H?1&h7X7R'7Vl(@?1tE&P7^$"0t& YY)Y7`[YjYqY$+@X30& YYY7o[YjYqY$+@3 'YYY7*ZZZ$+@k 3\P'[[C[7Y\)\/\$+@l 3'i\s\\7]]](@d6?1*(X=9]<]74f00M(C]F]7$"0(I]V]e]7]]]$+@3(])]7+](@?1) ]]]72*^=^D^A2%+J)C]KA7N$"0)I]V]O^7P]]]$+@$3`)])|^7a](@?1 * ^^^7h^__bJ%+ G* _&_/_7V_e_j_(@?1 j*w___7)w__AHĺ3 *$__"`7Cwaaat ,/+,b$bOb7bbb2H&J +c!cHc7ccc('(+ Lcc7Enx(@` ,¿cc7 00h .,oc7;P(l( V,~d7 dd11x!,X=d"d74f00!,)d5dHd7.mddd~#,ddd7Eddd2Hq,%,7e)e7We(@&"- eee7`ee9H'Q-eff7k_fnf{f|yr(*- Tf\f7!ffLxdC",-pk;f79(@,-&jf70F600X|-".f gg7MHO7(@4 8= 7L(@P>gt7ĎЎَ2H8+ qV>Ta72H q3>"HK7n#a0@"4>H7(@qh6> 77(@q9? #7 Ӕ6H q>@ frs7"ssLSJq@s@s7)ktt(@ A@N,t7=?tRtWt85H$qAA̕7H %(6H<?1DA @M7XcoxS8 WB1>7^js2H| q<B ,6>7'(@ dčB \g7%ɥХ(@ lǍB>7l2H qC,}7Dǯ2Hl q, JC[dh7  0@$7"D"|C&Dӱױ7 (@qd$CŲɲ7{ (@q)C ijG7 ":B6H_ qD0D ӵߵ7"%LSJq|12EBN]7)|(@2lE,t7=?tRtWt85H4qh3EǶֶ7H %(6H?1<6F@C7G(@L#6F MZ^7Xһ޻S8 ƎG7Kjv2HqtUEG 7? nz(@| x\qG #7 (@, aG7 2HqxG77C2Hq HLY]7d0@" ;H7N(@qkH_lp7 (@qH &7 6H' qHIz7SepI7% x(@ IS78Lwt! ?1l'JS7qkMzMM$"0 'J r|7y8OV6H7q$) Ku7VJ@qT*=K,7;x(@*oK7Tl}Xq-K?7V)@x.K7'4̘pq0LO\?7j8 d87L 76HN q\>jL7<.5XFHD"?L \h7J(),&AL +7Vܘ| H rNMS7kMzMMP"0`OBM7gAdFP+ ?1R}M 72HqSM7v2Hpa qZM4=7 ^7R$"0P[N[7>t0 ?1aNS)27wkMzMM$"0`bN r|A`78OV6H7qc+Ou7VJqd[O 7;x(@8eO7/BqPhOi7V)@hOq7ltqk%P7 rUP 7i Q qhxP6C7S k "P7 "<P+Z7(@Կ ?1+Q 9Eh7(@'^Q 7CZcTB1q4Q z7#/' rT%R NYd7|31qXR 7'22R¿(7; 00R0D\7R&0JJ ?1VS NYa7|31 qĔS y7 !(2HpqS tnS^7v2H@@S O7 Os \"0D"ȘT5X 7Se`;T 7% 16x(@tT@}78t!p ?1US7qkMzMM$"08U Q$7y8OV6HD8qDUCU7VJqtUE7;x(@U`s7Tl}q 1V7V)@dV7'4̘pqȭV?7j8d V 76H\S q|Vn7<.5XFH4"-W 7J3:(),(`W _l7Vkܘ| r͐WS7kMzMMP"0|ΐWj}72MYAdF, ?1XҐ X 72HqpӐ5X'7#7?2HX- q<ِfXjh7Se ڐX%2<7%љ_fx(@@pߐXp78t! ?1<jYSM7qkMzMM$"0`Y Vb7y8OV6H8qY7VJq($Z7;x(@VZ7Tl}XqZ 7V)@LZ!7'4̘pdq|Z<I?7j8D 8[ ,976HU q0Q[7<.5XFH"T[ 47J(),(|[ U7V) U a ܘ| r [SM7kMzMMP"0T )\& 9 \ 7   AdF, ?1d\ - ? J 7d s z 2Hq\W  7 v 2Hq\   7r  00P\  ( 7 ' > h,t )]s   7r  00T]   7h,D !]'*7x2C00#]HSZ7w00T%]7r00'"^7h, +c^5?T8@H(d2^ k48!@*<3^(x88CNH6'3^U ^8o@H(4_X=84f0045F_!58(4;p_8o"(,)@Ԗ@>_$A^nrףh0sPA`<800CI`5&<87Ozx(@E`I<8X,@ xG6a<8bH,@@Iua Wd<8u;GO6H@ qPPa]<8(@`- ?1SaCPo<8 !85H)qtV_b 9FU<8ssLJqWb `<8(@tE8>9?U?hT$:)w E8!@*<\w(58E8CNH6'wU^E8o@H( w E8!@*h!w(58E8CNH6' "0xU^E8o@H("gx667E89=\)*H#x  E8: , H,8 7$xU97E8;o@H(t%GGGl:\UqauGA3H٭ h)@d]GG$HE8HHH<P{Hc,BIOII4LJJJJ  FblNJJ9; (@lKK+KE8IqKKKD~X4oKK+KE8IqKKKD~X4rQKK+KE8IqKKKD~XX4uKK+KE8IqKKKD~X4x$KKKKKLa@@(zɃ$]EEE_FkFF`*)L L#Lqo;L4-@BLLLzLR8 LM4A2 =l߄ FMSMVMdMuM@AH4>$KKKKKLa@`ԇ$]EEE_FkFF`+<PL L#Lqo;L4-@BLLLzLR8 LM4A2= FMSMVMdMuM@AH4<e$KKKKKLa@ FMSMVMdMuM@AH4$KKKKKLa@藒ψ$]EEE_FkFF`+P/L L#Lqo;L4-@BLLLzLR8 LM4A2@=, FMSMVMdMuM@AH4PD(|MMM,MMM H,( YF ޭ a@Ȧn(FG6G>GGGl:̋qauGA3H٭ h)@t0MM NNNN<P{ (D4D=D8MDXD_DLA34,BIOII4LJJJJ FbԻJJ9; (@P6O@ODO7OOl4 tWWWmW483{|’FEWW00’ߏ,OOOP#P0PŒ?(|MMM,MMM Hƒ( YF ޭ a@|ǒi(FG6G>GGGlD;̒ǑqauGA3H٭ h)@(͒+MM NNNN<P,{Ғ (D4D=D8MDXD_DLA3Ļ4Ӓ,OOOP#P0PԻՒG(|MMM,MMM Hג,OOOP#P0Pْz(|MMM,MMM H ےM( YF ޭ a@tܒ(FG6G>GGGl;qauGA3H٭ h)@ fMM NNNN<P{Ė (D4D=D8MDXD_DLA34",OOOP#P0P07PPP]P PPPdL@.H07PPP]P PPPdL`.07PPP]P PPPdL.ԙ07PPP]P PPPdL.PPPQQ!QX98"R(Q:Q>Q7s QQ3XAgmZQd)gh)@ VPPPQQ!QX98$",(Q:Q>Q7s QQ3XAgmZQd)gh)@|PPPQQ!QX984"ʞ(Q:Q>Q7s QQ3XAXjgmZQd)gh)@ΟPPPQQ!QX98D"(Q:Q>Q7s QQ3XA&gmZQd)gh)@4`QmQyQi8QQQ0P"TT RR2Ri8{RRR ГqtTRRSi8SSS ?1  WS Ti8*T=TFTy<qĢ 5"WTlTi8TTT,<,q  TTTi8 UU)U,L,q1 nF>UOUi8lUUUbKqk UUUi8UVV  -qx9VEVi8bVqV~V\ldt٣VVVi8VV W-W+WBWi8%VxWW.!EWWWi89WXXd<8$#X0XCXi8LWsXX$<& XXXi8aXXY  .q( 'Y3Y:Yi8viYYY|%q++YYYi8Z8,@".g 0ZHlWlKJq䘓"'lbli8LHlWlKJq@a xllli8jlll(@Tmm#mi8/mBm00 dTKmWm^mi8 wmmm00@Ymm|8mmm@H( |8!@*<(58|8CNH6'U^|8o@H(̠UX=m|8-4f004mn%n|8.lnnn33$=Onnn|8QnnoN\O`?1\oo+o|8[[okoto 21ooo|8ooooT?14pp.p|8LpapnpjJ?1I(}ppp|8Kp@0@*̯n8ppp|8pqqS dX8&q8qGq|8cqxqq 2 d8qqq|8Rrbrr!/4$ rr|8ErT`@3P?,rrr|8 s*s7sSXr_h,JsZsis|8sss2r_\4sst|8"yttt8qXlēttu84uyuu@(Lȓ u8!@*ȓ(jw 88CNH6'ɓCUu^8o@H(xʓwX=9]u84f00ʓuuu8Mv]viv31Xԓdzyvvv8vwP,lVwcwqw8xxxp0 y\yy82{Q{{\ q"o'|9|@|8r\|k|r|(H(y||}8}~4~0! 0 q* ~~~8~ pF2q"R>^89M]<"P%v8\ρ[X "T+&Pi8~ȂԂ,<Xl?1/Ե,8.EU]`@2/,gtw86r@LH3X,8?#8GD!\T7,n8]E]`@Y_p:,ل8e4Wb$J=Y_ =  84}Å΅jpJļD4?W8Յ8GL^sTqlԼ dC0{Ն8np?oyIԇ8"7>8;HD"XKط8Qo8 Ok|X!l. #dP*0É܉8GƊ|H yTP@R8 H]pq ҙ[8ތ(@t\x@ 84BSd[4^ k8H._Tı %4Hk̸d 6B8pҐ 1Po(ސ8.ET[D*hq<\[n8˒  ym F̔8Vbș$ xk H 86Z8<(8BJj: Ĺ$8eP@?1$ɝ۝8m 7X ?1 $]&8}d29P@?1<(@Y8Οm u`X=184f008K[8](H(@l8-86Hy\,Ӡ82A l촔B,`iz7 )0sdx,Ӡ72A l ,`ܡz )0slX=84f00ԻƼI86EN2`&lԽOc9l8q@&lܿȢc|Ԣ8U^(@`  *8S@D&lĔУݣ8!8>(@XǔRKXg8Ĥ1@ܺ7Pʔ 8H[a00b̔800LW@ϔ "800/WLҔ8Ǧ8`t|1@ɍՔ8ʧYJ?18ה8AH$?1ؔ $5F8, ٩8Sf)@qt$8f0CLA14 Skw8|ɪbJ?1 $18¬٬ n$#*8m8=P@D?1DQh8έq 086H=q4`7S83 7֯8=QW@"kn߅w8e@T@l X=74f00 ȰӰ7_OJ?1 4`7x-51 r(4@C7l(O \o7"iñ3H:0ٱ71TPsJw87\h{4u@F,*i\H@`7IҲsPs4e3 ~7LI(H( ^,T7*i\H X=۲84f008.:@P"0,_ P_84<14!!88Lҳ@MuL#T,ݳ8bh 7DLu%,am}4<1d'$8ʹLҳ@Mud),ݳѴbh 7DLu,J`IҲsPs4x-L(H(d. Go buildinf:go1.25.800w tApath github.com/apernet/hysteria/app/v2 mod github.com/apernet/hysteria/app/v2 (devel) dep github.com/andybalholm/brotli v1.1.0 h1:eLKJA0d02Lf0mVpIDgYnqXcUn0GqVmEFny3VuID1U3M= dep github.com/apernet/go-tproxy v0.0.0-20230809025308-8f4723fd742f h1:uVh0qpEslrWjgzx9vOcyCqsOY3c9kofDZ1n+qaw35ZY= dep github.com/apernet/hysteria/core/v2 (devel) dep github.com/apernet/hysteria/extras/v2 (devel) dep github.com/apernet/quic-go v0.59.1-0.20260330051153-c402ee641eb6 h1:cbF95uMsQwCwAzH2i8+2lNO2TReoELLuqeeMfyBjFbY= dep github.com/apernet/sing-tun v0.2.6-0.20250920121535-299f04629986 h1:w62V0oOO2Do0vXeZkx7mgZ2YFuUaRcO6rNZewI3xzuE= dep github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE= dep github.com/cloudflare/circl v1.3.9 h1:QFrlgFYf2Qpi8bSpVPK1HBvWpx16v/1TZivyo7pGuBE= dep github.com/database64128/netx-go v0.0.0-20240905055117-62795b8b054a h1:t4SDi0pmNkryzKdM4QF3o5vqSP4GRjeZD/6j3nyxNP0= dep github.com/database64128/tfo-go/v2 v2.2.2 h1:BxynF4qGF5ct3DpPLEG62uyJZ3LQhqaf0Ken+kyy7PM= dep github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= dep github.com/fsnotify/fsnotify v1.9.0 h1:2Ml+OJNzbYCTzsxtv8vKSFD9PbJjmhYF14k/jKC7S9k= dep github.com/go-viper/mapstructure/v2 v2.5.0 h1:vM5IJoUAy3d7zRSVtIwQgBj7BiWtMPfmPEgAXnvj1Ro= dep github.com/google/go-querystring v1.1.0 h1:AnCroh3fv4ZBgVIf1Iwtovgjaw/GiKJo8M8yD/fhyJ8= dep github.com/hashicorp/go-cleanhttp v0.5.2 h1:035FKYIWjmULyFRBKPs8TBQoi0x6d9G4xc9neXJWAZQ= dep github.com/hashicorp/go-retryablehttp v0.7.6 h1:TwRYfx2z2C4cLbXmT8I5PgP/xmuqASDyiVuGYfs9GZM= dep github.com/hashicorp/golang-lru/v2 v2.0.5 h1:wW7h1TG88eUIJ2i69gaE3uNVtEPIagzhGvHgwfx2Vm4= dep github.com/klauspost/compress v1.17.9 h1:6KIumPrER1LHsvBVuDa0r5xaG0Es51mhhB9BQB2qeMA= dep github.com/klauspost/cpuid/v2 v2.1.1 h1:t0wUqjowdm8ezddV5k0tLWVklVuvLJpoHeb4WBdydm0= dep github.com/libdns/cloudflare v0.1.1 h1:FVPfWwP8zZCqj268LZjmkDleXlHPlFU9KC4OJ3yn054= dep github.com/libdns/duckdns v0.2.0 h1:vd3pE09G2qTx1Zh1o3LmrivWSByD3Z5FbL7csX5vDgE= dep github.com/libdns/gandi v1.0.3 h1:FIvipWOg/O4zi75fPRmtcolRKqI6MgrbpFy2p5KYdUk= dep github.com/libdns/godaddy v1.0.3 h1:PX1FOYDQ1HGQzz8mVOmtwm3aa6Sv5MwCkNzivUUTA44= dep github.com/libdns/libdns v0.2.2 h1:O6ws7bAfRPaBsgAYt8MDe2HcNBGC29hkZ9MX2eUSX3s= dep github.com/libdns/namedotcom v0.3.3 h1:R10C7+IqQGVeC4opHHMiFNBxdNBg1bi65ZwqLESl+jE= dep github.com/libdns/vultr v1.0.0 h1:W8B4+k2bm9ro3bZLSZV9hMOQI+uO6Svu+GmD+Olz7ZI= dep github.com/mdp/qrterminal/v3 v3.1.1 h1:cIPwg3QU0OIm9+ce/lRfWXhPwEjOSKwk3HBwL3HBTyc= dep github.com/mholt/acmez v1.0.4 h1:N3cE4Pek+dSolbsofIkAYz6H1d3pE+2G0os7QHslf80= dep github.com/miekg/dns v1.1.59 h1:C9EXc/UToRwKLhK5wKU/I4QVsBUc8kE6MkHBkeypWZs= dep github.com/patrickmn/go-cache v2.1.0+incompatible h1:HRMgzkcYKYpi3C8ajMPV8OFXaaRUnok+kx1WdO15EQc= dep github.com/pelletier/go-toml/v2 v2.2.4 h1:mye9XuhQ6gvn5h28+VilKrrPoQVanw5PMw/TB0t5Ec4= dep github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= dep github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= dep github.com/quic-go/qpack v0.6.0 h1:g7W+BMYynC1LbYLSqRt8PBg5Tgwxn214ZZR34VIOjz8= dep github.com/refraction-networking/utls v1.6.6 h1:igFsYBUJPYM8Rno9xUuDoM5GQrVEqY4llzEXOkL43Ig= dep github.com/sagernet/netlink v0.0.0-20220905062125-8043b4a9aa97 h1:iL5gZI3uFp0X6EslacyapiRz7LLSJyr4RajF/BhMVyE= dep github.com/sagernet/sing v0.3.2 h1:CwWcxUBPkMvwgfe2/zUgY5oHG9qOL8Aob/evIFYK9jo= dep github.com/sagikazarmark/locafero v0.12.0 h1:/NQhBAkUb4+fH1jivKHWusDYFjMOOKU88eegjfxfHb4= dep github.com/spf13/afero v1.15.0 h1:b/YBCLWAJdFWJTN9cLhiXXcD7mzKn9Dm86dNnfyQw1I= dep github.com/spf13/cast v1.10.0 h1:h2x0u2shc1QuLHfxi+cTJvs30+ZAHOGRic8uyGTDWxY= dep github.com/spf13/cobra v1.10.2 h1:DMTTonx5m65Ic0GOoRY2c16WCbHxOOw6xxezuLaBpcU= dep github.com/spf13/pflag v1.0.10 h1:4EBh2KAYBwaONj6b2Ye1GiHfwjqyROoF4RwYO+vPwFk= dep github.com/spf13/viper v1.21.0 h1:x5S+0EU27Lbphp4UKm1C+1oQO+rKx36vfCoaVebLFSU= dep github.com/stretchr/objx v0.5.2 h1:xuMeJ0Sdp5ZMRXx/aWO6RZxdr3beISkG5/G/aIRr3pY= dep github.com/stretchr/testify v1.11.1 h1:7s2iGBzp5EwR7/aIZr8ao5+dra3wiQyKjjFuvgVKu7U= dep github.com/subosito/gotenv v1.6.0 h1:9NlTDc1FTs4qu0DDq7AEtTPNw6SVm7uBMsUCUjABIf8= dep github.com/txthinking/runnergroup v0.0.0-20210608031112-152c7c4432bf h1:7PflaKRtU4np/epFxRXlFhlzLXZzKFrH5/I4so5Ove0= dep github.com/txthinking/socks5 v0.0.0-20230325130024-4230056ae301 h1:d/Wr/Vl/wiJHc3AHYbYs5I3PucJvRuw3SvbmlIRf+oM= dep github.com/vishvananda/netns v0.0.0-20211101163701-50045581ed74 h1:gga7acRE695APm9hlsSMoOoE65U4/TcqNj90mc69Rlg= dep github.com/vultr/govultr/v3 v3.6.4 h1:unvY9eXlBw667ECQZDbBDOIaWB8wkk6Bx+yB0IMKXJ4= dep go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE= dep go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= dep go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60= dep go.yaml.in/yaml/v3 v3.0.4 h1:tfq32ie2Jv2UxXFdLJdh3jXuOzWiL1fo0bu/FbuKpbc= dep go4.org/netipx v0.0.0-20231129151722-fdeea329fbba h1:0b9z3AuHCjxk0x/opv64kcgZLBseWJUpBw5I82+2U4M= dep golang.org/x/crypto v0.47.0 h1:V6e3FRj+n4dbpw86FJ8Fv7XVOql7TEwpHapKoMJ/GO8= dep golang.org/x/exp v0.0.0-20240506185415-9bf2ced13842 h1:vr/HnozRka3pE4EsMEg1lgkXJkTFJCVUX+S/ZT6wYzM= dep golang.org/x/net v0.49.0 h1:eeHFmOGUTtaaPSGNmjBKpbng9MulQsJURQUAfUwY++o= dep golang.org/x/oauth2 v0.20.0 h1:4mQdhULixXKP1rwYBW0vAijoXnkTG0BLCDRzfe1idMo= dep golang.org/x/sys v0.41.0 h1:Ivj+2Cp/ylzLiEU89QhWblYnOE9zerudt9Ftecq2C6k= dep golang.org/x/text v0.34.0 h1:oL/Qq0Kdaqxa1KbNeMKwQq0reLCCaFtqu2eNuSeNHbk= dep google.golang.org/protobuf v1.34.1 h1:9ddQBjfCyZPOHPUiPxpYESBLc+T8P3E+Vo4IbKZgFWg= dep gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= dep rsc.io/qr v0.2.0 h1:6vBLea5/NRMVTz8V66gipeLycZMl/+UlFmk8DvqQ6WY= build -buildmode=exe build -compiler=gc build -trimpath=true build DefaultGODEBUG=containermaxprocs=0,decoratemappings=0,tlssha1=1,updatemaxprocs=0,x509sha256skid=0 build CGO_ENABLED=0 build GOARCH=mipsle build GOOS=linux build GOMIPS=softfloat build vcs=git build vcs.revision=25a2530ac786a180dd8e4f3bce0c69a3a7954d83 build vcs.time=2026-03-30T19:21:04Z build vcs.modified=false 2C1 rBA Go fipsinfo g|L?l Cr'b7~[JC `d?d>b2  p q : : ;!! =!!0/ :  '.{noneŨΨ٨P0YPPmptª۪ߪ:@[ƤG   80`//T18IhJ58JJ. L5cGf\gffu``,v=G>0U?c?D ?@^xx4Z[n]D#Ԕ8p;PQd//U3@IXIЩ5f(cffiHOPXO8(QF]c+#%ii-|mJQT,T|Z[Zto]X`@7>{>~>Y[ y مׇD܇pD DHh4p<35cxii`j0uEo`-v9v  d`84tiHkop`@(4l,<Tׇ/dev/urandom   pr_? @ T 34MO?? ^ : .. . ..!.   / _ 000 +0;@DEO x ^`|the following errors occurred:!tae¢z^ Ȩ3T5ERx\         / _ 0    09AZ__az!/:@[`{~09AZ__azg jgrn<:ORQhك[HeHeHeHe 00 LP m   9 .. . .. .   ( ) / _ 000KPY^_+0FMRu@`E:>Y6@U`gp      oJoOoooo@j^j`jijnjoj            He 7 77=0`!!!!0!0"0)080:0/+xM--@./000011223W3foq    D F H J O T c f  GIlq  e ( ) / _ 000 DH‹`ɋ\+/,0̨  /5 #'<̨+/,0  /5 #'<? ABzD@FPG$tIK L(knNP+/,0̨  /5 #'<*'- 735)2#.!%,40(1$+6    @tAJ $n$ 68EPl #$n$p$t$$C%-%-'---2PQR,0=@INOop p XX & X&0X /sys/kernel/mm/transparent_hugepage/hpage_pmd_size;Zx0Nm 040  `He0 *H 0  `He 040  `He0 *H 0  `He0040  `He0 *H 0  `He@68<>@ACDFGO'/7?&.6> %-5=  !)19 "*2: #+3;$,4<  578<?jp|!#$&*....//00!0)080;04MNmp%*kEkPkYk[kakckwk}kk ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[????????-]B   ..:.;.@.].000012X&c   SQ   * . ` d f o 04?4sz !5Oo`eghj                 $~ |  ?F  8Ui                 ( * 9 < D F H J M U V X Z ] ` a c f o w                              .0/011122`2~2`|  !"Udeg  &(:<=?MP]  6:<=?@GPY      ( * 0 2 3 5 9 < D G H K M U W \ ] _ c f w                 ">* (0> ">* (0> " (0>*> (XG dEpɲeeP\P\0F) S$   578;FPY      ( * 0 2 3 5 6 8 9 < > ? B G H K M Q Y Z \ ^ f g v          5 8 : ? H P X pz|#%*-/24:>EGNUZ\chmrwz|oKUpQ R T   *0-000 -;Ż-0Fgi{ooooߦ9@ JP#'pz|  @n_n!(O  `nn"C     ?AJVoqPpP=@!ptv 0@P`p @`@  %&(*058@HJPU`jp)]4};=_F ~ 8 #{ #*#i'u'''!'')))))#.&%.).V.\. 000000>6DHZ\^ =4]c^`u00 ![jkGP>@@kCkooooo @0m7=K`([3{:<_  E } 8 #{ #)#h't'''!'')))))".&$.(.B.U.W.[.00000?"57CGY[];3[_bb d'@Bʚ; TvHrN @zZƤ~o#]xEcd #NJ                                   r w  x ~ X ^ p x *3i|p t y  P!_!!`$a$$$$v'',111 2)2H2O2Q2_2222205 (*02359<DGHKMPW]cflptpsuwz}&*]afjA EHMPWY_`}&!e??$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDAZaz%,\bekwyq   *!+!2!N!`!!`,,"ʧЧѧӧէ֧٧0Z\dfi!:AZHJMPVXZ[]`Z]|------------------  &(.                                        ,  of the  of s . and  in " to "> . ] for  a  that ' with  from  by (. The  on  as  is ing  :ed =" at ly ,='.com/. This  not er al ful ive less est ize  ous  the e 09`if o  f o  f o  f o  f o  PY )@IFOPY@IPY )Ш٨ Щ٩PY ';>{ 6V   5)14:\6 7 ;>fio$_jjZkbkUԝԭԺԼ:?EQՠ"% #(38:HJLPSXZ\^`cksx}tzY@ $(q FCdx},jx#q   |,},o-/.010,2050;00b00^00 spϩpݪm\_ipT !"#$%%&&''((()))*++,,,,,------....//////0001123333333333444444444455666677777888888888889999999999::::::;;;;;;;;;;;;;;;;<<<<<<<<<<<<<<<<=====>>>>>>>>>>>??????????@@@@@@@@@@@@@@@@@@@@@@AAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC#4D  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJ*!LMNOPQRTUVWXYZ{|}~                  #4D#4D+<=>|~ D R z |  !@!(A!D!K!!E!!!!!!!! !!!! !" #!#|######%% %%o&'Q'''''')))))))*0+D+G+L+)b9df \^uӺ?c?yڌX?9?-^? h?:D?Kx? !? ?8G?2Sg?hz?:?Е1?z?G?g!?Kx?4&?̈Gj?TNK?sp (??P??2Ut?Uᢜ>?&m??l??sjbƈ?UϋE??0?_  ) 1 4 7 = ]  ) 1 4 ^  ) E I W  E I HIWYmq_XZ\^ +&---------.@00112ҧԧΩ'/7=?BESgu  VUU433$Ir]tVUU;J$9.ى%IqgffF]VUU$I@8433.*J$ qaVUzDy 0  C{ ?gfVUJ9o43]g%I@XX %<<`<<AA*e>t>  r  @@````y` !!F\\0 9 fo6?PYPY09PYPYPYPY`jijjjPkYk@IPY`~!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ (*/:IV^chjnv}  $+469;FJX[agrvxz|~  !')+-368:<BFJRY\_adlpwz (*/:IV^chjnv}  $+469;FJX[agrvxz|~  !')+-368:<BFJRY\_adlpwz ")07:>HT\dlt{ )18<BFJNRV]adjmpz~!&/6>AGTY[biotz "-36;DHMRX_dgmpz %)+/27<AEIMSVY\bKkSsk*!s+!0011SE&!24>!A"B*J24>ABJbcc!"*bJ`aa`E&!*!K+!JKK&68=HWdlqvx|  !$'),/39@IKNP[ft "')06<DJPVZ\^`bhkmoqw{#(,15ESaoqsuy{~&68=HWdlqvx|  !$'),/39@IKNP[ft "')06<DJPVZ\^`bhkmoqw{#(,15ESaoqsuy{~1111 11 1/111 111 1111 11 0111 1 111 1111111 11 11111111111/11111 111111111 111111111 1111 /111 1 1 1 1 1#1/1 1$1!1 1 1%1& 1' 11"1 1 1( 1)1*1 1+ 1 "1 !1,1 -1!1 1 1.1 1 " !  1 !1 1 1 "  " "09`if o   f o  f o r w  f o x ~  X ^ f x  PY 3@Ii|FOPY@IPYp t u y  P!!!!`$$$$v'',0 !0)080:011 2)2H2O2Q2_22222 )05Ш٨ Щ٩PY'pz|  @n_n4Mh  89;>@DFJKPl!<Up4Vn6!(O  `nn3NTVg7Rk";Vo6NPUp5  %*"C@[`{ t~  @d e ?56   d f p t ~   !%!'!)!,!1!3!M!O!_!!!!&$@$J$`$')s+v++++.].//0000 0 00070<0?00000[011111 2_2222X3YY33MM!09.ϩ[jk>Q?0RTfhk ;@[ep.A                                                                                                                           AZaz psvw{}/1V`+kwy EHMPWY_`}!! !!!!!!$!*!+!-!/!4!9!@DFJKPR46NPnp  %*C ; 8> @ I L N O       ,> @  ;    6 > ;@ G H K L W      *  A D          > ;? @ F H J L W + L   >?+,18;<VWb cdgm 4#&)+0138UWacdm nr51;=>ACD=$1%+45.0/0#$'Y3èRS1/034M{.}n  p v   O y *48m@ajt|!!!!! !!!!!!#!%!)!.!:! ;!J!L!M!O!!;!! !!!!!!!!!!!!!!!!!!## ##"#(#+#{#}#####&$@$J$$$%%%%%%&n&p&g'''((+/+E+F+M+s+v++++,,P.Q.....////000 0 6070>0?011111122*2G2P2`2a222223MMƤ(+679w>xy@O.%',3>JN]blx~-79>ADFR]ekqv{~ #/;GOTar}!*.38>NTXglt~  */28?DHNS\agnu| #/5BNV_jq %*7BKVY\fo{ #&.3<?DNRVY\`o{ '+18?ENR`cfjnqux}%',3>JN]blx~-79>ADFR]ekqv{~ #/;GOTar}!*.38>NTXglt~  */28?DHNS\agnu| #/5BNV_jq %*7BKVY\fo{ #&.3<?DNRVY\`o{ '+18?ENR`cfjnqux}1oW ?  P X   q  9 ?   UYGM@Ctu8=KLOZ[]iAC`l<=>;D EF?]@F AEpqCOp$qq$t$//njojj7kB8k;kDknSnnoL^_1oW ?  P X   q  9 ?   UVYGM@Ctu8=KLOZ[]iAC`l<=>;D EF?]@F AEpqCOp$qq$t$//njojj7kB8k;kDknSnnoL^_AZ.269GJxy}2:;=>ACDFHNEp+rv /`.1V(/8?HMY_ho&!*!+!2!!,} ,/,`,b,c,d,g,m,n,p,r,u,~,,,,,,,@NyBl".2ny}~ħŧǧɧЧ֧ا!,W":AZ69GJxy}2:;=>ACDFHNprv /`.1V(/8?HMY_ho!! ! !!!!!!!$!*!+!-!0!3!>!?!E!!>,/,`,b,c,d,g,m,n,p,r,u,~,,,,,,,@NyBl".2ny}~ħŧǧɧЧ֧ا!,W":az*/37:HKwz~#3<?@BGOPTVWY[\`aefhiloqru} Eqsw{|}0_a/ay}s '07@EQW`gp}N!!60,_,a,e,f,l,s,v,,,,,,- -%-'---Am#/3oz|çȧʧѧק٧SpqAZ!#%'*./: ;?@\~Z[_7    jm, 0>^d e p v y w  pOZ [qJO`eahn}56 DEZ`}~;?~ C ! ' 0 8 ; > A C G Q S U V ^ ,,,,p-..... .........*. +...0.9.<.?.A.C.D.O.R.T.00=00 s~ twΨϨ.2/_0ͩީߩ\_ުߪ%R0EFILPRTW_ahjk   <adee!#%*,/:;?@[]_{}$~ Z_    jm, 0>^d e p v y w  pOZ [:&;=KJO`eahnn56 DEZ`}~;?~ = ' 0 C E Q S ^ } ~  # #)#*#h'u''''')))))),,,,p-....0.O.R.].00000000=0 00[ s~ twΨϨ.2/_0ͩީߩ\_ުߪ>SQ?0RTachjk   ;=?[]_`e))> H)@-)X%X(1(-(H%$ , ) *%+**(('*(*.)@/%.h'&&&.`-8')&' &('&&H ( &8 x)0:8%`..-X&P/H+h+ .'8+8*//*X*H*@.)h*h&$h x x)X+(+))P.+ %'X'$ /x':P:x*p/H' $&((&x/h)h%x%X)x&*''x%'%%$0./h(x((%+'(((X(/p2(%()p.(H&$8'%%(&2`/h8)P=$HXH8&0-*(%L.,EF<,^-.235>?ADGHKMWb c567@AEk0r12;<>n j!&,.801578=@B9UWX/>k_ 45>?AQoPRooooefmraz*78HIwz~349<?@BGOPqsw{|}041_a/`+kwy '07@EPW`gp} !!!!/!9!^`|~ uq   j  p  O y ?48mn@ajt|D R z |   !!!!! !!!!!!#!%!)!.!:! ;!@!A!D!J!M!O!!;!!!# #(#+#&$@$J$$$%g''''''))))))s+v++++,,P.Q.....////000 0 6070>0?00011111122*2G2P2`2a222223MMƤ !(+69wy[jk)O@O-bdefi >@\^7?y0wx ?w @DFJKPRq=+0;@HPQ`ev{ GPY`S`mp| !???\ !]^_`abcdefghijklmnopqrs?"#$%&'tu()*+v, -wxyz{??????????????????????????????\ !]^_`abcdefghijklmnopqrs?"#$%&'tu()*+v, -wxyz{???????????????????????????oK_pf01J#%')-Y[ : < > O Q W b c         < > ? B G H K M Q p q u          < > ? D G H K M U W b c  <    )  < > ? D F H J M U V b c           ; < > D F H J M W b c       145:GN59>?q+e,>VY^`bdgmqt ]_24RSrs .  v# +0;U^`|14Dks$7 ,,--a--*0/000ort} #$',T3Ũ&''-GS)D*6CL M{.|}* /oK_pf01J#%')-Y[ : < A H M Q R W b c  ;     < A B G H K L M Q p q u         < ;? A B D M U V b c   < > ? @ F H J M U V b c  ;     ; < A D M b c    1[4:GN59q~-g.0279:=>XY^`qt]^_23RSrs .  v# "'(29:;V;X^`bels|1467:<Bks,367   ,,--a--*0-000otu} %&,ĨŨ&''-GQ)D*.1256CL |4+ 1O /vz      8 : ?   $ >% ' FP8Fpst >'4EFs ,7>A;<>DGHKMWb cfglpt5F^R0@+,:0578;>@BC 39;>GQ R[/68?16:<=?@EGC415:>B@4G4H4U4jj0k6kOoQoRoooooo oLb-0Feimr{BD6;lu!#$&*016>DJ./012 34 56 789: ;<= >?@ABCDE@FGHDIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$uu%&'()*+,- vz      8 : ?   $ >% ' FP879Fpst >'+-4s 5/`01467>A;<@f&glpt8?BDF^3:=?@kf"%'+/79:;<>C! 38;>GQ RVY[068=?S16:<=?@EGI\ 657:@B@4G4H4U4jj0k6kOoo@oooLb-0Fgi{BD6;lu!#$&*016>DJ< ?AJnoq /M@X`jp 9 = P X a r                 ( * 0 2 3 5 6 8 9 Y \ ^ r s t               ( * 0 2 3 5 9 = \ ] _ ` a q            5    ( * 9 = X Y Z ] ` a              : = N T V _ a z       023@E@@AGIl*?PQUZ]aefnopurHJMPVXZ[]`Zlo1@Q`lnp D!BDxPmpt T3EL#MOZw5!;6!8!0-g-------------------0<06A000000011/111111114MNФ *+n2h  "@s %0F`|(@BDK`oqvz~ª۪ܪ  &(.mp (*68<>@ACDFG=Pptvfoqxy0WX8K=Lf./?\]_ko                 ) 1 4 : ; = C F I J N P R X ] _ ` e w               ) 1 4 : ; E F I J N O T X [ ^ d e x y                  ) : ; E I N O T W [ \ ^ _ d e p q v          E I P S d e          ;>\Hm%np%INOWY^_*[D\}!~7?T_mqty, -/<?ACnou_}~ MOu8:JLFGNOX^~e fr s     !!'$?$K$_$t+u++,^,,&-(-)-,-.-/-h-n-q-~-----^....Z..////@00W01h11011_112nrǤϤ,?˧ϧҧԧڧ-/:?xƨͨڨߨT^}Ωک ۩ݩ788?NOZ[êڪ'/loׯno7=?ESglouxy0WX8KL./?\]_ko                 ) 1 4 : ; = C F I J N P R X ] _ ` e w               ) 1 4 : ; E F I J N O T X [ ^ d e x y                  ) : ; E I N O T W [ \ ^ _ d e p q v          E I P S d e          ;>\Hm%np%INOWY^_*[D\}!~7?T_mqt y, -/<?ACnou_}~ MOu8:JLFGNOX^~  * . ` o r s     !!'$?$K$_$t+u++,^,,&-(-)-,-.-/-h-n-q-~-----^....Z..////@00W01h11011_112nrǤϤ,?˧ϧҧԧڧ-/:?xƨͨڨߨT^}Ωک ۩ݩ788?NOZ[êڪ'/loׯno7=?ESgloudd  d, dFddd d|$ZӤ b   G  E  (  x  /] * 25 =IVh "Tw Ď  4 # "% $ "( #*?&-u(0 P+3  !-63 #09  (%3<< 7&5? K(8B| .T+;F" dj->J Au/AMzi1DQMP]37#-JPz'0co6@U`g8<<?  9 ? ?        5 8 : ? H P X `       5 9 U X r x       H      ' 0 9 `'0YpMRuGPvA DGHKMPPWW]cflptaDPY`l+0F;   8;FPYGP EPlp6:GPY`:>Y#$t$$C%//0/4@4U4DFFh8j@jijnjjjjjjkEkPkwk}kk@nnoJoOoooooooopՌ"22PRUUdgpjp|-0FP&)r{EV`x  FJ%**0m,0=@INOKPY^_q=$';BBGTWdg+0;@HPQ`ev{ GPY`S`mp|ߦ9@ JP#AZaz ptvwz}/1VY`a Jnoq /M$ (@AX`jp 9 = P X a q                 ( * 0 2 3 5 6 8 9 Y \ ^ r s t               ( * 0 2 3 5 9 = \ ] _ ` a q            5    ( * 9 = X Y Z ] ` a              : = N T V _ a z       023@F@@AGIl*?PQUZ]aefnopuHJMPVXZ[]`Zlo1@Q`lnp xPmpt T^3EL#MOZ} EHMPWY_`}q   !! !!!!!!$!*!+!-!/!9!@ACDFG=Pptv!:AZf  &(:<=?MP]-@BIPuP'0c6@U`g  578<?@U`v   9            5 ` |        5 @ U ` r    H  # '0 1Ep7qru&DGPrv +?@ (*02359=P]a4GJ_a/D<H@F+   /?A  2:P\ .@r2s  0F`aeghjH3 P #$C%//0/4A4F4DFFh8j@j^jpjjjjk/kckwk}kkoJoPoppՌ"2PQRUdegpjp| ,NB!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ߦ9@ JP#_`ab cd ef ghij klmnopqrstupvwxtyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP  QRST  U VWXYZ[\]^ HEH qII&6>6I\6776v7@7(7R7|7733. 37777777733.33.3. 3.3.3.3.3.333....33.3.3333.3.37>?>G>3.33EO>F%F3MFUF-FEFg>_>o>]FeFw>>>>>! >>>JB>>>)Z>JC>#$%&...,t'{''''m''(K)KmFuF( (K33''''''.>.332/.3.3.3.3...3.3.3'?/?7?3.3 3.3.3.33* 33333.3.34C<W;&;-;4;d B;I;P;W;^;;;<E33-24/0KKKK33333.33.333倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ IDDDEEDD7DCDODgDmDsDDDD1DDaDD3.3KKKKKKKK..3-.333.33..3.3.3..wBBB3BBBB333CVBBBBBB3 FG;GIGWGeGsG,1,. .3.3GGGGGG3333333334.3.3#HUH II8 8I>8888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.#$%&...,t'{''''m''(K)KFF( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33* 33333.3.3C<W<===b $=+=2=9=@====F33-24/0KKKK33333.33.333倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ DCE1E5F=FDDDDDDDDEE=EDDDE3.3KKKKKKKK..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3333333334.3.3  &(:<=?MP]-@BIPu'0cpz|6@U`g  578<?@U`v   9            5 ` |        5 @ U ` r    H      # '0 1Ep7qru&DGPrv +?@ (*02359=P]a4GJ_a/D<H@F+   /?A  2:P\ .@r2s  0F`aeghjH3 P #$C%//0/4A4F4DFFh8j@j^jpjjjjk/k@kCkckwk}kk@nnoJoPooCoooooppՌ"2PQRUdegpjp|TV  9;>@DFJKPR46NPnp%*0m,7=NBCK!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ߦ9@ JP#  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVUUUWXYUZ[\]UUUUUU^UU_U`UUabUUUUUcdUefghijkUUUlmnopqrstuvUwxyz{|}~U!(&UUUUUUUUUUUUUUUUUUUUUUUUUUU   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVUUUWXYUZ[\]UUUUUU^UU_U`UUabUUUUUcdUefghijkUUUlmnopqrstuvUwxyz{|}~U!(&UUUUUUUUUUUUUUUUUUUUUUUUUUU  !$'*+.1456789<?BEHKLMQTUZ^bfjntz "(.7=FLRX^djprtvxz|~  %*/49>CHMRW\afkpuz~   "$&(*,.05:@EJOTY^chmrw|  #(-27<AFKPUZ_dinsx} #(-27<AFKPUZ_dinsxz|~ !*6?HWclu~,8AJS_nz"1:IOXajs|   ' 0 9 B N T ] i o ~       * , . 0 2 4 6 8 < > @ B D F H J L N P R T V X Z _ e l t v x z | ~      # ( - 2 7 < A F K P R T V X Z \ ^ b f j n r v z | ~       $ ( , 0 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~       $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |  "',16:>BFJNRVZ^bfjnrvz~  $(,048>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx  !#%')+-/13579;=?ACEGIKMOQSUWY[]_cgkopqrstuwy{}*2:FR^jlnprtvxz|~  "%(+.147:=@GIKMPRTVXZ`filorux{~#,5>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0 1CC%C`JC#L#@##HEH @y 'C,COCC;C7776v7@7(7R7|7733. 37777777733.33.3. 3.3.3.3.3.333....33.3.3333.3.37>?>G>3.33EO>F%F3MFUF-FEFg>_>o>]FeFw>>>>>! >>>JB>>>)Z>JC>Q'#$f'%&X'_'...,t'{''''m''(K)KmF%GuF0G( (K33''''''.>.332/.3.3.3.3...3.3.3'?/?7?3.3 3.3.3.33 CEIO_ae 2TC'5)'?)"C `]*!)^;!^; 33333.3.3";&;-;4;zB;I;P;W;^;''S);;<W!*fZEm3z3*  &. -24/00   |KKK3333>Gc3.33.333 :OJ倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ..3-.333.33..3.3.3..wBBB3BBBB333CVBBBBBB3 FG;GIGWGeGsG,1,. .3.3GGGGGG3CC[C sCGOU]gCCIUgCIS_gCkCCCCKC<V?RKTZ~ol *V? KRKTZ~ol *V? ]RKTZ~ol *V? oRKTZ~ol *V?3334.3.3 c~l( )])g){))q))j ! CC%C`C#L#@###HUH @y CCCCC7888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.Q'#$f'%&X'_'...,t'{''''m''(K)KF5GF@G( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33 CEIO_ae 2C'5)'?)C `]*!)^;!^; 33333.3.3"<===z$=+=2=9=@=''S)===W!*fZFm3z3*  &. -24/00   |KKK3333>Gc3.33.333 :OJ倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3CC[C sCGOU]gCCIUgCIS_gCkCCCCKC<V?RKTZ~ol *V? KRKTZ~ol *V? ]RKTZ~ol *V? oRKTZ~ol *V?3334.3.3 c~l( )])g){))q))j ! ';>NO^46$,KO{&(/dn{7?V_h+ 6-9;=>VI  : > @            6 7 ; > I O Y _       6 8 V W s w       I      ( / : _+(/ZoNQv~5HIOwB0C  )14:E FIJNOQRVX\demou\bcEOZ_m,/G<  69:G HOZHO  7.FOmo 79;>HOZ_fi;*<=Z##o$u$v$$D%///04?4V4CGFg9j?j_jjj kjmjjj jjjjjjFkOkZkbkxk|kk?nnnKoNooooooooo֌ #$$13OSTVchoko}./GO'(szFW_yUH    :?EGIQU%$+"%+,/n-/>?JMPLOZ]`p> #%&(38:<=ACFHLPSUVX`cefks} ,/<?IOR_fwz HOZ_T_no}8:?KO# ';>NO^46$,KO{&(/dn{7?V_h+ 6-9;=>VI  : > @            6 7 ; > I O Y _       6 8 V W s w       I      ( / : _+(/ZoNQv~5HIOwB0C  )14:E FIJNOQRVX\demou\bcEOZ_m,/G<  69:G HOZHO  7.FOmo 79;>HOZ_fi;*<=Z##o$u$v$$D%///V4CGFg9j?j_jjj kjmjjj jjjjjjFkOkZkbkxk|kk?nnnKoNooooooooo֌ #$$13OSTVchoko}./GO'(FW_yUH    :?EGIQU%$+"%+,/n-/>?JMPLOZ]`p> #%&(38:<=ACFHLPSUVX`cefks} ,/<?IOR_fwz HOZ_T_no}8:?KO#3J[_AJ{^C\Jw7]}Cw!cajUB@&n4QIUP"Iwq\-_Ɵ\hCJ9? 4iY3pjNѼ.+ʔב,$42j?+BhO" 9'½[%)<*jRz3jɊ;n!|[Qũi !1䵦S)4S2j.IYbQy8v8LgcUawĖ jbOFڐ!z2(3w Ǿrpi%OLsԴxn'1W/x $/[YI9-La]4ﰽ+VP9` 5Tpv ^7}-y|{"by8q"yD@PXr̔)AQF纱VIoh gRSr$L^ZE+;\xnWS^)NOjcDjP:滜3 5Z $"xE8N>NT/Sﳇ iC{ PLÞQG [~?"ҥa|E^PnhD6 )D.1=(iHfN`oQA'Ga}Bv<xI@wlFDq p[Gem`xqWn3bnGNR q8V$W|TSgTQY"R=:+8HL+P/hǟ ?\&Xk@ rRq65Jn\@0ǯxיXI qN/݅gpb#a "$#&&P{=!鮼 |Fbz?:7yEyRS@{(ڽ ]QGP27~ ?39>dd[מגX!h!1F{:=j+6g<^9*vvos1PY3$m4@qƤsfnKSA Erj0, XkE)j b\^9鸩NtHᮄ\4q:2J(R'o;.NF`g#'s$Aׯ*} }9,TtB%@f4YE" ڷ9BAVU'(d=koǡRlf*dcJ~Xac6 9s;ًiax=Wɝh:35RP-Dm[1ffe7QhTFp7)]((DiuN#CA)Oy}h UA?t'0FEh#9IZV6a=zlpJp@:ޕG5_Vٸb4IAS(S:oF%b(KcfqjQl2@z$Zf;ZdҀL+":XM=c/ˉ a 9] Ĕ&`ӛWfBX2b/8yY'V:ِK/\];5kvʃ&_BSv@+<]4rdtAxN>/wxRB@b+)N*8S|i{$WcI6k2\d|{g ?ƸG9ptyܠ#wnɷB3' 9[h'MlT: yg~ "I~EMe(]XlC]y2E߇yzVǣ(k 'j΍Bi-U’]7OC̳|<٫^b, ^h[8Cpj\˰'cA?ɨRT XT1a~uL DMk/`6%&Ն3rpͩQ$TZe( 夯$#%3|_B^2+@a d_+<~A>k ;YhIVuL6b* :g(`y!W+~$Q)uJ+%2H5'Mv:Dgw}5l<y5[k'[(c%{1%}B#%h~<_3Yq6*,29CҲ~ Gb_BG[Pc?IlAk"|Or$Z= G 5)=eX( U4+\Bx6,n rypr!li6[ylRb7ygݓx koQu4g$L&Ղu<Fu{⴪\?^%C=D(HM 9"l6#)\_*Tz8d 6G_ Z-ȸhǬ#C %dyZ%Z~=sꤏ<"yuх!=afNgy?*mURmG*mhP#] [w6^e}tr+*k%Csbk$<-0K#1 ] aNO3l6e%9m8+u~`q`l|=/iky* +۶+[$[?`~Ey1\3q4U^yuװw'C,f!*EInȱf=B G.aow]>:?qnGxį@xq$!j߶lN@gve RQ^q+zkA6y/+3C{]n^D ;,7)=O2O)ӄ 7V NܧV|$ZxeGD ]];be(jq0/v׭4xpەuCt92o@LmSЗŚSRYu$axmc*K"?7{F=~kvbk]vr!x:g嫂~4l@vs/ޚLЧ~wMmG=K12L =C&ss:y2nacfO4IDܾT^R A}ø@'YlDNGXn{,T\0{*] 0Gy}9Ӷ+p|F 6ڴkBvSy`CܘόdO2I#(7HPm vOsE}SBbYh+@`~ daUH1uyC;wonfh(4rU֑TTew>oGIUy\cb?9>g""m~cf~f78诤Gג߫jO2)RYtu ё|ؕ:S|۱sfFfhp$qKM C,Ue1X#HX 〽w'rPᰜ]HAq dx9dk/ ^BPg\9L(BI6!w_fQĩCQãQ(y$( [8 ưYJ)Xeި.8Ǎz̖ZSt;^sW~%1: 9  !!#$ !"#$%&'())*)+,-./0123456)789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ     [\] !"#$^%&_'()*+,-./0123456789:;<=>`a?@ABCDEFGHIJKLMbNOPQRSTUVWXYZ[\]^_`abcdefgJThijklmnopqrstuvwxyz{|}~cdefghijklmnopqrst'''uvwxyz{|}~     "   !!#$ !"#$%&'())*)+,-./0123456)789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ     [\] !"#$^%&_'()*+,-./0123456789:;<=>`a?@ABCDEFGHIJKLMbNOPQRSTUVWXYZ[\]^_`abcdefgJThijklmnopqrstuvwxyz{|}~cdefghijklmnopqrst'''uvwxyz{|}~     " 00G0GGG#1(1G<1111HE2h2m2 HHH222PHv333ZH3iHnHxH/444}HH4444HV5y5~5HHH 666H6603G_H030304041 4 14GH21>471C4U1a4F1R4n1z4x14}14141414141414115 252$52.52)5@2Q5Y2j5O2`5HHr25|252525257HH2525:;1414(HHw25a:;Z:;o:;h:;:Y<:=<:6<:K<:D<:R<&3<636%;<;<3;<,;<:; ???HH)>9>1>A>oIuIJJJJJJI IIJJJJ'JIIY?q?a?y?i??IIY>q>a>y>i>>II????I!I>>>>II??????'I>>>IIJJJJJJ-I3I/JGJ7JOJ?JWJ9I_D7eDcIkD7qD8wD8}DID>>BBBBBB>!>B/BB9B%BCB)?1?CC C)CC3CI>Q>MBkBWBuBaBB@ @=C[CGCeCQCoC>>BBBBBB77>7>QI>6707$7/D<7W6?7!?{I9?B75DN7;DZ7<<<77A?%F7Q?r7l7`7AD<<<,8&8?-F8828?777MD76)D?88?I@~7GD7YD7CG=N=U=\=0j=c=00q=x===============I@Q@Y@a@i@q@y@@@@@@@@@@@@@@@@@A AA@A!A)A1A9AAAIAQAYAaAiAqAyAAAAAAAAAAAAAAAAAAB Br R && Z>  Zn>ZBn   r~  "JN zr&f>vF 6 . r&Z6J "Vb" nR^ *n 6Zr   ^62 R &NBVV  * v:v2  ~ fb*fz 6  6 J 6z ^ :Vf^*NzJ rb nr . *6 BF"6 b *b >* ZBRR~ F f2"^.&   & N  " V B^bvjN.JNR&RvF R F b j R2bJ*FNJRVZnr*2:Nvb "VZ2 KFB ^ F 2 B ^ & 6  & V v  Z f n " VNb~Zv2*Fv*R":N>VRJZfFf &2&*.6"tBRV^fjvny2^   & * B F R ^ b f n        " & . 6 : : B J N Z ~ b f n      "  * 2 : : V Z ^ f n r J z         2 B B R Z n ~     * > : . F N b j ^ V r z v     ^ & :.JRVB^bfjv~ #(- 26:NJ7.j<An~z~FPUZ_"26NRZ^jdinsx"&}. 26&2:Vv>BFJN&.>RVVbnvZb. f: 26":Nb.BFJ jjnvznrvz~"',2Jfv1;@E*2J6bnrj~OT Ychm&&.rFVbjrw|AZ az yy/00911279HJwxxy~Oaa88  ~"3::+*;<==]>>(*?@?*?*ABCC=DDEEEGFOPP**QQ**RR**SS..TT22VW33YY66[[55\\OO``33aaKKcc11ee((ffDDhh//ii--jjDDkk))llAAoo--qq))rr++uu**}}))&&CC&&**&&''%%EETTpsvw{}t&%@?  ~P/ 0OP_`/1V0a```  З‰‰@@yy}}88A '(/078?@EHMQQSSUUWWYY[[]]__`ghopqJJruVVvwddxyz{pp|}~~   &!&!*!*!A+!+!2!2!N!N!`!o!p!!!!$$$$,/,00,_,`,a,b,b, c,c,d,d,e,e,f,f,g,l,m,m,n,n,o,o,p,p,r,s,u,v,~,,,,,,,,-%-'-'-----@m"/2oy|}}u~Z00ZZZZZZZZçħħŧŧZƧƧuǧʧЧѧ֧٧SS``p0h0h!: AZ'((O(pz'|'''  @   @n_n `nn!""Cဖᘞ5Me      }Mᶶ3ᐟဏE@ 1@@33 333@@@   3@            3@  3@3 3333@@ 3@330303030@0@0;@@0@@303@@@@33 30@@;0 @30@@@@@@;@03@3@0@@0@ @33;@3@ @@3@@ @=333303@@ 03030;03033003 30303003@ @]@]@Ἴ@    @@@@@ @@@@@@@@@@@3@@@E฽@@@@ 3;8@38@ 3@@@3@@30300303;33@@@ @3@3@@33@@ @3030@0303@@@@@@(@303@0303@;030303@3 @@@3333@ 30303030 0308@3@ 3003038;3 30303038@0303@@ }@@@33033303@ E@E@EਯE฿@3@@Q@Yaiq @) ~2 9 @@ဏ@@@@u௯@; @@@@@ @@@@3@@@ 5 5 @ @3j r y  @@5*U*u**u****+5++@ @  E@e@@@@@@3@3;3030;@@@000;3@@333308@@ 30303030 8@@3@30303@330@@03033333@0300;@ @@@@@@ DDA m@DD E-E E 030300;@@@@@@ ME MM KO -U -]V] kMmmp@@ q  smexoyQAi@@1q  @@@@@@@@@@@@@3@@@3@@@3@@@@EဇሏEᐗ %@@% EဇሏEᐓ@@@@@@ @@@@@@@@@@@@@@@3@3@3@@@3@;@@@@@@@@@    3@@@@@3@@@3@    3  @    3@              @@0303 3;@;3@; 30030;3@3@@@3303;@ 0@3@300308303@@ @03038333@ @@@@@303;@@030;303@3@030303 30;3@@03@030;33@03030;3@@@ 3030383@@ @30303;@@030;3@@@003@@@@ 03@30;0@ 33;303;@303 303;@@@ @03@30;@@ @3@030303@ @@3@3@3@3 3;3@@@@ 0@3@030;@@@30@ 30@03@038;@@@@@@@@@@@33@@@@@@3@3 @@@@@ဟ@@300@3@@3@0@@@@@@@@@@@@@@@@@ @@3@3@33@@@@y#######030@3 333######@3@@@@@33333@3@3@@@@3@@3@@@@3@3@@3@ @@@@@@3@ 3 @@@@@@@@@@@@@@@ '@@(((((((((@((@@@@@@@@@@@@@@@@@@@@@@@@@ @I)1 @@@@@@@@@@@@@33@ဖᘞ5Me      }Mᶶ3ᐟဏE@ 1@@33 333@@@   3@            3@  3@3 3333@@ 3@330303030@0@0;@@0@@303@@@@33 30@@;0 @30@@@@@@;@03@3@0@@0@ @33;@3@ @@3@@ @=333303@@ 03030;03033003 30303003@ @]@]@Ἴ@    @@@@@ @@@@@@@@@@@3@@@E฽@@@@ 3;8@38@ 3@@@3@@30300303;33@@@ @3@3@@33@@ @3030@0303@@@@@@(@303@0303@;030303@3 @@@3333@ 30303030 0308@3@ 3003038;3 30303038@0303@@ }@@@33033303@ E@E@EਯE฿@3@@Q@Yaiq @) ~2 9 @@ဏ@@@@u௯@; @@@@@ @@@@3@@@ 5 5 @ @3j r y  @@5*U*u**u****+5++@ @  E@e@@@@@@3@3;3030;@@@000;3@@333308@@ 30303030 8@@3@30303@330@@03033333@0300;@ @@@@@@ DDA m@DD E-E E 030300;@@@@@@ ME MM KO -U -]V] kMmmp@@ q  smexoyQAi@@1q  @@@@@@@@@@@@@3@@@3@@@3@@@@EဇሏEᐗ %@@% EဇሏEᐓ@@@@@@ @@@@@@@@@@@@@@@3@3@3@@@3@;@@@@@@@@@    3@@@@@3@@@3@    3  @    3@              @@0303 3;@;3@; 30030;3@3@@@3303;@ 0@3@300308303@@ @03038333@ @@@@@303;@@030;303@3@030303 30;3@@03@030;33@03030;3@@@ 3030383@@ @30303;@@030;3@@@003@@@@ 03@30;0@ 33;303;@303 303;@@@ @03@30;@@ @3@030303@ @@3@3@3@3 3;3@@@@ 0@3@030;@@@30@ 30@03@038;@@@@@@@@@@@33@@@@@@3@3 @@@@@ဟ@@300@3@@3@0@@@@@@@@@@@@@@@@@ @@3@3@33@@@@y#######030@3 333######@3@@@@@33333@3@3@@@@3@@3@@@@3@3@@3@ @@@@@@3@ 3 @@@@@@@@@@@@@@@ '@@(((((((((@((@@@@@@@@@@@@@@@@@@@@@@@@@ @I)1 @@@@@@@@@@@@@33@S`i2Տ\ B噜asRU^RxZGv\cҾ("J382t/)?;)?Z;S$YJeefXI- y]v>ᮺsy,,SoΊߙZiKy+ؑlHFq6N%#MDz 0rxjm5Q^3-O\5x,#Gf+1̯!P;LvU0 =*$Jߓk<ܭ 4mx݅KbSh@drk3o=qԇQhˌɩf%H;WK`0Kmtv-^85A>~;ΥuLR5]JBϓ CszΕ IBNww&Ԧ`fʴ"U 8G5U]_nUc^s 4!b/6#u{+ջCn6%!3G-;eUk niԜ %Cpv,n% DH(W^j8dW*͖7Ƽ>'u.h3DJkq!jz~X1[Dd)غ`YLhr3)$oE=VyԶӥk0bЏlwHijޔ3<)). %I qM^o(TPa,J2q\":1n1'H cmƚp̻, }x=M֥`%NFN *!&8#Xl᮴ fo(,nGMȟPEyۤ̂(}eC2f;^j@>Ծ@J6VcؑDwZhN"uO>6qZS >D[Z U1(\Q† yX葀r9Mnbf-!= -@s]Ι 4f|hNr#j9 bf'NDGCɨbK"=`?woɦq!M8U"|Hj`FS*~+TmBDt.OSU9zc%C1'~U5yX=X4/UKc5u|&o<%y^Fˋ#w" _uv{fg6]I@'᷂YyX7 1 ?gjgν$m\,B`A֋nsXmSx@I̮jPu9Hh[BRm-^zy;Ӧ{xd J2_`U\&;\HH/oJ&$ڔ;W`X=vWζ]y+zCB,Z[lS*xP1r'0(d$5VN1J<왾6w6^F?nY{U(ω/3&t~W!v]?OH8oꖐSkuzcZ (YImM\ٻ-qd`3ϪMy4,9UgAwGDrĆ`I,"u(19b7]k62c}:%˅tח1]dqӨMS{$crf-bgmYGB`=ހtRx Sal'.gVfQp[yͶSۣ2Fqk(󗿗φͲ"a}ȁ_ Wkyl]=;t60c1ÜD۾`wD-HU;մJM-u-]cxZbҶxF\4|q* 4M=5]z Y`tWFK?p8+׬XҘ'Fc{#TwBձL;,)UdJ_ wsj=r{~T>*bC#Oa鍲5*g8Ԕd1Ӎ@~8<vJ)?@'D|Y+(0TX0tx>ݔ<6Rj20:'Dܡ?^:)巧`Htޥ!d4[IV֑f4 ʕ%ΟkB@OQ]=;i‡FQ* k)XrGVieg!Ysۓ,S>ih0PҸ:BAsUrsONdP#9JFE߃b}$lۃ2kr]ΖKde2?/nO|{S ȢUra6__,tuE7#8H,RA,ZQ;"sMH=`>_ Xf&1ѷ?RpIFwϻ3ӛa՟k.dȂS|nǰsƣz={ch iN\ ->!Qab OInHiãۉZ&ޓuZF)v:k\m#X񗳻e 3R,.X}jtYg+WN¨@8H۔labMPF wfנ.t `2$^V$ il`#c?ʏū|0ks]|d|Fk:Bzk ,SҘl.J{qDw`zdrIdGJ|l_bϛ= -]:NJy4yxӺ9QX*r`K6(eNC2)b"=s>'=z_R?Z}5)f&ϰʨ&4*cݓR04`Cx g|A8?, LKK6)e^y 1cJFM}e5CENKP.?q/^9ϛdLZN'sv]pÂz}oj:U&N6U (&.tE+۲Ꝓɋ ;oOFkȒD7@n ˻zj B̽ܝY-#JFTW"GdeT-V+~xY~)p$wZU|Hihaέ["RDù?BrAggɟܥ k`ŗ T`鸶h;#)8>G#g$!e r v6i>[ΛpD0 ’sHo^+Ʊ;Hw 68(J촰c%2R l (8Z~HW_S#YQZ-7yHelE1D"'Xd˞k?/"=~Fr6-j[wŸG꺔R̆$bGט#?9': dҬ$0hS>-_Uj[n*uRDZZE dug.k`MFU=Ķ{s휆&|VsJyݭ'vcR] X`UY~S|n𸪯qޝhp b!q&" ŗ{`=Ui jP|};+*\B`w[zY78U@gf/Flk7._=;K##⼺;1a ^wl}9!J5U"ST.wAP~uu\T Ғsi$$dDKN^wÿ-> ;ZJbڗ<섎ꊭaнK'Jg9EpCK,΁My%1^_B0CXn >;5Snʋ }4Ud^wH~t*J6ڝXv%"݃:QӮB5yrjR;uD<u'm8c$S,^{tPd2l1+a}JϟCb.2:]‡ I62wyh.L[Mľ K7٬:|S\ 5$oe(KB.E.D?ˈPo ̼H9i$ MZDs00 h16A_p=|6+ aw̫Liv2=BzՔI?il7Sr3܀#GGŧN@a+eX&1Zd;Onp= ףp= ףp= ף@P$ (k@C*焑 1_.@v:k #NJbxz&n2xW ?h@aQYȥo: '@ x9?P 6NgM"E@|o p+ŝ(lL672V߄@<\l: K{ΗԆ H½D PvU1P?]%OʡZ7и@=J'ƫ͜mCư#o\{2~,݋] 7 n0b/54"&EE=!A+p֕C)@_v $_E^D+S69uq`D]ȩdL1FUJ:Ack݈-~<MXdQpl԰k2#FۄEk0ScgedF|~`?~On_O83^Iwm,ӿ\U /ssc*Og(~MTၲQ5F&B|Z"e B‹Xixu3_FiYW皮dR7/-#]gk}{x F6@2cPME;P fδzBΨ?]76l3oߌGA]DG #٨tY l*/h7ȇCØE)wyTzm)^Tj fX_4'R⌏.]^EsCupv]dB!ܨSyJIj~IrhcۇiEB<]ҩE֒PֲE# ś[[hwl26h& C2d#DѸIDvja5 bl _ӨŹzÇ67h͉,TIIdZk"!"lk*Ǭ唔o=]S59#wˌ:BnSv*xriJh %i]_fX~ь[eaz?w/8y/UJX8σS*g].a{tZݲ\*q߈=9tau]V7zGѹ: Ub" `M1k{W+ ~Z픝_vIsX}Aȏ%زnYzdұَ_o_FTX H{%;#jVJ ,ڔQ+(B]D"ySJt:5(+EWA\Bu-/ں5ai .|]|i~C%94›^g.²xº}DKa2si*bd2u{}(>DRs\x5˲dj:aEz®kE='WT[rKxT6c? <ݧjW<Ϗ(QDme %JdCYxķ ]=apeFU Yy "WB$ ˇu/Sm ξTSܷmh.$*(弇Di}nVyu܁7UD`ג{S⻅jU'9pxtmbCF'z8TfAX1{jiQ.DA"&v'ZҪ/ iyhx{RMh, XǂVpEa75 . @v`|BǼ5Гj]CMĸR5VJpz3zrS!{Z\L.YOt֨Ysyob dp+EV݊>ԅ6+>m.7J7̶șŇ" @Ա K ж%YJ^MdD.:0ܵ\$~sީqG_,>%t]V w(N/ukPopk/t#[DzT%k$M,4xߎT¶@)s$ Уrt-ČV<ڒez|/~qeݍ~e>"t*U1Vx_':5k\(37h*VFs-Ciu+-,Ws)b);gj{IB_s!6p$wqBv/?ӌ# S@J286c]ɞ>CH|Y{ ځo&|(1ca/r}c%2t.5_(o?0:ͳ[cрyϧz^KDb2üfQ6^U+Gٍ@4õjQOP4c3Vnع^G/ O 5X'a'bbLBx8}Vc G,ݬ@!tlXxP]C 7 RzRT%`ϖi *.G|$ PATW3L~tґR?GQ.G#wX嘡cHv WD^/gQe,s?5;X^~OK ނ'aB.cy9'zխ"xR7t8DZJٵ "Ho·"MPu8벚ƣJy©Qa_A33Ӽ(ׁl"M"sǥ 4k"hk9@fu)/ ZI`So:K[8h#`^ʵמrFB,8,Fj¢l㴒$s ǓbwRŧmO˸8ۢ:g(3tsɥDm@e?S.R_PD;ϕ&wd C4>04x^M Ɩr =A}_Lb%xW[wߺnYb47>'6r  ;~"6汧 O:!UWʏbO∩*r;듧EuϬ3f0rIl|j; hۘs*hیC?C:ԑy!YkO jHI6.iyF㌄ 9NDN @iꅕ!o!]eqKguDid>00G0GGG#1(1G<1111HE2h2m2 HHH222PHv333ZH3iHnHxH/444}HH4444HV5y5~5HHH 666H6603G_H030304041 4 14GH21>471C4U1a4F1R4n1z4x14}14141414141414115 252$52.52)5d@2Q5Y2j5O2`5HHr25|252525257HH2525:;1414(HHw25a:;Z:;o:;h:;:Y<:=<:6<:K<:D<:R<&3<636%;<;<3;<,;<:; ???HH)>9>1>A>oIuIJJJJJJI IIJJJJ'JIIY?q?a?y?i??IIY>q>a>y>i>>II????I!I>>>>II??????'I>>>IIJJJJJJ-I3I/JGJ7JOJ?JWJ9I_D7eDcIkD7qD8wD8}DID>>BBBBBB>!>B/BB9B%BCB)?1?CC C)CC3CI>Q>MBkBWBuBaBB@ @=C[CGCeCQCoC>>BBBBBB77>7>QI>6707$7/D<7CWCCE?7!?{I9?B75DN7;DZ7EEE77A?%F7Q?r7l7`7ADEEE,8&8?-F8828?777MD7EE?88?I@~7GD7YD7CC GQQQSSY]aceeeu<uWDEGKM[ lE$ZI^#j#$F##R####X##d##$$SmxqYGI[H| G=N=U=\=0j=c=00q=x===============#%')+-/13<EKQW$(,048<@DHLPTX\`dhlptx|CEGIKMOQSU*~2 Z j r v r  > J j v z ~  . 2 : > F N ^ z   &.nrz~>~BJ^jrz~&.jnvz~:NRZ:>BZ^fz~I@Q@Y@a@i@q@y@@@@@@@@@@@@@@@@@A AA@D#DA'!A)A1A9AAAIAQAYAaAiAqAyAAAAAAAAAAAAAAAAAAB B'Z"&n*.26:>BFJNJK KKKK"K(K.K4K:K@KFKLKRKXK^KdKjKpKvKRV^bfjrvz~v  *!!!!!!!!!!!!!!](f(o(x((((((((((((,$,!!!8"!"!"! "P"n"h"\"">"J"b"V"","t""""!2"D"z"""&"""""* "*26>BFJNY/a/i/q/y//////////0//v  Z FF Z>  z "> z R F :  !$'*-036?#2AP_n"""4 "&*.26:>BFJNRVZ^bjrz~*(C,*S,)%0))i0*)))+ +*+/-+:+,'--c,G+.-A-T+))/a+s,60**n+*%*((/*9*T-{+,g-+M*C*}0+z-W*,a*+k*+G0+,+(X0u**+***,+(-/,+0**+( ,,#(-* (7FUds""""" ##"#.#:#v#####Dcw,08(F(1(?(,zbJ#u }eV,LY/q\2l$DTp(GX$,$PxM((t_hM&kP)\}f%$x{5;>`ASht$ $-<KZi"""""###(#4#p#|###########@r R && Z>  Zn>ZBn   r~  "JN zr&f>vF 6 . r&Z6J "Vb" nR^ *n 6Zr   ^62 R &NBVV  * v:v2  ~ fb*fz 6  6 J 6z ^ :Vf^*NzJ rb nr . *6 BF"6 b *b >* ZBRR~ F f2"^.&   & N  " V B^bvjN.JNR&RvF R F b j R2bJ*FNJRVZnr*2:Nvb "VZ2 KFB ^ F 2 B ^ & 6  & V v  Z f n " VNb~Zv2*Fv*R":N>VRJZfFf &2&*.6" 8<DCE #&1E7E5F=FDDDDDDDDDDDDDDDDEE EEE%E+E=EDDDEEEEE!&&J'J'''5'5'.'.'<'<'C'C'C' ' ' '&&' ''',;@EJY^mrw   + 0 5 D I X ] b g l q v { !!!%!*!/!4!9!>!H!M!R!a!p!u!aEgEEEEF FFF&&' ' ''' "',1;@l q !!!!%!*!EW!\!a!f!p!u!&&&'',EJY^mw  + 0 5 D I X ] b g v { !!! !/!4!EH!M!R!a!k!'',6 ! !a!k!EFMFUF! & : ? N S chOT|   ! & : ? N S chOT|     + IEIEA$V$V$]$d$y$$$$$$$$$$$$$%%/%/%K%%% %!%!%(%(%R%`%`%g%g%n%u%|%%%%%%%%%%%%&&%%&&&&@&G&N&$&2&U&\&+&&&&&x&x&&&&&&:$O$H$r$k$$$$$$$6%%Y%%&&&&j&%&%%%%q&c&%%%q&$$9&%3$%|%K%$&D%%((#))(),)=%-3,)~57?3333333.......33:6w{CCCC~75?: 9=;y ACmECCCsECyEDE DEDE)OEOEUEUEEE[E[EEEEE,,////2255558888;;;;>>>>AAAADDGGJJMMPPPPSSSSVVVVYYYY\\\\____bbbbeeeehhhhkkkknnnnqqqqttttwwwwzzzz}}A/A/I/I/Q/Q/ nr~fnv "&*.26:>BFJNRVZ^bjrz~KK |KKKKKKKKKZ"&n*.26:>BFJNJK KKKK"K(K.K4K:K@KFKLKRKXK^KdKjKpKvKC>bBFJNfj N&(:4.CRVBX[`ps|eRvjocegikmoqsu  !$' *-0369RKTZ~ol!#%')+-/13!#%')+-/13!#%')+-/13!#%')+-/13!#%')+-/133333333333333333333333333333333333333362,/;D}M>\nqtwPbhVkJS58AGY_e/;z>nqtwPbhVkS58AYe;>qwPbVkSAYe/;z>\ntwPbhVkS58AY_e,/;Dz}M>\qtwPbhVkJS58AGY_e/;D}M>\qtwPbhVkJS58AGY_e9BHNT  U(GeiCEGIKMOQSUWY[]_a'' B G * "  " f   ~  ^ B   6  j >& R >tBRV^fjvny2^   & * B F R ^ b f n        " & . 6 : : B J N Z ~ b f n      "  * 2 : : V Z ^ f n r J z         2 B B R Z n ~     * > : . F N b j ^ V r z v     ^ & :.JRVB^bfjv~ #(- 26:NJ7.j<An~z~FPUZ_"26NRZ^jdinsx"&}. 26&2:Vv>BFJN&.>RVVbnvZb. f: 26":Nb.BFJ jjnvznrvz~"',2Jfv1;@E*2J6bnrj~OT Ychm&&.rFVbjrw|     :*  Z J Z J                                 :*:* zj           :*:*  :*:*:*:*:*:*:* :*:*:*:*:* zjzj*:ʚzj :*:* :* :*:*:*:* zj :*:*:*:*:* :*:*:*:*       zj    :*  Z J Z J :*                               :*  Z J Z J                                 :*:* zj           :*:*  :*:*:*:*:*:*:* :*:*:*:*:* zjzj*:ʚzj :*:* :* :*:*:*:* zj :*:*:*:*:* :*:*:*:*       zj    :*  Z J Z J :*                           @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ ")1:BIQYai                        q5M  =yy=}                       e=}  }}= %==  Um   } =  -E]u=}=                                       = 3 333333333333333333333333333333333333333333  % @@"=@@@@:*UU-=-@@m@            } --                 3333333                           @=}=                                                @@@@@@@33333333333@                                          333333333333333333333  3   9AIQ                            3333333@333333333333      @@  3                              3333333333333333                         333@@@         @@@@@                          @@@@@@@@@33333333                               0333333330000;003333333Yaiqy33300@@@@@@@@@@@@30003333@@00@@00;@@@@@@@@0@@@@@33@@3@@330@@@@@@@@@@@@@3@00033@@@@33@@33;@@@3@@@@@@@@@@@@@@@333@@@@@@@@@@330@@@@@@@@300033333@330@00;@@@@@@@@@@@@@@@@@33@@@@@@@@@333333@300@@@@@@@@@@30303333@@00@@00;@@@@@@@330@@@@@33@@@@@@@@@@@@3@@@@@@@@@@@@@@@@@@@@@@@0030000@333@333;@@@@@@@33@@@@@33@@@@@@@@@300@@@@@@30300000@300@003;@@@@@@@00@@@@@@@33@@@0@@@@@@@@@@@@03333@000@000;@@@@033@@@@@@@@3333333;33@@@!)19@@@@33A3IQYai3333303q33;33333333y3333@3333333333333333333333333333333@ !)Q19AIQYaiq !yQ9AIIq !)1}9AIQYaiqy                                           -M                @@EEEEEE@@@E@E@E@EEEEEEEEE @@!)19AIQ!)19AIQYaiqyYaiqy@EEe~ @!*2:A@@EE @JRZaEE% Mj*r@@y@=Vv@ @@  @@@@@@@@@@  @@@@@@@@@@@@@@@@ "*2)I)1 "*2@Q a!)9A@@@9&Efi A)I9QYaiq@!Qy  ! )1= 9A I] !!} )1 9A I !@@@@@@@@@@@@@@@@@@@@@I)1 y > ^ ~     " @@@@@@@@@@@@@@@@@@@@> ^ ~  > ^ ~  > ^ ~ >^ !)Q9QAI  !)Q9QAI  A I }=YAQ Q Y                  =333 @@@@@'5'U'u'''''(5(U(u((((()5)U)u)))@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ a 333300%))*U+u+++++++,,,,5,5,5,U,u,u,**u,u,,,u,u,**u,u,U,U,,,,,@,-5-5-U-u-----.5.U.U.u.....u../.u.5/U/u///-,//050U0u000001@51U1u11111252U2u1u222 22353U3   u333333454U4u44444555U5u55555656U6u666 ! 66757U7u77777858U8u88888959U9u99999:5:U:u:::::;5;U;u;;;;;<5>5>M>e>}>>>>>>>>> ?%?=?U?U?m?m?m?????????@-@-@-@ @ !)@19A@@IQYA%AEAeAAaiqyAAAB%BEBeBBBBBC%C EC!eCC@)19A@IQYaiqyC!CC@D !)19AIQYaiqy%D                       33333333333333              33                                      =ED     =             q!)eD        y}D}@@@@@ @@  @@@@@@@@@@@@@@@@@@@@@@@@QA e-eMemeeeee f-fMfmfffff g-gMgmggggg h-hMhmhhhhh i-iMimiiiii j-jMjmjjjjj k-kMkmkzz {-{M{m{{{{{ |-|M|m|| |||!)1 }-}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9AIM}m}QQ@@@@@@@@@@@@Yaiqy@@@@@3y !)@19AIQ@Y@ai@qy@    !!!!))))111199AAIIQQYYaaiiiiqqqqyyyy@@@@@@@@@@@@@@@@I  !!))11999AAAIIIIIQYaiqy !)1:BJRZbiqayAi!)19Yai1 QYa qy !)19AI!QYaiqy !)AIQY)qy19 Aa IAQYa!)Y1 Aiqy !)1Y9AIQ !)1Y9AIQ!)1YQa)19!)1YYaiiqy  !!)19AAIQYaiiqy)199AI@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@QYaiqy3333333333333333}@"}}@@@@@@@3333333333333333@} ~*2-~M~m~-~~~~~~ ~-Nn@@"*2~-   " * "@2 : B J @@@@Q .N@nY a i ΀q y !! ! !!!!!!!!!!!!!!!!!)!)!)!)!1!1!1!1!9!9!9!9!A!A!A!A!I!I!I!I!Q!Q!Q!Q!Y!Y!Y!Y!a!a!a!a!i!i!i!i!q!q!q!q!y!y!y!y!!!!!!!!!!!!!!!!!!!@@@! : B !*2  a !I)1 "" "* J  !)Q9QAI 2 !r !)Q9QAI !! -a MMḿ -Mm͂ -Mm̓ -MmM̈́ -Mm ͅͅ M-M-mM͆͆MM @-Mmm͇ -- Mm͈ @@@M---M-@@MMm-mM@@m-m@@͉͉@@@!!!" "-@Mmm͊@@@@@@@@@@@@@@@@@@@@@@@@@@@@=UmUUmU=@͋=M]M}M]M=@=M]@}M@@@@@@@""!")"@1"9"A"I"Q"Y"a"i"q"y"""""A""""""""%"""Q"EI # ###!#)#1#9#@A#I#Q#Y#a#i#q#e@@@@@                               33@@@@     @@@@@@@@@                  @@@@@@@@@@@@@@@@@@@      @@@@@@@@@@@@@@@@3300@@@@@@@@@330030000@@00@@008@@@@@@@@0@@@@@00@@3333333@@@33333@@@@@@@@@@@@@@@@@000000@00@@338; !)Q9QAI  !)Q9QAI  !)Q9QAI  @!)Q9QAI  !)Q9QAI  !)Q9QAI @@@ @@@@)Q9Q@AI @@!)@9QAI  !)Q9QAI  !)Q9QAI @ @@!)Q9Q@AI @ !)Q9QAI @ @!@Q@@@AI @ !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI ##@@##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$q$q$@@I)1 I)1 I)1 I)1 I)1 3333333@33333333333333333@@3333333@33@33333@@@@@y$$$$$$$$$$$$$$$$$% %%%!%)%1%9%A%I%Q%y$$$$$$$$$$$$$$$% %Y%1%a%i%q%y%%@@@@@@@@@@@@@@@@@@55uu5555uu55᥌                              @! ! 1!!a!i!q!y!!A!Q!!!Y!!! )!9!I!%%%@ @!@@ @!a!i!q!y!!A!Q!!!Y!@! @)!@I!@@@@@@ @@@@ @!@i!@y!!A!@!!Y!@!@@ @)!@I!@@%@ @!@@ 1!!a!@q!y!!A!Q!!!Y!@! @)!9!I!%@%@ !! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@ @! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@%%%%%%%%%%%%& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&9& !)Q9QAI &&&&&&'''!'@@@@@@@@@@@@@)'1'9'A'I'Q'Y'a'i'q'y'''''''''''''''''( (((!()(1(9(A(I(Q(Y(a(i(q(y((@@@@(((() )))!)))1)9)݌A)I)Q)Y)a)i)'q)y))))=)))))q())))))))* ***!*)*1*1*1*]9*A*I*}Q*Y*a*i*q*y******************+ +++!+)+1+9+A+I+Q+Y+Q'a+i+ݍq+y+++++@ +++++++++@ ++++, ,=,],!,),1,9,A,I,Q,Y,a,i,}q,y,,,,,ݎ,,,,,,,,,,,,,- -=--!-)-!-1-9-A-I-Q-Y-a-i-q-y-----]-----}-------. ...!.).1.9.A.I.Q.Y.a.i.q.y............ݏ...../ // /!/)/1/9/A/I/Q/Y/=]a/}i/q/y////////////////ݐ/0 000!0)01090A0=I0@ Q0Y0a0]i0q0}y00000000000000ݑ00=]001}ݒ 1111!1)11191A1I1Q1Y1a1=]i1q1y1111}@ 1ݓ1111111111112 2=]2}2!2)212ݔ92A2I2Q2Y2a2i2q2=]},y222222222222222223 333!3)3ݕ1393A3I3=Q3]Y3a3}i3q3y33333333333@ 3333334 444ݖ!4)41494A4I4Q4Y4a4i4=]q4y44}44Mh4444444444ݗ4445 555m{!5)515=95]A5A5I5}Q5Y5a5i5q5y555555555ݘ55555555=@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ ")1:BIQYai                        q5M  =yy=}                       e=}  }}= %==  Um   } =  -E]u=}=                                       = 3 333333333333333333333333333333333333333333  % @@"=@@@@:*UU-=-@@m@            } --                 3333333                           @=}=                                                @@@@@@@33333333333@                                          333333333333333333333  3   9AIQ                            3333333@333333333333      @@  3                              3333333333333333                         333@@@         @@@@@                          @@@@@@@@@33333333                               0333333330000;003333333Yaiqy33300@@@@@@@@@@@@30003333@@00@@00;@@@@@@@@0@@@@@33@@3@@330@@@@@@@@@@@@@3@00033@@@@33@@33;@@@3@@@@@@@@@@@@@@@333@@@@@@@@@@330@@@@@@@@300033333@330@00;@@@@@@@@@@@@@@@@@33@@@@@@@@@333333@300@@@@@@@@@@30303333@@00@@00;@@@@@@@330@@@@@33@@@@@@@@@@@@3@@@@@@@@@@@@@@@@@@@@@@@0030000@333@333;@@@@@@@33@@@@@33@@@@@@@@@300@@@@@@30300000@300@003;@@@@@@@00@@@@@@@33@@@0@@@@@@@@@@@@03333@000@000;@@@@033@@@@@@@@3333333;33@@@!)19@@@@33A3IQYai3333303q33;33333333y3333@3333333333333333333333333333333@ !)Q19AIQYaiq !yQ9AIIq !)1}9AIQYaiqy                                           -M                @@EEEEEE@@@E@E@E@EEEEEEEEE @@!)19AIQ!)19AIQYaiqyYaiqy@EEe~ @!*2:A@@EE @JRZaEE% Mj*r@@y@=Vv@ @@  @@@@@@@@@@  @@@@@@@@@@@@@@@@ "*2)I)1 "*2@Q a!)9A@@@9&Efi A)I9QYaiq@!Qy  ! )1= 9A I] !!} )1 9A I !@@@@@@@@@@@@@@@@@@@@@I)1 y > ^ ~     " @@@@@@@@@@@@@@@@@@@@> ^ ~  > ^ ~  > ^ ~ >^ !)Q9QAI  !)Q9QAI  A I }=YAQ Q Y                  =333 @@@@@'5'U'u'''''(5(U(u((((()5)U)u)))@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ a 333300%))*U+u+++++++,,,,5,5,5,U,u,u,**u,u,,,u,u,**u,u,U,U,,,,,@,-5-5-U-u-----.5.U.U.u.....u../.u.5/U/u///-,//050U0u000001@51U1u11111252U2u1u222 22353U3   u333333454U4u44444555U5u55555656U6u666 ! 66757U7u77777858U8u88888959U9u99999:5:U:u:::::;5;U;u;;;;;<5>5>M>e>}>>>>>>>>> ?%?=?U?U?m?m?m?????????@-@-@-@ @ !)@19A@@IQYA%AEAeAAaiqyAAAB%BEBeBBBBBC%C EC!eCC@)19A@IQYaiqyC!CC@D !)19AIQYaiqy%D                       33333333333333              33                                      =ED     =             q!)eD        y}D}@@@@@ @@  @@@@@@@@@@@@@@@@@@@@@@@@QA e-eMemeeeee f-fMfmfffff g-gMgmggggg h-hMhmhhhhh i-iMimiiiii j-jMjmjjjjj k-kMkmkzz {-{M{m{{{{{ |-|M|m|| |||!)1 }-}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9AIM}m}QQ@@@@@@@@@@@@Yaiqy@@@@@3y !)@19AIQ@Y@ai@qy@    !!!!))))111199AAIIQQYYaaiiiiqqqqyyyy@@@@@@@@@@@@@@@@I  !!))11999AAAIIIIIQYaiqy !)1:BJRZbiqayAi!)19Yai1 QYa qy !)19AI!QYaiqy !)AIQY)qy19 Aa IAQYa!)Y1 Aiqy !)1Y9AIQ !)1Y9AIQ!)1YQa)19!)1YYaiiqy  !!)19AAIQYaiiqy)199AI@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@QYaiqy3333333333333333}@"}}@@@@@@@3333333333333333@} ~*2-~M~m~-~~~~~~ ~-Nn@@"*2~-   " * "@2 : B J @@@@Q .N@nY a i ΀q y !! ! !!!!!!!!!!!!!!!!!)!)!)!)!1!1!1!1!9!9!9!9!A!A!A!A!I!I!I!I!Q!Q!Q!Q!Y!Y!Y!Y!a!a!a!a!i!i!i!i!q!q!q!q!y!y!y!y!!!!!!!!!!!!!!!!!!!@@@! : B !*2  a !I)1 "" "* J  !)Q9QAI 2 !r !)Q9QAI !! -a MMḿ -Mm͂ -Mm̓ -MmM̈́ -Mm ͅͅ M-M-mM͆͆MM @-Mmm͇ -- Mm͈ @@@M---M-@@MMm-mM@@m-m@@͉͉@@@!!!" "-@Mmm͊@@@@@@@@@@@@@@@@@@@@@@@@@@@@=UmUUmU=@͋=M]M}M]M=@=M]@}M@@@@@@@""!")"@1"9"A"I"Q"Y"a"i"q"y"""""A""""""""%"""Q"EI # ###!#)#1#9#@A#I#Q#Y#a#i#q#e@@@@@                               33@@@@     @@@@@@@@@                  @@@@@@@@@@@@@@@@@@@      @@@@@@@@@@@@@@@@3300@@@@@@@@@330030000@@00@@008@@@@@@@@0@@@@@00@@3333333@@@33333@@@@@@@@@@@@@@@@@000000@00@@338; !)Q9QAI  !)Q9QAI  !)Q9QAI  @!)Q9QAI  !)Q9QAI  !)Q9QAI @@@ @@@@)Q9Q@AI @@!)@9QAI  !)Q9QAI  !)Q9QAI @ @@!)Q9Q@AI @ !)Q9QAI @ @!@Q@@@AI @ !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI ##@@##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$q$q$@@I)1 I)1 I)1 I)1 I)1 3333333@33333333333333333@@3333333@33@33333@@@@@y$$$$$$$$$$$$$$$$$% %%%!%)%1%9%A%I%Q%y$$$$$$$$$$$$$$$% %Y%1%a%i%q%y%%@@@@@@@@@@@@@@@@@@55uu5555uu55᥌                              @! ! 1!!a!i!q!y!!A!Q!!!Y!!! )!9!I!%%%@ @!@@ @!a!i!q!y!!A!Q!!!Y!@! @)!@I!@@@@@@ @@@@ @!@i!@y!!A!@!!Y!@!@@ @)!@I!@@%@ @!@@ 1!!a!@q!y!!A!Q!!!Y!@! @)!9!I!%@%@ !! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@ @! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@%%%%%%%%%%%%& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&9& !)Q9QAI &&&&&&'''!'@@@@@@@@@@@@@)'1'9'A'I'Q'Y'a'i'q'y'''''''''''''''''( (((!()(1(9(A(I(Q(Y(a(i(q(y((@@@@(((() )))!)))1)9)݌A)I)Q)Y)a)i)'q)y))))=)))))q())))))))* ***!*)*1*1*1*]9*A*I*}Q*Y*a*i*q*y******************+ +++!+)+1+9+A+I+Q+Y+Q'a+i+ݍq+y+++++@ +++++++++@ ++++, ,=,],!,),1,9,A,I,Q,Y,a,i,}q,y,,,,,ݎ,,,,,,,,,,,,,- -=--!-)-!-1-9-A-I-Q-Y-a-i-q-y-----]-----}-------. ...!.).1.9.A.I.Q.Y.a.i.q.y............ݏ...../ // /!/)/1/9/A/I/Q/Y/=]a/}i/q/y////////////////ݐ/0 000!0)01090A0=I0@ Q0Y0a0]i0q0}y00000000000000ݑ00=]001}ݒ 1111!1)11191A1I1Q1Y1a1=]i1q1y1111}@ 1ݓ1111111111112 2=]2}2!2)212ݔ92A2I2Q2Y2a2i2q2=]},y222222222222222223 333!3)3ݕ1393A3I3=Q3]Y3a3}i3q3y33333333333@ 3333334 444ݖ!4)41494A4I4Q4Y4a4i4=]q4y44}44Mh4444444444ݗ4445 555m{!5)515=95]A5A5I5}Q5Y5a5i5q5y555555555ݘ55555555=@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@A A!A"A#A$A%A&A'A(A)A*A+A,A-A.A/A0A1A2A3A4A5A6A7A8A9A:A;AA?A@AAABACADAEAFAGAHAIAJAKALAMANAOAPAQARASATAUAVAWAXAYAZA[A\A]A^A_A`AaAbAcAdAeAfAgAhAiAjAkAlAmAnAoApAqArAsAtAuAvAwAxAyAzA{A|A}A~B¢B£B¥B¦B¬B·BÆBæBðBøBĦBħBıBŋBœBƎBƐBƫBǀBǁBǂBȢBȷBɐBɑBɒBɓBɔBɕBɖBɗBɘBəBɛBɜBɞBɟBɠBɡBɢBɣBɤBɥBɦBɧBɨBɩBɪBɫBɬBɭBɮBɯBɰBɱBɲBɳBɴBɵBɶBɷBɸBɹBɺBɻBɽBɾBʀBʁBʂBʃBʄBʈBʉBʊBʋBʌBʍBʎBʏBʐBʑBʒBʕBʘBʙBʛBʜBʝBʟBʡBʢBʣBʤBʥBʦBʧBʨBʩBʪBʫBʹBːBˑBΑBΒBΓBΔBΕBΖBΗBΘBΙBΚBΛBΜBΝBΞBΟBΠBΡBΣBΤBΥBΦBΧBΨBΩBαBβBγBδBεBζBηBθBιBκBλBμBνBξBοBπBρBςBσBτBυBφBχBψBωBϜBϝBаBбBвBгBдBеBжBзBиBкBлBмBнBоBпBрBсBтBуBфBхBцBчBшBъBыBьBэBюBѕBіBјBџBґBҫBүBұBӏBәBөBאBבBגBדBהBכBלBםBעBרBתBءBاBبBةBتBثBجBحBخBدBذBرBزBسBشBصBضBطBظBعBغBفBقBكBلBمBنBهBوBىBيBٮBٯBٱBٹBٺBٻBپBٿBڀBڃBڄBچBڇBڈBڌBڍBڎBڑBژBڡBڤBڦBکBڭBگBڱBڳBںBڻBھBہBۅBۆBۇBۈBۉBۋBیBېBےC་CნCᄀCᄁCᄂCᄃCᄄCᄅCᄆCᄇCᄈCᄉCᄊCᄋCᄌCᄍCᄎCᄏCᄐCᄑCᄒCᄔCᄕCᄚCᄜCᄝCᄞCᄠCᄡCᄢCᄣCᄧCᄩCᄫCᄬCᄭCᄮCᄯCᄲCᄶCᅀCᅇCᅌCᅗCᅘCᅙCᅠCᆄCᆅCᆈCᆑCᆒCᆔCᆞCᆡCᇇCᇈCᇌCᇎCᇓCᇗCᇙCᇝCᇟCᇱCᇲCᴂCᴖCᴗCᴜCᴝCᴥCᵻCᶅCᶑC C C‐C–C—C₩C←C↑C→C↓C∂C∇C∑C−C│C■C○C⦅C⦆CⱱCⵡC、C。C〈C〉C《C》C「C」C『C』C【C】C〒C〔C〕C〖C〗CァCアCィCイCゥCウCェCエCォCオCカCキCクCケCコCサCシCスCセCソCタCチCッCツCテCトCナCニCヌCネCノCハCヒCフCヘCホCマCミCムCメCモCャCヤCュCユCョCヨCラCリCルCレCロCワCヰCヱCヲCンC・CーC㒞C㒹C㒻C㓟C㔕C㛮C㛼C㞁C㠯C㡢C㡼C㣇C㣣C㤜C㤺C㨮C㩬C㫤C㬈C㬙C㭉C㮝C㰘C㱎C㴳C㶖C㺬C㺸C㼛C㿼C䀈C䀘C䀹C䁆C䂖C䃣C䄯C䈂C䈧C䊠C䌁C䌴C䍙C䏕C䏙C䐋C䑫C䔫C䕝C䕡C䕫C䗗C䗹C䘵C䚾C䛇C䦕C䧦C䩮C䩶C䪲C䬳C䯎C䳎C䳭C䳸C䵖C一C丁C七C三C上C下C不C丙C並C丨C中C串C丶C丸C丹C丽C丿C乁C乙C九C亂C亅C了C二C五C亠C交C亮C人C什C仌C令C企C休C你C侀C來C例C侮C侻C便C倂C倫C偺C備C像C僚C僧C優C儿C兀C充C免C兔C兤C入C內C全C兩C八C六C具C冀C冂C再C冒C冕C冖C冗C写C冤C冫C冬C况C冷C凉C凌C凜C凞C几C凵C刀C刃C切C列C初C利C刺C刻C剆C前C割C剷C劉C力C劣C劳C労C勇C勉C勒C勞C勤C勵C勹C勺C包C匆C匕C北C匚C匸C医C匿C十C卄C卅C卉C卑C協C博C卜C卩C印C即C卵C卽C卿C厂C厶C參C又C及C双C叟C口C句C叫C可C叱C右C吆C合C名C吏C吝C吸C吹C呂C呈C周C咞C咢C咽C哶C唐C問C啓C啕C啣C善C喇C喙C喝C喫C喳C営C嗀C嗂C嗢C嘆C噑C器C噴C囗C四C囹C圖C圗C土C地C型C城C埴C堍C報C堲C塀C塚C塞C墨C墬C墳C壘C壟C士C壮C声C売C壷C夂C夆C夊C夕C多C夜C夢C大C天C奄C奈C契C奔C奢C女C姘C姬C娛C娧C婢C婦C媵C嬈C嬨C嬾C子C字C学C宀C宅C宗C寃C寘C寧C寮C寳C寸C寿C将C小C尢C尸C尿C屠C屢C層C履C屮C山C岍C峀C崙C嵃C嵐C嵫C嵮C嵼C嶲C嶺C巛C巡C巢C工C左C己C巽C巾C帨C帽C幩C干C年C幺C幼C广C度C庰C庳C庶C廉C廊C廒C廓C廙C廬C廴C廾C弄C弋C弓C弢C彐C当C彡C形C彩C彫C彳C律C後C得C徚C復C徭C心C忍C志C念C忹C怒C怜C恵C悁C悔C惇C惘C惡C愈C慄C慈C慌C慎C慠C慨C慺C憎C憐C憤C憯C憲C懞C懲C懶C戀C戈C成C戛C戮C戴C戶C手C打C扝C投C抱C拉C拏C拓C拔C拼C拾C指C挽C捐C捕C捨C捻C掃C掠C掩C揄C揅C揤C搜C搢C摒C摩C摷C摾C撚C撝C擄C支C攴C敏C敖C敬C數C文C斗C料C斤C新C方C旅C无C既C旣C日C易C映C晉C晴C暈C暑C暜C暴C曆C曰C更C書C最C月C有C朗C望C朡C木C李C杓C杖C杞C杻C枅C林C柳C柺C栗C栟C株C桒C梁C梅C梎C梨C椔C楂C榣C槪C樂C樓C檨C櫓C櫛C欄C欠C次C歔C止C正C歲C歷C歹C殟C殮C殳C殺C殻C毋C母C比C毛C氏C气C水C汎C汧C沈C沿C泌C泍C泥C注C洖C洛C洞C洴C派C流C浩C浪C海C浸C涅C淋C淚C淪C淹C渚C港C湮C満C溜C溺C滇C滋C滑C滛C漏C演C漢C漣C潮C濆C濫C濾C瀛C瀞C瀹C灊C火C灰C灷C災C炙C炭C烈C烙C無C煅C煉C煮C熜C燎C燐C爐C爛C爨C爪C爫C爵C父C爻C爿C片C牐C牙C牛C牢C特C犀C犕C犬C犯C狀C狼C猪C獵C獺C玄C率C玉C王C玥C玲C珞C理C琉C琢C瑇C瑜C瑩C瑱C璅C璉C璘C瓊C瓜C瓦C甆C甘C生C甤C用C田C甲C申C男C画C甾C留C略C異C疋C疒C痢C瘐C瘝C瘟C療C癩C癶C白C皮C皿C益C盛C監C盧C目C直C省C眞C真C着C睊C瞋C瞧C矛C矢C石C硎C硫C碌C碑C磊C磌C磻C礪C示C礼C社C祈C祉C祐C祖C祝C神C祥C祿C禁C禍C禎C福C禮C禸C禾C秊C秘C秫C稜C穀C穊C穏C穴C空C突C窱C立C竮C竹C笠C箏C節C篆C築C簾C籠C米C类C粒C精C糒C糖C糣C糧C糨C糸C紀C紐C索C累C終C絛C絣C綠C綾C緇C練C縂C縉C縷C繁C繅C缶C缾C网C署C罹C罺C羅C羊C羕C羚C羽C翺C老C者C而C耒C耳C聆C聠C聯C聰C聾C聿C肉C肋C肭C育C脃C脾C臘C臣C臨C自C臭C至C臼C舁C舄C舌C舘C舛C舟C艮C良C色C艸C艹C芋C芑C芝C花C芳C芽C若C苦C茝C茣C茶C荒C荓C荣C莭C莽C菉C菊C菌C菜C菧C華C菱C落C葉C著C蓮C蓱C蓳C蓼C蔖C蕤C藍C藺C蘆C蘒C蘭C蘿C虍C虐C虜C虧C虩C虫C蚈C蚩C蛢C蜎C蜨C蝫C蝹C螆C螺C蟡C蠁C蠟C血C行C衠C衣C裂C裏C裗C裞C裡C裸C裺C褐C襁C襤C襾C覆C見C視C角C解C言C誠C說C調C請C諒C論C諭C諸C諾C謁C謹C識C讀C變C谷C豆C豈C豕C豸C貝C財C販C貫C賁C賂C資C賈C賓C贈C贛C赤C走C起C足C趼C跋C路C跰C身C車C軔C輦C輪C輸C輻C轢C辛C辞C辰C辵C辶C連C逸C遊C適C遲C遼C邏C邑C邔C郎C郞C郱C都C鄑C鄛C酉C配C酪C醙C醴C釆C里C量C金C鈴C鈸C鉶C鉼C鋗C鋘C錄C鍊C鏹C鐕C長C門C開C閭C閷C阜C阮C陋C降C陵C陸C陼C隆C隣C隶C隷C隸C隹C雃C離C難C雨C零C雷C霣C露C靈C靑C靖C非C面C革C韋C韛C韠C韭C音C響C頁C項C頋C領C頩C頻C類C風C飛C食C飢C飯C飼C館C餩C首C香C馧C馬C駂C駱C駾C驪C骨C高C髟C鬒C鬥C鬯C鬲C鬼C魚C魯C鱀C鱗C鳥C鳽C鵧C鶴C鷺C鸞C鹵C鹿C麗C麟C麥C麻C黃C黍C黎C黑C黹C黽C黾C鼅C鼎C鼏C鼓C鼖C鼠C鼻C齃C齊C齒C龍C龎C龜C龟C龠CꙑCꚉCꜧCꝯCꞎCꬷCꭒCꭦCꭧD𝼄D𝼅D𝼆D𝼈D𝼊D𝼞D𠄢D𠔜D𠔥D𠕋D𠘺D𠠄D𠣞D𠨬D𠭣D𡓤D𡚨D𡛪D𡧈D𡬘D𡴋D𡷤D𡷦D𢆃D𢆟D𢌱D𢛔D𢡄D𢡊D𢬌D𢯱D𣀊D𣊸D𣍟D𣎓D𣎜D𣏃D𣏕D𣑭D𣚣D𣢧D𣪍D𣫺D𣲼D𣴞D𣻑D𣽞D𣾎D𤉣D𤋮D𤎫D𤘈D𤜵D𤠔D𤰶D𤲒D𤾡D𤾸D𥁄D𥃲D𥃳D𥄙D𥄳D𥉉D𥐝D𥘦D𥚚D𥛅D𥥼D𥪧D𥮫D𥲀D𥳐D𥾆D𦇚D𦈨D𦉇D𦋙D𦌾D𦓚D𦔣D𦖨D𦞧D𦞵D𦬼D𦰶D𦳕D𦵫D𦼬D𦾱D𧃒D𧏊D𧙧D𧢮D𧥦D𧲨D𧻓D𧼯D𨗒D𨗭D𨜮D𨯺D𨵷D𩅅D𩇟D𩈚D𩐊D𩒖D𩖶D𩬰D𪃎D𪄅D𪈎D𪊑D𪎒D𪘀B!!B!?B..B0,B0.B1,B1.B10B11B12B13B14B15B16B17B18B19B2,B2.B20B21B22B23B24B25B26B27B28B29B3,B3.B30B31B32B33B34B35B36B37B38B39B4,B4.B40B41B42B43B44B45B46B47B48B49B5,B5.B50B6,B6.B7,B7.B8,B8.B9,B9.B==B?!B??BAUBBqBCDBDJBDZBDzBGBBGyBHPBHVBHgBHzBIIBIJBIUBIVBIXBKBBKKBKMBLJBLjBMBBMCBMDBMRBMVBMWBNJBNjBNoBPHBPRBPaBRsBSDBSMBSSBSvBTMBVIBWCBWZBWbBXIBccBcdBcmBdBBdaBdlBdmBdzBeVBffBfiBflBfmBhaBiiBijBinBivBixBkABkVBkWBkgBklBkmBktBljBlmBlnBlxBm2Bm3BmABmVBmWBmbBmgBmlBmmBmsBnABnFBnVBnWBnjBnmBnsBoVBpABpFBpVBpWBpcBpsBsrBstBviBxiC(1)C(2)C(3)C(4)C(5)C(6)C(7)C(8)C(9)C(A)C(B)C(C)C(D)C(E)C(F)C(G)C(H)C(I)C(J)C(K)C(L)C(M)C(N)C(O)C(P)C(Q)C(R)C(S)C(T)C(U)C(V)C(W)C(X)C(Y)C(Z)C(a)C(b)C(c)C(d)C(e)C(f)C(g)C(h)C(i)C(j)C(k)C(l)C(m)C(n)C(o)C(p)C(q)C(r)C(s)C(t)C(u)C(v)C(w)C(x)C(y)C(z)C...C10.C11.C12.C13.C14.C15.C16.C17.C18.C19.C20.C::=C===CCo.CFAXCGHzCGPaCIIICLTDCL·CMHzCMPaCMΩCPPMCPPVCPTECTELCTHzCVIICXIICa/cCa/sCaʾCbarCc/oCc/uCcalCcm2Ccm3Cdm2Cdm3CergCffiCfflCgalChPaCiiiCkHzCkPaCkm2Ckm3CkΩClogCl·CmilCmm2Cmm3CmolCradCviiCxiiC°CC°FCʼnCμACμFCμVCμWCμgCμlCμmCμsD(10)D(11)D(12)D(13)D(14)D(15)D(16)D(17)D(18)D(19)D(20)D0点D1⁄D1日D1月D1点D2日D2月D2点D3日D3月D3点D4日D4月D4点D5日D5月D5点D6日D6月D6点D7日D7月D7点D8日D8月D8点D9日D9月D9点DVIIIDa.m.DkcalDp.m.DviiiDեւDմեDմիDմխDմնDվնDאלDاٴDبجDبحDبخDبرDبزDبمDبنDبهDبىDبيDتجDتحDتخDترDتزDتمDتنDتهDتىDتيDثجDثرDثزDثمDثنDثهDثىDثيDجحDجمDجىDجيDحجDحمDحىDحيDخجDخحDخمDخىDخيDسجDسحDسخDسرDسمDسهDسىDسيDشجDشحDشخDشرDشمDشهDشىDشيDصحDصخDصرDصمDصىDصيDضجDضحDضخDضرDضمDضىDضيDطحDطمDطىDطيDظمDعجDعمDعىDعيDغجDغمDغىDغيDفجDفحDفخDفمDفىDفيDقحDقمDقىDقيDكاDكجDكحDكخDكلDكمDكىDكيDلاDلجDلحDلخDلمDلهDلىDليDماDمجDمحDمخDممDمىDميDنجDنحDنخDنرDنزDنمDننDنهDنىDنيDهجDهمDهىDهيDوٴDيجDيحDيخDيرDيزDيمDينDيهDيىDييDيٴDۇٴE(ᄀ)E(ᄂ)E(ᄃ)E(ᄅ)E(ᄆ)E(ᄇ)E(ᄉ)E(ᄋ)E(ᄌ)E(ᄎ)E(ᄏ)E(ᄐ)E(ᄑ)E(ᄒ)E(一)E(七)E(三)E(九)E(二)E(五)E(代)E(企)E(休)E(八)E(六)E(労)E(十)E(協)E(名)E(呼)E(四)E(土)E(学)E(日)E(月)E(有)E(木)E(株)E(水)E(火)E(特)E(監)E(社)E(祝)E(祭)E(自)E(至)E(財)E(資)E(金)E0⁄3E10日E10月E10点E11日E11月E11点E12日E12月E12点E13日E13点E14日E14点E15日E15点E16日E16点E17日E17点E18日E18点E19日E19点E1⁄2E1⁄3E1⁄4E1⁄5E1⁄6E1⁄7E1⁄8E1⁄9E20日E20点E21日E21点E22日E22点E23日E23点E24日E24点E25日E26日E27日E28日E29日E2⁄3E2⁄5E30日E31日E3⁄4E3⁄5E3⁄8E4⁄5E5⁄6E5⁄8E7⁄8EA∕mEV∕mEm∕sF1⁄10FC∕kgFm∕s2FبحيFبخيFتجمFتجىFتجيFتحجFتحمFتخمFتخىFتخيFتمجFتمحFتمخFتمىFتميFجحىFجحيFجمحFجمىFجميFحجيFحمىFحميFسجحFسجىFسحجFسخىFسخيFسمجFسمحFسممFشجيFشحمFشحيFشمخFشممFصححFصحيFصلىFصلےFصممFضحىFضحيFضخمFطمحFطممFطميFعجمFعممFعمىFعميFغممFغمىFغميFفخمFفميFقلےFقمحFقممFقميFكممFكميFلججFلجمFلجيFلحمFلحىFلحيFلخمFلمحFلميFمجحFمجخFمجمFمجيFمحجFمحمFمحيFمخجFمخمFمخيFمميFنجحFنجمFنجىFنجيFنحمFنحىFنحيFنمىFنميFهمجFهممFيجيFيحيFيممFيميFئاFئجFئحFئخFئرFئزFئمFئنFئهFئوFئىFئيFئۆFئۇFئۈFئېFئەFําFຫນFຫມFໍາFཀྵFགྷFཌྷFདྷFབྷFཛྷFྐྵFྒྷFྜྷFྡྷFྦྷFྫྷF′′F‵‵F∫∫F∮∮FほかFよりFキロFココFコトFトンFナノFホンFミリFリラFレムF令和F大正F平成F明治F昭和Grad∕sG〔S〕H(가)H(나)H(다)H(라)H(마)H(바)H(사)H(아)H(자)H(주)H(차)H(카)H(타)H(파)H(하)Hrad∕s2HاكبرHاللهHرسولHریالHصلعمHعليهHمحمدHوسلمI′′′I‵‵‵I∫∫∫I∮∮∮I〔三〕I〔二〕I〔勝〕I〔安〕I〔打〕I〔敗〕I〔本〕I〔点〕I〔盗〕IアールIインチIウォンIオンスIオームIカイリIケースIコルナIセンチIセントIデシIドルIノットIハイツIビルIピコIフランIペソIヘルツIホールIホーンIマイルIマッハIマルクIヤールIユアンIワットL′′′′L∫∫∫∫LアルファLエーカーLガロンLガンマLカラットLカロリーLギニーLキュリーLグラムLクローネLサイクルLダースLパーツLピクルLフィートLベータLペニヒLペンスLボルトLマイクロLミクロンLメートルLリットルLルピーL株式会社N(오후)Oجل جلالهOアパートOアンペアOキロワットOサンチームOバーレルOヘクタールOポイントOマンションOメガトンOルーブルQ(오전)RギルダーRキログラムRキロメートルRグラムトンRクルゼイロRパーセントRピアストルRブッシェルRミリバールRレントゲンaصلى الله عليه وسلمোৌୋୈୌஔொௌோೀೇೈൊൌോෞဦᬆᬈᬊᬌᬎᬒᬻᬽᭀᭁᭃ𑄮𑄯𑍋𑍌𑒼𑒻𑒾𑖺𑖻𑤸 ೋ ෝDDŽDDžDdžFلآFلأFلإF가F나F다F라F마F바F사F아F우F자F차F카F타F파F하IメガL주의LギガLコーポLヤードO참고OイニングOシリングOページOポンドRエスクードRファラッドೊො≮≠≯ÀÁÃĀẢǍȀȂḀĄḂḄḆĆĈĊČḊĎḌḐḒḎÈÉẼĔĖËẺĚȄȆĘḘḚḞǴĜḠĞĠǦĢĤḢḦȞḤḨḪÌÍÎĨĪĬİỈǏȈȊỊĮḬĴḰǨḲĶḴĹĽĻḼḺḾṀṂǸŃÑṄŇṆŅṊṈÒÓŎỎŐǑȌȎṔṖŔṘŘȐȒŖṞŜṠȘŞṪŤṬȚŢṰṮÙÚÛŬỦŮŰǓȔȖỤṲŲṶṴṼṾẀẂŴẆẄẈẊẌỲÝŶỸȲẎŸỶỴŹẐŻŽẒẔàáãāảǎȁȃḁąḃḅḇćĉċčḋďḍḑḓḏèéẽĕėëẻěȅȇęḙḛḟǵĝḡğġǧģĥḣḧȟḥḩḫẖìíîĩīĭỉǐȉȋịįḭĵǰḱǩḳķḵĺľļḽḻḿṁṃǹńñṅňṇņṋṉòóŏỏőǒȍȏṕṗŕṙřȑȓŗṟŝṡșşṫẗťṭțţṱṯùúûŭủůűǔȕȗụṳųṷṵṽṿẁẃŵẇẅẘẉẋẍỳýŷỹȳẏÿỷẙỵźẑżžẓẕ῭΅῁ǼǢǾǽǣǿẛǮǯᾺΆᾹᾸᾼῈΈῊΉῌῚΊῙῘΪῸΌῬῪΎῩῨΫῺΏῼᾱᾰᾳὲέῃὶίῑῐῖὸόῤῥὺύῡῠῦῳϓϔЇӐӒЃЀӖЁӁӜӞЍӢЙӤЌӦӮЎӰӲӴӸӬӑӓѓѐӗёӂӝӟѝӣйӥќӧӯўӱӳӵӹӭїѶѷӚӛӪӫآأإؤئۂۓۀẦẤẪẨẰẮẴẲǠǞǺẬẶḈỀẾỄỂḔḖỆḜḮḸỒỐỖỔṌȬṎṐṒȰȪỜỚỠỞỢỘǬṜṤṦṨṸṺǛǗǕǙỪỨỮỬỰầấẫẩằắẵẳǡǟǻậặḉềếễểḕḗệḝḯḹồốỗổṍȭṏṑṓȱȫờớỡởợộǭṝṥṧṩṹṻǜǘǖǚừứữửự῍῎῏῝῞῟↚↛↮⇍⇏⇎∄∉∌∤∦≁≄≇≉≭≢≰≱≴≵≸≹⊀⊁⋠⋡⊄⊅⊈⊉⋢⋣⊬⊭⊮⊯⋪⋫⋬⋭ᾈᾉἚἜἛἝᾘᾙἺἼἾἻἽἿὊὌὋὍὛὝὟᾨᾩᾲᾴᾀᾁᾷἒἔἓἕῂῄᾐᾑῇῒΐῗἲἴἶἳἵἷὂὄὃὅῢΰῧὒὔὖὓὕὗῲῴᾠᾡῷऩ ऱ ऴ ైේゔがぎぐげござじずぜぞだぢづでどばぱびぴぶぷべぺぼぽゞヴガギグゲゴザジズゼゾダヂヅデドバパビピブプベペボポヷヸヹヺヾᾊᾌᾎᾋᾍᾏᾚᾜᾞᾛᾝᾟᾪᾬᾮᾫᾭᾯᾂᾄᾆᾃᾅᾇᾒᾔᾖᾓᾕᾗᾢᾤᾦᾣᾥᾧ𑂚 𑂜 𑂫 B´C ́C ̃C ̄C ̅C ̆C ̇C ̈C ̊C ̋C ̓C ̔C ̧C ̨C ̳C ͂C ͅC ً]C ٌaC ٍeC َiC ُmC ِqC ّuC ْyCÅCṡD ゙D ゚D΅DΆDΈDΉDΊDΌDΎDΫDΏDάDέDήDίDόDύDώDאַ5Dאָ9DאּEDבּEDבֿMDגּEDדּEDהּEDוֹ=DוּEDזּEDטּEDיִ)DיּEDךּEDכּEDכֿMDלּEDמּEDנּEDסּEDףּEDפּEDפֿMDצּEDקּEDרּEDשּEDשׁQDשׂUDתּEDײַ5Dاً]DآDأDإDذٰ}Dرٰ}Dـً]DـَiDـُmDـِqDـّuDـْyDهٰ}DؤDىٰ}DئDۓDۀE ̈̀E ̈́E ̈͂E ̓̀E ̓́E ̓͂E ̔̀E ̔́E ̔͂E ٌّvE ٍّvE َّvE ُّvE ِّvE ّٰ~E⫝̸FΐFΰFשּׁRFשּׂVFـَّvFـُّvFـِّvFक़ Fख़ Fग़ Fज़ Fड़ Fढ़ Fफ़ Fय़ Fড় Fঢ় Fয় Fਖ਼ Fਗ਼ Fਜ਼ Fਫ਼ Fਲ਼ Fਸ਼ Fଡ଼ Fଢ଼ FྲྀFླྀFデH𝅗𝅥H𝅘𝅥H𝆹𝅥H𝆺𝅥IྲཱྀIླཱྀL𝅘𝅥𝅮L𝅘𝅥𝅯L𝅘𝅥𝅰L𝅘𝅥𝅱L𝅘𝅥𝅲L𝆹𝅥𝅮L𝆹𝅥𝅯L𝆺𝅥𝅮L𝆺𝅥𝅯Â̓Ă̓Ȧ̓Ä̓Å̓ẠÇÊ̓Ē̓ẸȨÏ̓ḶÔ̓Õ̓Ō̓Ȯ̓Ö̓ƠỌǪṚŚ̓Š̓ṢŨ̓Ū̓Ü̓Ưâ̓ă̓ȧ̓ä̓å̓ạçê̓ē̓ẹȩï̓ḷô̓õ̓ō̓ȯ̓ö̓ơọǫṛś̓š̓ṣũ̓ū̓ü̓ưἈ̈́Ἁ̈́Ἐ̈́Ἑ̈́Ἠ̈́Ἡ̈́Ἰ̈́Ἱ̈́Ὀ̈́Ὁ̈́Ὑ̈́Ὠ̈́Ὡ̈́ὰ̈́ά̈́ἀ̈́ἁ̈́ᾶ̈́ἐ̈́ἑ̈́ὴ̈́ή̈́ἠ̈́ἡ̈́ῆ̈́ϊ̈́ἰ̈́ἱ̈́ὀ̈́ὁ̈́ϋ̈́ὐ̈́ὑ̈́ὼ̈́ώ̈́ὠ̈́ὡ̈́ῶ͆ἊΆἌΆἎΆἋΆἍΆἏΆἪΆἬΆἮΆἫΆἭΆἯΆὪΆὬΆὮΆὫΆὭΆὯΆἂΆἄΆἆΆἃΆἅΆἇΆἢΆἤΆἦΆἣΆἥΆἧΆὢΆὤΆὦΆὣΆὥΆὧB̀3B́3B̓3CᅡCᅢCᅣCᅤCᅥCᅦCᅧCᅨCᅩCᅪCᅫCᅬCᅭCᅮCᅯCᅰCᅱCᅲCᅳCᅴCᅵCᆪCᆬCᆭCᆰCᆱCᆲCᆳCᆴCᆵD̈́3C゙C゚Fཱི'Fཱུ'Fཱྀ' @6lثM/\cX֜  /BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqc|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-TR j068@|9/4CDT{2#=L BN.f($v[Im%rdhԤ\]elpHP^FWث XE,?k:AOgst"57unGq)ʼnobV>Ky xZݨ31Y'_`QJ -zɜ;M*w u j R viP& 9( ; 85.B Y ? 5!K   x1 !({ '4 b W 9  &  GY eLf l s 7  T ! 0 w *m'? 31 " Dwf vR>w uj"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IX.1ẋ)j̍F ts#PF 謬 kAbsWL-Gqb.6lkcZL9La\Į}Sd vЪ#OJ0+hshz~@5-vsJfw>7G9@>l4OtU[ s6!TYKKw bӓS+)cL$_JmɤO;N5F<+# >>QM[?0G({]BgAw;g$nꏧL'U4oŵ*Fk,* #ecwI-S}2!`{<vwV N&nuAYD,k0[3_zwE]{V/n+_Yf,9I %H,}sB$Gav݀x@+ ?8:we-}_J;TqxEb &}n䝵sdp>N+ava垓%=d %#hhwiҧ3Z4ޫ^87 $VwNC[ 7Vfmފ"(ʊ#S| .Kc% oig5U?ԼYSws+u5.tth["d|iJfϰ[BHn`&T.2skX]-'7"V)e*>.'[`ؼrK~V#p$t3 C]ăcOR@%BT5fחGwަdyp B e k.?uXI,|/#_>@MJy).AGoZgZH^rf< O\*K{&&M9olen%:6hA,uw"×((\TkiL6-wJ$X^f{Ym% 1z3)+Y]ٙN[]xAԢf^?a^5L.V}Get0;?ZlP*mbgԝa<)>uzGՆv0o/5*#=҅ jX3w_A5#Mj- d5:t\]>yhP-Svn.7i@X_B'|,G`J)'q/qHofw{hЃ(8m5@Pu mF+a1./#{KPQV㡈IIu˓1iv{s^]Y7جgkힴo23.*CeBg(bɍKP9Cc̖1YhVÍ{2a8uz&UK$τŊb9ZD_{Z.0*,sBjOIj.Kp^ Xo;Lxї-1KhC-,>RK0(#sS.۪jk=>9=h*K -HhJxRX@_̴2fj]^X :'pJH=`HYf♈ \sfۘG$Ga|w9i;**7C2$eOINz:  HdD~@.{‘1bm۹s 8ƒ }8V/eB=~,=|]Bp#.m9rK,cG |b}Gp@,Bhy̫cstfMPæ W8TS@pm;ʙ̕,i}[0CAw1NI2e -ZRA<~JW}j) Xl/Zh9]Iʼn'oPLP Mէ㬼MjAjoo[UˆBwD{G<7L>5=@:TM 3Es?;*1?@s4Y!,-/2ba3 r+^ -2Ը]uF#Κ?-.je=iU-8 lɱO? hR=a ll8Q'Cb*]r\)mR/uҺ !"2y@ *'^foQ3Tod lq ^B#y˲-J^:DpOς֡rdl cx>nxc 1qwutA] Fv@κI'Ii2/d""ԃ\n<[;ig>␚6\83Ő)Ea.bmxz: 30-Z1eB' U,ۭc$Oow:*gfQOx@xtlA{*NNͷ Z.H@߄K383 7&˓V\V.AtxLahLT^3eKTu qeȧ/Ĉȱ~o$YO0'XM\!@cai..H[׋kF^(A{i:tɹ)sb.97M!k5GI:U+ Z7 zKf&>jiT()'.4 ń81aؙǥ>Zxf8i'O:4Gh68tbeY*؅ zBU=rL >rO3\ZԳLݽ;g}AkM8Tj[e!vG#QԀ<8q) atXJ ]LLm$`jމ(@.fWG7tb(tk"@QN v3zB"QƗ)W{q1ʊ)U!uTH-\77EXH O t_-Wq@#U׺Ov{aY`Jo&It-KYZpYZW-rrZy%|qiwE Pnz!P9A;Ӛ+qO$ٰN%p&y$+= Uͳ d䯙Ev/0_<=d7b5o-Q1Z{ f k5KrgϪ`[y|rځA* JO\hP>- dF&$:!b[W3 ͢z;'0N犵km.*[l=Q`(ĖAKN .1phoɰVx*n!3~]Ms֠/CZ;Q)10*a!3!.udnRw$>Mm/JhAHQU!}aql*̓cdP.?sf1cK%8议:)7F`eb^SϐY^͗8/菷g0^])S92W: $|k(M&cGN,BpCL9"Ηվˮah#lSzS(B/̴Q31H¶KOɲb| r*TO5x0i& 뉩"6;by#;T&dn%X q7#. Z3ƪ^蠆*=y_2wbsG/d~u`I[0z/jC<qKWr7W*Ff0c\I\۴}ke~K+czVpWfLuzeDiaaH"']T)jYƜ*2]Czδb\I =6=TW,#H1uX fJP=a.ϟK'd_AP+Vj4.:5@ N[FIɄehBӕbu\NV Fs򮤔x7ƔuީٌvZQ*2nxVɑ?TmCg1H7M2XK!rzEa"_'dkܨ>mQsq[{7KCDžyEax̀=MUM qv@B+Q™z=ͻ[̤(M-M-VVD"yahX(\hblAјt@){YĔVRO,$.|P0Tl1pF̫k `7ӬOQ Q1*btS*svIO֬Qᦁe"s31ڄeiQml*Оv`[?&"hӆ5L*dܱ7󄡈ԟ߲%#l6;)R<,F-!U 7쪉u?1Z޷1t߱ Qզ+ a`hYEr+(j¤Jacv\GWt=*,~ b "4⠵eۜpMR?Vu0/7S+jlB &܀9/:7;sSj8]4.aᾨY/h-Q!M0.|^1j*r㠫 V'uk:3Pk%i=53 uo4^t$IP޴5O3d(wd1!M(ؠ@G҅j_xN'%f!Vl9 ϻ^ܢT\NL rѨwpgpjm>P# NN`EEkwZ ٺ4u>F1)dО' QZAI2k +Aa6Ba `6l13"")D=i~]OOhX!< `! s@0 oZw wgaȎ-O?>50$]^vKn>" Ss.\8vj@=0e.)a>3ߒ*bz ۮl.tZ5gF@[owZ<,{5`q@roz?q7YJ DP҇@SRD2Lb!|"ΦUA7(BZ ^LXjt5pܹN~&T:YK5!n^nj1AµM^4o cbaNoF#\=Tm(R۞VoY]nl&`ӳ/x"m׈JA)G2p6e?P-$^{ҟMB4l&62J9h0{l̀\ж왂I59^HkG׆a>`RH594v4%3&r% 6`;5@)7DžNLu[@oN?5Sq.R ?ALݫ3?Cwu:ۤ}(Cѥr<}mmlxoT+3Ce ~& 3ưm^%1\%W xS!k:H| Gݴ^HA=q nV=sV'^Dk椡4GUܛ 9\ъ*D=d}j ܋-ߩe o[afHRYi3sJ}fʗG-eN7z0o>Lr#JRoI(멒J{/x6\|* V 5iD%}@`HSIO位ZR~k2^D4R6 @; c[ JbX\>NV$Fwaٸ\µ(/p&\- ?^Vb=s:|Y3EO!<0m@|M0mb:g\~j݂NHg8Wj]c$Cnp\Av?ӎz STbt䭾fUyZP+DP 1b Oz @HX^ِ~X^RB.|dڇw}pZ4-R.× }->ʻ%Fvt$NeP$+ҁg$YÿUB83#[>oGPÖ7ak i4] @Tqr+>j(UZv9l <:ۢP;/(C,X$`BrT2e_:0rsAc紨{R)H<~e gTF&K}S BHN.%œ&>jDZg؎dq-S~EAџ~- I(k%ws2"I!KɔS{M$sJߋj VFU\9;-XFڊ/NGzjv6y T%usDWٝEPY(Հ!x^~qf_!K*J3v+w举-e4O\#8zo:5}ӌeު_S:cqj7_Ҋ u˟?0D/ e->τP N~[;7Tq]E\2װ̖G$aU]wAE18 rąPK5S-ȦJ7,4TtLf-]hB1gh`6Զh,mB) Ohwub~_K Yci;e*i/XpJ 9'6y*DF(dIabfG47 aα\D9ֿa<[̮g!AԤN"SZ #VI:K{wtP`q [b3aɸC G]Tut2jOJwRy R)mA |*b07y2tG}N k-z_s [ƪA[{2%9CUCrl['S2ţ] ~ZQ6\Û_Bdzշm]؛}HEH@>&=)ͣţ"0E?,?fxc)z?2̈́utz-=a4Kwtx,RB><<_=>"_ 9INcrk2Y9C|lGe0D0kulmTֽZ.˜~}uu`'C;<ѯ̱W)wQּaRZ1n΅ rz%5 &`jaֹM#T~Nz:<[vyJ$*Ţ^P:ܯp⫏L +" wm]slVݔ6&I.p]HXj'gpXMqSc,ɱxpkNa9E&,=KIR͡*2mrc+ޢ6w>M|r8x6y<{ԖT+c0ľzI gcGak㉆vQhGΏe?./= 82ٮ!ڧ\j]ĞʺlqBSza/^Úh$GҼ\|?Bz@LRXGdJN,×pBsI͘fQ.{a?Ӻ!7}/ne!e珥fɸGZ: %sK\XD~ eF =&H}؈9( n\GE wfykl'څ:Ӑ=Xbh.b|C {jCNN%m=5ΔC8~`ae@" ug·B,ְZ`Fn*;j{K2B]՛M|EjN~[lf1g|{ 9ՖWBsrQu؋D]d}߮Kk*/V/9 i=d蹰NwAOc$(Zho:^_'쯛W?"%BS4JmUa%e93!8{RTf 2 }f!v3P(5 wuݱiQ|Ϝ1< @_Q1H툇<+g͕'8 礉[D?2a"l[;c%{N1T_ OIu lx"pe5zG8H|8nǛksF^;B&!fJEk6^ O8cv1(UPHx' )٪͋50?G h:CO/h *TMՓeƊEaЌ3mXt)]çVXe."3diYgPybd4)m1ӮeN^T$(G qnP4uWE@V}&<2y}b1R [^5\a0a*p VkjԿ akj[uK4w~VLW1iΎex&{@>tt (aؕj꺫f4+}*] TIHC13 _1ӳJ抨J5EP/&O(9%Rf(Zz2Gɴؗa4GjC6=0K>c Iҍ՘Dl.wweOtVӥ;S%t78)n9dK&&qYc9kEq$^rRŸ*Ƒ9AVxF~1ٔJ/o/O|U# |tݻ'|U*R?-)P|ƲF,͑m6꾢@A$YzG$uFnDHxr0%c(P \ c9 8ymH>ͼER\*>x8xoUTS?3  d 5H7DO{ЩEz <)qgt)WZq@ErjBqyԪoki9FU)8̊$":fd2n(ZYV C@:zy *Y$veJJ^K?FReӞT0mzW]ܷM}8vhJ-v Gx][M6ynV 8%@7-`f &a Oe;OQch,u4kFJPQvu*V֛&ہP%y4SQ8_d`\H㯖oVDwj1ihBMm ੡廍Bg&1_&XH:6acfe-BmkcOiILV]Gw0I:/{ذ4 F\.Aw&r7<'Ơh|"n{`AU? @}(>ؓK ̸mP<ȩL8Ϯz\EK C&ؙTA)ҵ7T'ВR3˧j7 %Z"T-47 8f-c pZaq Q=\-H3ZSا}XqhRo;չSP-L3 $[fo@es%K],O05"F #>}qss3Y!fWd ߮]%' >4[=\u_~oTiI4H>XwA0˯!g/ouE!$k*"J'dX*e׏9;@L'qGFڋnG~@#j<W~90_dxJ_[}wPp&I׿!4: 4_RE4 0eӡ}ys_5q`gu޴$N%a^ލ?T %HHޕ"enq7B_󭢗Oy< D|[%1u+@A!!#U-h5[Ϟ^qo'HN ~< h>Sem.XqgA+ g%L u}W6*^PR$"=|..X/+L)g4[ְT F]xȗaɤafBB yndop%ŸVQq2KCRj" m2' N<&gNη<ȯQZ?}U_znX 7 r|õD8gݷxq#n9EMj2Khp^Kf}Ji͋p*\[i\3(pxǫt#K-SG]Zȟ eʦǐs6FgdPI7cH:ث)@ ( J3/WyPV?⾜%X_'45bHo'++S*Qq $v E:6kL|S@:`2q =ո8*hy]tڪUˌ~y^q aa㿁GyQwb֕XmTK(+k\\MVTRa`) L랪0yS钏߃t )̲D*ZE, VhKzV@YsaJ!(k=4ܚa8)9n^:ܲ!Mtr.;n\-4uԲбs` c(^aJ_R=I)OϚN+Í >lp]>e Kqy EYgnhZJfYF%s8O.;xt:z$ ^An1Z uJ~,0o|\KlҽS [+=9hUpsZl &v7YQShA0(pKޑ\b1lfzwը]b$95yzA=I,'#BĸG=JG*pB 볶D)s^PaG>&|_3r[ֶu&eJm.fd!ac@0Pp3(oh|K'f:/%;twT`J+lPRF4*>9UYau"!KEPxJuEԟ; 0>>t#Q+MH2i q̀bIcVwD{C'z,;P|#H%3/3gsi%YR4A& X)6} Gb %"55A10K"*[=clhŧRSr,8d+XCn }3Gt2mX47q|Q@_ee/?PDnRv~gcɝAi3LQ, ڵ^O{<C(Ŧ<~ fwg#ד@{xMsw{[pF$= C'8:D3DZZbC궣va2F: /jq[?tJx+jg^MLA"k'ܛ{[bߴwY[K,BоuqN"sJ7} u dz̃TNϺ9 vA=LM>i_3''1GF"4$[|keODjnZFzFZrhlgGF:3&͜ǁ+)"SӦiv-F$C߮ mlt`2#>K/- KE2>~+_f)|a#O&g~O\W2Q=JxW*Fc7PX0;Oܾ p ~VOq $6afD|\2/|f;N!v=@;1&IW#٩rF!(йf+9"daDP{2}JLNpq[/44Dzc힐(Ť,ш~3خ-6%l*C\B P`ZB]jhr-塙)Oͭ͂?/c_Yhov1,W0\ (HO]/uX,91fXnʐZLdh Iґg?jLvocJ x(0I$_yLW|a=_Rr~H-_ ;&L c@QFXj^d{MZt?u"Tg9yK,mB?rUU%DmnaݨhG8T^r /0֝CckȃQn敔1ygL-y‰$ ey$2REJ$ً,+1Q5N/?<3AC|[sqbQ<`-up\,i{yar]rrSʮV[ S5|+c4 F_[TrUb{\!3y A:(ZG* 4Tv97樲,]֎ ?VO3eJ~/Jゝ?тo4D:Ϝ1TyErI کݸtTC{1?\TZ˔Ǣ pg> lc!['v4Y^V$ I_pΘ$J0 w~k?~ratڶ ;Goޡ^Ķ9[Խ@DM~4nxTYr!c~t4rt6OW-L [|טQ M:fA,'qKynt>WK6n@PKF?u{ؘ m\-G;Q#ê~Rg9e` Ɨr.a# J/ wcrhDL\brkw&ydՑxh*s!#rhg+f;XѦ:m'Q∑ʰㆎd㪳8E$4C dX4$ufr 믫g'o-U&ɖc+,8X==hX^:@W<9?Dm{$>dž9y^cǕTO ck_~indкws,_t(zXyaeGe d 830tĮ`ŕmޡV3pf:LQy a S#ԓ ̺ %ٱ x~a1ΩnDK <DÖmw@M+[._ޖ^OIKY O lEoC`ϴ>ͮE v2NP, GrPf,$/2x1'Ô3=)1qՁ'B .6@6-zeZtĿ;i|J-x&2 6LBOP _Ԯ)7\ \C}aZ%?u4BjBzA=~Y kr'XLC jWϝe|ip"+nmNƚz'|5{i7U7i)DWt Ym3+EM}w-]gel{7:7%:C:5w|Ϯ9݅0^i3iYEY|Cfj~.db("0l6gFEʞ P=k>|U2![g0#vv:am:&1LBkz(lK׵(Hͥ8R`}DBxu\)H)m;- xQM 9Q4hIנN@v#Yۀ%̖:C?F; v!zRX zS0!@? ' Kna[~ ksf:)(j)a]1UV$4̪.Ɛd+ԃMjyyQueφk6XkgFѮSPp[eϲI-o@G7+ݒ Kt }܂݄`nErǠ)1.m/] ϣ44pQJBq+`ׂORknȞ%[8 {0jfe\#Xc~FӾ-FΦ bB{G7BW4፻\jTh2htaD ,_44]8zJV*UvDehRB^v T+\5ˏ/Oa#~[ IAB<,utgƸGz=Ӛ/7|*M µ-g*f e(Wv+1G ׭pK7KVst=0>ni.47JHK= 4qta-M40!C:N>xaWOr?Ñ? ¨g".w1i3>m&+1+sk΀_'O_֡oHkE]{)d[zPU*,`#\RD [}-TڮCQKeS8&6?@Pfk¢|4DѴEqiLa-=Z sMkOQ.E:PA $~M"EzjOң|幽cEF_Ϙm*s^ BBv{@dsT~H~J0zkҠ/O4bl\ ,W:Afai^/ \a`M =R7{oHr%9vS2ΰ1e6rV°BNAWAre>ţ7Luy<8Yg HdNa]by MÈBG}TxAI-w!,M$,KF|ev'u :H" .ռdPf^[uH,0@0 O{b. XzIҟ'̖Z;H4Y<~bb^Ѽbr[iR"k~D ",IzdK/.hA%ʐa4b'; [ -rnPw51}Q5_'x&m퀔T}$w| `9^pH\3īnSKc y_iZ('FO.޴鏢X LM | 毬miةP %Ċ oVHa[_U^Cktl',4$^Ք |p5 L,yU85i3\`pl~G/Dh= TTʫ>15p(ŕ:]^<ʛSe`jQ\\' ֞ fV?T6;*++TPrm!}P߻Il=*cB `|^oyF8J)xt=0ͧ#<ރ?,I+Ezjn4!20'P4GAy r5, ¦7A `Cmn[v~3J*FvG0A0ɳ3c{NMק=CU6)}{G(E W;#wtmt!̫czp=3eɿƸ[3<@K,'e? 7ܶJt]Ju%^*i |b%}2ol'v/#U&p-WxQ ˋrsQ,^Pش+F՚pW h*AxAfpE$m$LTh{[}b;R.P  [ uJ5**_b*1)?8*ߗǰf_?ТoLB|+&"rt nS.+S.ơ4,̛F,B8\O(UC XB @.K_޿4бǕ.=C8G6fBwa*߆OzB{`b_#$kzc uP_g<圑E3ݪ/PC*h*܋Yv(A*eMQ 3q9`b3{%ȑl?]x@8gJ> ZzUA2"Gp I(iz1m4+Pxq{HthX@eN}!(0;Q5[i6fJ; ]M=#5Ku3cNsDVxbWsIC$!]n{];[+*eU_7Z4z wp>TO7186MJ8]Td:8L.ѩ[PZ$N bS9ԛ)rpKTܛgT Hk01` <&XZ|G;i^1c:(mJGLxjbǏҀMf,r fzӄh7(XO)0vЏeͬU>U+pJ ʸ'4Rwa4kIķ{7DH=chc B^suJ'dzO4D"(+heH%56 J& f"(dY-tx}Y5*̕M gA|c/ye7ey_ G5@pnS _սp3\,zCptNLj (_nҋ"թ&/QچQvsvSZ[[ MR($^'Gm}Cބ;sv7Sd"u`4Z v!j;TЁ7ԅkث5FϙuQa]QYֆU1=f s\ yKA!d~'R X5GZ]DSi ̿@wt'{` ==R`)`U_>x _Ǟ+(`+0G'sYeIќ}!(9foIy=%V>?74K)p5(e. .:1 [諞m:}-Һ?j_;؇R "ntAO U%6s'f4 Y9?`V+L9^t^%o = \1lbF+mDQ]qSϋ@\s!8/hi‹.-',Ms=i xl *%~Wg`g?f:sܻ#暵5< 040ozPۙw'^ cysۈr6HW5oA]6ڻVrsB5Sv)ªT%\wU\(M舦TϺm z ȏ,u ;8E\ބ|̕uRP_Y]c6$q$֨Se2emZE˸B-S8#w|wc7Y|J`upekۥb?8sx ȼk4p W%F!`jLTr`6܌ي,} fGd#f\ l@$5_c٩-2e0Cυr 9X"$;YއP{YFe%pèM=yb7M\nh'~v^WLGRs#m:7]uIGeQ l$ӱhP`tb,ݱڧ9a݃vrf/vKu׉@]C[Sn%3bOw!yRE!rʗFJǛeGSu/5oyk5Q@y]e:ãi&JQ.UTl I[YJY>cI8T-sTx ..) j <Ų'u2sJw2~-Kd dKi=GsF`kCʡ:yN"UV K">@^&N2^pVY"BY_Lq)1haRAe"hcFP$ W0"!{<ܜ~r2# 8˻nic}2",@]Ù.T+}߱V{ݦɂJx1A9OpڳUlf4;kꠡ yCZG0SMYf. rh_rc2KC%hn o}+v zlTQ4p4blI)Z%z.xFSW5x` ߩLzR9}TƊRHHG?DXJ=6-<%UU^;G&3(\O][9:2i%ȢBjq+TE W x+хCh)d3(X? g;L4NڞҦ/O6N+awEy4 g[ׄホQ;-nCO4BS§@ݹVxpr/SSEf/lkKBPbgQ J6.P$t&?-J{&߀f5a˯/Hsu–_I׷Fѕ8nE Q9=qی.0,&]1ߐQP=/[2ȅe!QgBC!;YdϢ5zYbb 9ƌ&2{vB+40D4mEe F:Yj:fSN/{㺏̳m@:zldQZt%'ǨGw13\^d!`'"/lʝF&[<VL.o3Ѯ3d0VPnV9.WP4$![ ϔԉ.X R1 aS&v&*ooifkr 5tPEe쥹#}"J#ʕݘauȩ`tQ^2PF^WO%/v*\3o䝈΃`dis'5*A45ѭ huug}ɛZț2s2B)}~W4)诔 BCeAw.ͧQol3qVj_oب{e xq޳55 |U:Ba iqd̯!j6: m]jO-E'ʜO?䗩u,}P=2RzK1ۆe|0hF\9ӴEp>.MFH"lv LslH1TBRmqRrJMLf~?xJko8r gV5u f1xK yYX;iSKVRzQU׭=dX* g&NR1@}pcل0c~fUܜoD.+s+N9.qn@}u0%f?}Pi&_{u ޥ @mY33s>)xּpCh,=pFUa/(JɤV GS=_ _$7*xq?":n *UcjSj:$-| <uqHgoOs{r6yUT <(^_k M W;5jNfO&3\W_NA ^!`@ehgRFd.˼d; j z_ Gt5yZeL 2'| Xd*qC=;uL:@{_`]d46|u%WX۶lXl)z @zr|o Ƌ\5~Jv}RʫMɡ# ̑ "?j,4J2 ¼B/nt AKKsFV{@WW?6h'yx$3Ej%Tb~ z[m\dwzQi4_ +w}/\2w3^\  ,p-ȅ<Σ#3sVaA0k~Нsk8xAX)&ςOpi^/ øP%pZWj{Y/$(Yq=Fjǻ&6ݎ-WA;L̲:]F5gž4wd|klƼMd{b(&@ZK1De", =0{zaNs AYW|WM2KlϮ_æF̥媧y&N =vp)P-fnsH"u;f]WS ~;E!bfK2 YRoUCXYV07;mۉG/ɵrl}F9%HD0w|{VP1/+ԌnX~%ؕ>Qݿ s\wI ooQVt+RWG lƽk!W̢h-75'|a4Bra%VFqHe1j3/PAɪMq DXXwQ iOTm1 `DDd?;40G3($-, <5[*[rC9oWgaxI꫷}ұzޯ#aXӆfYtok]J{6 O1L 2'ʊ֥C@l0s||0) ӳ7[\%LRRQWa68yއ*i TȀ{(vfv41PI9e=ƟGS Bfا\X4;:g)XGDj{|f`욼ݟ{ig4FA /gJ!z2t<ĠeUOwKej `B;*es=;\]Zn'_R]Di] v F-l)1b2X 9cFͥB,q;uC#h/ל_Z)E#W? 2lR.N\xP㋫s 'c~e=^o7[IȒۻiAC.$oQZD%iI P*c+Hf F>WEp0uλbq۽ ]9^PzyWMCh,j5`63K;l-AWt[ȇ-:qt<ޔ["`ku+]|T5<3<>tɃA\}~4p 9JӷІ5p6`+'vJ SE)Mi#XIZ>{Lz~/Ƴ4Gh|ggO?'~^ى.%A}ɹaǯSYga& ]*g%@+91Yё$t<;#A}?n#p(`IbcI+KeU6r-m_vV"^l^ XD{p7;G*,*=*w{Z0 WNd.JJnRSJ 0#&âjt(@L)d1Q ZQHV{YBTH:|q}Xee+$$z˖Yۊ3ZQ`uVȱи(qf 7A*#:p$a hWiRCTM Ojѭ o5UOHN.8U} n/෵I&vkN`m'F6Ѻ`(K|!Ȓ-cTЦLG.HKrQ`eF!d{iuН2.lY[Ndhsev!#^^UrƮ`ªB@3f)-=uP#3HЍL\cQA\{*<|Bfl{$=O 2.`Ch. (,R/l%x=^DC&QC24U gi(b'WJzuӖ?P #8$J6"t堍؂NƗ.uPp5P2Akv;Sg ղمJ-4:/RIv;I[ iBT8ǝhD}*x@?,ߞ.𲳷^ 6#0 bH0/[vS! e=Խ{9tӟ Y}ܦ6H]<5t#=:xu1ojìخPQl mli, ~~|bӡxhw-z3bQa:_&o'(.<R/Qs߬}MFD~wtd!j(YU^JhuYNdS;Vp NLkt܂z˾l}&ka-}8SAOup7YWQa:B A͡E"Y6Lq6~ğe<4WatS O+oX#Qs\>ə0BW-:q1e߀GrJPf[TSA:jdyA yκy)6"B8]v)kmm:nZ]u  [l߈ʍp8ˌί5"c j=Z5,%-yebbs'(D38,Vs1hs~] ]AH|>98Q6GUr"!agn>e_Juǵ |+?~: Pr)n~@wpAL(# jʋq (%ւjg45\si3~t&Wab}{qkxӿcstd5)6'{V71:e6Ȥ)+ϾBiY]O<T}J$Fo\%, 8ƼE\DkmY:~ڼj^(?;꟤wE2C*a4=1OOr`43I1H:UepIVJ yRFEOTmiޢ>u"Ks@@΃z?މk5R7pyGvgNR< %{tGL1gL;zo&ҝ)nWlHCfg#)4/ϓ`E^[׋C[M?>5]|Mh|~68#'FSa␩ov3yWACb}0j}߽OcaӢq^e1[1W+n,w'H3Uˁ%"p4 Z. d@BI8 U6kV\fDŽm4K2yzr't#lmV~8vP~Nlܰ .F'ݺ9H$eyj5yRE#`B@MB>hc[N忰[2MY9Gaa*K*g% =ە8"jvs5CFؙ$* Tb)H5&q]h+g>ј Aa%N`cY]I\2Kg;4*j>g)^Ds's( |}5~.*waY|zJC{J!n"ZXȄzx$4T{Aܐߘ3$☨J4v—gvey=ѠYh}/pd]sQdUvQkN `NMKq@e {D|2q Oϵ3 kNhH-Ni}G'$B?)m)0]JxM~R^i^+rM*Gڐg-1Bac\a/]îN/t*$ a]:#gmNtwr\҉΃ f zקJM0L (-(wBRxV‰b![8R'_kg+I$N/cya60%u^&[.7IVH3WUD[s.s3* h71˿RQMBӴDJ$B,pr0?蜅Q<1Cx=פRndz[x-L*Dcv.{-;r' |8ǏF/o4\PFaf75^Vd>:ʈ[I`S״&/>Y^f7 .L|nx>roH#coYp.XDv"trc04Oo r\%Y|?]ƣzh=jRH2'G? C)6DLaq, ! ?΃3hn2wY ZK]#.=u 㶻_<~H8*$g#8lu#-X":^PuBe(Hۓ^p;c!.ى$0j-q ;c ov;]̥}QŏJh3?y51#k_tX3[wbo}za/J+æmޞwc!_@RV8V<g z"U}Kf N@UIρY2x#IٴSCր4؄H05 eG0e 8E;O ?q;5J$pFܾ|y?t(#򸭅dgcTW 36"y>W}_(U֬ hؤyy#_Dg^HE(垸aH՟ʼn7p% )o0Gw.V2k{39%&*yMBt=D @kN5iK! srBt+cltFsĕbޣ; ҾߊxDD\|݂&X|c5=(sG!&)tIPwIah5~"%,?~ΑۋkV+S:xNAlِ%eyu~%W  g @<:nqk1p澦l2AV5`4J䉪j5 Fuov=dыbҲnqa]JQPb}ς P#6?v Hp:k~RzXRnr}}bnxkncCT;ho/LU!'Ɇ*`IUߗ/1'|,1*<9͂aĶ(ue^hd-'Ά:`|)\CcB*ZH""be G;21dR6N@;=C#dm>=#.dKOy1 X=}gilI_;`y:6[Jc Ep)Ы;ZV pz?=o2s~J2U"i/)parlmRnTEOIt9<+1/梹#Hg Xmc,I~pF,r@N4fjzE7*@>a<v'\|gFht!(mQO$|O7ÔI !g<%  MAbªPI4(mZ]KGj* xh5:udSzqlG(J?`єͳ'kRRs[d+d BTp'\)(9RCj.gںs+PfL'/Ct;@'h'WGvih }my[l^4# IC҉>z1s[=ZHk$GTߌybz$=v)ӟ-DE c'hz(5zeT= OCcEaO;ФwD\}|ҫ%Wcc׭c~[s.7Νqj<[#H2uΫ l dEĪleY-!)gגpsNlN!, nl~R,LÌ1J{_f \&Z.ex[c^X9S8~/-E7AP hiG+gCGNEkIj,4`6*bl @>cmr #QrN@Hl;Zf$'|"*fG"gdL!umFNzw9' 6>X.Z_9 ߢ9e])~/&nMᝍS-~BB,ec3ݫ uv%=|lZ uR.0Þ-{58Q=_ td(_QޫQtDȸX MR(cu Dgl2,B.6FP]v_G Bime#@N;xnN#a `:Jʼn*^N^,9Qf)1m@]y 8> zNȖaum;iS¯/c$opjnB775wRYc$M~g t]Wv%tQZCɡ3AU9aY DsiGqFKhSMl7h]W·ra%G+^ qv4 <+e,@8V}шS9}4mE+oTcg??z"%ȃ]dW8-nw SFt qlщ)=-\^3`E<+)Ը* GŒCGg1VN( uLGXy{lbPl" NbH<`2'P\)T%FEƲf֭wbW?Xo9 J%R=Wx-zM~XOy^ qeDTd5K9k;1=i`mVqKW/d[HIC'W,J HϊZ)h3>}Fh_UgIݽC!(fT 4\^y죣!>lGӥ촪6_}4`${/ R*kP`/Wb8<\M! EgTz,F]߿coPv"*3^A@KA *kTU4'E{Q)e֟!5 N!e)C2;*M!{T^-_6M)-J"Y\9Z!DXt%?9g$>D#ucS`۸!!fPU7L{~%O.{|h5Р2Ï^tLp/_8› Zq);䉰Tқy M`p9N^WI8^|\? r|lv&yTZ`ÿxZQB2HVǝz2TD( pQ5"+K9h'={iKql:.o<wLB˜ gZ3$q3Lc19 6?:|J^y.͡~Ӆ=hA5- 1*HXk1T'`B55av&.)%>OzY,*z-K˦ h(Q⢰m{Rʺ<1A@j<K+_)*^_yZ.Pj/Z%هʐ6yΓ9֚<|Ӷeid 4 a] ?߰q@+[7Ӵs/Y=NBT47m).h^5+ s?-9ims1\UxBV,Ъ5j(p%)\?*c4=}ϲ0(6*k ˿?dNCO.@&ΊlĶl)=XrR%= aRF]0> ˖\$zߋDYq#\" G5Ԭ ՂVE+rEg 7-t$F&{vDEf|/a?`I ޓTsF;g|w)}V'k E+a WTi>13| Hʛ|rB^)F|!9+tsV,S-< w}~\YzZGni))t^8zy?7aiYxrz`r4 |YgK~̟nz;r)x:L4磉^V..Q{I]>.#]Oy3 ̩$p` HM{Y׻rcU pL1M+F2l͞b>3:ݰ9×+TϰIUHgoxu'ḀNV?iiGZ/q,T xے c&ɊG$ jH$`?;&Vj"VNR70C+%xm峻`@HG.I 6uMcy mSl|ЂuòJo#"\hY twZJHɾ3+f2rsYNmh1\$zN( $Wd G8zk` ͷ?Ƕ $# awO8:f畆~.b=JFKZCw$i3=+IX:bL=5>?}NEa?d86LeN__Pe@\IebP-Gu țΑ5ށXIpO:g(_ꄓtP 0Uv1tUil`rгH|\Tezi@Y xP&h&_ez(|6e >fP M8.MVEjwfrfqwBh9Vwڑ&g0?$ {ȊULtQfS}IhdFs!thjTb:> RC귴#e5%`aZWg u}DEP!bxo/wk09 1ljy-~gr\{ "rj3O)5cEG 8n/GI.›)n2''˶~~IU3~i/j4su$L3|x_qn> NfftWEv*3Wn޵Uʛ3֧#`BNRR^pU?z " ?cUSku0o(kAXS;|/wMuoO@;\0N.l܍)͢Π@44K6m|t )R¨ vN.fx4h^%G^D| dq^hl>^R=,s>znnF[&+c|DݺJlsvl2,9 Icю,i3/ J+@9ǐ<-W MƘ($ũ <ʞK{5 g8}%lmdӚ(#X&˔i[(V"^Ogk/#>IHpXQ D=pp"bw{,+(m7Szpi5otucSqʃԿش\Ex8AG<2K_Ɍw w^r.HR5PT釱JB瓊mPrZ-܀ hZ1<)lBd3c0>d/d{Z&KfRZF Z4~+/VĥtEDY}I5I#6@VIQx7bj\0C7ZVMiܸ4Q ptBmmC'fp[Xo I+ѝ\>`ķ?üQ*9/p-2} Q"ȺTxNiP:@ )49QTOY j8ʿ4ESl]ƸR4TE@[=-ZAJ`HU*g0\f7Ys5}lTe)vF'l k/.fG"A;ՅzQѧv}'܂_\]Qacg0SڨKĐIY>aӸ0hהC.Ȃݯ[_߭7CtLsq;.E~CBgXJS,½CQSk|Ωme$d\6)枚[PSpao?S~jJ绔< 9vrz'ɿN] PF#Gw  |K=iSF뉒p9+MD*qi?BjL"BDxPTr]T%ajx%ǝT M&=BB NYW z!Osy6.)z~lt3ʐeo!_UEaxAXoB4Do46UZ 󚣙VYVoЏhry `^i'a͂ݩcl=5}gLt7V1&YTN)USno.s|DbگeRϛWGu8} c\rS, ԏ߷|ht#\@v6,9(}ZA0xoaC^Wu#(gKORbve@V{8u',*\8n3Å~/;0q!F_8[[f%g}0x|ɇw<γWTM=U*=!Ͳh䉒ӓ":!ˊx?(k"5i)tB5- :gaOu Vq,h@]""#pD/NX%cTQYW5m/Xkh8]r~s-v7b__d3 r7w +fR̰ѿD!F{]h.w{v4}#H_v!C ;rc&v7M)WkR;XHӭ2H &=8PkCG4j\Ӯ;NFҡӃBzAhRKռ#N0$?$6nCam ;j&|w-E}R%aBFK{(KĖK/VTRǓe JI#?,SHi]xbkV4$j.$dg]i/HB'g] !Q7e٨% ED9jGe} dYVIw6˅pR05=kuƘ=2bNjKޜ?AT0}dV+O#-%+ wv4s>}Bn+|j:司Nk*wH31Cqf2NerF?AH..q-,l@P6&Bap:X`7$|1T&^U0 e-BWGl}_O-dAs\c:#?dCZxӜ5u|h S.u=vJ\7ϊUL2=D\ÎK/bd'MI{[pQ},v\ y}2~}0bYkg"fn9&z}ElP$ZuW`12ȏ}3M-d}j˥{ۑeWA%=@՝Y0vRkZhi#s!BGQj|<+UzI=nZ W9{ucIy#8Ћ01Su3\۪wOUigi<3Ng/Йp/QQ먪͎݉g"tԕ0}El Yz1_|'BNu! n{S$ ,2y{0x0<6vm oi=Z>O zpOXV6޺qs +G_O@8y3R(J<юdFv.>6c6 Sďsp4U^89"I;6%ɹl \ېIߨ.|%\ai':$r4˧ f$^LakIvbMs 6S, 4eLMFJ<m?ĥ[ͣDIQ`+k/NxvRsXIl.~Tbik-ejB#W{HˋCyؑ ',can<\EH e\|y3K ^lR61/Kb9{Ag{'y6ȎO6nn#l |R3m& u  6*l$$R^uʯf}ְ˦PN[iC4yIɞ 5,fR$Ui1P`"y\#wQ'y0iY įJ,O?VBH;jUVכс,*J4DyD&Q_@sif_l EUg)~oq/ݑ;-3v/n?CwDF t/x~刨,< F x[ǫqRQ(N< OI-x`@PٷTy?2,h/P$Phq'5+yf !g>\Lgp-դ ]i\s\ބ'%cRr/ “5/ 8cB@NɈ,{%Q~l!Zd}WsmQ9:izT>:{v L³)ܦ-kBDq v3K Ǟ;X _ixЉCr d(1tA@{|V͠dTˢ Ys mwof 8H, N$EK3*bE˶J3Ag{;RY` pVڄ>VXW;w}TKR]0$}?v:X&q5}nS1 ͔>$A, A R̙WmD_h#KIC~ZxfB`i|78%J,&!{A_tʸWQ-/Go1&p\6Zf]V]tWZ_6Rn~=Uv1qcĭG8%N"1K'yߪX坤QsHXw$a6&Jj;%δtD^]L:oCk]"M׾\Z'aݪhe[OH/m V_a|I5{pXQVmE⾹\7fa. L=K XEL&ސi? 0/]f!r$+RaC Tb]mq!wQ{pH6Knf\/)Ŧ͔/W4ul!\  c̮ ):WܜHϞ6D2'O?#7nRx!]148XrEWٿ dtnw!Sn@^S[L`"f/ α{3wU:r; wJbd3GB z9ծ] Y9e5(S*xE.݇.Ƙ1V[r'HAN%O?rPU * ܾ_DTo 1R P7C̚4 }BOT%s*4"2MR'Oo2.%V"YRX EDZK7!Ji!gV#. !:\snP3JA&uDiEU㦂~mC*"hƗ@r-_27D ^gOvJ:ӫ-*`yN":#( 8oxxis1-i+QDnNV O:e"(G@KCsJ,*qgLBOBl\[ړY1"}UVܓն+B@LZ/2e(^#:IFEqm5}s0z妭ߠNw$kCE2A'̗wf\b+bꩮ]HXR}¬W\Q jTFK~5MM+/jَӧvz뻠k*5D>I$؍K$1JL23 n9>m>E5AYe=@80^ޛNJAohRBJZ7&_5Q2m?RϚƟ %/ L\ԫ0)"{PNwڜ-kz:y1M]Kr*p847Qo(`O:y7@X0|% t+uK 8D*,򽅲"<(@F2np1`rwm05! Y11 "s6揹 PXJ?kaW'oXH8;vqK^Z[F=]F1w wQ{'bm(.HmPcX \;N͗;8c VP=yy5x!^5/ѕ7B/ù!=4ksOBɿlY-N;<0TBuGk7}3^bY ]07Y=@W'성笒`LSmFcIr VG}qXԐ6㣍m@@v6õ7ryK:՞g;ؼ^Nijvm'v`tbI<S%TPk+LOߦ:iN`IJи c_$D,!ƪ ܮRRVN pVs#l]ڣn ͨɰOt  o1yd jY7W"kz߂ܐ/CQ6p],ť٠{ ڝ|;>GL[D55՟SN8+F^}wsG>VW-F7 i.='<8% 5l)Է {Kgı؃3q,A+>^Ck Lڣ`$,Y*“ Z-D:p1붇2e*0 u8|DP*L\lm(2(:ܝ>ieA̧k "\$i kj.Hc->G`?pFǢ׊d:n Ul~4MX}mfi#_@) GFij>e$ hΧt2P#&lKLaΉC&[tT1/$v{?a#+J5TZWT.d6!)VHUN?W?%X2ʕ\/~t|d W-8 ?:g°-'4ㆦDFĝS.ԙ*HX7%,gd&+>9\t["lc-dU&c^C7C.cXIIjI1XIU<ޑ 7pQM9GX8A%(}~C[ϑ' w5'^Etu>p(2937rU#2ܰ" ǹ[==bRJD6tF4 /f`ۺyV!N>2Zq8+ @ }_bu#dCn3AAEsVʈ&ԵâӞkOH'.Tcg [FuQQ"E>j'i]$BM?{)$=Z/qɑcuKR!i}фkn;W]Ȭ5TXVtaX~6&oŐʥw"vNX"n>]To$Wt%uG>ogj_"iśD|^{3M^m+Lry^j0inIȌ{QŠf& X+b?Wj5k+&8 :Ή$:0nȜO|B-&?bN V |c7Q9&GGJ\UbP0=Klv~ɂd1KVT||٫XmÅDߖ}z9:GGԯUm٤BvDݤ&lٌIX>Ps.r&„Ἴ,,hԻ_%VԄ+gd-L-cE -h2Ixb>7,o>󖯥?7g:1k#7)3S*٧$j;y%ϰĵf$?yWhe79^Rrz&N׸; 䦚YPMZ,)N=7U3 8ESiiDdbK^GK(=ts8JS5?)fE158 (4ƨF$=~_ڍPήwN=:&Ok!iGOJfhTL#5z{ִ7CʦKRTX3/OK%z]zWz(;R׸,ݢF.:9.M -Z5FƁKҦB`gՒ.piMTL(*_dĿ#ty 7_"rD4Ͱ,uYa^ com쌛a r) ^>o_n`JL"$mLB Q .[Y6)E6f⪂6A9e3Rq&Iu 1 ˗2cb:RODaU3{^=^> kgae`p5bdOB6&ڟAHv1 1ebLu}ѱI4TU:,bn"W^+z0 6}ϝL$th\d:4y'_WS̊H怅~P&)W}q/ g2^HC!zuWu ) }BzJ880j+sêX ^Χ˕xs7TAFANJs )+9dCK@赂9LcdqOh}~s*3۠YݽYRW2Mۜp"8%;yV7KVνv/' az7rCOBD fQ+qIߵiW&]3ٓ\g#{ghz6Y!yV^ʪ;qV!Qa W3i+,BxHhhehc3we\d(s${p m/s;DAmA>ΖZA:.h:/ԽFۺ~PRMLs|.T>Rzʭ7~ɑ2;ItUF q~jL.ij8ކ]?B2]쏼lxքXWh tǶs!5LW#g)[atXq[QH7(Juv!o32 &80M,,Ezifc| 9)*i(@t?VѾ9 T\ W-<*8MKЭk )`%=cә4ZMF\S¶1K"DAX1sI&e6ުg]S0r&u#. iE+ (nL h]jsA.FUn@cx=dXC_$BIb 2^FHԅGFuf_lq(y*|VEe\p(`J9lKW( 4X= {z62RP,9.KoDxpؘCLwLs*M')j|&\vӟ!{q $vZr6h[UO*9qv^ Nq'6/!?um>4nN?%YU. $zU0~WXwP},cܥՅnrA4?8IaGqi}Xd#Lfh(]f!)uN/*zj\HUH m!j- eFqߊs~c \ HԿzmdj5Z.=cds1Old-+m{ʇؠ_i7Fn`YN*z~0JG?'P |֤c~B@4ڋrTno?¶#ԍD*qv~Jn OK2 \H9.{b.3DA>|윊Fi.m:dk:xv/B0V|Sikkj8ǟӫ3 iS/[23,6@Z>nB99a`%I 9e4M|z=OzBr.h8hM$rݯLN\}@h·LyቮUȴeٰ|5[J.[c,,(|(:F&v@kMWr-/sz YUi2ʅHއ}$a`90_qu `bPՂP^9dúu)!MV>?>J4&F=MojLXl/UӫrxԒN ٔ;b|AҒ'$qBg\mX* {pw,!sT5w![ͨ*YYiXwdK0)vjX&WF/4M@ 8DJi(D4DX oELu?qաjF ps !yIgjIG φ"6s0FiH[q֭}!s8pɊ Ǟ)E]Z~(t}ֈ XF6d`C`-'=:q>*Cu'G^V2bs oc ҨdUz'>*NDb 넿8dS2ܺIquOAP}ƺ1's=%(nh0г;Zj09 :xA NS88&d"^66\ 쏍MH4҇C9|si5~EWZaH?IeÔ.MZK2 |Ft j,c_o3MۅT~zièN˧enqPOC/zt11S=>ڨ?\*/5dJ MTڻUno=jo $J߈j7$LHU>mA$_E*C=2jřg+C P(UH [UITkߗ)opٵ(Z72  1>hYT~+ ;GHoL"wWEȥ)(oE+vV\ي".t<|r[f pv]S_"smI5m3^foi3oά[i`|R,YqEe{5urt~+EszqvvmH=Z8Χ hMP&E!%]2l\³'Ng;zli.φ \jMfoa"u6H-65|<*8:DՀߴG[$jr<"F~~1FN\klt>} +̞h{/XT*wKg|N{JC+r"J,ς,6Yn8uͣxY$2mӽ-tC'wen4Ϫ>@b,I͜c+=3!m|\v*΅ e5n*9y;+ M)#`l.? țN~* )=}:7^)?'7@TXAbF0 8Syio$WORcHB+Rbɭΰcl}hGQ߭u7[%fK7gvL`Fˀc`ln&'zj(s# _d(+V0_Cv6Ag1Pn)"n 2"E!a3^WIl9Qvkm ;c|Ch)Lv8)? W9 Kݽ;d4E[B!贕`NRpP9hѭiyL2(db[/{a!d3q~7 }ՋzA ]M¥l)XqLnۙL6檪iNjdKoJQvcc92J%P|H*}㘏E\SQs5SDAâ] m/ie'.=7 26Ɉ;}YtllR=xeIEsdGS~]SVe.xjY VaN2;`%EИXE>2yq^ 6Bl-AMBD_QN]#hQrg#E q`'VZy䑔[(^pL*]O?#zJ4njJF`28)fkqTm_fC=ȌM6W'SdzXl%ނΜǷnyYn'1p)0 D7u? \֎Ç|$㞻bFwKޮ7vy GakL 5?й?c{,A4Wn>W0K~ o£ΓtV?K]Џ`j*v%SxYC# RoE$`>]sSsuI;K F'pYkuS2-4+{ܽi5BHɡX[`F)ղ~p)O Ej,YQ7WI6' 9*<ث 0;+섫YjƤh 2<Tm8ōķNIFɵz |B8Z"h$/cD"D8}x_3Xܔ I&ckRAdX%wFxHp)X?;!|pkΠ81k&T h.$@b:Qu%rۦ 7K-6IqJul\/J 4%E_W3|\$1Y5sE~6 z~g0 (KD35;0 oRE $( +215wN!sm2gxv>ɕtTxl˅дz NCE 9CVܙ 1w%ҴWJ׬%P>h؟r;ݍH.aRdTᴫĬFl 6GwC@)a?4%T%yUߖL\Zż,A붂Y,ݪ•eW.'ӮJwvh"76l)!wĂr~6xp V1U4s~^ԒaR#4u%3RkUYiu{t^؉XFlepn0\ C0OødV1&]w7jfn׋s mS}k#y"jl$dْsqx(qV2HUOh%u'*" 6gAЙJD UX;7S*6eXu,xA~ #P0_?G0hRX P;w ٖ*'ӿ ƜٵJtzm8k@ }甎c,*80|3oxq}9/\U ?J# | %EvۄGTȓ;"|@xSdPugl1nG˲ u3~WMq?{N1O4ݵ cRl,ȋ  (E-"ay*W6$V>1RHԡ*1Sbqso=H*m $ˤA\ߌ3@ N60ozVgWI |5z=j ~2 ^f$/&&`/By,:&K -:}r%DB:~9nf+ t0x*݋[ z5Vgdn!ٟ-j;ML@8S^ۡI+ҭQ 6y뺭[Xz K ~uQbK!iݟ{Vʢ .s 3=ĵCH^yXMbJsj{Efh(H|89k(&sqf`ny2ƐFNffbN's Jtl'g{ k#9 -A6?S.>BMԳK:|k;CvrݭRT' ^@}uoP59<5kDD~'@/Md}HH+`E4F»lG?Cȷ!@g.Q_nVI2{-E=݁Kx,L9b㮫d1|xcgQA*zU:wQK/s@'0qo' ɟ)@E5>[Y*SILWQF{EԱ-؟#߇[D$uYb<ġp@3rEj$!E1w.U䋘UQ+sWN:@<jonЮ/4$HypYkf[ݶjR=硋ve*0IWW}lͬGk7w *?Q|d9>{|\YtP%)V5ĕ|TLc 2G$kw!pӪ㓥Osehr#M; u3Ps orn-[ͯHqw q}=pD^6ari{#w|+P'$b7㋋J-zK7.s ʮ8.% ;kCc-+1zA\3qB.GЀ \%˘sJ+cKEJ1\Z/۰U])ft8k$X!kSr܁[.jЇEq\E@o}x`c,rɹ[)$m|ɦ$jA ) Ӄ O [#mn`3i,@.)M^R>.wcMŘ[]t*f*foGԴ*-|\Ew ïߦWPUb.|= ,*#Lꐏ4Z]U5=ӏ'Pڮj# ,L2y18k]Mh9 uF+ez&]u֤ >@;>4>se=g 2b3ozkPxjY ")JVldn3@" bRjg+"X74hA,Ѡ'vzR۴ESçiQ)iAƴ$Yu)C᥎u|ع@ڋƏ-^eVt_Q=yOJS_!0:;hnu.t\|Xr15giP=k}}TGݙӔn)e: ȴl mB@mRodR'b}F€"rI{C)XjfRѰénKd&AW<dUUϣ۔RP} t ׹b,N C}?e/ -j8{{M ȊV5DθQh%9>xL D!\RZ&i)Ke۹4튝Y2.5c5@Oګ8,`bEZi6xM:NJgYR"{l@m!U=xuM4<* :b$y ?fN5iBl$5RUOo&HkPn>w1N$^j:6(fH"*uj2=ϱ?BM'G2t}8Δ5̆l:F~e:CF%d^0m]5;{44eM)RsOƨIΡ YMKJP!f"L\!ZD A\f$x$ܖi>fM-Ͼ,wT7瘙؁B_[9EA(yP1м4YK"XCuqM0"A1 _4OˆXu [ R#joyE4P62'M`ȅƕ_/*it%2Khx4<.Ə|k+.[ғGQ=v;6Uݎn Jav~rTNDAI8V=j_;`QqB.WAc1Oȵv7#f;hlZVqo`KHgg]e!фt= 3av:MåY5)> L|uVܖ2coLܝИQD@ueKdpus3i"VF+cĬB֯zBFu\ɷe01ޣ#n; &=hMR7 t u#ܾH%>"vc;]kmM2^pdR3 p:GX86jj L&l\HКzQj Ԓ'alj|L x&O\mP&ӄGJ^*r^zo,pq<*s-'(mq\{,Bx L?2z,z2 " v08Xuubs1<'3tD4ʉy62XDU?o[!&:+k+r[zEbdr 's\xY¶bj QVW߫+_r4@b"j! .F =W6jք*1u)>iB@ә::#jJbЩyy /RVZLNQ}lyJdpi>DDj)}לqH0+G+Ro*c̉b|--L+*y9Ct8[{*Xp7H_8UUb͌"Q ZOb/=!sL{7d|NZeA6c0%oT[m\c-_h.Qm4-osyP7Ӝ.5N G3z.F|COi8 {[Rd1ͣ>K!]!i uGwWOCR$m EuKosLNE=4Y 9V._{6E~ i7w1SbU[u/Ax5}|1YUYmQrLTspZ {Wt#!tyʬ$f|gnQ\WE;4 Iclǹi8 l@|GD)!`.}P+yZ~Qէ Zָ:ܰc(ݳi{ub=AN_2ڝ`*ZEti6&{B2 i\ [^9+rio5BByY=cT kQ`ohfFcf6<o }J=i%a+M7L96jsuvg9\p|ZSO>σMN n6*˶e ƓA/ӢMzotK`= |\ c+ݴhhf2[ Nyb*_[Xw?liwqL:K'=7Y<,&c%p?\31YjY4V)a %$Z`*jl8!QCL4Eud˅f$S  ]^Q芬ogc J#}QU^u ~Na]KY4ֽtGTSSQ:MqBclW=8}XI;b_bDb[>xqnKZ1᧠Ǖ٪#&m*pM C{u׷Gl*%rdT~ѧgӉ}`yw/Jw=ObQ^vmuU~<(̖@㮲aH 1-gU{*K?,$ċ2?Jc }dةRe cCPtHHaژ0鑯. j~Dk(Wd:vBₙd+xFN2Pᯪ=t* `V PYHEOZv?g93ȣaxm2T8{(Ͼ/ᱤ}hlcX|!=^7;an0SР֗hU ;حz[[HNg+šzmЕbB GRH읆mNw. :{~g?)aE˰c;0 9 ߎItJ*mP5#?`.ZԦXe[j,h\:8vgP( д2O{jӸGfKÒd^mPImP˴9uսq>"`dKml&@SN,pcpr55"/yw#nj%N~ c`t5Ƨ>?B R/ybU;G[=ݹ8-=-=i %/^]_8ZkP(ڰ5"#7e;C8D^hBkw K({3lIOKG;|5~[_&(tf&DB,>OT`7}{1 ZwIh/M@veGijmuMt̾@!6VvRΩ2'`o:@dZx  f.eGO^x]1q5 H'@/@rc`r&q uܯ@q4kZ)oȏ9d8cg wqO||/*oe N$qV(D|~$h=s֮0">(q|{Hٔ߯h#3x̆9a$ "D(W&XCN~8(ڝկ Ó=6_2 F1ȑ>Kߓ[5(1bHdO8ĨR;2\ٿ.3+"gQEЫ蟔Do:Jctk _+ϢFDa"ߌG.' :PƘ *psHm쇋Mݞ'`kozY^0ќ(b b&@Ԫ}]H~dW4)o@|%!0-( 5Q|[`!,sj#e{SNodMsh0]7$! Dʢ*xF[sjAVj&{$mk@ B>?i _к;;sr gPDt?erQXK>`zȡgqr=~ (7Dc&6\SȨà;fAÅ*b}mM虈J|+06/ǟG13gḮ+AӓIkG%S(u3/տ~9Nt}Dk6,2K#Rju81lě JJol('LLdQ{'עXVR 0Ce>Y.a "7 `=.t1|nsdQ|%vu6'f\Qe?{y]Y2zr3\=33c鍾=s~Ģüa5!\LfIX{ڴLI轅i{x *{@,R\\h.QնRԧ~1 ܌ ^u^wd]&BDZҺdy^&.G,e->嘁D~t48gAGT~7F"X7@Mi@p"CZ}%o9˿dmED|T͇DKaB*iO`ӑ{"yc>De!f;t<e8q `{6OdcDmu3[G_&dAL]`OE׏` juy^ ϽёYʆ%YW!jQ9緢$W..r?jQh<߂G{WNcֽliEZ6h9|Qu&cvzTg[v.7@i,$x*?@`y+@9ȼ)m|G"73j0qzYU|﨑FtԍR%Sւ+iچ{m_dGV=@LסZHڗmyy S 깭ȲJ s33%z+E3#46sއVupG(Xˑ/>(nV x.E^SQ)TV=g B b'6rqWq>)Z'v}L0  XǸ5,Y(P$)H}ɯP:$nc'E'{m;4eB*gbS~O=1B*28akWEKx _m<j'6B3h܁F:A$V3A4e yooWZiFϠeD+.=gA{ѯgķ)ij<y_6%oiʛmҚ{~;isjebM+`8C¾s_gof["J7.ѧJm m>g&XWgbQb$lݳ-nWyZ-(a"͉tܰ9)wq1 GaaT=4ʂgKP:ꑥ5$'qz ]WJ$^JwQϹ?+d'E6zxڝS H3 Z!0v= {wx {+Iv%:_K+M,4bP\] 330Q8B$Z<?Uҝbn92諆 -JR 2]%Sv*XWY]@Oeȓ( G7R> i^)}԰YedcCH}xI<'T4l@o&PGtyd!.#B{Y.wESöUQGS `(4yv1GZ 5c">/sg8(KĄ@s1KDX?jUnܜF,Hq.Mϗ5؟ݙC= in2mesDq!e4W57r=e!+|2 嗛CAPs C#΋btsT2Y @ 1:sfW.Q}iМP@7=5Wi_/+R,!I{Z/[>li9 C4[ĥ9k:~G *()et;T5oH::ClIpJQT Gѽ|*:qƵV m(X׀@2fqAͭ(l_ 3xj+Fa_ b1W{FoeGlʍ4A>x8qک3]z .wZ)-M13ׇ>NJIHeF&=x d-45P6f_2u4z̨/t$jӫ49qmai>pi._^;TrlPaЗ:p^ C2y/ 6K MFj5c(p!kJQ-x7gJqʢ7RjA8w~n2 L?[yQ|?NIhuuo>4(kcR,7a#-)B?RTj6P?; ">ZzdP5[1k==ǿ:])k9D ; 7=^d=^R}r M/\uoXe&hƕ8 v{ Ã֩9f ^ȳS u壁~$D9C}sHe)7Jڦ5ŦbdJ1Vod |H[ &si#݅&1F oTطmW$eyBH_6jM=YKL1Ψ<0& Gq}|hOMRzr6B*hr< ND+wު B^FzLˁRrmҪ#HxD(n%6*4nvmFMbjğ INZpwz-(ݖr]wOq>y6Q³΋a hM|Ek+'(M@<&Ď_= @p 0)Ŵ:@i-&̮"Jp2{l%rPGmF7l 1G9چncB8&q6}A,Yqm=byMȏ֍I0(":|χ] D:Xg ÖW)"D#MssF29>4:hY6a'S({z~a&>ٜwȹI3@y<鳉z,:]u![%hTg~3.WsZхCU^Dt6N' ħr)+AqӚךS??E[7H<ŖN]o2T@ʯ:硬 gLy.^ԭ'6J~U mKVr &C_ /)pkkc&LV*5=@jX-F޴y,^=O#]A=gȩUUSoO΄\A`HӺқ_fS۳acԙ/t8N[6[ʼ nh u> 4_ʟE!zҤf 1#L:% @ P 7LCSl>Рa!#QRFt%쑥L?ɝ@´xUCܯ a;*^k87/Qa W-$kp-Fq;# ӝ1'pSN.F~yhZNk ?BB~Lh%][^ShI C3ۘ3f Ks̯޸_ _7zp` dATbI~~z$9)~$ tUo+.ecIÐyBA~pO)]TMCQދ6c&0|vvX%sqQ)Uȴ'-,O'-U NDue(vQF8{@k9I0^%65\F][ :'&lʋBgS.= yWWZ ޅzM޵6ٸ$vT&~tAcMxهuצ:`fXf>1~q3ZjFb2L9|Sȡăߌ91b^[F<k䦤]NOC`*+I)/I$f-g,7؊/`:~YsDް VAmq9.ј:`d6H@f?O7.?IN?8)gnMp>tv ۏ3 .jTufDZ*Cy-ޏU?uWS-9:kJoAϝJ eMH{fh<ْߘni<'iaP#k`'^jB:mӎj[jA(U#E+!{i4HǓR ˖J:yqT:5x3[KsF8uBQPs‡tܡK- V,s>=;7uϼkZtlO2sjcE?ّY@-]^JY; KSV<Ӟhb:Vlqxaw'h@ = uF!5{e! u%=_)SMuk'ܥ./P0&gɾn\GT* y px^ެ0i״RhЖT FKaЮ }?A4bdHd^\iB&;/nmGR`p݂$yQ:}A,$+.X_+HOp]Ⱦ[22ĈMEQРSmOD:V?4X"\tmE }aM@G9,)&+,b2><^ԌCު@Ih'0ګ*2"˷MMv{  ^@9})f^ZN^ſDb7۱S_ h-B0DYE8aܣ$v}kM0pVvC6dK:K hʀV|SNtuJ&*ؕZtlz%=mT=:iW3.5=? 0'U6U4!܆!\,Qeh?r5 #Z~9obx;+Eûqw,Yz=;"Й9aVeÚ֋pe߭X72~r*11}/۳ΏoOx>5оo-F,[uEF|'|,V2|raݮ]ʢ|bdoF9+tDbM)* 1K'Ch@q )]hR'3^YT;8M#}JrU[0NJ-ȊYsBi)JPDg7ݎ(Pف=]prٸqb"CPBQrB00ݝ}S*C|2,irޘ(_(챃~F1#wWmWq$R&X ,<~?|&TR::i4ȿ;rB#&E*=0L2^ԇTe% [/5l2H'iLUEK4oj]E3u!]95*&pfxc7|i r0PwR'=j_񄭧,YEF$gy k^rp37}̀P!.}>$%D߬|1Z#u "xf^6ܨ_%Lk4)х~>EX#y#$- eUΰ # MS[;6z'A,6y-ΰl g$#"cd(.}WUw6Qv`21Kq,{>d*.9õd#-j̜r#48Cib2""pA=ցm.̮_;}%lc\#JEX놲7}Ŏ-132]Q&: Աу Bs\$;2R&Rˏ,9LQZPD|CฤbYbҐ>(Tpܮ-˾Gew}_vTd| y> cQJ m 2~+6UP]>OJ/0q]iix +c.9A/|0 f ɪ#X{-&:4 OY ÷Di4av\Q*k/> p {"RaN £Zb膛CNXܥq=X @l(&_=m*qG3ahi-OڤiTY/P83nx:S(4%uKO Z*(cw/T^SL ?HĶcZ% Oҕ 皔twrm}S;xb몤 49'ʂ uƽ~X1x-1. v"JtހXj. f0\nCZkRå0O"|lޔ34- *63Eפf}SQp熗Ղֺ _=y%VF'/Ҟp~Ba@>y>0Mir YѹyX_jP'T9$,+ލ}]7,t8Bm_OAOݑ$' TdjdZu =72,N ssqTD7SN v;$B<g4Kx컁H8y8-9 3C3S`+9aFѬȿ*dMƬXr'9 Lˏz¹ m( +hV#IJz}bD眹cLH^sƞtV켇k8FxΗDifb%e^d}i&1YzPU+<ʹ@?jpSuNNHn.'JQ**gZSB'~ǙQڌT"/PrߩrXaq_݂+Y:.#5'0v2ZP!@>n{7Vcƴ] blYzdmlu¹ɥ m-ɆBjބlLj/?J5{A'k8 Db-&CLA,Υ+bCg7Ɇ&BzG F1_]s.IV@a+58!l_+mcGH+h^{ͨ~Ms}XQjT.9 F|5o{iofid=S>™L7z,N':$WgPr$#ayArVz6y\73@R!GuܽNjMne*)ǒw\ld:=phJ}ENό9=椯AQ{BZͰj7LSܭ o:G1 $Hv!'^Ů"'%TX RHYjNJlqN?@&a ѓeF]@Zw̅cr5%8OhM"ZKpl1_Y&O8O6lI'9aZo֖$ f-jp5oô뜹`SXO<v◰ހc"~ll;D3[:+ 桏'NBx1%$8͐|x^iM\:YP*6DXv"ȱn rK4s;b*AA0 g>ym:h?̯1WU0וcr{J(ّHki1G93哀Y,,]#FwiCռuBSFq/=g RzqdĖJДVs,wJ7Ո[=c^+UkQ&LbWfIˊ0`K"]MLڹЕn7A&）f#cKk3!._ِ; "3))ĩϒ6RRQb(pH218}%[y6?G~4O1J3X93Ո,uvEaw~!%;9fxAb XʕI"Тm:KEZzg @eJ`R*~n2%n z8??`N  l\b]S)4u/iL[lH xLgZ-a HٸŤ/PA |/VwB5W쯮FjX!~a>ee*Vz'pp/FQ`q: quaCF )DEӎ}?xywBt֫fVGG@Ʒ=IX1 YXcsZRrˬ#D=ͧ>k:uGi.5Zvjd6m;jE2+ٹڜpG dl^5#QnхFH xa3(ɇ1sr&8c5> kvɂ~xUH8>S&NB,v:w^L.8|^t=\zmm_*^FPvzչ 2TRqX>7^0g>ȷFY-Vbxk"nJQ~8 ʃSTt1/vh8e) ZQrau2^8I\Zu~nFp}Dtdhr=Ezi '6?k6F@Ĕ~^gRk(1 Y0]ѩ/(Op[6~xl8QK2{GW8%(9;̰C\W6x'j%-p"\/mmΞOlY{:B.,~@O|@&T=Dz?^`&֦A#$fk!6،^|3[=҆kLC~L4z1bSOz= `?>g̡TI35AU8h44dGbL/ )+J$GC5EF#M܁¾-*=2G+R& 4m/?SvX7 WQ6O-u܌Q"dz惴މXE`1XtR/kp|JtQ^[0&wLe)0m 2O'';sY!`?׋C޴]͕E5H2 Vn}- JN^TZ!B>ߢ;cD|[ޖ Ns+eGu%s&迄}`MZcCIP2ZaK; x D߬ #B I+%],̵yd2"i!xB9O\~ie-+[سw0ˣҕZ)&IT[7%҈J]! #o+*deT$!Y5#~X,ׁ8U ![ 2 $`Q ٴ9Ov{V]\ƚі_&ϨqR67JpETط=2CS񒰯6y#oM.BM83 -bm}خffNv1@{ MKXvu_93sVY%6+L8CNeFxђ7ނ3-M&vbdfṢN.Nzqp,[ ILfUGlG˃+L3XiްCrB?w%=LcQg5D*/;I sTU c֩F]>}U=O,L_`Rz{SdMSo#v'Y 3lLWov2 i!m2Ufr+pa(VLݳ6O1$a ~:Xz@|m8(BCʘ PX#ெ(V1g *Y㤞UCQ'+q #$ZUQPMZL}٧UstY/L-}ﵲTZԀ$ Ya1xo.U:0@%ZާZ=j1da|^+Xz14UhصUށ[چ^M *% S衠5cر(*n}A`hLӄۥ2spkVҸ6_wEX t_Yx 3"s~AWt. p\E|rUtLk/G~Cp+\ a/xƶ3ۮ%T 6}qM݄o1ρR:>jÍF sx5k&dsG ~ɎMV͌ƒ\z><2s5x|ub>>'=/.$N=͜WS>Mwb{őw#֍zʄ@sm\T,q$l;57Jd],|c qFYwjnĿ1+J6w)~W5+rS#m(_)759dž:ӿPRnnS 0y28 L9#;82C򏢓l7eQ%tHn(6} xI(($n=zl+PL@W_v9q<4}->~K%,18 'rpj+Ē[[h#zй',Y fCȭ{RvR@_N$J6ֿ+:@l[~Ixr)1 L5a3^yn夈.ʄ ]gޗ{oSN]uB~CW1#%1uIMݱ?}Vs  R AL5:Sѧ!|al%ޘ4^ T B+Z{bHtj-k,%VFsL=1bm?Ty".8J-Hxs@f5 ڄf!$?A{#r{.SLw_ SdN6OVgq|eڭR ?]N}P/*ג*jm~AAqLʅ'ٲDW -mOW@k<;Y1E Zt˂O+~pHte|afYkdv nakx /cxa'h,cw700@2kű>oN蟘tdȱ 缡;ӯfH&AW"[H{A JV(2お|w}MiJ|8`#eL\pK*<̳6=x7Lq~RlŴA.pAƝ;5n#[[BSps.OHя?Zη1TDڋ.4(DҳFBp<)2?>kYG3ޯ4S)ܙ`A z}m-߄Hqi(^ U?(TѨc-BOa ͎t6T.\{Z81R%z3z?L V[gqQ>uVմbOb>4*gic׿}H:S;/G=\ɉWMY1V 3w( =RkPX:0 _}J|ݭ/UBÒl )><>H -c}9]Jn+LhyKUl-b3+ Q4R:d![XUh̓Z竄/`P*d#͆hᦐh!Y"[A1n 5(Vzm<%VZom[߄] e ~7K9dYeiJ%Vؼ#O3\aB=R :NAyPma 01!mޫg ŪP5ײF|.:33]6քeu?D0z5nLBCﯝ_S:@ -5Bke`ө dGl1 %IW;"!*rY jwB !+P~G2|JOt{?/0mbve9wGO_=ni!s/~ bؾ׵$h(}pꙩ FwM{-fKXtc @@=N*o2W .8*P-j΄Jz~oe{ENQa\/#Ҁ gH~#`o~ښQH6=g D&&p@NDW)JvJ_~]L ȦAJ1p ݼV'\Ԑ㔄fVهO=7n>=e?%Į]. I~e ֥$wqlp"<} {px`q)a0Hu?ҏHjdRΗkMB>ˌ^ mGwQVC\@&k{G y- `#q|EXս?.'¢eo&n5 HTZF@ʑučfɅbR^_hw۳-8B3x++ogGɆ© A 3BT7 A9Pv)Ó_;(I$>Z:{24 V qز17V҄b C`%1Vo؛ήFKLH,>.=8<~lUp cHiA pfLI`7k 0>Ft)|gh>.s YIآA CVM#O*\tw)˯YW/0r0'Y("C&Ͻkk icI]-j+v,ձ<Σ2ۚ+uj#@Л =1l ; sћ SN2Lzx=P$-ǽf}C\lVQ˅nF5JٔI T}G!2+ '/ψtRFg}._>*ٶ;:mM~<_2T qӣ|-ǔ?@1XB(փYI˟ڄs;h`ٶ=iac\6`t4YT}s8Ñ{WH Z o;iޅ67-sp8q7l,GNv!v<ȣn*#:[[GQ c&Co)4‘ * 'QVH0R=E{X ԄfDH\B鐾C>Sz;YӒ6\D >ztqYqs90.\)q{ XaV ̭-LTY/:]S^cLN3cf5r xa}T[9]'.cl$!3mmXs,&8W `UCp8ߡ@gu &#\>pK&ԕbw({?jO &TDPm2lGf3STu (OR5N))6gFE!-i^HrO-35-w Sl?)u {+1SpZ#Peض;1XGú @^[^"p J-VgM6.P wܠ?PjKD?ۥQm}Acnj(`G.%6 1FV\[W>p00<|t897TUä$b99vK~) =7;ZJ=F;W{(uT,+rcr H?zV-? 1-'=i_g.ZۥJQA=e6<5?Z΄E;(Ff,nۅC5D*$]-L._Q{_{ MM.2~YA}6Uu?S{)Xq9ݎxR^1k3{uG?g~ :Ș%/~'AuL47~f%>>^J4#;@:4cT(ck(d|I5{'~7'j$Wbcf5hSd:z1)9 K'xf7$I *7}Ph:pf2dVԬ nr :@{i0ZZKpj8a\QXBw+Ceg!A`:7u| sY&1F}W]([! >1EiS0ׅI'tˇ;=&w**ay~+zXބ~0ӃLH:XDxSzv }ȓGl7]7=Y*u:kŠ HmRzh) %-.hB0!u+e*30. a(hq酮!>4fI[BAG>;G*!Y`%92Mf3ʼ%6\If,Vɋ4F0M2~@p bF:sԨ$ð2Ֆ![7{_ } G>;O_Rˢj2 "n@Ԇ`e4?FQvN~ڃءHֈrX&O0ơ'<l%S5\Y݅ z2U r"iA UY6[ErʵAv $1Xuw-ukFu2l;otaz@t%)_  &KUls(//΢7pܔA@<y6E4?D{QL_`悩TL&͑4^k|_1<$GIRuZeee&)07ޠd!Q^f:R5NljϬb&}>s#HD/;HkN"@e;Sԑ쿪&]]ܭO.??dI 6@['8LM40Qi"FxPAΨ.yAu[7[Qԗ\YO}':O2O4e}Q9чƏ\0X4䂟<\dD:%z8+A*Z  > @> `> > > > > ?  ? @? `? ? ? ? ? @  @ @@ `@ @ @ @ @ A  A @A `A A A A A B  B @B `B B B B B C  C @C `C C C C C D  D @D `D D D D D E  E @E `E E E E E F  F @F `F F F F F G  G @G `G G G G G H  H @H `H H H H H I  I @I `I I I I I J  J @J `J J J J J K  K @K `K K K K K L  L @L `L ʳʳʳʳʳH˳@ h˳˳˳˳j   `& & ̳& & & L  ' @` `̳³ ' @'  L L L  γγ@@@@@³ <@гггг@t `u v @M +( %%| | | |( |0 |8 |@ BMĬ0_|/c9(&(&|` |h |p x ı26| P#|  | | | | | |( *s |8 |H |P |X @@b )_dMᣰM N, | (,| 瀰@X `A0  (  @  H  P  X  `  h  5@YR/įc1nN8H8WG| | Htx||Ȼ |л |ػ | ?ǯVnN| VR| 20@| |8 @ǯ| | | | | | @| 脯 LQ Ϭv+햰|Ⱦ |о |ؾ | | | | | | | | | |( |0 |8 |@ |H p |P |X |` |h |p |x | | | @| | | | | | |ȿ |п |ؿ | @| | | | |0 |8 |@ |H |P @q |X |` |h |p |x | | | | | | |  | | @| 䦱/t Scݰ!G̰ d h*ݰ!#ׯu`JD#'$໱1t"q3u.? Dv+;#dD0"85u@8fv+.16g3@"1 x 33ݰ! $EƱ2ݰ!<'-wƱ2,z5ް!"#g6w+M7Pu "| ߰!dv| _#| |8 |@ |H |P +W;s|p |x | 5M6TF| ɳɳɳɳ| | | ݑ-Lja| %| 騱/dud|( |0 1#|H |P y!|` 5@| | | | | |( |0 |8 |@ |H |P |X |` |h |p |x | | T0-0&,}g:6O˯ l*Q6m JE#!"%&"%6 | | `@| #͔ | ٔ ( 0 8 @ H ɼEؼS |x | | | | Ư֯| ,| ;| | | | g?'&?'| |` |h |p |x | | | | | | 'Ѱ "a/0u7;E-c $(,| | | | j #t^) |8 |@ |H |P ( @|X _ïn4 | | | | | 7NG _)3h| | Xh| O| ۯ|  | |( ' |8 7|` |h |p |x '3b8#۲0Ȳ+|    ( 0 8 @ H  P X ` h p x  0(B]爯 ۯT`k ik fDw Y| | | {+, 9l"| |   @| | | ##}+@ @( |( ύ|P |X |` |h /1| | | <K5&үF| ^| | ίb8| | '#| | | | | | | | | | | | | | | | | | T0-0&,}g:6O˯ l*Q6m J#!"%&"%6<+|( |8 騱/LK@|P 4L@ @|x  @L!| p*| ˴k@p @ @ @ TX\| | #R@\R@R@K@L@   P1 $p   `` +``@`@@@@@@@@@@@@@@@`@@`@ll@@@@@@@@@``@@@@@`զզզ_  p:::::;03? P30;P;p;+@ @@ @ ;p3 ;33++p1;111@ A @A A A B @B B B J ;@J J `p ,, ,0,@,P,`,p,,C @C C <``@`@r  `  0@,  n@ \ AA@$ ,Q33x+ @k !!ӯTAC mM ==rpp>`  a f  @g  M g  ``u`u`uu`ޤ@  ``` @@ ```    @( 3 _ $  U  -` 33@%  wK(+ @x xࢡ    v`@``w``v b  @`w`w  @_ D (8M ``w`w   02զզզզզզզզ @`զզզզզզX  H p---------@n @Ŭ@Ŭ@Ŭ@Ŭ@Ŭ@Ŭ@Ŭ@Ŭ@Ŭ  $ HHXXIJo  33``x@.h@d  ` ` ` ` `` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `  ` m ```@פ@פP>@@@צ@@ b M V `{V `{>             `ѩ```  b0 N Q//@I J w  @Q// e  N9 @ P `  z222.9 ?9...@?.`?9 f   ``  N h  `@`x   `' `k¡@`ު``@5YY f23 0/` @v``v`Lౡ555555555555555555555555@@``5@`e@`/``k@ġ@ġ`e`¡`e`e`e@ġ*%%¡á á`á```@ġ¡@ġá@ġ á@ġ¡@ġá@ k@@`N @))5%@5 _]]¡ ` N `h  š  P³ T³ P³``` [S```@`ݬAׯ` ॡ` `ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`ૡ@`t'ͳ ͳ ͳ```ມ`@    ϳϳϳϳϳϳϳϳ` x``````````````@,p <'`*`á``šp³`ਡ˦``ਡ˦``ਡ˦``ਡv`³óPԿ̿OT( ӯ?į$t ba,3 E Oį]J?Q пc .t ] Tk6c > 8t tܿy?Ŀ_įؿAȿųųų\Ƴ`Ƴdzdzdzdz8dzdzȳȳȳȳȳȳȳȳh $  g (g 0g g x Hx UU&g Rx 5_0_ǯ``ॡPɳ2 3 @4 4 5 ʳʳX˳\˳`˳0̳γ` `ު@5 ϳ`ϳp  jϳг```ггѳֳTҳԳԳ\ճ`ֳҳӳԳ\ճֳPҳԳԳTճXֳѳӳԳTճճHѳTӳ`ճճDѳPӳ@ճճ8ѳPӳ@ճճѳӳ`ճճѳӳ@ճճѳӳ@ճֳ$ҳӳ`ճ|ֳ ҳӳ@ճpֳҳӳ@ճ׳ҳPԳ`ճ ׳ҳLԳ@ճ׳ҳLԳ@ճh׳ ӳԳ`ճd׳ӳԳ@ճX׳ӳԳ@ճֳDҳԳ`ճֳ@ҳԳ@ճֳ4ҳԳ@ճ0׳ҳdԳ`ճ,׳ҳ`Գ@ճ ׳ҳ`Գ@ճ׳@ӳԳ`ճ׳<ӳԳ@ճx׳0ӳԳ@ճֳtҳ(Գ`ճֳpҳ$Գ@ճֳdҳ$Գ@ճֳѳӳ`ճ ֳѳӳ@ճֳѳӳ@ճPֳѳӳ`ճLֳѳӳ@ճ@ֳѳӳ@ճֳҳ<Գ`ճֳҳ8Գ@ճֳҳ8Գ@ճ0ֳѳӳ`ճ,ֳѳӳ@ճ ֳѳӳ@ճճѳӳ`ճճѳӳ@ճճxѳӳ@ճH׳ҳԳ`ճH׳ӳԳ`ճD׳ҳ|Գ@ճճhѳtӳԳճ`ѳlӳԳ`*@ġ׳`  >ݍ Rb > *r ޶+y SSI 8c c t  O`@ ǯtasCu ݬAׯ دy ɳɳɳɳɳɳɳɳʳɳɳɳl˳t˳p˳ ! Ƚqگ@8̳4̳<̳k z G1wl PPPy P+Pճ,ѳDӳԳճ0ѳDӳԳճ<ѳHӳԳճ@ѳLӳԳճ4ѳLӳԳdֳҳӳ ճhֳ ҳӳ$ճtֳҳӳ(ճxֳҳӳ,ճlֳҳӳ,ճֳҳ@Գ ճֳҳ@Գ$ճ׳ҳDԳ(ճ׳ҳHԳ,ճֳҳHԳ,ճL׳ӳԳtճP׳ӳԳxճ\׳ӳԳ|ճ`׳ӳԳճT׳ ӳԳճֳ(ҳӳ0ճֳ,ҳӳ4ճֳ8ҳӳ8ճֳ<ҳӳ<ճֳ0ҳӳ<ճ׳ҳTԳ0ճ׳ҳTԳ4ճ$׳ҳXԳ8ճ(׳ҳ\Գ<ճ׳ҳ\Գ<ճl׳$ӳԳճp׳(ӳԳճ|׳4ӳԳճ׳8ӳԳճt׳,ӳԳճֳXҳԳ ճֳ\ҳԳ$ճֳhҳԳ(ճֳlҳ Գ,ճֳ`ҳ Գ,ճճѳӳtճճѳӳxճֳѳӳ|ճֳѳӳճճѳӳճ4ֳѳӳճ8ֳѳӳճDֳѳӳճHֳѳӳ ճ<ֳѳӳ ճֳxҳ,Գ0ճֳ|ҳ,Գ4ճֳҳ0Գ8ճֳҳ4Գ<ճֳҳ4Գ<ճֳѳӳճֳѳӳճ$ֳѳӳճ(ֳѳӳճֳѳӳճճlѳxӳճճpѳxӳճճ|ѳ|ӳճճѳӳճճtѳӳճ4׳ҳhԳdճ4׳ҳԳdճ8׳ҳhԳhճ8׳ҳԳhճ<׳ҳlԳlճ<׳ҳpԳlճ@׳ҳtԳpճ@׳ҳxԳpճճLѳXӳԳճdѳpӳԳճPѳ\ӳԳճTѳ`ӳԳճXѳdӳԳճ\ѳhӳԳ``¡á`!!@@ `X X BB84@ /gg@c VV`11`zz ))`s))i 7Kmm@((@uubb<<p=@}}BBEEq%% @KOk@++ss44 =@W g=D qq@33i@@HH Z 04`h `++ Y cc`CCEHP=@@E@E@!fP4@p4!X(!@48![@@O/@E`H!hX!h!@x!@4@44/@! RRRR0@O@@T@!K5@!05!@_@!@T@!@!@!@o OPpT@"@@lmF \@Y@`U b \@P5x@@F@S "@P@p5a`b @5@500@5[ K\@F("@`@56@06@P6W n@UP0=@F@@]8"@H"@p6@X"@h"Lx"@6@G@]@"p0@6@@G@"@G@6>"@G@U0@6@"@H7@07"@P7@P@@H@p7@"@"@7@"@#@#@(#^@7@7@U@8#@H#@7@HX#h#x##@#@#@8@HY #@#@08@##P8#0$0>$@p8^8@8@P`[ ($@L0@8@8$@8@a@9@09@IH$@X$L@ll`c S mmc h$x$$` ==h'0@ ==``eө`kөԳԳԳ`@ `@s %ec Ba x x x x 潯8'i>°]°?ZZH L׳׳׳׳׳׳׳׳`@ `@5`@kөd5>°]°?ZZ l³T³ h³T³/l³L³+h³L³0 l³ L³, h³L³' l³\³|³l³\³x³# h³\³|³ h³\³x³ l³\³x³ h³\³x³³L³ ³ L³< ³\³|³/³\³x³5 ³\³x³l³X³x³ ³X³x³³`³x³l³`³x³h³`³x³R66R66S66 8 /3'C7S++ x   x  *x  (4x   g   >x @D$$D$$~ ͳͳ ͳͳ/ͳͳ+ͳͳ0 ͳ ͳ, ͳͳ' ͳͳͳͳͳͳ# ͳͳͳ ͳͳͳ ͳͳͳ ͳͳͳͳͳ ͳ ͳ< ͳͳͳ/ͳͳͳ5 ͳͳͳͳͳͳ ͳͳͳͳͳͳͳͳͳͳͳͳ>ȳȳȳȳȳȳȳȳȳȳ:>ǯ-w w ǯAׯ@,{ w ̯bدsA`k%``eөөdD"Gư -۷1#ӯ!Nb cS Wb >101c-i-p@g CUo-KU@@.ܶܶǰ ǰ Ȱ 'Ȱ Uزy:` @Y+&.0ذ!/212"T"MrOw ǯw 5@Aׯ@py kk *?80;@:#T>X?_?>e 8c 2@Uw U] 6-$ i yKYYD +/ j 0ϳ8ϳ ,ϳ4ϳCHϳXϳ4<ϳLϳ2@ϳPϳ= DϳTϳN  O `O O O  P `P P P  Q `Q Q Q  R `R R R  S `S S S  T X X  Y `Y Y Y  Z `Z Z Z  [ `[ [ [  \ `\ \ \  ] `] ] ] jE ? k ZqEZk J _ͯUUUUUU?< ,+w@SUu-(g ~@[UcUzw --z閯 | K s,Y k z閯 | K s,Y k ȳȳȳȳȳ Tг(гг г$г<г0г4г8гггг г,г@гtгtгtгtгtггггггг`г`гLгLгг T      @ `        @ `        @ `        @ `   C? tӯN_3ӯt  t .oI f?m?g,Uԯ/c u W_8c lp< S.6=...>>+@=...B>>i z a @>+.@=...B>>i z a @>+. Tdkʚ;2#   (E- g +b@+UDBK-g " 8 w @Uّ T 5呯 /ǯi@b j2/2\B@   0<P<p<<<<P9I  p9 < = 0=| M{°sj<'TJlJC_Z Yk[A1* [ [a u5+ R9;+ v|3<da I_) ѯ>5 ӯQ?.i .&c g,ӯ䜯 oįu /c NBt pӯ3 ԯį8c Lt & ԯįAc <  R Fį   0 @ P ` p           `U    U U  V @ `    `V   V V  W `W W W @   X @ `        @ ` @U,S'?8G*厯 息  /49s b .?>5?b S C*rŌ $^=a @_F !+g,.=_ a?-T@[@Tf v v     6ƯS֯d֯Z+ > 4   x" 1 A A Q a a 4s / K W  )Hʰ ܰ!ܰ!t"]## $%,&,&;'J(J(X)^g*g*>+S+Sr r r   ! . 3Sr  r  =  I  U >x BABA--K IAIAPAPAPAPAPAPAPA% = +,yQ-J W Kȯo̯w̯d ?0f#.AYۯq Y^~ "Yɕ q !DD ;+r{ Xbد6{ ̯x BABA--K IAIAPAPAPAPAPAPAPA% = +,yQ-J W Kȯo̯w̯d ?0f#.AYۯq Y^~ "Yɕ q !DD ;+r{ Xbد6{ ̯į"ԯ oYm,GȰ 3ԯ.,@;Yذ!+;v" /_h Dԯٰ!gȰ wo7ٰ!Jc Sc \c ec nc wc c c c c c c c c c c c c c c c d d d "d +d 4d =d Fd Od Xd ad jd sd |d d d d d d d d d d d d d d d e  e e e 'e 0e 9e Be Ke Te ]e fe oe xe e e e e e Vt `t jt tt ~t t t t t t t t t t t t t u  u u u (u 2u (w EuE"FJ <5z} V|m m YE0F \;+ԅL\V6{ } ˯/OvVӯ/D ?į/D/z 6D=Da / / //V唯 YF Yz Y YǯYYVu YVtYV #Y缯 oqگoy p+pSSpT/DV j ! j y z ,  z V>z V z Rz b z V>z Vݍ z VA/DدDDگ8z 8*z 7 Vr 7 7 7 ޶7 B 1*QE1lCQ"֯Q~˰ "֯ 1 \QūƯtdGӫ᫯1 﫯" '˰ bOsA Agb uQƯ5b- #UH js\w֯: AƯTG s- %Ob"G-& $g/%M1Aܰ!v+'eƯ""Q2˕'K("c##G˰ BQ;' #,Bs蕰pǯ֯֯-"͑ ǯQ֯r֯ibsw %.text.noptrdata.data.bss.noptrbss.go.fuzzcntrs.go.buildinfo.go.fipsinfo.MIPS.abiflags.gnu.attributes.note.gnu.build-id.note.go.buildid.elfdata.rodata.typelink.itablink.gosymtab.gopclntab.shstrtab