ELFć 4P4 (444xxxdd,s,sss=>>  Qtdp```,cYJ4 _o`JJJw  T 5>=C > =T >=!x DCR4  E D FE  o$xxdEP*p`` SGoViUQy6uVITRMWfXZRXAy/MzydkysLaT4SYRwGUe15/M3xc93tXyCUux77Pgj5z/HPDahxzNqppUKyKCt9mQGNUC944U,]߄+= %w ' < !$$ 4 7  4  <1!$$ 4   4  < !$$ 4   4 '+= %w '$+ <T!$ >  += %w '"B0@%% 'B$D$! $0Ep608 , 8!0!b%% c$!0C$!8@ep0H  - H! $0$!A%#+$  '> >   += %w 'h <* w$p <*(5'>'!$ !$+'4'!$ !$%%5'!8F$%(B$e0` F, C,`5'!0CŠ%(%0+'!H$%8'$0! , ,! "+'!H'$!H!H$)%tJ5t%HDTHLu`J5?Py 4 < K!$$  G<@4 "4 d  %"! $% a$a` $a0'+= %w ' i "#%bd@" @%8'8$ <6$ <6$8w% X@K%D%n-!h$ $8j`dh$' <)5%P@@D4X<#X$X#`$`+h#h 'hk% Xkq% `q $#X#`$`!XlX H+p!$!"B1@!T VŽl @ d4"HCp8#!CXB$<!!C!0 BTpt$x\'ptx\'+= %w '\ded9$8'$'!$ !$*(''!$7W!$B$8<$K-!X8<04!PD!8g+ D! G%,! ($8G,0$ D4'('<'!$7W!$B$`0 p g! 0 <)5'LP8'qP!8GTL&PK& <6!8W<6!X<6+`!Xl' $ d'P@$8<6$8<6$ 'TQY'X`$Xg>%8'8$ <6$ <6$8w% U@K%D%n-!h$ $8j\`d$' <)5%P@@D4T<#X$Xg#`$`+h#h 'hk% Xkq% `q $#X#`$`!XlX H+p!$!"B1@! VŽh @ `4"HCp8#!CTB$<!!C!0 Bl$pX'lpX'+= %w 'xde9$8','!$ !$ %%.% 0'%8'!$7W!$B$@DL%+h!hm@D8<!`L!Xm+P!Pj%l-!PL0$X48$PL<'0'D'!$7W!$B$A%%pT |0 p g! 0 <)5'\XP'qX!PKl\&X& D<6!Pw<6!`<6+hW!`'X`$PK' $ <6$PW<6$ >l<6$PW<6$Xw%`j#` $Xl#` $`L+P #P 'P@% `qk% Xkq $#`#X$PK!PLP !XDkk9l`| %% xHl%L%-!p$ $PpTx|,' <)5%X`LH4l<#p$p#x $xO+ #'% pq% xq $#p.$p#x/!ppXnqk%!Xl1kh 6 |<"B0 @ !h  |4"Cp8#!blB$<!!b!0 B$t' la!$a% Pa  [{ Px|af 4Apl!$<!$0d  G<@ddC  !#A|   |4"Pbp8$!lB$<%!0`$! G<@``C  !#AP%l!a#x#c$##c$##$c$#c,!d#$t' t'+= %w 'LddeT9$8'$'!$ !$P*(''!$7W!$B$8<$*-!P8<04!H%!8G+(%!('%,!(($8',0$(4'('<'!$7W!$B$0(p g!(D<6$8<6$H7%P'@4<#@$@#P $HI+8#8'8% @q)% H)q $#HI$8#@H!88@'p!$!B0@G<@X"  X%"%  X  LPT@4'p8!"D!$<!A0@G<@\"  \$"$ $\  LT@a!$aa!$aD0!'"H'<T!$%8'8$ <6$ <6$8w% @K%D%n-!h$8K$ dhp$' <)5%P@@D4\<#X$X#`$`+h#h 'hk% Xkq% `q $#`#X$Xm!XX H+p!$!"TB1@"%X 6t d"B$"lCDc$C$c,!Ch<Cc0`G<`TTd  $`  CdX4 dh4CHdp8E!e\c$<F!e0 G<@b  "`$A4 dH\CE19'8$8g%f'`$<6$w<6$(% `!D$D"B$"!D$"+!8x`'x`'+= %w 'pd%0$ p$$g# g# $ p0+ @DHLt%%l'!$&,!f&8+@F,i+P!J9$8%8BX\00p g!0hnjƌ'8'0<6$0<6$8%hnjƌAI'H $H'>%8'8$0<6$87<6$0%0B1>%0B)i,b0@'!0Ȍ)0 $H*%@(Ȭ@' $%%%('$+P!B%&8,+@F+P!J9$8%8eB9F%8BA,8@'!8*08G008p j!8猀<6$8<6$PWBXBP g%PUU%8!8+P!Pj\ !XKdT %PL!PG+8G!8g!8G0!( $0pg*0%% l'&$+@!%f&8+0F,h+@9$8%0#B1>%0B)M,F0@'!0ƌ(00000p h!0dȌƌ<6$0<6$@(l' %$+-!Pjd#`$` #h$h+p#p'p% `q% hq $#`#h$h!`` !Xl $lkk%k$0$@ %H %$5  %$n  %$5  %(%$n  %\pPT%@$$,!@(4h<#`$`#h$h+p#p'p% `q% hq $#`#h$h!`` H,q)%$0T$(P!8*h1` 6  \pXtt,6xB` pCD $#%('$'!$ !$\Xt6%$5  %$n  %(('%8'!$7W!$B$8< %-!hM8<04!`!P+@!@H%L-!@ ($P,0$@ 4'('<'!$7W!$B$%%&H&P%HIe 0Hp J!HI*)<6$PW<6$H7%HI NBQ%H*B)(-@ @'!@  0 $8%8@' $% $5  % $n  += %w ' "%g`$+ B$ $pD0+R`# `#D0&`'$% %( <4ǬǬ$+@!(% &&8+0,(+@9$8%0"0f0p '!0njȌ'8'@<6$8<6$@%8(a4 $ "'<T!$  4 i / < "$# $&E&d%b@%! !64 !8%<@"4C dp8D!4$c$<B!B0@c4< 8!EB$!b0`B%8"<$B$8"B,!D<"G< @"$  &"# $&#8'G<@"#  "#  8'+= %w '"@C0$+ ` Ђ ' ' '+= %w 'L!P$ $!$t $#"!0$"0 !,8P$ $t 40  LP%(%0$+@!0%(g&@+8-i+H%)9$@ %8 (,08p h!8@%8T8 4h $LAH'$,@!H))1 4H'q*%<!PHl1J$8!H,)%!@(i1 D<,TB $" 84P<D>y 4 LP(,$+= %w 'H<CB@ t <"@(@% %(-DDe# 0$( , (% ì$*0f!0 G0!0G<nj  #'$"8'$+8!(% &&8+0,(+@9$8%0 $0F0p '!00%0$,0!@14H@q %<J!H'K1`)8K!@ %!8H14,,VDB (@,4>y <@( $+= %w '%('($(%<6$8W<6$(%(.%O%-!x$`$P%pL4Ό#x $xO# $+ #' & r% xq $#P#xO$x!xxpq%!pύ&x8!XH'G%('($(%<6$8W<6$(%(0%O%-!x$`$P%pL4Ό#x $x# $P+ #' % xq& r $#xO#P$!xxpq%!pύ&x8!X$\H'G%('($(%<6$8W<6$(%(0%P%-!$`$P %xL4ό# $P# $,+ #'@1& 1r& r $#q#p$!0€xq%!x&&%0%`L'G%('($(%<6$(<6$8W%(2%P%-!$`$P %xL4ό# $ # $,+ #'@& r1& 1r $#q#p$!0€xq%!x&&%0%`$dL'G%8'8$(<6$(<6$8%(G$$m-!`$8g$(%X`4ˌl#h$h#p$p+x#x'x% pq% hq $#h #p$p!hh Xmqk%!Xll&`LHL\a| Y  P`LtH,' <)5\!$p'G%8'8$(<6$(<6$8%(I$$m-!`$($8g%X`4ˌl#h$h#p$p+x#x'x% pq% hq $#h #p$p!hh Xmqk%!Xll&`L\LHa| Y  P`LtH,' <)5\!$$p'G%8'8$(<6$8w<6$(%(PPK%T%n-!h$8j$(Xht4' <)5%P@TP4l<ʌ#X$X#`$`+h#h 'h% `qk% Xkq $#X#`$`!XlX +p!$!"dB1@"% 6| t8"<!d!C!0 Bp'G%8'8$(<6$8w<6$(%(RPK%T%n-!h$8j$(Xht4' <)5%P@TP4l<ʌ#X$X#`$`+h#h 'hk% Xkq% `q $#`#X$Xm!XX +p!$!"dB1@"% 6| t8"<!d!C!0 B$p'G4% ,%?2% .%@% A*% B,% C.% DE:%(6FD%0<%(GB%0>%(H%0I:%0J<%0K>%0LMJ%8'FNT %@HL %8'OR %@HN %8'P%@(QJ %@(RL %@(SN %@(TUZ %HiV Vd %P\ %HiWb %P^ %HiX%PjYZ %PjZ\ %Pj[^ %Pj $(,8wb$0','!$7W!$B$0 3 8(` ` $$d4'+= %w 'wb$'8'!$7W!$B$ 3 (` ` $$d'+= %w '("C$(# B8@"#"#"#" #"#"#"#"#( "$(# 3   $$"(" B8@$$"'+= %w '','!$ !$a<%0'!0ǬŬ!$%(0"$4'!$7W!$B$a4 3 <(` ` $$d8' 0,'< $+0%(%8$ 0(!(+= %w '%8'ȬǬ$(B ($ 3 !0 A $$A(A !8 $$A,0'pa<\. G""@ ! (!G <"B$"#&C@ "B$"(m $L8' @$! @ "B$ "#&b@ "B$",m $LM<'H @,m LM<'0@   % C$$$$G<D  $,%  D&$% &, 0G<@&4'D)  !%$ &@%'($$ 4%DG<&  & (G< 'Ȍ(!  &'! ()&(G< &$(  &!' ( $(( ̕ ( 0@m$$Ǡ4*$$<$0!$, $ $ 0"(&CD@@DO 0(G<@"  " l bd+(*0,$(%(#A #+A#a$  0(%bG<D$4e  $%D 4`& $LM<'<ڂ!$$ ,"8@C`G< d,%F  $#% &`,#@ G<`,#0$  #$, 0 $C`Cwc$% $%0w%0f%@<c$48D 4'$X $LM<'+= %X '78!$m '+= %w '(4"@Ï&b @4  (!, c > ( "B$ "#&C@ "",7G<@ "  " !4 7G<@,D"  ,#"D#$%bbd% @" ,ab8B$O%+/0 $* @%H''!$ !$A% ' $ $ $<c4+b|`&<6&W@<WB$&A@X"!Lt^ H DLt^ L @ HDL @ 4 w)f%08&0&0f'(B%8(D%8(F%8@&8&8B$!$$+0D,B$!"$&2% &4% !%$DF2% F4% B%D & &$B0!0&Ɛ2% F$!0&Ɛ4% 0&&a&A&a&A&"'$G  "p+# % cp $##!C C(`% $C$(f,7!$$ {W '׀G$ , $ 8(8B$#( DBA+@#@$8 ,  B, %%!0!A!$ {W '7!$$ {W '+= %w '0"F<$F<F<B8@ "@$"<@b!$ G<@00 C  !# A$%DEG<  A  #! CA$&# <V!$   bbG<@b  !"a,7!$X "C@" CD% $(!  %C(`A$,!AX "+ b!!$,!$X "+ b !!A "#('%1  %1  %%1  += %w ' $'+= %w '" \ B   $'+= %w '%B,@<`B$!A F<`jB$!A!"0@'  <@[$!($+(%@(><`j$!(8`F<`R!$m 1 G<%!$"(@<!4!0Dd$p<d$0 f!&<dd%0+0 (,A,0' <B&D @Db $( "D$$A8 e $    W (Da8<,'+= %w 'Ïd$dÏ$dtd0G<4$+0 $%,>< i$!( $ %,><`j$!0@(40Ɣ',$!A!$"#8$8G$ 8p $#8 )#P $P*+X #X 'X`$8gJ% PJq#P !8G@(0@*!PK1,+Xl)`K%?m1m1&`%$h - h $#@`H , H ` - %I%M "$,+<"B$<"B1D'Gp '!G%( @%(   %(($,<@'   ,( $G<'' = ,( $#@&+(# ><&  ,($`a$$d!8 e $    W ,$@D0'$1  D$1  $5  $5  += %w 'Ïd$dÏ$dtd0G<<$&,>< i$!0Ɛ@8%80(,$!A!$"#@$@H% @q $#@( *#X $XK+` #` '`$@k% Xkq#X+!@h@ )0`+!X l1-+`)l%?11&h% %p - p %#H(hP " - P h (- %J%N "$-,<"B$<"b1D(Hp (!H%0$@%8  $<%80 @(4   4<%, @N $ "!b ",DC,Y`@><`jc$!bBG<` dd 4 = $(#$#(b%+e##`><!&# 04 (0 #d$$a8 e $     W (4DH8'%D$1  $1  $5  += %w 'Ïd$dÏ$dtd0G<4$$+0 $%,>< i$!( $ %,><`j$!0@(Ɣ%(0',$!A!$"#8$8G$ 8p $#8 )#P $P*+X #X 'X`$8gJ% PJq#P !8G@(0@*!PK1,+Xl)`K%?m1m1&`%$h - h $#@`H , ` H - %I%M "$,+<"B$<"B1D'Gp '!G%( @%(   %((@'$ ,  ,( $WG<8G  8('H D(!8 B$,G<'' = ,( $#@&+(# ><&  ,($`a$$d!8 e $    W ,$<@0'$1  D$1  $5  $5  += %w '"B$"$"t"@0BG<$4`d,$0 x $"<"G<@\"  "\ "D# (G<$$= ( #8+(#(><& $ ( $$8eē$į    W 8 @" @ ( Cc$C4`dtD0G<\%$ D!!a A#$C!8 e $(< @,'+= %w 'G<)  "0@$"0@$ "0@$$$G<C><`<\ ($ Z  :<Z 84 b  %%8484<Uc  <9c4!$*$ "C0G`D#$+3`BB0@ %!B$\!$!  #c0`# . c$(,0'$(,0'  $(,0'$(,0''>!!0  "B0@". B $( ' $( ''$( %0% %TI c$%!(+(e%! %%(% %+(/ %0%  . $( #0B1$!(+0G#0$0$@ , @ % $#0&@ , @'0$($ $,048<',048<'#$B$ Bp $#$$(!C,048<''$0!"4+(d,z+8F #'!A&&p!8#A$$7!$$W!" #'+@H! !!0  . 4,7+D`!%8+8<@D' 0 .  4,BA#a $Pi c, P# !0ƌ$f%%C$+`#Dc$$ d f, $ $# d c, '$#8<@D' C,$E ##$($+`#$c$ e e, $ $# d c, '$C 8<@D'8<@D'м 'PL%"T%c0`G<^`e,%F"B0@D"$+b@A" @    '"C8 ` !!$@$ @ !B!!A#$ "@D# !# ) 00$(!8BA!A#(!! $+0#$B$ , $ e,!$a %A B$ d c, $$b ' "B0@". W#!d8B%(%0O C,$D B$De( c#080!@1 $+P(@#('%H$0 $P , P 8  - #   !(i$$@ %8!c$e$ %b0 , $ ' !fc$e$ %b '8 ,8 8!e%!%+8d$("W!CCD*%&E4% ,%eE2% .%E% E*% E,% B%D'@'` #$"+= %w '"#% %(&0+( %$$8#@$0+(#('($ 0p$ 8p $#0$(#0!(% '$$W    "$## $ D#($e+#'@$ p $# c$ cp#$C!(D@8 @B$E0+(# '!EF0+0.$# &$H , H$#8@0 , @ 0 , %f%i #$(C$?e0e0&    # '# '<(!$$ += %w '  !$ $ U $  < <@[B$!A!@ [g F< %%^ (@< <"@B$" "$Cw$Wc$"C$#A8 e $$ F<SLB$DB!04$ap0!"(  s%,6@F<@%%^ %,&@8+ 8"@B$" "$Cw$Wc$"C$#A8 e $,"%<$&-`#% &(@$$w   ,$" #$?00 , 0 ?0 $#(08$0 ,  , 8%g%b "$&PH'<@[B$!A!F<`RB$ p    ' 'D$1  += %w 'F<!$ 9 Ž - '+= %w 'F< c$dG< B$A,($ #  ,(%>< !$ ,($ $$"   ,<!$ $H ,(G<` $$" (&"@ @,<!$ $H $'<`jB$!A!!$!0Uc F x<|$! Ġ!$#(`WG<M  ,-LG<N  -.M(m2j@ ? G<@@@C  !#A,X8(< L$$9@`WG<L  +,K$Gd0 Dc$+`Bc0`!$|&#`H d,H08b@"02 8 04$$$!($D&0q08T 0%0$$C f0%0:f0$+8$+8 8,f$*8&(f$$8$f$0f$$+8 8@f$$f$8$f$80f$ f$ g&0{8x(x% $ ? H@Dc "0%% 04$$$ %@0!00! $+0HF#0$&#H!%  %G<@B$!A$d!$"(@$F<`&(b*b+,$#%"%4 '4 '!8 F<(!$ $B ><$!$ $B &F HLG< c$$ x$ P ^% P$G $G<$!$ C d"C$#A8 e $P <0!$ Fg!$ $ ( <$!$ C G<!8 F<$!$ $B $F<$!$ C " $(F' Mx 0 0 4 !$B$C(/`#$E8E8 <!$$ 4 @ !$$ - <$!$ C ><(!$ C "C$#A8 e $'%0!8!@+H!( $!$%D&( <`jB$!A! $ += %w 'F<!$ D9 $ A$$><!$ D9 $D - $4 <!$$ 4    4 D B!C0`$l9  !$$><!$ $9 'м '+" %w xx'#"B&^(@C`B@'@G<`Ï  #`<$dhld'$#+"%'"$G<$$0!G<خ!$X , 8G<@PB$!AB@%$ $gbWp X'|'!$ !$AbdX\(b@(a$$><!$ X'9 ('T'!$ !$A('$  P8 ' PaTa <΄!$ $  <_-!$$  <=!$$   4 <!$ X'9 C`A$$><!$ X'9 B@'$><!$ X'9 ! X' [ px \ |X'[ @X#C|0%`b@% d% ?<$3"p k p d l h 'f0,<+8  e&(&B&D$, b$!A"#B$"B,!b"P'D$1  Da b!"#$+(04 &8 $,#$!A# !$ i '4 "#D! $+!C" ' '$1  $5   <Ԫ!$$ $U <ڄ!$ $ (U "D"$ "?!$0  4(0B1+@d $P&q#jB)!@(%q# <(\4(!0H!@ ` $ p!d+ ! BB!fC+f!dCA$( \L $#K '+= %w 't7"$#$T#$P#$l#$h#$d#$`#$\h!$X X T X P X l X h X d X ` X \ X xtA|AXX  tXa\bUc   ?<\ LH ?<Z c ,0c L H]  <Z D@33<33c4ӿ<33c4 b  $D@33<33!4 ?<33!4b  t` `0,G,0c L Hb  ,a$0c$$,!0,0,c LH<&7Z LHUc  LH ] ta b0,G 4 BB!+0@!0d$@p p# $#8h`$@p!8B8(B)<(\4 ! !(8!0+8+!!$4@Dp@!DD,4<+0$ %<& "+0"+8e,$ % # e#"+d##&"+0"+8c,$%f`%%(T#& b+0C,!+8$ % %%X\P'T"!X\P'+= %w 'DH  Dde&0+8+@D,8$0%0&@+H+P-$@H%@(%0%8%@%0% %8%(#@'#HF+P(#H*Q N A%@ - $ <8H*q8!Hi<!`g!H&+X!Hi&X+h+pk-$X%X`%H%`=$<8 p8! <!8! +(@<+0+@J,$0! %( J5IHBI d $`iq#@ +`  ! !  p! B((B)!0(p# <(\4(!(8!0`$ p! +8!0B  B!! !D+8D+ ! !d!$&(d+0d,'+@G$(%(% %8H"$#$L#$H!$D IX LX $ 0HX T "$! , ?<\  ?<] @8Tx"|!$!C0!$+C!# !b,!$+b!Ad @8\  d D IX P'+= %w '<!$$ղ  #8`Coc8`Cfc8 `Cfc8`$'Y &CB,B0 @@'d$'+= %w '$7,*B,B0!$X  %d`(, X 04 '+= %w '""<\!$ G<@d  !$a7G< $(%  $#%!F<F` Fn "` W?A$F<S$%0L8'4F$&0",LF<%(%0 ^ $L%(%0,,dA@   d"@B$" "$Cw$Wc$"C$#A8 e $$,APB$F<(SB$ {W ,P"H>#D$(pttE08p (,)7P0 $0!H**$`!@18pttpA$   ,H( $!8B%(F%$%(%(<\Q1@P%.F*@D@%$, F>B>4@K0@D$8)D',@><`j$!BD0@$+0 B1 #0&}@"? D L P @   ( , 0 ?!$%"+= %w ' "& Cb&"@"b"$Db&"@"b"#C   '"!  B#08!gcw@&,1b$!A$$7!0$#'`0$ ' 0$%#W$Wm "C$#A8 e $, '@$5  $5  !tCwl c$!0  l9 $ !$$><!$ 9 "C$#A8 e $$@('G<B$ 9 "C$#A8 e $48('+= %w 'G<!$ 9 "C$#A8 e $,$'G<@.$+AA@7G<@$"  $#"#@!$ӣ ({ ><4AG<  A  #!CXA$($ SW "!C"("' < .%!H> <@.J%!8G+,u`<X> <0.%!Xkhf n-Xe X)40 hk%D%d'% 8l0>< .%4> <@.J%D> <0.%T%<*p $x.p %!-%2 4-  +s:+q3X@T### q#q($E!A  Xh!"#@+(' ! &@&8%8$%%1  %%I  %A  $1  %$1  %%5  $5  5  0w, !at ,L+" ` `!  hJ5  %$5  @!@h <)5 $ !$*@'%%M  %E  5  $5  P\!PI KL!$h8lL%@+P@0w*,@H !at (H+"`5  $5  += %w 'PwX@+T!($ 0=?<6$@?<6$(BC,B+&H'0 0i7*,@($$#H Xc$H !!8@!$  8, Z H0 (X 0!$(PS0g),5 Xb$H#B$ !<@!$  <, Z H0 (X PTX $[ @ \L'$5  D@$  H$ (X !$(P+("0e&,N !%4@!$D$  !A4%30eF,#$!$ !@@B$  @ Z H( (X !"%$5  ! D$c$d($5  $5  += %w 'dF< '$5  '+" %w LL'G<Ț><pt<.$p'%%$%(%0 X$%h%'(C8>< .%!H* $`KhB J- ` h $p*p!pύ!><@.&!+.@+M(@΍#x $x4# ><0.&!8 . $r!p&xm%$x%xXxl\PTL1H%%%0wE,l !a ֗ ' @@ @l$%!$!D#A' `p '(bl+ "$b!CCB<$ w}< .% $ $xl%x><@.&H><0.&%TP!(X\LP>< .% $ $xld><@.&H><0.&%|TidHA |X\LTPxl%+PH@ <$P@ <<6$X@<{4%0<6$0<@@<)<6$(8 < !$$ LX!$- <!$$ L- <!$$ @ <'@ p(m c, (!% ', < !$$ X- <!$$ `l!"- <. !$$ 4 @@ @$!#!C4  0!8 ><,4A48('$,0  ,4"+D@4$$48('48(' <0.$!c$#$8f c, 8!C!$#(`G<0.><4.><8.><<. $(',% #B$$%(E$#($@ , @ $Hp!H) (@!@hG<@*  #*0' <0.k%!`KH - H > < .%!PLJ $pM J- p !H#P$I*@+@b 'A  $1   $4 ' @0f,1?<6$87<!(, @$<$@78!0Ɍƌ!8'P@'8 $(,F><@4bD'T'!$ !$A<'0w',0 !a4?<6$B$ ֗ ' @d,4@$0=$$@7@C!8!(e!i'H c'` $(,@4%?<6$0 &, $@$X$8!0!%'%E"%" $($#,$CÌŌ' $#'@$¬@$ $[ $ BB /%UU,%(#<& <%<6$w<6$#<6$W%a% <!4 $ $(;70!0njƌ#@$@#H$H+P#P 'P@% @q)% H)q $#@h$@H#Hi!@ ?1#HhP'0` %8 - ` 0 (- P%0F - 8%0$$@,!8$8%8$%@% % % <& %<<6$w<6$#<6$W%a% %H% %0 k?0#HdPhp,$ , h%` P -  $- p% % % $$H+0!0$0%0&% '0#H$H+0#0'0)% H)q#Hi'P#h $PMJ% PJq#Pj$0!0?0#HfP,h $` , h  - ` &- P% D% #0 $0#H$H+P#P 'P@$ 0p#0f$0F)% H)q#Hi!0?0#Pi $`-pM/%h )- ` - h I- p % % $$P+H$!H,$H,!@%H* w# @8+H ?0#Pih,p&xL0%  )- h %` p . I- x %H%H1%0&$$P+H&!H$H%HI N+= %w ' "8@7$$@$+A@$ 6 (,'$ ߘ (,'B$C,`!#dc' '`%(d #$#($e+ # ' B$ Bpc$ cp $##$d!C!"$(,' $%(!$&,uW0!0Fnjƌ'@'H%P(@@$%('P@Q#X $Xi#`$` +h#h 'hk% Xkq% `q $#`#X$Xm!Xl! j#P$P#X$X+`#` '`k% XkqJ% PJq $#X#P$PL!PK!PE+PC8@e$ $A@$"?0#PX`pI$ , ` X E- p%(n - %($H$@#( $(%#H$H +@#@'@$ (p#($((% @q#@!(@,6 (p#(+0#0%0 0p#0!(@$#( #%$#(@P +XE`?K1#`pixhq%) k- p $H. - x %X ,. %Xr$@ %X ` ! % $$!$% ',bW8!8G'H'P%XI`%8'X`Y#` #h +p #p'p$PJ% PJq $#P$PN$H)% H)q#H!HI!(+! H q+@#@%8 8p $#8#@ !8!0@$#8#H$H #P$P+X#X 'X`)% H)qJ% PJq $#H#P$Hi!H*!P$+PC@@)- ! H q#H+@#@%@ @q#@!@(!0@$#8@$+ $+= %w '7@"$   ғ '+= %w 'd8XB$d$$+ (B$G<ᎀG<",@$ $G04x $| &D!(x %+ ! | $$$(,  +($(,!($4$$(%( p+ gl !$ Wi 4 !$ 0'%A  %1  %$5  =  7 !$ <6$W$ @,<6$(&(0+0&08%87%8'$@4<6$0&0+= %w 'G<К!$"@G<̚!$ G<К!$" @  $G<КB$AG<̚!$m '+= %w '7"$!$  "B$"ChDc4Dc4 D$!<6$7 %ae0%(%0w%0m 7 "b#m '+= %w 'r"8@"8@WO%w#8`!8 7% @ dXDbbB$b bX"aa!$a'#$d8$%0w%0f8 % !$% %C$d8$%0w%0f8`% c$$% %$% wW% d G< !$"W$7B$ += %w '!$<`B$ ' '+= %X 'Ž$  '+= %w '7"$ wd8"$$%0%8W%8Gb$%@W%@H H 9 X$& !$!%0$rc8`%0$0$ `!0 $% <1!$$ $ $ %0$%AW+@!8!,('$('<p@$<!4 2[ (E <<<< @,048G<Ԛ!$4><,'D$$ 2[ ( @G<ԚH'< <;!$$ <  4 <,'<$$ D2[ (L@'+= %w ',048><,'<$$ D2[ (H@'+= %w '%$G<ؚc$% w7% d 'G<Ԛ'$  "8 @$&7@$&7 @ ' ' <'@C@l!h$2h%A`%+* $,<@B6+(W$ %`$Ƥ<6+W<~6& 7,$d<~6* 7%d`;<c4 <@B!4  h%l$D'@'!$ !$ ptxd'%><D'$ $Z  @A8 $ ptxd'8(,hl%%(B$*0AtF,1D'!0 ȌɌʌƌDHLPDG <ԚJ%@XLG <ԚJ%&HI" 8]%0d04G<Ԛ0'$ )" G<ؚ!$ 8@hlXD'G <ԚJ% 0 r $%H0w)% L %k&X`<`D!8!,  ('`<  X!(A8@hlD'G <ԚJ%(,ptxd'\ <0!$$$ \  4 <=!$8$ %$1  T <]!$$ ><- !$$  $ ¹ $$($&   7 CG< $E &%  #$! %$&#A $"'"'<!$$ += %w '$*A#@ E< !E<  !8 E<  !E<$     '"""  '<!$$ += %w '$$$t$PF!$.$ 4 "Cc$C"Ca$C$!"3@C8`B8@$" <,B$BÏd$E0+(c%0,`$ e`$l&0+0%(&0#c(`c,4` <  $+A ' <   4 <!$$ += %w 'D"lC&a.`tC%`D"DB@bB8@!L+A`#A>< +" TX@'H  8HC$ 4P&e`# $  8H4 J $&7`8+d$+ 4% +d$4g8$! '8,0$! $ )d0,0H r  A@B%% w<+ W!!db %% <C('`% ( !$$ '+= %w 'HL b  HL Z H Lb  HL b v HL Z H Lb  H Lb K "'/'!$ !$A+$"HL b @?<H L]  b  -$"-$LH%H Lb  -$"L<&W-$LH% /<!$$ D'<!$$ D'<7!$$ D'<@ $@<] 8$$8@< $@<c  @<8<@ $@<\ 8c$8@<?< b  %@<% 4 $@<] 4!$$(<@ Z @< $@<c  <@8@< $@<] 8#$8% ,0@<c 0B$"'!b0#$CUc  <@ <&WZ  $@<\ 0d$8($#.$$e$++$,a-$,#Q<!4aC #"0!$-<0<e!4><4$G<!F S > += %w '$G<ܢ$G<> H'$F<$G<B$A  L4 *`Y8 G<!$3 ?<!$8  8 ! %@G< ><G<6 HBD!$@ 2 F<!$m E<̙ $E<̙G< E<ș  !<-!$E<șE<<!8 E<<@PB$!A! d#$ * '<7!$B$ /$1  += %w '!8  !8 "B$"׃7H"$$ $%(Ww%(E '<$B$ $B ",,@E<@Tc$!a#!CG<`C  !#A<$!$$ C 0"C$#A8 e $4'+= %X '&& '!$7W!$B$a 0'+= %w 'H'`'!$ !$A><(B$ $B DY $'' '!$7W!$B$aH'$'<'!$7W!$B$aH'$'!$7W!$B$a@'+= %w ''$'<'!$7W!$B$a ><(c$ C ' += %  'p''!$ !$AlB$!$  F<@%%^ *@Pl ; P"@B$" "$Cw$Wc$"C$#A8 e $$! \F<!$ " G< $0F<`$F<\B$A<  \"tB$C!t!7$"0$F<`!$F<`F< %%( ^ $0%(%$LF 4%F<\c$bF3  %$ ' j "F<c$&b@ F<c$"hV F<c$"&C`xA !x  ' Ec8`F<!$X  %" `t& Cp+*b,$a%A#   F<c$ X t"/@"%@pt% C%0 " t%(% p# D#e+D#bA%% $$GM  ,0('n u F<!$ ' Z G< G  ,0(  '<8& h D   @CX#AA!$A@!(  048<'A !(- A X#CCc$C#`0X#%04 48!$8 X#%  !$F<4!$ 480$(, `F<@X"$F<@F<8&a <8f  ab'+= %X ' "!h   '+= %w ' ,04<"-@@XC##c$#C`,XC%,0@04B$4XC% @ B$F<4!$ 04, $( `F<@X" F<@F$ += %w ' '+= %w ' '+= %w ' '+= %w ' '+= %w ' '+= %w ' ','+" %w 'G<`!C+b!"CB%#X& C*(b,\+8$ % %%0F!DF!8$$@#0jF!8$$@#0`FF'!$ !$A <8 !$$  `<`!$ 6$CB G<@C  !#A   $ ' '+= %w 'F<,G<''+" %w TT'''!$ !$A ''!$ !$A<_G<@$*A H' p"B$"#&C@ "B$"0 \,; $$8% ''!$ !$a <c$\ '$@ $$8% %\%8%PP,*<@K`G< l,-N  ,+- .`,+@ G<`,+0,  +,, 0 $K`Kwk%%` $%pw%p n%` $%` $%PU@*@*?@h \; h! pB $$8% h !# %%p!# `L" > Lp" p "B$ "#&C@ "B$"0 \,; $$8$4''!$ !$a <4 c$\ '$X $$8$%%1  !x%p%`@x %*  %*+@+ L@@!FR+CB`!E+)9`@!fs+c/R!es+S@%+) @!%+C`!ER%+p|+p% % 1  % % 1  %%1  %% 1  %%1  %% 1  %%1  %% 1  %%1  % % 1  @ !0%h%X)`o%!x%Cx+ @!%+#@!%1% +h-+hi% % 1  % % 1  %%1  %% 1  % %1  % A  % %1  % %5  Q  += %X 'Ž ÎĎŎƎ ; '+= %X 'Ž ÎĎŎƎ ; '+= %w '"#%b @" ab%! "" #$% # "  & d$e%0G%0%(%@%%  &8 % +F@$$ @G<@  !" ""#(G<`(#  "#("G<`#  "#"G<$  #$# @G<`(C  !#(A" @G<`(C  !#(AG<@,"  %",%0G<`0#  "#0" @G<@0"  %"0%&&"%c8`B$&"G< (0  !"# $(0.0 @G<`,C  !#,A G<@,  !",G<@0,#  !"#0, &%B8@!$&'XE\G@D&(&@)&(D&(!@5XG\E (G< @("  &"! %(&("@ D %+ D& $ D& $/G G '<T!$<,B$BÏd%(% cc,`$c`4 / < "# ! 4 G<!$$ U  U <0+A&`><4+a!`,$$ * ,7k $$ * !$ '><4+AT  <0 <4 <@PB$!A! %$G l!&# a!7 G<0+0$ %d`%%(A,,$A $% $><8'!$$" $, * e><8'+= %w '"B<&W`'r '+= %w 'H"C<& w !aLPTD'4!0B  #8`!8 <';!$$ Y  <!$$ Y  %%%AH"C$$+ d4!0 H" &CY@LPTD'a@A$4B!0 @" &C@"C% !$$7* #%B%$LPTD'4!0 8 <!$$ 8  4  S > > += %w '  $* b + bIC@ $(  \ 4 %#+A@(`($OY  % #+# % %$(,04'@h  > S > %%1  9  += %w '$ , $*b `#$!$ !$a$ $,z  ,*(% (&0%   048 '+= %w '40%%B$%*0$!0Ɛ$*0&$  40$,  $*0b|&$!$ !$+0bB, $ {  40 $%0%8P!P*H$*@!@ $*P(@$  $ 40 $+P@8<@('%1  9  += %w ' !"#P%T% 8D! '$  D!$(! C8C$P(`L$x <@0,4P(T%H8$D# %#i#('$ $!D  D&$$!HA8($<@0,4( *P'@+Pi@+(\`H'% %9  % %I  += %w '$$ $ \ %#!, ;@;$$OY , % #+# %(,&d`4$  $+b 04 '9  @h  > S += %w '$(, $+ +$+ d$$,Q>< i$! D$,G@><`jB$!"!d$ $,8><`j$!DA a$+#@%$$7 \  & C #C!#   (,$'D$1  $5  D$1  $5  += %w '(,0$<4+ d $+(+$+($%,R>< i$!(D%,H@><`jB$!"!$ %,9><`j$!EA $+$@%$$7 \ & C #C!#  $,0( 'D$1  $5  D$1  $5  %iB83@"()@!$!aBK$+ GD8$KB8@$ MD8$TB8@$$%(]@DH4'@DH4'@DH4'Y    @D$H4'@DH4'@DH4'Y    @D$H4'@DH4'@DH4'2=%(B$"@,(Y D A $ $( ,  +"$&(d+d,$%a" (A0,bp$p0!a!"`$*`K%X%` %X% +`b+`JyPp#`g#hG%#` J%g $PL!P%%%h %p%x$:Y+ _ r! +8+W8&p!8G<  $(+"`&p!"& @)(G<@"  $"$ '1  *&%* % RS&H+i*H.$J% +3*$% T +!&%@%H% % %@%H % % 1  %% 1  % I  A  <!$$ 1  <!$$ += %w '"$*b`B$ ' @ "$A'+= %w '("@,4d& @< !$+$ (,,"$D0D  " (dď@Dd0ef%8 &8E*(E+0&,$0%( $m $' d@('% $%@'0'!$ !$!B b$,0$ '$ 4'+= %w '(,$ $  F<,$ŏ%8%  ,$ 4DL''!$ !$< <4DA6 PAAW  r  <@$%L' $  @''!$ !$ $+ bL'% %(vP8'%@ '  <@@`h$i(c%%H%@% w<+ Q!PjH IC<8,ʐ,à$,(L 4!, 8,<<@( D`H`%$Lc$LPc$PD`c$D%%Hc$H$%` %%  %%80  H0  <,!$!C% % BB,@$$*Aw ,"8@1 C8 `C8 `B8@4'"8@!8 $4'  %%$ C8`<,!$!C% % BB,@$HWHC$c$$ w , (E<@L$!($<[$8dH%H /%-$<$%((E<,!$!C% % BB,@$lB@8& C  4 / $ 0 88 $+= %w '! [ ("C8`C8` C8` 'C8`  'G <0!$< 0!$"F<% @'+= %w 'F<)`G $<$' $ !$%0<!$$'$  "$0@B$@P$T!8%$ B$$+b D '  HL8'9   #,?`P(T$E<@LB$!A"4!  <΄!$ $ 0 <<@PB$!A! $$ '/$1  <[T!$;$ 8 `<6!$H4'!E%( !0$%8wǠ1@>%$! ( ,g,$0! !C$ (%L'`'!$ !$a <5c$LHTDX\dPp`L' l'%I  9  %I  9  %I  9  %I  9  %41  %I  % 9  %41  %41  += %X ' F 8<$'м += %w ', 4@0 м 0 (A8<$'4(0 >  8<$'м += %w ',0&bB,B0(@4'8& ,0"<&7 `'@`<<@('@м ,49@"<@('48a## +0# % ##0+8#0%0*`'*& > '&&d`##+ #d<@('м '(,&bB,B0@0'4& ,0@м (00@"8<$'04a## +0# % ##(+0#( >  ,a##+ #d8<$'м '%"`м  <+ <&(w,0% <%(% %0@8G%@$&8+@D+H%,$8'%8%(%8BHW%I$B% @8G&HC+P+XC)-J9$HI%8@(%@+#@#Hb+P#*4%@ $'$+= %w 'F<\.048<%!$#(2` $ apF<$! 0&8G< G<"G<8A@$A# $%#(e+e&# # $# +($&#f#e(%#(+ ,!E#a#$A$A#!CA$A#!CA$A #$!CA$A#$%#(e+e!E###A$A#$%#(e+e!E###A$A#!CA$A#$%#(e+e!E###A$A#!CA$A(#,$%!(+!E!!aA$A#!CA$A#!CA$A#!CA$A# $%!(e+&! !$! +(&!!e%!(+ &!!d$! +(&!!e%! +(&!!%! +(&!!%! +(!D!#!A$AG< AA$AG<!$!F<c$cF<<#$F '+= %w ' $ ( $B, > '+= %w ' l '+= %w ' $ ' !+= %w 'En ' !+= %w 'n  '' &"`G<`d  '  c  ''+= %w ' > '+= %w ' > '+= %w ' > ''(0*A`%+@$,& #! 0EpG<#!E ' $,  4'4'4'+= %w ' "@$( 04 <'!$(0 4sY <'+= %w ' '+= %w ' '+= %w 'G< ! $ ' $  '+= %w '"$CpG< `# `  '    '' '   ''C,`%F<!$$ $B Y F<<!$ C ,'<,B$A'+= %w 'F" ("4 "  G<\+B,G  "C82`!"8*@!8 <!$$  E< !E<   <׿!$$  E< !E<  м  C8X`"B8@"B,=@i"@!<'!$1$  <'!$$1$(, < i)%!H!!D), @><`jB$!"!##"$ ), >  <`j)%!IB#0#F %+(@%$$7 < iJ%!P*AD*,b@@><`jB$!"!#&#0"*% *,Q@> <`jB$!"!#&#0"$+&@$$07  <)5+@(%%H < i%!`,D,,@><`jB$!"!#i#H"l% ,,> <`jB$!"!#i#H"!%+)@$$H7  < i%!`,D,,@><`jB$!"!#h#@"l% ,,x> <`jB$!"!#h#@"%+(@$$@7@p< i$! D$,]@><`jB$!"!d$ $,N><`j$!DA a$+#@%$$7 \ ) $OY  %  #+%  +b $(,'A  h  h D$1  $5  D$1  $5  < "!$ S > += %w '  ''+" %w xx'dX$&088Xg&0Db@dE$%%*0%0'$!@+H  P!Xl+H 8b+@4hi! +X"`8TPL! *($<<!$ $B F<$!$ $B "B$"xXF<`' @$D$F<$ <1!$ xXF`F<% %(^ % %(@t<(k!4  G< t@ ̺ t"@B$" "$Cw$Wc$"C$#A8 e $$xXA`G<889F<% %(^ % %(pv p"@B$" "$Cw$Wc$"C$#A8 e $$xX$$%8 e $><$!$ C F<!$ F<Ꮀ><<!$ C '"! "G<`#  "#F<@!$ $B $ F<+ F<$!$ $B <$!$ C PF<<!$$ C  F<!$ ><@!$ C 'E5 4 8 < B$c$`C$B8@e“@$¯%$5  += %w '0' ','!$ !$a <4c$ '4 <(@,8$ ' D0'+= %w 's  '$%# } v`` `d'  ' <4\!$!$ ݯ,(  '%# ''dht! " 7 Y+  ""Ydhl'  $(,048<@DHLPTX\`   $(,048<@DHLPTX\`''F<`'<  ݯF<` '%8%0 <`Y$%  '!  F<!$>w6 4  | # ݏ'Ď#'F<'# ¯^]$َ  4ݯ ߯,ï(֯Ǐ^  (   # ݏ'`l 4%%X$+ <`a$ $+ <0b$@$+ <c$$+ b>$&D;@?b?$&D6@@b@$&D1@AbA$&DB8+@BbB$&&@DbD$&!@HbH$&@LbL$&@PbP$&D@TbT$& @XbX$&@\b\!&A!,  "d&@b!&"!,  !B&A!, "d& @b$&D@b!&A!,  "d&DI@b$&DD@b$&D?@ b $&D:@b$&D5@b$&D0@b$&D+@b$&D&@ b $&D!@$b$$&@(b($&@,b,$&@0b0$& @4b4$&D@8b8!&A!,  += %w '" #& &%b @$$#&bB8@%%#&bB8@((#&C@,,#&b @$ Y % '$ "!d&c&b%"!, += %w '"d&D4@b$&/@b$&*@ " d&$e& %D!@"d&$e& %D@b$&B8@b$&B8 @ b$ !$ $ Y % '+= %w '"d%& e&E%D@b$&@ b $& @b$!$$ Y % '+= %w '6*  % !$!$$ Y  '"d%& e&%D@b$&D @ b $&D@b!&A!,  += %w '"d&D!@b$!$$ Y  "d&@"d& @!b&"!8 ' '+= %w '$ Y  % !$!$4 Y  '"d&@b$&@b$& @b$&D@ b !&A!,  += %w '"d&@b%&E @!b Y % '+= %w '"d&@b%&E @!b Y % '"d&-@"d&$e& %$@ " d&$e& %@b$&Dd%& %D@b$&D @ b $&D@!b!!&A!8  += %w '"d&D@b$&@b$&D@b$& D  ! c Y % '+= %w '"d&1@b$&D,@ b $& '$e& "d%& d%& !c Y  !CB Y % '+= %w '$"! dc b ] $" d ! c b N  "$d!c b ?  "$d!c b 0  "$ d$!$c b !  ("$(d,!,c b   0"$0d&DB8 @1!1b&"!8('('+= %w '"d&D@b$&@ b $& d%& ~d%& yd%& t d %& o$d$%& j(d(%& e,d,%& `0d0%& [8$8e& V@$@e& QDdD%& LHdH%& GLdL%& BPdP%& =TdT%& 8c! Y  % "c! Y  4!4C8B Y  %<!<C@B Y % '+= %w ' "d&@ " d& @b$&@% %$'$ D(!Cd!A!b Y  $+= %w ' "d& @ b $&@% %$'$ D(!Cd!A!b Y  $+= %w '" d&@ " d&@b$&@b$& @$"$d&@% %$'$ D(!A$!CB! Y  $+= %w ' txt @Cd0 c0 `4 % %%% %%0c8c`PL "= @ !86 A L23  0! "#S`C8+`#c0c8`P"" !\ >  += %w ' "C0`%%  'c$e$!(%$8fpK0@ , @! 0!d$B0@%% "!'&b `CDEBi 0   'B$!(b$!(%8Fp0@ , @! 0!!CD$  += %w '"Q DH  ! !0 `a$#c0!C''$%I   "B0@%:"B0$+b`$+b `C8`,!$*B8&@(!$$B8@$!$0!$$+b `B8@@!$$!$C8`$!$B8@0!$ !$ "%`%%#!#  += %w '"B0B8@%%@(A'1 '+= %w ' "C0Z`B0@%:"B0$+b`$+b `C8`,"$*B8&@("$$B8@$"$0"$$+b `B8@@"$$"$C8`$"$B8@0"$ "$@BQ DH  '''+= %w ' "B0 @c1 C$% 'c$`+(b'!(#.8 [8$]8$d$+(D #CB$#$!a'%I  %1  += %w '$"B0$+b `C8` "B8@ "C8`$"C8` "B8@ "%@( 'c1   ($!0 47G<`#  "#"04  ,'+= %w 'dP!7  X`"0@ $%!0%AdCc0%alTptL'dP.5 U h d+ HXC0c8`Td dlp$tL'TP < 8@dF  8HAG< @A  @#!C d8@ H Hdlp$tL'Pc1 D <dc1  \`  %%1  $%I  %%1  "#! += %w ' # (!@C`<4$% %  $( ,E 0'(&"@% $, 0'+= %w '@840 8% @$ &(D%( < 8$%(@E E<8$nj%( < 2 @8$2E<$nj- $ $% %(@8$%.    $D,'$D,'D,'$H $H*q$!H++&`d$`D,'8   (a$ b$@ ("!8 <@E  $D,'D,'$P(P J%!PGK&`e)%` @8$cF%(% ^+= %w 'P X@D\HD 0 04%(%(%0%% 08t004 $+H'  %)1 $+HI 8 i $+H' 8 g+8 8[0g%8+8I,<823 0 @! !8 Fc$% CG<`C  $#D$ L $('('('%5  += %w '$7L  &"<`B$$L  $ bD$$+ "0b!A"#<>$& `% % %%% G<%  $%  (,$0 '(,0 '5  += %w ',7L  &A;`!$,L  , bD$$+ "/b!A"#<>$& D`%%$ G<$  $  0$4$8('048('5  += %w '$".@@ b $&D9@$b$$&D4@(b($& D/,!,c % 0"0d&D@4"4d&D@8"8d& D%<!<c %%% '+= %w '| '+= %w '} '+= %w ' "'C'"!  ' !"!(d+"!!!+%!A $d%d' $#%A$( #"#(d+"##(E#&+E#" '`$D&d'`$a%A$( " (b0!0+8@!8H!0+0H!0H!H'+8'P!8!0+0!0bpq!$!" += %w 'HL b  $ HL b !8 HL$ <0 4b  0 4b  +e<}$!(%0,t0./0@(><@@$!(*8&a$+8A{g%@+ +( 4 '$*(&>a%$0?$+(0$*0ce$0+(4 '0?0#%D?!0 %A?b0%A$ '0?0%b?!0%A '4 '0?0%C '4$ '%%' $b!0%"$ '4 '%1  += %w ' d%(><}$!(%0,t0./0@(><@@$!(*8&a$+8A{g%@+ +( 4 '$*(&>a%$0?$+(0$*0ce$0+(4 '0?0#%D?!0 %A?b0%A$ '0?0%b?!0%A '4 '0?0%C '4$ '%%' $b!0%"$ '4 '%1  += %w '$ #$ !ce(#$a%%$,$0'4,0'$*0 +04!0Ɛ08%(+%$`(##%#E$!d  !"$&C @4,$0',0'%%I  %%1  += %w '  #$!ce(#$a%%$$$('4$('$*0 +01!0Ɛ08%(+%!`##%$!D !" &C @4$$(' $('%%I  %%1  += %w '$+ $+ "q $%7A?a0$%7A$ '4+ w< 6! w$+ $+ "P $%7A ?!0$%7A?a0$%7A$ '%0%(<6$(%%*($j+($x!(#%0, %$><}$> <@@J%%@><}$!(%88L0!@*HB ./0@()$> <@@J%!(E+X$N`!Hi)+X+,`+((8%$+H9 !($0? $+(%8!$+($'!(#$0+(% ' ' ' ' '$ '%1  %%1  % %1  %1  += %w '$#(/0!(ef2%(f4%(f6%(fg:%0g<%0g>%0%(<6$(%%*($j+($x!(#%0, %$><}$> <@@J%%@><}$!(%88L0!@*HB ./0@()$> <@@J%!(E+X$N`!Hi)+X+,`+((8%$+H9 !($0? $+(%8!$+($'!(#$0+(% ' ' ' ' '$ '%1  %%1  % %1  %1  < CI$+ +d8-d8-c8`$$!$# '0!D$Ic8$`$% Nd8id8 $% %($%(=nc8`#(`$%  c$* a! C$0$+( $0< $#A0 #40%8E($H !,  0 A, 8% - H%)% d <@<&7 8@D$$$+ ^$* E '+" %w ``'    T  ( +b ><\ L32HD 8 B DL3H  2 2%@D"$+AH!"L 3  Gb  '' 'T'|'!$ !$+ b#T'  P  %% \   %#+# 8 > > 9  9  '+" %w dd'    ]   +b ><!$  $(,'><g H32D@ d K @H3D r ; 2,`@"$+AD!"H 3r $  b  '' 'L't'!$ !$+ b$L'  Q  %% \   %#+# 8<!$5 O`|x`%%  \   %#+# % 4 > > 9  9  += %w 'DHL ƚ  H&{ '@ <`~!$<#!$ += %w '8 !8 04U  $(t^  <@ D$H(L,'046 <@DHL,''+" %w LL' E$0p?!0C $+08?,H$0T'p'!$ !$ $+0eT'PxL += %w 'H %% \ 4DH  4%#H+#R ( L $   += %w 'P TC$"$+`L%0%(% 5@Ld08+$( e 40b8d$%$$ o8d$%$$ x8d$%$$ %$#070! f$ $%(% X $@$+@D 8<5 <)5"8<%HD<84$  !$#,!CLD<48%@%HPT $X$h - h , X $#8P , P%8Mj%$+XK$!80%X%`%hU > > > > += %w 'La HC+d8 #$# '0! D%(-c8 `#$#(/0! E$%% %('P T  <8$<$&0cfE<&8$,(aE< !8,<8<$%0(<$%0T` $d$$8 , 8c$ $# @f0 c, , 0% 4 @0' `&0D+8(+H,8$0%0f\`&0D+8+H,$0&%0 R`##+ #dLL \ @HL  @#L+#  <`~!$<#!$ > > <`~!$<#!$ += %w '0\  "(Y@,C-d8+c8L`#$#(/0!(E&8F \ $,0  $#0+#  >  C-d8+c8 `!$#c0!C#(!`C0c8`C c4c0bd8od8xd8xc8c,$0$% %^$ % %^$% %^$$*0.!0DƐ%80,9$+@  ` 40a,f$+00$_808 _$_8!$  _8+ += %w ' '#'!$ !$a40% '!H(0$+!$% +(+0g,$(%(,<̥400 $@p#@HP'q#j ABN%@ +H+@,$8%(%0c$f,%("! a$$$,!+ B,!,!8$"%$  <6$%"\@<%7`$dL'`dL'`dL''+" %w LL' d8 @c8`><c$  ^ %><>''!$ !$ fK9s`G $+Xj `EK9 `GJ9 @eK9`*$%gJ9 @ $%%P% % $|%X?'V'!$ !$  $*`?'$a'# в >'| $% $*`w?'$a' #ų >'|w9%%P%X_@  $ (,0'W'v'!$ !$AW' $b' # G$+b `EC8 `GC8`eC8`c$a%fC8 `#d a%gC8`>'%X *@''!$7W!$B$(,Ϊ 048'  $ (,0'  ̯ $(,'<T!$<8!$  '+" %w '@'h'!$ !$A@' Y B@'#bG l'|'!$ !$AV % G$+( E8 G8(e8 @'!$ |'%'f8g8 $% <@' |'<%  d@'!" |'%%(l'!$ !$A@'l $pt`xd|B@'  l'|'!$ !$A@'l $pt`xd|%(G$+0 E8 `G8`e8!$f8##a%%g8`%%( * l''|'!$7W!$B$(,Ϊ 048'+= %w 'h% G$+( E8 G8-e8"@DH M'P'`'!$7W!$B$d(,K 048lpt<'f8g8h\d*0`*8%%% L@$`$ ) * '%@DH M'% P'`'!$7W!$B$$(c$,K 048lpt<'*`%#'a%@DH M'P'`'!$7W!$B$(Ԯ ,04lpt<'D!$H+ A@@ $$ x'$ * x'x'$ ,! %89,$$ a1$a$ a$a!$$a% $1  x' a d $ %, !(a08$` $1  $1  % $1  % $1  += %w 'P H$L+0D%D $$+8D,  4 B!d$@p#@(%H%(9B0 ף<> 4B0 0B1d $Xp#X  <(\5` $XqBq!Nq#1!Xq+x+p!0!0!0BX gXBY ! p+X!0fDX#X++H+pFq!p#p#Hd$%@ %(ף<> 4@P@H G%@ I%+-!X `+-`k,$ <%!H+pk!X)i|H-u!$h!H+P(@j+8 $8%8@8@P _ %8gJ%K-!(gXG-Q!$g <k%!Pj+`'Fg!8'J <k% '-8$ % @ 7 @8 %(.,'!$d!(g+0$d! $ aB$d e$+0$ d! $08!Ea'%1  %5  %$5  %$n  %5  % $5  % $n  %5  % $5  %(% $n  % % 5  % $5  %( % $n  $1  += %w 'xt%"`|6`# $ $#($(E+0#0'0$ (p$ p $#(# $ ! #(* "p f$8 ,   , 8%G$#a c, %A $ !B l' $#8$HP$`h , H g- `%8&8' , P &HJ%8#($&(@(@?%$,*$$l-!H*!P,c$ (`o%$,-$$n-!H!Pc$`@`\<80,#` d! $08d d&e+e08$ dd$ddef$$df# '0! G<e  $%,'$%I  %%1  1  h!@(0$ % % <̥400 $@pI$b# +@"1d+()ef# d# d# E'$ D! $#G<e  $%d b ( LMA$J 0s%%M  % 5  += %w ' ! %%8 $!$A 'B$% %8 *  $<500HH $XIq`` #X+h$%&h +h,%X%% % ,%(@$*g`8`  `0+$%+(`$$#(b%̌!PLL$%  nj*@%B8ף<> 58B9d $P'q# @ $K-7`Œ <k%!Pj+`-̌!`J,"@Œ$! +`B&8 Œ+8 Œ!0$D!$ a$ '%1  % 1  %$5  %1  % $5  += %w '06 \"$$+b=`A 4Bd$8fp# @ $,WH$ <)%!8'A -L@''!@H,AG$! $A,6@e$,-F$<$!(A,"''!H% ,d,D$!A, !(c% ''%%A$1  %$5  %A$1  %$5  %A$1  %$5  %A$1  %$5  !PK$% |B8ף<> 58B9d $Pp# @ $K-*`$ <%!PAm-''!XJj,@$! A,@ %A$1  %$5  %A$1  %$5  % A$1  % $5  <T!$ B$+ " $  +A9`#"$# #A!$* 8 8  (  8 `8 8 ('('('$('I  += %w '% C %(&0'8"8ED$H+@%( $+-8 $*H + %(L'h'!$ !$L' $ $ $<~B$!A!!0+ '$$ `B * '+= %w '$+A @ $*A @"$$+b @ !8  "8@!8 $''E%%(*0+!0B0+8- $@p!@ +Pi @ +Xc `@$%"8@$#i A!, ' 'м %%1  $*(# $0p!0nj+@'Ȍ+@ŒC8`$#'@"!, ' ' 'м += %w '"@#$ p$! d + !  $' "@ #d* ! 3 $'$'+= %w 'ba* "&D$+(?d$0p$!0Ɣ +0+0A0c#A#0a(p##$!$  $' a  bD* c 3 $'$'I  %1  += %w 'd,%%04$( '*8!8B8+@7$Hp!H**P @+*Xd `@$%%H !%!"!<B$!A! ' '*8!8FB8+@t@!@*@$%*8+8^0!(&0f 'E<|$!0Ɛ,#A#"$"!# <2!$ 048 '><|$%% *0$-$+@P!@%H)- !@+>`,#"# #A$#! <2!$ 048 '&0$,+0d+0### #a$"!048 '048 '%I  %A  %I  %1  += %w 't %PTX \`dZ %tF@ *A`%@@%(&znj!:p<5+H 4 <)5+P'?@ @~  S ! !+= %w '7G<@"#  "#   '+= %w '$ !@(!"}  $"+ b"%&0   $" #G<@"  $"$ 'A  += %w '"@&A @$G<@"  !"!@# $#*b` '<T!$$"<jB$" S <T!$`!Xk!!H++X"5`!XkXp#H+&X`+X&'`(#$&!( Y  4<8 0( <J5@,'$@,'%%I  1  %1  I  %1  %%1  $% +0!0Ɛ%8&`$@,'%1  += %w 'D",/@"8@@<%4+7 @< 6!7<c4+b@' Dz 0C$ <@%0%8$H8'<@ Y H8'*@eA+@e!@+H !H&*%X &@h$4,#!$#c$$b! Y  $! $0<@ ,4$$c$A%*@*@e#$H8'$H8'%*P@#Ph+XEp`#XHk%!P+`bgJ!X+k&PK@F$!0&'Ɛ #b!$H8'c$%0%8 *@e+@eE!@%H&8g$+@7!8%@&0$ %@$H8'$*8#8f+P@#PFJ%!8+XB`!PAJ&8#b!$H8'% 1  %%1  %%1  %%1  % 1  % %1  %1  %%1  %* a! C$*0f$ (  @<($8H8'$H8'+= %w 'p( #8`h$* &%'8'!$ !$l%Yl!"(@4dh , t`'$t`'%ph\* C$d!(D$*8G$   p\l ,  t`'$t`'6B700'!0Ɍ0 $8%8'Ǭ!$*0"!8%@-'%8<'!$7W!$B$d%%B$* C! ".B/0(<'!(0$ $ t`'$t`'+= %w 't/ ld8$* -%$'@'!$ !$p%hBC(`4p ,  xd'$xd'$xd'$8 p!$(4h%5h%lh%t`+(C pt, #"@xd'$xd'%%%9  %h%l`+(C   #b&a xd'$xd'%%%9  6B700$'!0Ɍ0 $8%8'Ǭ!$*0"!8%@-$'%8D'!$7W!$B$d$h%t$+0!0Ɛ>B?08D'!80 $0$0xd'$xd'%%1  += %w 'L; D'@ !8<@ * !$D<d$*(% $<T!$  0$C$(% <8%8< i* PTX4'PTX4'#8#?$8'#Pa!8$%%(% %( %0*89 ,@ D % H!+(bF$ +8=80!8D!!+PaG<`,  ,,+@!0$ ,+`!#eG<e  &%fP$TX4'%1  %I  %%1  9  += %w ',04 8$r/  $<@D('+= %w '($%% $%0!8C%@> <{)%!@ 'P$PE% !0Fc$%(*8a0c,`<T!$  ($%<2!$ 1 ,04 'c$* a ! C><{$! ><{$%8%@*Ha, +Hag !HC)!H%) c$+HgW #HO $H'!HI#8g+PK@P!PGG<G  )'Ic$0%%8*`+'!`#$g!b#('+8!%G<@"  #"#,04 '%%1  %%I  c$*8a!8C!8%%1  %%I  %%1  '+" %w '`'\'!$ !$A%%$ $`'%0%%(%08%,l*@'t<+40`h!H) $*XI`+$  8p I ,> 0C$4+(%$`+)$*0+@%@'\'!$ !$@'$$` $< d!$   ,%+$g$8!8'<'8@$+%840`,!<$+%840``$+@ $< d!$  ,l"$!CG%0`<TB$  `lh0%0'B$$*8G+@g#H+H H!H)#P*#8?$8!8G<(  '(tx|d'%%I  %9  += %w 'd# "8@p @#$<4(*(E$Cp<4%`%0%8`"!tx\'tx\'!%!$ %@#H*H% @DHL@' `"#@@'& @'@@'LH!8D+H (<4  S <T!$ S <T!$ S <T!$ S <T!$H'HTP!(L+8e,@<  S <T!$H'HTP!(L+8e,@<  S <T!$<{$!0Ɛ#$$A!#<2!$ 9 $('><{$%% *0$($+@?!@%H)- !@+-`#$#$"!<2!$ p9 $('+0D+ `#$#$"!$('%I  %%9  %I  %1  += %w 'x&"`% t| Y %x` `lph'lpt * ^ @*"`%DTX\`T'x#C"pp!A x lptD%0kT T'&" @T'TT'`\!(X+8%@  S <T!$<!$><!$$ <@!4x ((y % @$ xx (e #@` b@d% x8%D%@e$ xx ( gxa$ xx ( Wx!$ xx ( L#` <"!4''l$ xx ( HdLeN+(%" $4' ?!'@ABC''+" %w TT'<''!$ !$A  <'$^ (,084 '>:?!8T%D'%@%S'!$7W!$B$!''+" %w HH'<''!$ !$A  <'$^ <(,048@%%<'\  '+= %w 'X %%  !\ !  <@D HLPT $`(^ ,04dhl8'dhl8'+= %w 'X"4+b @ 48B<̄4@@ $@ qPP   pH*q#h# D#0+@0,(L $`T8'H'!$ !$aEp @E<  O $'$'4'!$7W!$B$a(<$7@$@@%"@%b<6!W+b !$!A,0p n< 6!w+C!$!A K@$'#+##"  E<`J!$&" %(<$ w$@@('%@ /% <6!(+  c$!,0$?<6$w$(4'$'4'!$7W!$B$a'$'!$7W!$B$a'p$*b`dG8dM8dT8 > > > > > > > > >  %%0 \ p  p#+# PxpP% %( \ px  p%#+# % %(L<@p!$ "G<@P   "#P$ %"P "#"$L"%$ %''!$ !$a > > > $  $ $ $tx%:;lp%%%0x%8%P6c$* b ! a$0 $+ <ׄ$  +A`#@"G$@( #AX!(I  k%m) -8 9$#ho 1! %X%h $q1!hk%n)*pe !pΑ%1 $+x` .8 n9E<ؚ%h +p#pew$p#(! % $ $t% :;lp%8\%0x%% %I  %&$*8 +8=!80,+8<!$  +A%`#Cc$# '$$ x!8$ $ $tx:;lp%P  $mI  %%1  9  %%I  %9  += %w 'C(g`C()`dC8 eh8 eS8eT8M8de8dS8dT8 $$ 'd%(G8!fM8fT8A$# '0!dB8@$1 !$$ '+8-8%1 * ' '!$%(Q*(" !(a$0$+($*0$+AA@!8D $ '&8+0?aT"8@W80@bIB8,@bTB8(@A!8% $$ '$8$+ "aT!8 $$ '!8  ' '1  %%1  += %w '0 ,d-8 +84('"$# '0!d% %(%0$*8C!8$1 $+@(; <5+H 4(0B1B)+@!@d $(p#e<(\4(!(P!@ ` $CqPp# !+ ! BB!e+(e! #(#E 048&$,'((&H+@h*8)-9$@ %84'&@*8-0)+Hi$@(%8!$+ an< 6!(w+!"!$!$!a  0!"+An< 6!(W+4!$!#!$!A%%(m<46!Pm<46+W<6!7!AT8'+= %w 'L F<B$&A@ @<$W`<@@ %b@ B$'%d<6! w+!CDHn< 6!n< 6+(wF$!(E<`J$&0&9048&,'((&H+@h*8)-9$@ %84'&@*8-0)+Hi$@(%8ÌŌ   40! +0n< 6! n< 6+8G!!FB$!G%% $%(%!p0q%ѡ%X%0+(+p ,$p%(-$<4pp $q#p+!2Or# $ E,!(Gm $ ( B)Xp#XK+pBy!pxq#x/h!h!p+(!(q!X @BA!@ X#XK+PK+h !(`p!`#H,#H*%P+ @$+H !H&R%  !$ $, !'-$C%,'%1  !`0o%%X%+0 +P ,-$0%0-F$ @84@!0D!@g+H!@  &H*Ph+X)-$Hi%H* *H+(,$(%(#&(*+ ,$ %`,@ @(%d@  c$/% <6!(+ !d48,?<6$w,048H','<'!$7W!$B$aH','!$7W!$B$a('+= %w 'Xl$(d<$(/`\tp#(D#0#+8E#0&8#*@a+H,$8'%8<4$*8+@,$@ %8 &8#*#+D,$C%A <%(|P'T<$0w@@0?%@8 c$7%0<6!8+0!\`h<$@@ @@O% $@H' $G%@ <6!H+@(! pt#@#d+ #d;<ʄ4dp !?<6$ ?<6$(# (!08+('!!e4'h'x'!$7W!$B$ <' '0'!$7W!$B$a'<'L'!$7W!$B$a'T'd'!$7W!$B$aɮ ,*`'T'd'!$7W!$B$a'h'x'!$7W!$B$a ,`|<P'$|h%0hB%0hD%0hF i jR %HI jT %HI jV k lb %Xl\ \ %(%0%8I<$@hq$$$+ D b!@H0D7G<@4<88+("& @C$#(/0!(,0#"!$#B$$C!D48$< ',048< '$%I  %9  %*A;`!c$*0F$   ($$g$$+8c$ $+`C( `,048< ',0#A$b!4#"8$< '"( @,048< ',048$< '+= %w 'd, `d+8 $$#(/0!e%(%0 -8%$#070!f%(, $ $%(%%%e$X%% hlpt\'%%* %C! a$*@($H<  H<X$$$ $+HI  $PIp! $ $*XD`%(%%%' A $%(%%%+ I# %'$ #(!d $$ A$ $%(%%%$ $%(%$, $ ph:9$#@G1!h8; $%(%%@%r0 T,%%@# hlp$t\'hlpt\'% *P"E@!P#J*X`+$D8  D T0,$8 $L% $+`@ q!@H%; $*`H%(%%@%& ; $%(%%@%+PA@#($#PW $P*!j; $$; $%(%%@%; $%(%$, < $@hq! h:9$#@G1!h8 (LP%%@3%%%%(# hlp$t\'hlpt\'`!#hlp$t\'hlpt\'% *X"E`!X#k*`,$@4  @PL($4 $; $m% $+h @ q!@h%*XH`%%%%( %%%%(+8A#8$#HO $H)!(i%%$%%%%(%%$%(I  I  %I  '+" %w xx'''!$ !$a8'H'!$ !$7 J8"$#070!(&8,%0%8%%%(%0fM8"$#070!(&8  $ $%@%(%8%4(%0%8%%0'!$ !$a'% *8AB!8$*H I$dL  d'H'L$$ $+Pj@ $0p!0$m$*X`%@%0%%(!@%@%0%%(+8"#8A?$8G#@"!($ %@%0%%(%@$%( $8<'!$ !$a'/8 $H'8'!$7W!$B$'8'!$7W!$B$$'%#B0!   H'8'H'!$7W!$B$a'8'!$7W!$B$a$'''!$ !$A'%%%I  %0 *@F!@ $*P(@$pX  ('H'pX $ % $+X` $8p!8$ $*X`%@%(%8%( $%@%(%8%+@F6#@&%#PW $0!( $$  $ $%@%(%8% $ $%@%($ .J9@`%#PW J1!( 9@%@%(%P%g$|4%%P'!$ !$a'% *X"D`!X%k*`+,$lT  l$'H'| $`4 $Tm% $+hPFq!PjJ% $*hj%@%(%P%" @%@%(%P%+XA`#@%#X_ $X+!($ @%@%(%P%%@%($ .k9`%#X_ k1!( 9 ` x0%%X-%%%(%0'!$ !$a'  $8<@D%@%('!$ !$a'% *`"G!`%*h,-$hP  h 'H'x $`0 $P% $+pXfq!Xk% $*p%%%(%0 a%%%(%0+0A#@%#HO $H)!0%% $a%%%(%0%% $%0I  I  %I  8<%@%("'!$ !$a'%0 *@E!@ $*P(@$t\  ,'H't\ $ % $+X` $8p!8$m$*X`%%%(%0%%%(%0+@F#@&%#@G$@!0%$%%%(%0%%$%0%I  d "8[@!8U  "$<4D!" B$#C $Cp#"$*a`$%(7Q<4@CA#0d$@q#($qH$O @DHPL$*x, 9$o%!x 9%X%h %a% Mx P$>LH@%X%h$D%X%h%X%hp%@%*H -*) @ $%P%Xk%#` g 1!`L)% $%X  $J)I@jlb %PLld %PLk^ %Pj_ 'v K  \DpL> $ $hq!h+P@!PJ%X *Xd'`*P@!X k+X @*p !x+x E%8ǬB$F(( %%8 )%#P W J1!P$$f(E%0G,G$#@G1!@(%8B%8H,H$#HO )1!H)%@()J %@  I, I$#P W J1!P)) %HIJR %H**J,@J$#X _ *k1!XJ)@%P jlb %PLld %Pk^ %Pj.$+`K.l-yK$#X _ .k1!@!@(. %!X+`Ik#@H%#`g $H,! &`'Tt`<84\h Y  `h=<> <@5c$!bB048#!$#$!<@$'+C`04 $8#!$#$!<@$'#$*0&$+8'!0Ɛ58+004 $8#!$#$b!<@$'04$8#B$#!$$#!<@$'28;"$*8&+8+A`29`Ð0c8`Ð0c8`Ð6c8`04$8#!$#$C!<@$'04$8#B$#!$$#!<@$'04 $8#B$#!$$#!<@$'04$8<@$'+`04$8#!$#$!<@$'04$8#!$#$!<@$'04$8<@$'04$8#!$#$C!<@$'48@04$8#B$#!$$#!<@$'04$8#B$#!$$#!<@$'+`04$8#!$#$!<@$'04$8#!$#$C!<@$'04$8#!$#$C!<@$'04$8#!$#$C!<@$'+`04$8#!$#$C!<@$'+`04$8#!$#$C!<@$'"$*@%+@+Gy`c0c8`c0c8`c6c8`04$8#!$#$C!<@$'+T`04$8#!$#$!<@$'+5`04 $8#!$#$!<@$'+`04$8#!$#$!<@$'048<@$'%%I  %%1  %%I  %%1  % %1  %%I  %I  %9  %%1  %%I  %%I  I  %9  I  %9  I  %9  I  %9  I  %9  %%I  %%1  % I  % %9  I  %9  %%I  %I  %%9  I  %9  I  %9  %%I  %%1  %%I  %%1  %%1  %%I  %%1  $*X`!`&` `+X4`!Xkk%k1 $+X`99`#$"$#c$.8c0%Cg0<%8G<%+8048##$!%<@$'%%I  %%1  %%I  %%I  I  %9  I  %9  I  %9  I  %9  I  %9  += %w '','!$ !$A  %8CIG<#8G+GG<Ĝ#h -!8: -!86  T!82  :!8. :!8* %$#8?0m$! ).8%1 $+p PLHD@<$L% % %|'x\E<  O `'$'4'!$7W!$B$a\"8@xxdZ8"8@b$%% -''!$ !$A|''`'p'!$7W!$B$a'`'!$7W!$B$a$|' $8p%@!8$$!$%( %(BF$0 $+0% % $+D@% %$b$%(%0 $Hp%P!H*&%$$( %8BH$1 $+@(%0%;$+F@%0% b-E8+B8@b:B8@<$$p!Ap#8`'#+##"  d<$7@`@@%"@%b<6!W+b !$!"hln< 6!wn< 6+W!$!"  8&") E<`Jc$&d`% d<$(w`@@0/%e@(7%(<6!0+( c$!ehl`?<6$w`dp5  E<`JB$&"@%d<$ w`@@('%d@ /% <6!(+  c$!dhl`?<6$w`dp ''!$ !$A|'%*!&2+TtX  XT+A`#A#ac$#$#t! M$PLDH@<I  += %w '0n ,.8,8C8 $*0E4 e,[ $4+0eQK (!a$$#c0!  `  $ #(%<<!$@$DHL$'<@DHL$'E<ؚE<ܚ<@DHL$'$p$<@DHL$'$%I  %A  A  %%1  += %w '  d-8+8 $$# '0,!$$% %(% %(׀%%%0!$%%0*8$>!8#$1 $+@(6 <5+H 0 $*0E %,X $ $+0%OI$!$#B0!  `  $#(%4<!$8$<@D '48<@D 'E<ؚE<ܚ48<@D '$p$48<@D '$%I  %%9  %9  %%1  += %w '  d-8+8 $$#070,!% %(% %(׀%%%0!$%*8$>!8#$1 $+@(6<5+H , @/8$H/, @/8$p/d!$.$$p!$pd x|+ b-lp+(d%Tt$' Mx T av  x|p!$+b t'9  %A  9  1  %9  !$*8"!8%@/ 9} d; L#p`*X*`+X*E`\!X+k&@ '%pP`<6$7c,c07` ' @$ $,g$,$H($A!0%!4  #H$#k+ #d%%+ c$!0d@L  4 8 <6$7!8!,!0H<'<T!$  ($lptx|X'` $w_ 48 <$&0%0P<8!$  048P<$" <@\`<' dh> +* E,$ ($%`/TLHDlptx|X'lptx|X'DH4!#8!+#!b` w_ B$<@<'D$'$O 8(,04<@j$ (Ep $#( @Xd$\+8% $++* $*@+@`%h''!$ !$ah' $$ $ <@k!$  (BW(!$7  (<@c$$ c ,048$'(!(",!  р \!$$ b K`@"e&9@!b Y / !C B Y " "c! Y  "d& D% c! % '+= %w 'sL ) ,",d& D"0$0e& 4$4e& 85$5e& 86$6e& 8 (c(! Y % '!B&A!, "d&@b$&D@b$&D @ b $&@b!&"!,  += %w '"d&D6@ " e&1@b%&E,@!b Y " !C B Y  "d& D% c! % '+= %w '<!$ 0G< @<B$D' 0D"DLR^%0%8(%@j+Hb (0@<8 $+  LPT<'+= %w '('<'!$ !$A$,<Ꮍ<(,8< 8<, (m $@DH0'4,( E @DH0'<!$ ?$"< oB$"@<l&A ><Ꮍ<P\%('% <<&AV 8) @G<c$% %(G<!$ <Ꮍ<(,8d ec<nj Ȍƌ  $ ,%(% %(%0'%($c$`0 <!$ :$"<{PB$"@DHdnj<enj:fnjgc'% % <)5Pp&( G$!$"(@G<  $  &!# " $t! G<@(C  !#(AJc$%$ av d <TB$  $ b$ a$  $A  $0('0('+= %w '"B0C8`C8 `B8@$"(!'$' !  ' b$ a$  A   $''+= %w '4 "#B0`@"D$ X$OY J  4%0#(+;`8($0%!$+P'@P+XI$`!PFJ+0PjJ1@%P  '!`k1$Xn%XJ%+XD`XCq!Xh!X+` +h% 5  % % 5   h  4h <T!$<0!$  '+" %w tt'! T$x|hlptF<~B$!A!`!0+ E ) >  $*A `0#(`9$*a!89$% E<< $9$ 0$'0$'+0$''+" %w ||'T! $+A?@L  $+AB@"8@!8< @,! H   H$!  % X! !,'$'"8@"8@!8 $''h! 3 "8@@%50! L' '<'!$7W!$B$aP!8 L!_!8 '\` '$'Db$@*A9`D0! L' '<'!$7W!$B$aP!8 L!_!8 $ \` !8 D   '$''+" %w PP'0! H' '<'!$7W!$B$a!$Dh! D*A& X\! @0!D |' '<'!$7W!$B$ah@!"&A+'X\! @! h@!"&"+'|'+" %w 'R|!&'  |"$#$`D$%('%0%!$7W!$B$$*@:8/ 8 " $0p!0 )1)5ɬG< Ɍʌ  ()! *Ȭ%  $ $%X<T!$ $+'/ $+' 8  {9 <%C8k 38 A&#`% B Y '8 8 8H  $+' 8 $$+aH $+' `8`BB8`B 8`BDC%+( 9 ''9 ' 9 '&"&%A!,',  $+'`8`B% 8`B% B%  8`B%  8`CD%B% +( 9 %9 %% 9 %  9 %&A&%A!,'A&"!8'$+' $+'-  8 AB At^  l 9` d`t^  d` b '8 ACD BABdt^ ` \dt^  l`\d`9 \XTt^ P LTt^  \XLP\X b +`d\ Xb +$A'8  Z; Hx8 Z; H&"!,' #7  0%mh  $$7,%" D$HL('+= %w '<@K  :,  $ 048> $$7,%" D$HL('+= %w '4`"0@ $%!0$$+a`#8`0!#8/`0#8`0#8`0#8`0 8<T  @DH('<@!$ $" ' += %w ' " 'C'"  "#! $(,t> ' += %w ' "'C'" "#! @ ' += %w ' "$'C'"$ "#! (,04s? ' += %w ' "'C'" "#! $? ' += %w ' "'C'" "#! $@ ' += %w ' "'C'" "#!  ' += %w ' "'C'" "#! g ' += %w ' "'C'" "#! q@ ' += %w ' ",'C'", "#! 048<@ D$ (' += %w ' "'C'" "#! A ' += %w ' "'C'" "#! $A ' += %w ' "'C'" "#! $A ' += %w ' "'C'" "#! 5 ' += %w ' "('C'"( "#! ,0*B  48<$' += %w ' ",'C'", "#! 048B  $<@D(' += %w ' "'C'" "C0$c8` ! C  $' += %w ' "$'C'"$ "#! C (,04 ' += %w ' "$'C'"$ "#! (,0KD 4 ' += %w ' "'C'" "#`d0 $ $8Gq!Xl%%h'%p% !$7W!$B$+`#'$!dG<玃`T< *B$ < *!$d' dDT $`P\d% %1  %%1  %1  %%1  '+" %w dd'# #8~#(8%(!(B(!0%*8#8%%%(%8`@ `@%(8*PI@!PBP #Xl%+h $Xlqk%!Xim%'% !$7W!$B$+XH~`<\q!i#$l'!$7W!$B$aÎ'''!$7W!$B$'l''!$7W!$B$ `4a\8\g$<#(P*0*0%B  r `P8*g * !  - `P*E * !  - '% %1  % %1  H*0a]!0a+8B0$@p!@ %%P'%X%!$7W!$B$!+@X`p!d#$l'!$7W!$B$aÎ'''!$7W!$B$'l''!$7W!$B$ `4a`H`$X($h!$7W!$B$d''!$7W!$B$% %(*0e7+0<$$(p!h($%H'!$7W!$B$+@&$!dG<T< *B$h < *!$d' dHT$'%% 1  %1  %% 1  %1  %(L*0%]!0%B0+8$@p!@ %%P'%!$7W!$B$!+@jD`p!d#$l'!$7W!$B$aÎ'''!$7W!$B$'l''!$7W!$B$ `4a`a$D`L($%!$7W!$B$h''!$7W!$B$% % %%$*(e9+(b>e$$p!8d$%H'%P%!$7W!$B$+@'c$!dhG<`dX< *B$ < *!$h' hX$dL'%% 1  %1  %% 1  %1  += %w 'd`# dh#(PXT&H *H ׀#Hd$%׀!He#Pd #H$%{#(׀#(d%)$%!$7W!$B$!04'H'!$7W!$B$%*0$;!0%+H? !H# $0Fq!0$4'%`%!$7W!$B$a+X')`HIq! 0G< (,< *B$ < *!$04' 0d,XT $(L'% %1  %%1  ,$% !$7W!$B$04'H'!$7W!$B$a%*X$`!X*+`g>!`) $Xq!X n%4'%x% !$7W!$B$+p(`q! 0G<(,< *B$ < *!$04' 0dPXT , $(% %1  % %1  +$% !$7W!$B$a04'H'!$7W!$B$A%*P%=@!P)+XG@`!X# $Pq!PHM%4'%p% !$7W!$B$+hg*Xq!h0G<`(,< *B$ < *!$04' 0dPXT$, $(# % %1  % %1  += %w '<`U!$ < GB$'+= %w '<@i!$  !$$  '+= %w '4d$f!f$*8 $D$*@D$(<6&(&<W$& $bŒ(t^ $ (t^  X$ @$dΡ eO<}$!0Ɛ0*@(V670@0><@@%!0 $*P!@ʐ +PjF@Ɛ+0B$*P @ K-:` $+Pj@4$ ",@8$!(% E<&H@0(E<  8$%% 0(<@DH4'0($,  * #38 $+8=$$G$@#(!0+8a1#a'$?$8',!8*@e%(%@%(%&@ $   $8 ! 8'@<@(D0H4'%I  %%I  $%1  %%9  += %w '"@<!$ 6$"<'B$"<86& W  %$+(j$+&@"0@@@(<$!(&,9! $$+ b1+A+`#"#A$#$+@9O)-$@ %''!$ !$$+@0'S<_!$  $S$%&0a   $$%%$$%(%@Ȍ $#H(% $@q %Hiq@P K)`p $ '$e! (h$ '$ $(,04A HDL*($Gh*0%'8`<_!$$  $%0$<_!$$`  % %0`*8$%&8  %%% %(%0hh$+88G-$8%8''!$ !$$+HP '<_!$  h9`$"p#p%8''!$ !$  $(,048 <@D  $(,0p48 <@D$/| $Ap'!"dec!$!""&!  $(,0p48 <@D|!$#(`*(%!a8 <_!$$  $%$<_!$a$\  %\%*0%(T\&8F   T\h*0%0'%8<_!$$  T\$$%8<_B$!$X  T\%X%8 %xp%p )% +x(:x !xO%  $(,048 <@dDh  !hdDdh  $ (,d0h  !dh  d$h(,04A DHL%@D$(!(%+ b'A  dhG $@ q'!@     $(,048 <@Dt0$lypxdh *@ tl&.   $(,048 <@dDh  $(,0p48 <@Ddh  $(,0p48 <@dDh  $(,0p48 <@DpldhS% %1  %%1  % Q  %%1  %Q  += %w '0D$''! $ (*(d+(d 8 <_!$$  0$$<_!$$  0,4%8%@X!Xai%% I( +H[ #H)%#H O J$$HI!H+,b %X,d %X)N %H++X`@@%0%@!% $0!0ƌ+(d8<@'%A  !PJP , P %@ $% @I$+P'@$+0(!(%%1  % %1  %%1  %A  %A  '+" %w XX'RE -SM$, I$ $5  !xm@ @#Xd% +`d$`>-M$$5  %% 1  % >$5  <T!$< !$   '+= %X ' "'C'" F<0B$l- % $5  м %% %`d B ,$(xd%H %0!p0%͡%% $ <*Xgz`$`` !`Bh %`h %`i %`j %`l %`@Y `q $#`!X%XC` f$+`bx`q!`, *X1``XTP|\   `c$W`xT|PX\$ xT|PX\$`+Xb:`tq!A"#!  $(,04A !x#A+AP`%%%% % `m$+p$xq%!x *xI  %1  <T!$<(!$  %1  % 1  += %w 'd %%L$L'h`%% H$H'TX\ ` $(,048( <@DlptP'+= %w '><x*0$ p'@ !$C0*0@&(L| 8T$%0$F<%%H%H  F< t> $`G<   #!><ᎀ"p'%!Ah"#! t{N $( lG<   #!h!@`l#%%0%8%@+<\8<_!$$  \`<$%8$l<_!$$0  \`<%0%80l*H %(dHD&Hg9   l`DdH+l"B$@# !dcB % %!%"%$%@ cp $#!b% "L`@|T$P:$"B$"H | S_ $ l"D* C$%(!b8@<_!$$  lD$$<_!$a$,  lD%,*0%0%0%(d&@X48  l84XDd#"G<⎣@"  $"%%1  %9  += %w 'lS| @#$t!E$(!(&e`%%% x xtxtXT\#@%* <k%`dh`'l $S $*PH@$   \TX $(,04A DHLSl p' p'+= %X ' "'C'"Ž#+ b" 'A  += %w 'pS "8<@!x| B $(,% `<_!$$  `%$D$t'  J!x*A`%!"8@<_!$$  % $$<_B$!$T  % T%*(a%&0 dX\  X\dt' %!F<0!$Q <*H*% 4<`   hHL8@d<`4  $(,H   $(fF % $0!0&ƌ+(d3D d8@ _ d8%($0!0ƌ@+ e 3x |'%A  %A  % %A  1  A  %%1  %%A  %%A  1   |'+= %X ' "'C'"Ž#+ b" 'A  += %w 'p/"$#$Xd#H<!$`dh`'p$/  X+"M`!"!0 \@<J 4\H@0%X%` -$4\%0@0H% %`L&h,!hD%+xX!B  A$+"`(!(X$+@'!(!0 $+hD  S_ <+"` \! $L!8D*8F$%0!8+Hg +H #8H?$8#Pd!8g@+h8XTl  $^ ( D2L!+(b`+(A[PlX  $S^ 8*A P+($>(0!0Ȍ!(ŬD$L!(A$+0'(!(H&@& |&H x-|+H( xT!P*L#/p t'%1  %%1  %1  I  A  %% A  %%I  %A  1  %A  %H X+`+&X+ `X+X+`!XI$+Hi 4\%(%0@H%`L%1  1  %%1  1   t'+= %X ' "'C'"Ž#+ b" 'A  '+" %w 00';% $0!0&ƌ+(d%0$@!@+@H><*/@#(@xthB!$C<0$'$;  d`txh4'  $(fF '   '"d`tx*pm#h+p-k#px w$p# D#-@!p`  d`txD@!f+?`s%+S7# R&#ï$!+)L $##!$B$#$!C $($,H `%Ld+(p$t"pC   `\T  \T pd L$(DL ,0T4\@%0/%0D+@   TD+b   \$^ ( T@+ Cj#CD#(# d'$!d ] +AQ`#A# a##$#!a pd #+ b2`  d`txm%+p-#p #x+% #Ï$0!%%%x%!+u`+n`H< ##!$B$#$!C $($,H `%@D$(!(%d+ b<l$t"p   `PX  XP ld H$(DL ,0P4Xx%0|$PXx(_%8+H |   ld $] HX+b   $^ PH*A`(X#d#$c$# '$ ! !$ ] <  %0%($@!@+@x  e P+b^   X$^ ( Px+ CE#C#(# d'$! ] ( l%@D$(!(%d+ b  ; 'A  <T!$<8!$  %I  A  <T!$<8!$  %%A  %($H!H) A  %%A  A  % %I  %%A  % % I  %@D$(!(#a!$  &$T\@(%8uD+H   o pd $] L\+bh   $^ TL*A`(##\#c$# '$ ! !$ ] TL@+ b3% z$@!@rA  I  %I  A  <T!$<8!$  %%A  % $H!H%) T\@H%%I  A  %%A  %A  %%I  %%I  %%A  % % I  %%A  %A   '+= %X ' "'C'"Ž#+ b" 'A  += %w 'x|;*( %8@E$(!($@!@(&(@E$(!( %P !Pj&(E%%0!(H*PE@+PE@<_!$$<  H<<X><*P*@`%P,F<0!$Q <*#`><*#`  $Q 80X`%8)F<0!$Q <*H)  O 807 S 80 LhlTpH'%@D$(!(,+ bhlp+!0 *D H'A  %@D$(!(,+ bhlp+!0 *D H'A  %@D$(!(,+ bhlpH'A  %%A  % %$0!0Fƌ+(hlpH'%%A   H'+= %X ' "'C'" F<0B$<|*A8 @LhC<*(($/!($C+(aM%8  $Q '% ($H!H) +@a%+@G#@HG$@ #Pg!@#XG%X `l%h !h +`K%%8$P!PJ@+@g#@#G$@ #Pa!@# % $` !` +XD`@+ b+(40,xx#(C#0#b$#!|A$C<* DD(D$'! $C+ a#%0 O '% '$@!@+8a+8F#8@?$8#Hf!8#PF%P @K%` !`+X*`@+ btt|x+840ddp#C#(l#bp$a!hA$C<\T$X\`X'$/  HHTPTL4+b 88D@D<8''' T LPT<@D {N $(PTL$H   x| {N $(|xhlp {N $(lphH't'  H'd'  4+A`# ##A#a0$d!LPT  / 'I  A  %%I  A  % % A  %I  %A  %A  <T!$B4+A2 rO<5B4ApB4+A D8'F<0!$Q `F< G<,d  $< =$,dF<$ $+"(`F< G<0d  $<=$0dF<$ $+"`F< G<@4"  "<=B$4" '5  5  5  5  += %w '$7(, 0jd* 48< '+= %w '$7(, 0pe* 48< '+= %w '7$   '!!+= %w '7`F< G<d  $<5$dF<$$+"(`F< G<8d  $<5$8dF<$$+"`F< G<@<"  "<5B$<" '5  5  5  5  += %w '<@!$ @$"/l* < N!$'+= %w '<@!$ $"/l* < N!$'+= %w '<@!$  $"/l* < N!$'+= %w '<@!$ 0$"/l* < N!$'P'+" %w '@''!$ !$A`','!$ !$A@$,`'/l* `'48 <|r* '_'!$ !$A`' ' @$s* @' '_'!$7W!$B$a@' '!$7W!$B$a0'+= %w '48D@H%$H !H(!$*@$N+@$R@@!@h%H4+P7*@4+P7@$4+H7 )$*P$@@P !PCJ%X 4+`w4+Xw`%X<(6!XwZ <$6!PW%Pj S <T!$%0+8O!8 %@9 A0%@($0  $<@!$(`%(!&$0$+0&$0+0&$0 $+0&$0$+0&$0$+0 &8:&8=&8?&8*&8&!8 (,<@!$0`0K%k1 $+X8`(K%k1 $+X2`K$+`k0,t*)*` @4'P'!$ !$4'$$ <U!$   $0,t $*)<!$ $"< B$" 8 %% 8$''!$ !$A ؉ $(0'' '!$7W!$B$aT'''!$7W!$B$a 8<0@' v $,(` 98<@'  ' '4'!$7W!$B$a (`0 HP J   = HPLdP<"0 !0 B4   8<@'C8`B,[@ "0@"0 !0 B4,( <>c$= %%0h$%% %%0h\Hh! h*A H0! ' '<'!$7W!$B$ah F<&C`%F< %h%@\0  , ,(<!$ $  ' ' '!$7W!$B$a,( Pd\%''!$7W!$B$` @<@8o8<@'8<0@'I  `0  A 08<@'$$%0BB,@%<@c$% <$  Mx %% %( %% $$%0BG$0 $+8 B8@%<@c$<$%(  Mx %% %( %%I  %I  %A  *`! 0 &0 04%8%%   = 08<@'8<@'%0%%%8%% h$$%,%%<@c$<$  Mx %% d <T$ h$$%$0 $+8 8%%<@c$<$  Mx %% $d <T$$%I  %%A  += %w '(% , $C0c$$+ `#!  @ $@'$@'@'+= %w '$"@@!TB @!8 $"!!  L(P8HD@<I8 )u)9 )t)9 )f)9 )8)9  $l$I( %H%$"f,('@-$0%0%0!@$*8#8$8 $#@HP$Ba+` #` , P g- $ X8a$8 - H%@*%8+@ '%%1  += %w '\ "@%#`$$oaHLPTH'&AL`#$%(%0%8) 88<_!$$  H'8 $%0$\<_!$$  H'8 %(%0\*@% &@4  \H'4PTL!HP H!8%HF< T H'u  % @%"@$$\@u  D`$0@,$<%!$+0*8,$0%0$!(B$* A ! d7%8$%8  'A@N% (1$*@+H,$H*%@ %1  %%1  '+" %w xx'  d($ p$+(Ae! /%0$%0%8%@I@V% I)%+H*P,$Hi%HI % %(D0%%H%P%!p͡$%H O $`fq $#hpx%B +# - p - x %` .$ h$h-%`1$%h,%+p 8+) $*x@ %8h''!$ !$!%h' $ $ % $,g('@`-$0%0%0!@$*8#8$8 $#@HP$Ba+` #` m-$ XXa$Xl , P - H%8*%8g+@ '%%1   += %w ' "'C'"' "!$*6%c$ $+(*0',$(%(".%c$ D,%('0 ,$ %  ' += %w ' "'C'"D  #'B'! d$$ #d$#($$(!e%#$/@! (c$#c0B$!* "%% %%& e   &" '<T!$%$+0*8H,$0%0%%$4c$`$0ep $#8@H$BY+X #X , H G- $ P8B$8 , @%0 %00`$%8'}( $<!$ $"<< 6&W9@<@B$&"@2E*   $(,'+= %w 'F<< B$&A F<8< @ ) l #E<8ф$'%p<!$ `$"<)B$" Cc$`B !DBB %D %!%"%D$%D@ Bp $#!b%#c$`! !$!B %$ %!%"%$$%$@ !p $#!a%&" '<!$ Q$" <@D HD (' `$+A3` #($#A# /$%!aLPTX\0'E#`#hho $X!Xf&(%HDE< Y DH%%E$H`E<#+ |D <!$ G<@  ""D Mx aG< a  "!b!$|d% l!dld+(D#(D#8?$8E ,D"H!E-9\-95%+hg)*h@ ''!$ !$'$$ $<@U!$   $| $# $q$@!@(\ $  t%+hh $<@U!$   q$|<$ $# $ %h !h-\ $%8RQ  !H)(B$$$HNO )1 %+/&  $  \G<   "%T\,P$ <TJ%(4 $$%x%0%H !H +G<`+  ,+,,(%$+/&  $  \,G< $  "%$T\,P$ <TJ%(4 $$%x%0(%H !H +G<`+  ,+, $*x)9? 84%0+/&  $  \8G< 0  "%0T\,P$ <TJ%(4 $ $%x%04%H !H +G<`+  ,+,$D@%<+/&  $  \DG< <  "%<T\,P$ <TJ%(4 $ $%x%0@%H !H +G<`+  ,+,$] /9?% +/&  $  \G<    "% T\,P$ <TJ%(4 $ $%x%0%H !H +G<`+  ,+,$ /9? %+/&  $  \ G<   "%T\,P$ <TJ%(4 $ $%x%0%H !H +G<`+  ,+,$)9? PL%H+/&  $  \PG< H  "%HT\,P$ <TJ%(4 $ $%x%0L%H !H +G<`+  ,+,$$ $$ $$+= %w ' L'c$$%g$,'%@%!$7W!$B$0&H ,%{<@B$  H%aD$($H%*(d/(D$0p!0&GHɬʬG<`ˌ  ,+@̬d <TB$@ bG<d  !$B$+(b $<?!$   %(H $0Fp$!0ĬĬG<Č  !$L'!$*P' @P!X*k!PFJ&PK@a%w'+" %w 'E<E<E< ''h'!$7W!$B$!L $(E(7<@!$ $"G<`,4  ,#4$#0 #$$d$ !$ $$ dc8<@D 'E$D$B@E&(<@!$ $"G<`,4  ,#4$#0 "$B$!$B   "!$8<@$D '8<@D '+= %w ' "'C'"<!$R '+= %w ' "'C'"<!$ /S '+= %w ' "'C'"<!$ZS '+= %w ' " 'C'" <!$$ (,T 0'+= %w ' " 'C'"<!$ $ U '+= %w ' " 'C'" <!$$ U (,0'+= %w ' "('C'"(<!$, 048<W @$'+= %w ' "('C'"(<!$, 04W  8<@$'+= %w ' "('C'"<!$(, 04W $'+= %w ' "('C'"(<!$, 04Y  8<@$'+= %w ' " 'C'" <!$$ [[ (,0'+= %w ' "'C'"7 @ $'+= %w ' "'C'"7& '+= %w ' "'C'"7 '!+= %w ' "'C'"7 @ $'+= %w ' "'C'"7& '+= %w ' "'C'"7 '!+= %w ' "'C'"7 @ $'+= %w ' "'C'"7& '+= %w ' "'C'"7 '!!B&A!, += %w '"d&B8!@b$&@b$&@ b $&@b$& @b$!$ b ''+= %w '"d&B8@b$&D@b$&D@ b $& D% c! % '!B&A!, %c$d(  !(! &  $ !B&A!, += %w '"d&B8@b$&D@b$&D@ b $& D% c! % '!B&A!, += %w '"d&B8!@b$&@b$&@ b $&@b$& @b$!$l ''+= %w '"d&B8!@b$&@b$&@ b $&@b$& @b$!$l ''!B&A!, += %w '<`!$ v G<@F<\  !"F<\<`!$$ v G<@F<`  !"F<`''$'!$ !$A "% ,%$%*%e&%D%"%$%&%2% .<%(4% :%(6% %(2%( 4%( 6%( F<`$+= %w '`'p'!$ !$AX\%!$*($!(a%8i.85:8('8'!$ !$Ag $ '% (''!$7W!$B$`'('8'!$7W!$B$`'('!$7W!$B$txT'('8'!$ !$Af $ '% (''!$7W!$B$`'('8'!$7W!$B$`'('!$7W!$B$txT'<'P'!$ !$<@'%04+%(48F<\<P'!$ !$aX\`P','!$7W!$B$$d@'F@'X'!$7W!$B$aHL*&% 08'@'X'!$7W!$B$aHL,$% 0@'X'!$7W!$B$aHL&%dc0c,%%lT'@'X'!$7W!$B$aF>080 $#@(A $#PHJ1 1%1 - M- n-'P'TP'!8@ @ PO P 8g 8%8%80,%(%0 $%8)'+" %w (('FDLR^%0%8(%@j+P%@4<PLH $DTZf%0%8H%@+P%@08PLH $ <!$ += %w '! <@!$  !"B0B8@%,!G<@C  !#A A'"#! += %w ' "'C'" !"#! ' += %w ' "'C'" ! %  ' += %w ' " 'C'" <!$0 48* <'+= %w ' " 'C'" !<!$$ (,* 0'+= %w ' " 'C'" <!$0 48 <'+= %w ' " 'C'" !<!$$ (, 0'+= %w ' "P'C'"P* #$8'!$7W!$B$a'8'H'!$7W!$B$aTX\ # $0(,4`dhlpL' += %w ' "H'C'"H( #$0'!$7W!$B$a'0'@'!$7W!$B$aLPT tx $(,X\`dhD' += %w ' "H'C'"H& #$0'!$7W!$B$a'0'@'!$7W!$B$aLPT tx $(,X\`D' += %w ' "@'C'"D'S'!$ !$a@7 #$('!$7W!$B$a'('8'!$7W!$B$au (''''!$7W!$B$aD'('7'!$7W!$B$aD'('!$7W!$B$a<' += %w ' "8'C'"<=>?81 #$ '!$7W!$B$a' '0'!$7W!$B$au <=>?<=>?4' += %w ' "<'C'"< #$$'!$7W!$B$a'$'4'!$7W!$B$aZv  @DH8' += %w ' "'C'"! #$'!$7W!$B$aFǠà!$C+00 $Ǡà!$C+0. $Ǡà!$C+0, $Ǡà!$C+0* $Ǡà!$ B+`( $ǠŠB$+0"6 $GE+(&< $<:$+("82 $dhlptxH'@,D<`!$ $"ǠŠc$+(C0 $lB$"F<(<'+= %w '"d&@!b Y  "d& D%  c ! % '+= %w '%$(% w7% dGM (a  G<@((C  !#A%a9   \'+= %X ' "'C'"! !m '+= %w '  <@B$<!$ $ 5$"<@!$%8='P'!$ !$$='!`+0$!$%0 ,<5HH $X*q#0+,`(,='!"0$d#$$#!C$#a' Mx  |%0%8$ ( )'<'!$ !$!$:$< %%H''!$ !$A$<c$$<ĠB$'$ u ')'!h,0%!$%@ -  <)5(PP $`Kq#@ ,,#), x)'!"0%d#$$#!C$#a' Mx $ |x$1  $1  $1  $1  $1  $1  $1  $1  %1  c$ e(!(# %8 %8 #$+= %w '% % %(%0' !($c$`f Ɣ#(Fb$$$($*$$`  B "% %(dG< Ōh  '($ %gĬ'$*00!0fnj !(@*H += %w '   C,^`D$e$#070!0&:'$D|p'|p'$|p'|p'|p'|p'$I  |'+" %w '1`&d(` &+` &d&`' ' '!$7W!$B$a'''!$7W!$B$a% & % ' ' '!$%*"@'!ABD$0'!($+  B$$0+( $0B0&D@$ ''+" %w '''!$ !$A''!$ !$Ap(Bt  @ @$*a7 A B@D$! .8  <!$av 8h<!$ 8"G<@h  C  h$!#$$CC Alf8,o8(o8$k8 u8p8$# '0!$04!DG<@,  !",%$Vsc8`ec8`ac8`rc8`cc8`hc8`<TB$!$`  @`CG<` C  !# A@p$f8 c8`!$$F<@!$($',$I 48I : F !H'$(+@1 Mx (P| jb |-`@(7, $+88$0% ''!$ !$ $+8'  $@DH('E p!8: 6!86 < !$ `d\"#G<@  $$8 "lh"G<@  ##$?|''!$ !$|$$%!$"(v@\ $$$ @\$PE PEB$  <,% %(%0 (dhlptL'B$c$D04H`G8H@- 1 0!$4+A`%D4D $<`>!$   C$!#G<@d  @&$f8,%0HH8,04D&*@<!$ E<ܘE<ؘ "G<@\  #\"#`#"Dd0h4l< B$ptL'dhlptL'+= %w '048 <@} $ (DHLPT,'+= %w 'TX\ `d $ @,<TB$  @,% %((hlptxP'L$<$%(%H48A`<LADB0- / 4!$8+A`%H8H $<T!$   C$!#0eG<De  D&%f48H,&E*@<!$ E<ܘE<ؘ "G<@`  #`"#d#"Hh4l8p< B$txP'hlptxP''+" %w dd' 6  $ (8''!$ !$A8'  ($,9@04EB$""G<@  "#"("# $(< B$,0'<!$ $ "<>B$""G<@  "#"("# $(< B$,0'<!$ $ "<>B$""G<@  "#"("# $(< B$,0'@<  #'#'"'!$7W!$B$a"#' Mx  @$<(,0''+" %w <<'''!$ !$A $% PT\X '%0'L'!$7W!$B$X'''!$7W!$B$(%%% '% ,0X'$ %H'%  ''!$7W!$B$4'H'P'!$7W!$B$E<& DE<   D4!8 X'$  ,0X' H'%''!$7W!$B$4'H'H'!$7W!$B$`,c$@#'6'5'!$7W!$B$"0+##' Mx $TB$""G<@  "#"("#< B$'<!$ $ "<>B$""G<@  "#"("#< B$'<!$ $ "<>B$""G<@  "#"("#< B$',0 , ,0''+" %w <<'''!$ !$A $% PT\X '%0'L'!$7W!$B$X'''!$7W!$B$(%%% '% ,0X'$ %H'%  ''!$7W!$B$4'H'P'!$7W!$B$E<& DE<   D4!8 X'$ } ,0X' H'%''!$7W!$B$4'H'G'!$7W!$B$`,c$@#'4'3'!$7W!$B$"0+##' Mx $T< c$ $dG<T  T!a# @0@0 $<`>!$   d$ ! DG<  &%C<!$ $ "<>B$""G<@  "#"("#< B$'<!$ $ "<>B$""G<@  "#"("#< B$'<!$ $ "<>B$""G<@  "#"("#< B$',0''+" %w '''!$ !$A $% PT\X '%0'L'!$7W!$B$'''!$7W!$B$0%%%  $'%% | $'$ %p'%  ''!$7W!$B$<'p'x'!$7W!$B$E<& LE<  L<!8 '$  $|'   %0%% $+(C8?,$(% P'l'!$ !$ $+8%P'H8B$""G<@   "#"0"#< B$ $'<!$ $ "<>B$""G<@   "#"0"#< B$ $'<!$ $ "<>B$""G<@   "#"0"#< B$ $'| $ $'%8H!$$(,!'  &$H$$ $ $(,(HȌ!Hʌ+Xi`4   T`,'`T y XL XL Mx P+(D$+(Az%(d't'!$ !$+dhl# D$#8?$(!eptxde$g+@ $< !$  xG<   "%t'%(%8%e$epc$!G< `\< !$d' \t'd'!$7W!$B$|'<<@j!$ $"<@j!$  $"@!8; $ 44 $ '$y  %% (,`84E<@j!$ $"<@j!$ $"<,B$"4C8d4c $G<  ##C<d@c$G<  ##BDCHB#G<`,  ",#"( %$#$<$% @DHL0'@D;  C@<@j!$ $"< B$" C8d4c $G<  ##C<d@c$G<  ##BDCHB#G<`  "#" "$#;  C@<@j!$ $"< B$" C8d4c $G<  ##C<d@c$G<  ##BDCHB#G<`  "#" "$#`84E?''!$ !$A<"=\% d,%>Z%c.% 4?%eF<\㎬'''!$7W!$B$at''!$ !$a'% ''!$7W!$B$''!$7W!$B$a''+" %w  '"0C``(BD8x B8G@abd efc 8 TP%'% 'L'!$7W!$B$X'''!$7W!$B$`'! X'>  'abc jb   'E  8<@ '' '!$7W!$B$'''!$7W!$B$aw   8<@ 'E;  C@<@j!$ $"< B$" C8d4c $G<  ##C<d@c$G<  ##BDCHB#G<`  "#" "$#;  C@<@j!$ $"< B$" C8d4c $G<  ##C<d@c$G<  ##BDCHB#G<`  "#" "$#  $@DH('E@!Bc * !8,( +(!b$G< e'  "'$ %"dDH '%1  %1  %1  %1  %1  %1  %1  %1  %1  %1  1  += %w ',4+"`(!d<+0(!(gG< i  &)' (f%$8$ $$^+8c8!8+@[@!@ G<`   ),* +$*8%+8G@b!c * !8,( $*8%+@$@b!c * ,( D '%1  %1  %1  %1  %1  1  += %w '<d$@%!$&(47&0a#02(X4+0$80!8+H H!H *#`G< -  *.+ -+)#0($DEH('$*0%4+00$0!0+H DŒ!c * !8<@%@H('$H('f$4<@0D*8+8.!H$B$!h c ! d$G<g  $(& '4<@0DS%1  f4<@0tD!$B$! c ! d$G<h  $'& (4<@0G%1  %1  %1  %1  += %w ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h$ P!!(8TX \H4D,' h$ P!!(4TX \@0<,' h$ (84P!TX \,' h$ (,  !8 l$pL'lpL'l$pL'+= %w ' w(4+"y`$!d0+0o@b!dc !<d$d40<04(8+0N0$!0+@DD@Ì!GB !<d$d8<(+ "& $! +8@!ec !<Cc$CD'%1  1  %%1  %%1  %1  1  += %w ',(#de( /(@(!( 0fp $#0$8 ,$ 8 '+L%$*H( $ @c &`L@k T %PM&PKY @n %X&Xla &PLc @l %`&P@d &Xl$Hi *P#@#H#+P@!$H!H&+P"@P!PK,G<-N  +-, .1  %1  += %w 'LH#a,d$0/!($C((8B<@ DP [ (%$H,0PD@<8$*   [ $$$H@PD<8+@" !@H!H+P@@!@ +G<,   *,+ -4'%1  1  += %w '@0,D<8 f@0,D<@H*%*XG``+%*`g,!H#!%+`$d`!%!H+`$[Œ#!!% @ !@0,D<@0,D<!+@$4@!C!@+H$+  Œ!!% @ !d G<玣h  $'& ($'$'%1  %1  %1  %1  += %w ' ''+" %w ' $%'$%*8׀G$׀G$'$*@p%_$%8 *@ x@@|%H%P4!8G*@ƌ   |'Ō !G |!@* x*X`,+$% !$7W!$B$a''!$7W!$B$A% % %8*@G%@C+@0$Hq!P,K%'% !$7W!$B$a$+P#t@h#%!,#$'!$7W!$B$aÎ'''!$7W!$B$4'''!$7W!$B$ `d*`p h%@Q+@=$0 $8'q!P,K%%`'%h% !$7W!$B$a+X&`$!G<玄 $0 $8Gq!X,l%%h'%p% !$7W!$B$+`#'$!G<玃e$0$p!8d,$%H'%P%!$7W!$B$+@'0c$!dG<`!`)0 $Xq!X ,n%4'%x% !$7W!$B$+p(`q! 0G<(,B$'$5+*9@8-'$-8@8@)- %@^) ,)TX\L%@4%@='$ $d `d S <T!$?0@4@ 6 , (8X'Xd`!(\+8e(D@  S <T!$ S HD!  DhHld!$<D$P,<%X&4h3``'&8`'``'lh)%d+X` $ S <T!$ S 9  !++= %w ' $=/  (,0' A (,0'+= %w '< @$%H%X%`'%h%x%12$ -  /.  $#p1x - x%p%p1$##.&p 1.  . p%p . %`%Xr%)% -)$,& &$d0&D&b<6$W<6$ 7*6%(<6$(&(6&(&&d&a<$7<$ WE0&0&8&@K&8#%d&h#3&f&b%d&g&a3<36$73<36$ W<6$(W<6$07&8&@I&8!%d&h!1&f&b%d&g&a<6$7UU<V$%%(%0(%8 $#P(J1XB%`h%1p - p H- X - h%@%@17 $#XA $#`hpho%@ - h k- p - @ %@%0%($!$8'(L''!$ !$%b%><.c$! a$08 , 819 $# 08 , 8 L'! %!$#(` 'H'!$ !$A<6$%><.c$! #$00 , 0)1 $# 00 , 0  '! %!$#(`%/W ! D)> %(0:U %8G0%(;T %8G<$8%(; T%8<$8%(1Q_ %PjJ1%8R^ %Pj<$PW%8CM %@ <$@%8!$"(@L'! C/ '!FB!%>%0<D%8BN%@(8#$%"&'(!0'<T!$%0<D%8BN%@(8#$%"&'(!0'<T!$DLR^%0%8(%@K+HC L0HD, $hijkD*4>lmnoD*4>pqrs D*4>tuvw'h'!$7W!$B$a'h'!$7W!$B$ax'<T!$jT %@H?k^ %XhA Bf %` !`$h&h!h!hDLR^%0%8(%@j+HC PL0H, $$"?'@$@I$0!HI*$PG%@ ($(8, $0'!0Ɛ$0%0&'3A$LC$H@$ e '2'!$ !$AT4'H!$7W!$B$a4'3% %0'!@N$H" $!@L$H" $!@J$H" $!0$(EŠ!$$(L% $0@,8,0!0&Š%(0!0&$0'!8ǠT@$ e 4'TH!$7W!$B$a4'3%!$('!8'H@V$P*%@H$!8T$P*%@H$!8R$P*%@H$!($ $% !$c$d(X''2'!$7W!$B$aX''!$7W!$B$aP'<T!$ ,408$"p<H<DH@<'l   ".@!!"0,`$%70!$4+(8+8 $%0+88!8e %@9 A0%@($0  $$( ' $ S <T!$`$$ <@V!$   4(<4%08$@!@( $ $+@f $<@V!$   84(<4 $$@!@($( $%H<4%(]$+@f $<@V!$   84(<4$@!@(%(( $%H<4<LPTX<'LPT$X<''+" %w 44'%0$+8G 8 8 %% 8 %% 2    Mx '<!$ $"<B$"`0K%k1 $+X8`(K%k1 $+X2`K$+`k*)*` @0'L'!$ !$0'$$ <U!$   $ $*)<!$ $"< B$" %%%b$+@ $<?!$  G<   "!0%0%8L, $0p$!0ìG<Ꮈ   "!<!$ $"<&U@+`G<B$%(%04G<!$   $(0' '' $  <$&WB0 $(   @D,'<!$ &$" $  !!8 LPTX\,' '$    $(LPTX\,'<!$ &$"$ av 4X<!$ 4"G<@X  X""$ av <`<!$ <"G<@`  `""$H0'"8@!8 <2!$D7$H0'<,!$D5$H0'$' $ '<,V!$&$  S <T!$$H' $ lptP'%%I  %%I  += %w 'h 6& wO<c$&#e`\`p"\!`6&@<%&88E6&w`<c$&C`$$< !$&A  "!G<8c$d G<8!$<@.!$&Q G<8c$E($8D5' 2D-<!$ 0$"<8B$"PTX$"$"$" c$+(% $!|DHD  8` ba+("b!AB/!$a @ 8 -  @ -  @ $+0/8`8` ba+("b!AB!$a A j*.   @ X 8,"$+0bX+0ASB# ##a'$!%$  @Cc$C A *"$+0b)+0A$ B# a##$a!%$  @Cc$C A 'I  A  I  A  1  1  1  %%I  %%A  I  A  I  A  I  A  I  A  db$\*A`d , `"0B8&@l@0!xd |' '<'!$7W!$B$a!8 $|!_!8+ l a. l + "!C"` 0  a. `#$H*(bf%%I  %%A  I  A  h 0  a. h"$L*A`>'+" %w LL'0 $+0z$+0$+0]8 #7 H%k"$ +@bF+@AAplƌ#8##a?$'!$  "C$#$E$+0+0%&!#B$# '$d!a$ lp "B$".8 "D%8! 0  $ <++6&W `%0GHB%8HD%8HF%8HIJ %@ IL %@(IN %@(IJR %H*JT %HIJV %HIJKZ %PKK\ %PjK^ %Pjlptx|%l''!$7W!$B$de*% e,% e.% ef2%(f4%(f6%(f g:%0 g<%0 c%$Ĭ(Ŭ,ì'<!$ $" , (40D$+@'X#$g#H'!M#$G!? 0$<o$!$ !$@$)% % @ $,8<&(D  <D@$ > ,@$*A`@$8<&(d ,  ,@$#ADpA@'@'%%I  %%I  %%A  %A  <T!$3&u>?3&u? ss& s8!34!<b&Da&|xt@H@S(p`@3(m`HDP@<L apah iJ %@  iL %@( iN j kZ %PKk\ %PKk^ lmj %`ml %`mn noz%po|%po~pq%q%0qrs%Ss%rctu%u%uvx%x%xy |%< |%ș |  a %a %s% %(%0 %8K%@%H%P0%r%X%`%h<%p%pa%%q?%%q@%rA%rB%rC%r!%!F+%!t! +h!(m$hF%F'$Q%h-o !0+h!8%p%@% } h L P} d |L P} ` xD H} \ tD H} X pD H} %"`%` CDE FGH'<T!$z!$ $$(,0R 48@`` $  ($a$e$$<$8D$4B$0DH  'd ,DH< (8 'd (DH4 $0 'd ,(DH  'd    !8 T$X@'TX@'T$X@'+= %w ' ,( 4"B$"(,,( 0  4#c$#0   4"B$"8'+= %w '$!$  Î `"$ !$*A`'+= %w '$%  (, z` A$0* a(, z` ,(0$% *(@(%0%8&! *( e ,(0$'  !e  !(,(0*@e+= %w 'TP#"c8`XX# a8%p! bB !($*0#0%8%8% %0@ PX @% T*@!B<HŽ#c$ @  <<&$# 4*(*($HL f PX4@*F * HL e X4@* * HL e D'T,* A!$!AB@HŽ @  @,@b$$Lb$8 ,8*C D'%P0* #!(!#B@HÎ `  @A$(@0LB$8 08#$*C`D'+= %w '@<#"D#a8&(C *(b#(",%0M!(##0"(#( %80#b#"$%(!!% @%$@$8*00'!!% '$@ 8 (*@!!% @&$@ 8,*8#C+= %w '("$$ ,$*0E%0'B$ ($ ,*8"%8B$ $ ,%8(+= %w '4 ,!0$ @C$8*(d2E$*0 ,!0<!CC$B$    ,B0<!$!d$ @ ('('+= %w '84#" #$$'! $C ,0 Qg $$ 4$,!0!b ,0 4Qg #$4a('+= %w 'PT`\X$$% %0%8PT<#@ $*P(@`,!"HD@ j @#$PTDH< #k #8`D% %H$PTH Dk $H#"D#a!$$8"!8PT j p 8HD"!!@% PcTB$ `!8HD"!% 8PT i %(D"!wPT h (H#"D#(!,8*@e04PT <g 40*A!8(E$DPT*#!$ <g #!8H(!8L' g L'  g L'+= %w '$!(,4 ,"$0c$B$* b% $c( `% ,c$* b%($B( @!8%(,$!( !$B$$B( @8$< '$c( `!$B$`6!$*A`%$B(, @%`B$*A`% $!(, !8% $!(, 8< '+= %w '$!(,4 ,"$0c$$!( "$#$,6B$* b% $c( `!8% ,c$* b%($B( @%(,8 '+= %w '4"$8% $% (&)&(CF#(a2(=,!0B$$ 4#"c(`$g8# a($$<<('B$ *(C%(,!0B$ !8 8%(4<('$<(',!0$ $$ 48*(,!0$$   48,!0$ 4$`,!0b$$   4+= %w '84#"#(`@!b$ $p $# $( ,f$ ((' ,!0! &$4$d$* $@K@S&PG<%8&8A @N%@(&@ I&8K@T%H*&8'@L&@ $ *8# += %w '$TP#"!a@ $(ep!b! !%(M2!(> ,(a$e$$@$<D$8B$4HL $'k 0HL@ ,<$'k  HL8 (4$'k 0 HL $'k $  !8 X$\D'X\D'X$\D'+= %w '$!(0,  8"B$",00,$!(4  8#c$#4$!(  8"B$"< '+= %w '(!$$c  `"$!$*A`'+= %w '$%  (,  g A$0* a(,  g ,(0$% *(@(%0%8&! *( l ,(0$'  !l  !(,(0*@e+= %w 'TP#"c8`XX# a8%r! bB !($*0#0%8%8% %0@ PX @% T*@!B<HBL#c$ @ <<&$# 4*(*($HL pm PX4@*F * HL l X4@* * HL l D'T,* A%$!AB@HBL @ @,@b$$H!Lb$8 ,8*C D'%P0* #%(!#B@HcL ` @A$(@0H!LB$8 08#$*C`D'+= %w 'D@#"H#a8< &0C*0b#0"0%8P!0##8",#0$%@2#b#"(%0!! @&$D (8<*84'!! ($D 8<$,*H !! @'$D 8<0*@#C+= %w ' "'C'" ! ' += %w ' "'C'"% " + b$!d$+("bc!$$! Y * ('1  %1   += %w ' " 'C'"  "#! $(^ ,' += %w ' "'C'" "#!  <:B$e_ ' += %w ' "'C'", "+ b$$!de+0"!"$fbG< @b'  $"& 'd%& '1  %1   += %w 'p E<$+"`E<c@c$>TB$"6&W@<B$&A @$4$8<@(' 0$6&W@<B$&" T!"B$@!!#!B%a%a%a%a%a@ !p $#a!A%,E<,46&w`<c$&b`%%% 9Ec$ tG< `<>!$8' t8'p'!$7W!$B$atB `tx'd  ax'%%1  %%1   '+" %w 'xdC `L'L'!$ !$L'HDAHDLB  @4xCN`|Ε  @PT@BPT6&W @<B$&A %(|x ` `' t'x ` `' t'3H x"! $!$3 %(E<$! ! $+(bH+AB`#A#"$"<ـB$!"04('%"8(@"8 @<$!(! b$+(b0+A*`#"#A$#< c$!#04(' $    X$ д @4 @CE<8$Gt%8Xx"|#!0  X($0  $`d&P T'%`d!0 &P T'@X0CG<`4C  !#4AH< !$ H"G<@X4 X4C  4$!#$6&w(`<c$&C#@!"B$@!!#!B%a%a%a%a%a@ !p $#a!"%!(!8 ' '+= %w 'F<,'h'!$ !$a<@c$,' F0&0F8$B,@<!$ K$"< B$"E<\0D,E!(e(F+8% <U!$   E<\#aEC`DF$"6&0{<$&Fv@\`G<@X  !"X,(6(&dhl   s @*$ @',,!5 3 X''h'!$7W!$B$a,!,6'%X''!$7W!$B$ `h l<*$ <''+$ !P"T!c$ XG< `<>!$' X'P'!$7W!$B$adX `Xhlp\'<>!$ hlp\'+= %w ',"DC`"@!B @ !  ''@A'+= %w 'P Ld[8$$!(d]8 e"$# '0! d %% %% %LD@@Di 0'% ''!$7W!$B$ '0'?'!$7W!$B$` '% LPTXH'%@C$! #.8TXH'9  $%I  += %w '4J J D!H L8<@ DH ( $,'E'!$ !$a BxC|FB >'$ $$(V ,04l  <B$|4C cPBBCDB<ҥ$|'  ] 0:@$(T,Xl!  <҄$|' TX<*$$ $($,, 4 C|d& $%F0xc%(%09h4P$ h '!2$ <!$ /$"<$"c$ pl8#$!$7W!$B$a,dp0"+p%l=,bB@$"+%<<b8eE?$?T@ @B$B(@<!$ $"?'$ <\.!$ %% %(%%%(% Pf@$+0$ $<U!$   $@0!0 $Ǥxd`<= $=[p$(<!$ $"%1  %%1  $x$(%(%  ($#8?0!8$$( $$_ $+ AX %A '$' f !8x= :de$f+8 $?\Sth$(<!$ $"?hldDdi<=$=\S tp h!$!( <!$ $"$M''''''''''''''$''%%1  %%1  %%1  %%1  %%1  %%1  `Q`hlp\'$h' f = l:`PdLe$Hf+8 $6&W@<B$&" $a%%$`"C` B.@E<$njHgxP$ !d  |6&W@<B$&" $A'xP$ !`  |<!$)$|' $ '$HH )%!H*&XB`%@ `$"$HH )%!H*&XJ`%@ d$&"#!$c$%0% (`'%@%H+ % $+0T0 $<U!$   T02$@H !HI'%8%@$A  $I  $I  += %w 'T `@P\%(&h@ < !$3$  lptxL'lptxL'c$!$% %  0@f4g$%@%H0 lptxL'DHd  <`B$DH<[!$<$D' $ lptxL'$B$@,#<&`(8 Y 5 0,@<#4$\`(88̐h9̐29J9@%P<B!$$ Y ,@<#4$\`%P0@$4l$ptxL'+= %w '$(a$b$@!  ʎ 04% %(%0(,%0$c$`%8! $$<!$ 3$"<8 B$"<6&0<$& "+$ !P"T!$"<gB$"$"<[gB$"!$ 8D$%(%%0%!$7W!$B$ Č0!+%=a H! $!+%<aLHŒ@DE X; cd$c(!ecB(%(%)%*%,%@! cp $#!%P$$,UE<+ "NB!CE (V@8 0Ǡ$+8Hn)ɠ$#(/0!0$$]*Š+(HTĠ$#!0%!*(% &("  LPT4'<!$ >$"+`8#`A#h*o $h# !hm+x*+x## #x$x!x+P'%%A  %%I  %% A  %I  %% A  %I  %%A  %%I  %A  %%I  A  <T!$<6&(c<$& ^<$&> aBb  '|''!$7W!$B$a'|'!$7W!$B$a $'<!$ *$"<ĔB$"%''!$ !$a@!$!Ž @ ($(+"&`@$!e!$+A`,#(#@0/$(!(#A @@  ,$48<'I  1  %1  += %w 'LXTPd`\$ $ P%0@%@%HLXT#P $*`j4)*<8D!  D%$LXTP8<@ !   #8 `8d$TP<%*`)%8,L!PT X<8a  ,*))<) %$T+8@(P!(+@FL 7@H!H')+( X8 %88*)tTPL  X8 0<#"8#($)48*@e*g+L$cPT X@ +!80G$8*+L$BPT X!$@ +!8<0)'! u H'! 9 H'H'%%1  %%1  @H!H&* +$$*@ +@@@!@+H # A# d$$&%%1  %%1  += %w ' +"`@!(+0@(!(gf%$$$$*@+@@@!@i+@ $*@+H W@P!PKl%h +Xl`+@y@@!@r  I$$'+(a@!DAd,$0 '%1  I$$ 1+@C@@!@ :$*@+@;@@!@i+@ $*@+H% W@P!PKl%h +Xl`+( a@!DAd,0 '%1  %1  %1  %1  %1  %1  %1  %1  %1  %1  1  += %w ' +"a`@!(+0W@(!(gf%$$$ i$$ 1+@6@@!@ -$*@+@.h@H!H)+@ $*@+H Wj@X!Xl%h +PL@, '%1  %1  %1  %1  %1  1  += %w ' d$$%!$)(* "&HB #H2))9 +Hw $@P!P+X%m`@X !XlMLm#PJ)Q@#H)) $-( '$*H +H[ @H$!H+XEQ`w)@P !PJ+H* ( '$( 'M)%*P(@+P%@W@P !PK,%@` !`%p %x +p% %1  M W@P !PK)%@` !`%p %x +p% %1  %%1  % %1  %%1  += %w '(`\#"!a@ $(ep!b! !%(a2!(M 0,L!!e$f$$D$@D$<B$8PT X('  L!!$4PT XD0@('  L!!$0PT X<,8('  $40L!PT X('  $(  !8 d$hH'dhH'd$hH'+= %w 'd$+("`@(!( +@V@(!(+ ,$,%$e(+H; @H!H&+P3@%@H!H&)+($%@cw+(@(!(+8"bW@!fc+C@B$%0 '1  %1  %1  %1  %1  1  += %w ',(#de( /(@(!( 0fp $#0$8 ,$ 8  '@P!PK,+L%$*H( $ @c &`L@k T %PM&PKY @n %X&Xla &PLc @l %`&P@d &Xl$Hi *P#@#H#+P @!$@H!H&+P"@1  %1  += %w 'HD#a(d$,/!($C($4B8< @ $%$D(,4@<8 @8!8 c  $$D<4@8 +8"!8@@!@+H 0'%1  1  += %w '($  I%@ @H*%*XG5`+%*`g׀!H!%+`#8@`!%!H+`#/̌)@`!`+H, %X ׀!+@#@@!d!@+H# Ɍ7 @P!PL%h %p +h ' '%1  %1  %1  %1  += %w ' d$$$$*H % ',j*Hd +H @H$!H+P@ W*@X!Xgl%h %p +h%%1  %%1  += %w ' w%a$(*"`0Ž@$!#! @ ($' `#$0$ $48,<'$0*(b"+(b>@!$!Ž @ ($(+"&`@$!e!$+A`,#(#@0/$(!(#A @@  ,$48<'I  1  %1  += %w '"d& Dc!  "d&D c !&#%"!,% '+= %w ' w%a$(*"`0Ž@$!#! @ ($' `#$0$ $48,<'$0*(b"+(b>@!$!Ž @ ($(+"&`@$!e!$+A`,#(#@0/$(!(#A @@  ,$48<'I  1  %1  += %w ' $ Y   " d& D% c! % '+= %w ' $ Y   " d& D% c! % '+= %w '<`!$ 0G< @<`B$D' 0D" !<XB$<`B$!A ! $ B$ $+= %w '<@ $L  L`<$& d%(%(%A$(0DE<&0,AE<  E S <T!$<}%!80*H+ >?0@8> <@@)%!8' $*XF`+X`+8$*X `,` $+(e $*($(&(" G<`   # $(,'+0%;!0Ɛ(+0b/+0A*# ##A#a'$$!  $!#c$+(b!bB$( $(,'%1  I  A  %1  I  A  ("@#* b E S <T!$ nj$($*@$!$*H $<(6!H+@ $4*@$ <5*8$$0Ȍ80<HɌ $'%%P%%( %%H8% 0T< ː<`|@ <7!$$ !| #$!dc c8`$%@#Pb%|@+A`#0%7$0&#A#!(!PA08<% %T`+"k9`DHŒ r  @H+b D% D $$! 8$%# #H+0dLP ǐ "$Y 6!DLHP4nj0Ȍ!H,ʌ+X`  <(!$$ ! $ B$ $+= %w '("8@$CF$* `C0d81d8CFc8`CTd8:fd8ytc84`z"84@$CTd8 ER8 EU8EE8 Dr8 Du8De8tc8U`Crc8Q`Cuc8M`Cec8I`%$%"8@@$CFd8EA8 EL8 ES8EE8&Da8 Dl8 Ds8De8fc8`Cac8`Clc8`Csc8 `Cec8`%%%J$ %% \ $(  %#(+#<  += %w '048 <(!$$ <[!$ $ += %w 'PÌ$+08?,$0,'H'!$ !$$+0T,' (<T!$  (P%$B$*0D<$$<> $$+@C(@!@(G<  &' <!$$ < B$v $TXL'%%1  Q  += %w 'H"8@DCF$* `C0d81d8CFc8`CTd8:fd8ytc84`z"84@DCTd8 ER8 EU8EE8 Dr8 Du8De8tc8U`Crc8Q`Cuc8M`Cec8I`%$%"8@@DCFd8EA8 EL8 ES8EE8&Da8 Dl8 Ds8De8fc8`Cac8`Clc8`Csc8 `Cec8`%%%JD %% \ 8DH  8%#H+#g ,0 += %w '<X!$@  0<@% B$$*(EF8ǀF$*8 ǐ0818BF8ǐT89f8wt83w83ǐT8 ɐR)9 ɐU)9 ɐE)9  Ȑr9 Ȑu9Ȑe9t8Sǐr8Oǐu8Kǐe8G$%0%88?ǐF8ɐA)9 ɐL)9 ɐS)9 ɐE)9& Ȑa9 Ȑl9 Ȑs9Ȑe9f8ǐa8ǐl8ǐs8 ǐe8%(%0%8S,%(%0$ \ ($  (%#+#Q %(%0  += %w '!!<TB$  !"!%(B$$*0F<$$<> $$+@@!@hG<  &' $('%%1  += %w 'TX += %w '048 <[!$ $<6!$w $ B$ 8<@DH L$x ($0"G<@,"  "6& w<@;$& &4O$& !8!,% 'c8`$ 'f!8 Aa!8 Al!8 As!8 Ae!8 $ ' '$ '$8f $8p$!8'&PI @c$  %⌑@$"B8@ !"fB8@"aB8@"lB8 @"sB8@!e!8!,% '+= %w '<"4#,% $*( !(D`8$%0"!B @ $*aT`#8`Cbc8`Coc8`Coc8`Clc8`%%#8`Cic8`Cnc8`Ctc8`C6c8`C4c8`$<B$#8`Cuc8`Cic8`Cnc8`Ctc8{`C6c8w`C4c8s`$<B$n(0$* a+$8<,!$$ Y  $< B$U(0Q #8` #88` At!8: Ar!86 Ai!82 An!8. Ag!8* @Dl,"0!d <TB$@D@"tB8:@"rB86@"iB82@"nB8.@!g!8* @Dl "$!d <TB$@D<!$ $@' $ <, av (@Dl "$!d <TB$@D<!$ $@' $ <, av l8d)0X@D4a8bd <TB$@D'p''!$7W!$B$`>'$%% c8 `%%'%8%@'$H !H)")%%%0%8%@''% )(` @H*%+XI#`OP'!$ $ $"<!$< !$ $  $"<!$+A9`%($'4'!$ !$$$$(#8#@E?$(!e,044 $048$G< `t<@!$$' t4'$'!$7W!$B$x'I  9  %I  9  I  9  I  %9  %I  9  %I  9  I  9  %I  I  += %w ' b a+ Aid#(A#0"7$0!0(5Ő 8  8 8 8(Ő-8$%$+0EH#0A$#8?$(g! *(% a Y  $' b a+ A"d#(A#"$Ab!$* c Y  '$'I  %I  I  += %w 'L ! +(A#0A#8"?$8'!8(-8 8  8 8 8$%!a+0A#0A#8"?$8'!((%   +A]`# A #"$"!a<!$ $; T " #!b " #+ b@$#+ C9!# b#C'$d!#<!$ $* T0"!C0" #$#4"%L 8"$G< `L<@!$8' L8'H'!$7W!$B$aXP'%I  9  I  %I  9  %I  9  '+" %w XX'  ,"@( 9 @ 9@ 9@ 91(-9-$+(Ao$#8?$8!0*(%  Y 4  !8 4$+`%4'D'!$ !$a$4$8#8#(E/$(E!(<@4D $048$G< H<@!$4' HD'4'!$7W!$B$a\T'X +(bs$+Am`LP# "#A'$$!ad <TB$LPX< !$$ L'$` \T'X +(b?$+A9`%( '0'!$ !$ $ $$#8#@E?$(!e(,40 $048$G< `H<@!$ ' H0' '!$7W!$B$\T'I  9  I  9  %I  1  I  9  += %w ' <~c$!bB`B0+ E S += %w ' "! AB ! "$ !$ '+= %w 'H! "8!( S += %w '@"@&A @G<@"  !"! "#d$%+0D, $ S += %w 'D"@0#H%(x "$!0H%  <"$$$$0H*(M$<Ef&0 CG<f  #&c fg$i+P@,8 $G<@  $" e$+8E0 $ S += %w '0"@&A @G<@"  !"! "#d$%+0D$ $ S += %w 'D "!0H% <$($0H*((<EFEg&8 G<g  #'c gh%i+P$@,4 $ S += %w 'L "!8P% CD$,$8%%*(,DE(F<Cg&8 G<g  #'c gh%i+P"@ $ S <T!$ S += %w 'H " !$$ += %w '< ! $ B$@d& DG<d  #$c de!0g+@$0,  S += %w 'D" C8`$<>c$C8`$< c$B8@$<c$H&( G<  $%(4 $+H 0 $ S '+" %w ||'"@&A @nG<@"  !"! "# d$%+0DT $ t"CD$ E+0d8 $!$$ ?# ,0 4$(<@!$ G<@<  <"" $"$"( "G<@,04   ,"0#4$"#$<[B$@D8'+= %w '<< !$$ ?# ,0 4$(<!$ G<@<  <""$"$"( "G<@,04   ,"0#4$"#$<$[B$@D8'+= %w '<<!$$ ?# ,0 4$(<@!$ G<@<  <""$"$"( "G<@,04   ,"0#4$"#$< \B$@D8'+= %w 'd 8'''!$7W!$B$adl"B$l"L'%8'H'!$7W!$B$L"8@"!8% P,\4 S $%I  `> S <T!$<<*C @$d$%& 9(d(%& 4,d,%& /4$4e& *8d8%& %!c Y  !C B Y  0"0c4! Y % '"d&@b$&D @b$&D@ b !&A!8  += %w '"d&@b$&D@b$&D@b$& D  ! c Y % '+= %w '8"4d&x@b$&Ds@b$&Dn@ b $&B8h@ b $&B8b@b$&B8\@b$&B8V@"d&$e& %M@"d&$e& %D@ b $$c$! b 7 4("8(d,%,f0'(0g$4! 4a, b ( $ ,b $A 4<"8<d& D 8c8! Y %<0'+= %w '"d&,@b$&D'@b$&D"@b$& D$e&  ! c Y  !CB Y % '+= %w '"d&$@b$&D@b$&D@ b $&D@b$& Dd%& !c Y % '+= %w '"d&@b$&D@b$&D@b$& D  ! c Y % '+= %w ' "'C'" ! ' += %w ' "8'C'"8 #$ '!$7W!$B$a' '0'!$7W!$B$a <@4' += %w ' "'C'" ! ' !!!!!!!!!!0!0!!!!!!!$!$!!!D!D! ! !!!! ! ! !+= %w ' "'C'"7 S  !!7'AS  !! !! !+= %w ' "'C'"7 S  !!7'AS  !+= %w ' "'C'"7 S  !!7'AS  ! !!!+= %w '!$H' <>B$  x|d <TB$x|d <TB$$&(9ab ec $(, ' < B$4bG<@b  !"a%<<6& W<$& ab4aG< a  "!b E<Մ$0'$8F $8p$!8'&P!@B$       %+= %w 'Hdh9<&d`,0>< <@VB$,0D $H LP0'(, !(,<@!$$ ('$M7 <T!$<~%!8`0+8E<~%C$><~%+8d0!8`0+8E<~%$*H 0( 9 $* $89 $% E<< ,($$ $><~%9 $0$'0$'$0$'+= %w '$8<@DE4I  "C@0C$d$w$,A$ R 4 "W: "0C$$+1`$+b `$+b `A8 .$+b`"0@%!0 !+!8A8 B+A8$'$'$$'<@!$ $"8E<(E<,E<0E<E<E< E S += %w ' $ y v (,'+= %w 'X\%%!$*($u+($!(a%0'$*@ "8&(  $ $+@(\8$`,+0"~8.P T#"`#0#(E/$E!b  .%C,`'$+b=`"C8)`&C8`'B8f@EC8e`\B8Q@E S += %w ' $ y x (,'+= %w ' $ y $ 5- (,'+= %w '4"8@0C<T$&d`D% %(c,0%% %(`%% <@,'($F$4%% %*(;(EF $ 0 0 5 %@%(%0%@%(%0 \  0!aG< a  %!e08  += %w ',DHL4 "B@< Y!$   G<@  C  !#A G<@  8C  !#8A G<@ 4  <C4   !#" %<A % !7!$V 4 "W:!$ $ X'+= %w '8<<!$ $ >< @-"@D"H#L!  <7B$e_ $@-A@%DAHC0$ $%%E` 0!$  @"$&b@$p  (,d <TB$(,< P-"@D"H#L!  <7B$e_ $P-AP%DAHC8$,$%%`,8!4  P"4&C@4HL  P  <\T!*"@><\P! ><`X!*"@><`P! >  '<~!$f$'!'+= %w '"&@P! "@!P! |$ 8(":@0CD$E&!+8d!,( $<T!$  0G<   "!,(%(%% D$!FG<`C  !#A4'4'%%1  += %w 'PD"H# 5 8"$(#$P`(8D,,$&(4(G%(L' 4 (<@DH,(",!d <TB$<@4(d <TB$DH< -"@D"H#L!  <7B$e_ $-A%DAHCLB $'+= %w '<%@8%( $-@0$($<@8*0o0!0Fƌ'&@l׀G<PȌ  $((0PĬT*@T, 8XC*a`XA,p 8\C*a`\AA , 8LAHCc$DD+(# $<@!$  8LG< D  "!D% 8HCa$!G<`,#  ,$#4'<T!$!$8$(' $ PT#8 <'(,DHd <TB$(,<!$4$(' $ PT<' <'+= %X ' " 'C'"fW '+= %w 'TC0`0'L'!$ !$a$4<<-ǐDHŒLÌ  <7B$e_ $p-ADH xpHnj8 '$  D p (; $ `TP<f@c<&G<@&  #&@#ɭ g P TxH (T$PC$,x 4L0H8+P#@%P%X) $*PC@@''!$ !$a%PT'$ $<T!$   PxLHTl$` !` $G<  .P%0  Hx?%(`5  ;<()B$>''4v Hx?P+>%8;><-ǐDHŒLÌ  <7B$e_ $-AHx?PDnjHȌ%H!%8%(|,G<!$048$<@D' !  lPT  <`B$ld <TB$<ڙ!$*$' $ ,G<c$048<@D'  D(  <`B$  <XE<$$$ $ R F<<@-"@D"H#L!  <7B$e_ $D-A%DAHC% %(%0|$`'L$8$D%0%`0,@8L!<  D"<&b@0,@<p x*" 0,@t Y  0,@<p ,!$4 PTX\d <TB$PT< "$!d <TB$X\  (8@ <@!$ƕ @$04@C%,04@0'$ 1 ,$DH<'+= %w '"d&D@ " e&@!b Y  "c ! Y % '+= %w '"d&D@ " e&@!b Y  "c ! Y % '+= %w '"d&@b%&EB8 @!b Y % '+= %w ' "'C'" !|  ' += %w ' "'C'" ! ' += %w ' " 'C'"  "#! $( ,' += %w ' "'C'"( "+ b $!d+("!"dG< e&  "%$ &b$ '1  %1   += %w ' $%$ $d((!0!(Ȍ&@  8('+= %w ' $%$ $d((!0!(Ȍ&@  8('+= %w 'E<E<F<@#B$" $#G<`F<@#B$"@$"G<@F a8R  @A0  -c8L`B$B0 $+bF@'@0@  LDH<#B$"<`3B$"G<@8  8""hX'dF<0F<4\Dc` `L \T!` !8A d> \<#B$"< 'B$""$G< `@<<@ !$$  "$,(x* $+@f! $*@ 8'T'!$ !$8' $ $<|&B$"G<@  ""$'<(4!$$'+= %w '`C0,$+ d$$+ d8 $+ d8\d+ d8yC0`\ C0`\d\% + YF<X& bdc   T#@G$@!@ #0 0'L'!$ !$0' $"$F<|$ Z, ($B$ + " $<%B$"G<@  ""('<4%B$"G<@  "" '+= %w '\#t"0,$+b `C$$+`C8 `$+b `C8`pC+C8`"0@p "0@pCp%+q`hd$d$+ % >l $Ni (0TXh!<B$T'  X (T0Xh!<B$T' n 7h"=<$B$"G<@  "" '+= %w '0"0@Ž$(, 45 @ Ž$(, 45 @'+= %w '( %, '(*A]`$! b$*0B$  <~$!dc`c0+ E<~$`$*(a 0%(9$*!89$% E<< $$><~$9$ , '$, ''+" %w xx'0a@ L' '<'!$7W!$B$a!$\`HB$@HDTb!@ @!8 DD,!  '+= %w '8"0C8` 04 $Ni @EK9`&K9h`+X""`)8#X"!`d#pMw$N!+p 4D 9&9o*p4+pl#pl!x#Ç$` !`l+/@L< +@'>ip!H#$'!$7W!$B$aG<`<!$ <!$' %!$7W!$B$%'P'!$7W!$B$ax|T'% %1  % %1  %%1  % %1  %%1  % %1  %%1  % %1  %%1  %1  1  ,'+" %w '`h+"@`L$ ap\! H$%8'%@%!$7W!$B$p+H') Hap!%G< <B$ <!$' L$\`hH)$%!$7W!$B$!'P'!$7W!$B$!%l)%H*$!$7W!$B$A'P'!$7W!$B$A%)%8@+P@Php!H*$'!$7W!$B$A+P'@Pip!G<@<B$ <!$' L$\`%*P(@%;'%!$7W!$B$+P@hp!H#$'!$7W!$B$atÎ''P'!$7W!$B$P'''!$7W!$B$ `*`c8\`%L$ )%*P(@%<'%!$7W!$B$+X'A`ip!H#$'!$7W!$B$atÎ''P'!$7W!$B$P'''!$7W!$B$ `*`\`%L$ >xT'% %1  %%1  % %1  %%1  %1  1   '+" %w 'td$x%%&(gj&0#02(l+0$L$@ph!P(HK%%`'%h% !$7W!$B$a+X`%!(#@G<`<B$ <!$' txL$hlH+$% !$7W!$B$a'\'!$7W!$B$A) #0($|}`'$*0%Cl+0aL$8ph!HH*%%X'% !$7W!$B$A$+H+K $!H#$'!$7W!$B$a|Î''\'!$7W!$B$P'''!$7W!$B$ `*`c8x%t@K`'$`'!$7W!$B$'\'!$7W!$B$%txL$hl|*@+@bp!iH$$'!$7W!$B$c$!iH#$'!$7W!$B$aÎ''\'!$7W!$B$P'''!$7W!$B$ `#a'!$7W!$B$aG<㎚`<!$ <!$' txL$hl|%% 1  !$7W!$B$'\'!$7W!$B$%txL$hlp!#H$$'!$7W!$B$c$!iH#$'!$7W!$B$a|Î''\'!$7W!$B$P'''!$7W!$B$ `#a'!$7W!$B$aG<㎞`<!$ <!$' txL$hl%% 1  %1  % 1  %1  += %w ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h$Yn P!!(8TX \H4D,' h$Yn P!!(4TX \@0<,' h$Yn (84P!TX \,' h$Yn (,  !8 l$pL'lpL'l$pL'@'+" %w 'DwLX+"`L$ apH! H$%8'%!$7W!$B$T+ 'ap!eH#$'!$7W!$B$adÎ''<'!$7W!$B$P'''!$7W!$B$ ` a`d$dXT`TXL\+0L$8pH!8H$%P'%X%!$7W!$B$!+8Dp!hH#$'!$7W!$B$adÎ''<'!$7W!$B$P'''!$7W!$B$ `a`d$d\`L+ "LL$(pH!(H$%@'%H%!$7W!$B$+((5p!H#$'!$7W!$B$adÎ''<'!$7W!$B$P'''!$7W!$B$ `a`Cc$Ch@'%1  1  % %1  %%1  %1  1  += %w '#de(/(@(!($ 0fp $#0$8 ,$ 8|'H)$,!$7W!$B$!(0'x'!$7W!$B$!%% $*H( $@c &`L@k T %P&PjY @n %X&Xa &PLc @l %`&PL@d &Xl$Hi*P#@#H#+P;@!H$L $XHq!,H+$%`0'!$7W!$B$a+X,%`H*q!(G<鎰  <B$, <!$(0' ($ L $% % 1  %1  '+" %w xx'#a,d$0/!($C((B  p (%$,0'H($% !$7W!$B$8<''!$7W!$B$  p $d$;+@"@!@L $P!q!PHK%%`<'%h% !$7W!$B$a+X )`$@(q!8G<莻4<B$ <!$8<' 8$4'%% 1  1  ,'+" %w 'pl\t`h!$7W!$B$!'P'!$7W!$B$!pl\t`@H*%*XD`+%*`dP!H#!%+`'L $hqL%!H.$'!$7W!$B$!%+H' %!H#$'!$7W!$B$aÌ''P'!$7W!$B$P'''!$7W!$B$% ` apl\t`pl\t`!+@'iL$Hq!H)$'!$7W!$B$!!C+X'U`q!H#$'!$7W!$B$aÌ''P'!$7W!$B$P'''!$7W!$B$% `#a'!$7W!$B$aG < h%!pΑ  > < h%%@ #Ph $*`j $!`H+hlW+hPL<,# $! #8h`D8e,4+A6`#AH!(#0"7$&h!<+@L@PL  < h%%@ H@P( $8) $84!@Elp"$h> < h%,<HL,4+(80#(H!8#@dG$hh!<+P'@L@PL  < h%%@ %% % +(iH#(i!@##$#!g+8H@P +@'>ip!@#$`'!$7W!$B$aG<`<#!$@ <#!$H`' HD4@%!$7W!$B$%`'p'!$7W!$B$at'% %1  % %1  %%1  % %1  %%1  % %1  %%1  % %1  %%1  %1  1  += %w '+"@`$ ap|! $%8`'%@%!$7W!$B$+H') HDHap!%@G< <#B$ <#!$@`' @$H|D)$%!$7W!$B$!@`'p'!$7W!$B$!%)%*$@!$7W!$B$A<`'p'!$7W!$B$A%)%48@+P@Php!@*$`'!$7W!$B$A+P'@Pip!<G<@<#B$@ <#!$<`' <$H|D84%8*P(@%;`'%!$7W!$B$+P@hp!#$L'!$7W!$B$aÎ'`'p'!$7W!$B$'L'\'!$7W!$B$ `,*`c8H|D84%$ )%4*P(@%<`'%!$7W!$B$+X'A`3ip!#$L'!$7W!$B$aÎ'`'p'!$7W!$B$'L'\'!$7W!$B$ `,*`H|D843%$ >t'% %1  %%1  % %1  %%1  %1  1  += %w 'd$%%&(g8j&0#02(+0$$@p!P(K%%`l'%h% !$7W!$B$a+X`%!(T#@G<`PD@<#B$ <#!$Tl' T<D$@P8+$% !$7W!$B$aTl'|'!$7W!$B$A) #0($}'$<*0%C+0a$8p!H*%%Xl'% !$7W!$B$A$+H+K $!#$X'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,*`c88<%@K'$'TLH!$7W!$B$Ll'|'!$7W!$B$0%<$8*@+@b0p!iT$$Pl'!$7W!$B$c$!iL#$HX'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,#al'TP!$7W!$B$aG<㎚`<#!$TL <#!$Ll' <$8%% 1  TLH!$7W!$B$Ll'|'!$7W!$B$4%<$84p!#T$$Pl'!$7W!$B$c$!iL#$HX'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,#al'TP!$7W!$B$aG<㎞`<#!$TL <#!$Ll' <$8%% 1  %1  % 1  %1  += %w ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h$} P!!(8TX \H4D,' h$} P!!(4TX \@0<,' h$} (84P!TX \,' h$} (,  !8 l$pL'lpL'l$pL'+= %w 'dwlx+"`$ aph! $%8L'%!$7W!$B$t+ 'ap!e#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `, ad$dxttxl|+0$8ph!8$%PL'%X%!$7W!$B$!+8D40p!h#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `,ad$d|0l+ "L$(ph!($%@L'%H%!$7W!$B$4+((50p!#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `,aCc$C40`'%1  1  % %1  %%1  %1  1  += %w '\X#de(/(@(!($ 0fp $#0$8 ,$ 8PLD')$,!$7W!$B$!(0'@'!$7W!$B$!%% $*H( $@c &`L@k T %P&PjY @n %X&Xa &PLc @l %`&PL@d &Xl$Hi*P#@#H#+P;@!H$ $XHq!,+$%`0'!$7W!$B$a+X,%`H*q!(G<鎰  <#B$, <#!$(0' (X$L  $P% % 1  %1  += %w 'hd#a,d$0/!($C((TBX\ `l * (%$d,0l`\XT'($% !$7W!$B$8<'L'!$7W!$B$  * $d$d\l`XT;+@"@!@ $P!q!PK%%`<'%h% !$7W!$B$a+X )`$@(q!8G<莻4<#B$ <#!$8<' 8l$`XT4\dP'%% 1  1  += %w '|H@<!$7W!$B$!@`'p'!$7W!$B$!|8@H*%*XD`+%*`dP!H#!%+`' $hq%!.$`'!$7W!$B$!%+H' 480(%!#$L'!$7W!$B$aÌ'`'p'!$7W!$B$'L'\'!$7W!$B$% `, a|08|04!+@'i$Hq!H)$`'!$7W!$B$!!C+X'U`D8q!@#$<L'!$7W!$B$aÌ'`'p'!$7W!$B$'L'\'!$7W!$B$% `,#a`'HD!$7W!$B$aG < h%!pΑ  > < h%%P #P $*`j $!`C+pb+p[l\L#m$a!,' Mx  #8i`D8fLT+A9`#Ah!(#8&?$'!\+H l`pl  < h%%P h`p( $8) $8T!PE"$> < h%Lh\lLT+(XP#(h!8#HhO $i!#\+XG`l`pl  < h%%P %% % }+I`#!(d#8'?$8'!8+@E`p  "d& D7 ! c - "d&$e& %"@b$& $$$e& c! Y   ! C$B Y % '+= %w ' "$'C'"$ "!@$  (,04 ' += %w ' "('C'"( "! $ @$L  ,048$' += %w ' "'C'" "! ' "!#""## C'$ D#b!!$ += %w ' "'C'"b a+ Adc#A#(# $'$$!a 'I  !+= %w ' "'C'"7@ #+ b"'A  <T!$<$!$  " !#A+= %w ' "'C'" #(*8%(!+0b+0A#0#7$0& #a!$ 'I  A  += %w ' "'C'"`b a* "` ``  %%%-E<,B$"G<@ F<  #!"#<5B$"F<0'|'!$ !$A$4<c$0$<< $8D<$@L< $HT< $P$\<-$  ' Q " @" ! $'"!  += %X ' Ž><.c$' $6 G<` d e  !$" %a b$a $' $'+= %X 'G<@"  " '!$i  aG<d  "$bc`'  += %w ' )$+P ^@+P!X@<lP:\##((/$%!A$   $<%(\ %%%(% njP :$ 'BP+XI` $Pjq!H*1(!(!% % 5  % I  % %A  += %w 'T d@Pd(%(4'H'!$ !$g)%+X #`0 $<`!$  0G<   "%TH'%8%H%PdP($@p%!@ G< ,<`!$4' dP(TH'$,4'%H%!$7W!$B$fŒ+@Oƌ@p!0ŬɬX hlh@\ce\B@+H2 c(p!e0bbl``$ptx|L'tXx\|`L'dthxl|pL'%%5  %5  += %w 'Pd(4'H'!$ !$fnjȌ%Ɍ+P!@0 $<`!$  0G<   "%H'%0%@%HP(Ȭ$8p$!G<,<`!$4' ,P(H'$4'!$7W!$B$e+8:8p!(d T@(T@84\XX %cbB8+@bp!C0`AA%\hlp$tL'%5  %5  += %w 'Pd(4'H'!$ !$fnjȌ%Ɍ+P!@0 $<`!$  0G<   "%H'%0%@%HP(Ȭ$8p$!G<,<`!$4' ,P(H'$4'!$7W!$B$e+828p!(d T@(T@84cXbB+@"hH&p!@(0hlp$tL'5  %5  += %w '@( 048 <Dś $04 $D$  $(HLPT,'048 <Dś  $(HLPT,'+= %w 'Xd,<'P'!$ !$$<fnjȌ%Ɍ+P!@8 $<`!$  8G<   "%P'%0%@%HX,Ȭ$8p$!G<4<`!$<' 4X,P'$<'!$7W!$B$cb+(wap!A`"d#G<`\ #  \%# %C8`0(  \Ch0&a 0(,%(`%00(%(%0`,0'0 `C8`&`$"'C8` `<6&w` $"B8@@ B8 @ B8 @ <6&W@ $"l@ptxT'%5  += %w '<"#$ !<}4$$ <}B$$ $Pi. $+PI@( $+PIa@$'9$'0  $% "B4"$% @$#(/0P!(x%%>%(%0('9l'@0G(g?8  %>%(%0x"B$"$% xC0#@#$#!0P!>%(%0)*9&@+ $+PI@.'9+'0$% $% @$# '0P!%>%(%0xcg z@@$# '0P!%>%(%0xL\ $+PI@?*9@['9o\'9'@0G(|gC$+@2A8B8C8nR $% @#$#!0P!A%>%(%0x $% @#$#!0P!A%>%(%0xQ8-b8z8= $% @#$#!0P!A%>%(%0x $% @#$#!0P!A%>%(%0xA$#B0!bTt(8$%H%!$ !$%Ht$(H(<hp 9@P95 $$- (,0``@P $tĬŬG<Č  #$ìx x@P>%(%0E@Ptx $$M (,`@P $tĬŬG<Č  #$ìx x@P>%(%0x<" @t<c$ x"G<`t td%  "$# %b#P@  A@Px x@P>%(%0  /%>%(%0x**9@$ +*9@$?)9 $> A$#B0!b $(n 8,04%>@Px^*9@'0 $% $% @$# '0P!%>%(%0xn{*91@|'9I @#$#!0P!A%>%(%0xWt  @Px x@P>%(%0;H` I  x{$ @$$#!0P!Ax%%(%0%$$+0*8*8x$ P@ `$H(n 8,04x%$@Px?| '?| '<!$ $"%(%0 '+= %X ','!$Ž ŽŽ(i i@$$ , .@D$T+(d0+(A48#A,#"$"P!AD , D%e%X\`dH'PT $ <!$ $"<"#B$"T "G<@P  P""X\<B$`dH'X\`dH'E,A$#(/0!(Lǔ$%@ L%@%8%%(%TP "!(t v  :$*8)'8>-'88(0 "' $%i$*@U(8" 5($i!8K "5($m(8"$$($s!88 "5($TP%;:&8*( A!@"'8@TP%)":!8 @$"L$% @$"L'X\`dH'TP% X\`dH'#A+(A%<<!$ "$"<B$"< "G<@P  P""X\<B$`dH'%%9  $I  0@L"B$"$% LB0",8"T4#CB$#8$P!dG<D4$  D%$4%X\`dH'<!$ $"<"#B$"8 "G<@P  P""X\<B$`dH'* a(! b$*0c$   ,D$_8$ $+0$$+0$+ %$I  %9  += %w '# 0,9$+8'(080, +(  $( '%% $( '!$#(/0!  0,+(#(A+0E%%0 $@p!Hb)!@(%B$*8E<6*8$ $$( '%%9  += %w '7   $% '+= %w ',d$+018)0+(88%!8 ! !8!,%8 % 8 8 8T0efƌ&(f&($eeab$c   ,G<  #%0m   ,G<   #!I8F08#Babc   ,G<   #!abc  $,G<   #!('%%1  %%1  %%1  %%1  %%1  $a!$*("+("0!0ƌ $*0&$+@ 0!( (%1  1  += %w '0de(v$8!8琁8n$@!@ *9@ J9 @*9@*9@*9Y@$P !PKl9m9 999D+ G< A  (!H% %X%@(j 0<" @(<c$ 0(%G< '  %&$ '$ #+ b]"$4,'(I$8!@$P !Xkl9=$ $!!K 0$ b+ "*d! G<  (%b+ "a!'G<@"  +"+$4,'4,'1  % 1  A  += %w '7    #$$+ b" "C(W`#D$ ! B$(!c"bB8*@b"0b@ $b$b bb$G< ef  "%$ &bd  '<!$  $"<.B$"CB #G<`  ""<B$'<!$  $"<.B$"CB #G<`  ""<B$'A  += %w '< "$#c08!%8t @ f$*837$*808 1(  0',7$+ $$a8f8 $@DHLP0'$@DHLP0'r$*8n8r8 $@DHLP0' $@DHLP0't8v8x8p t ]  {&8%%"$ $+0b"$$+@"$ "$+@"$$ t ,  $$ $+($$$+ $$ $$+ $$$ @%0p!@DHLP0'@DHLP0'@DHLP0'(M $ $+H $$+C $+? @DHLP0' $@DHLP0' $@DHLP0'@DHLP0'<!$ '$"`E<$DH$L8'#8!`CAc8-`Csc8)`Ccc8%`Cic8!`Cic8`E<,E<(DH$L8'#8` S += %w '0 ab+ "d$0p!08%p!0ǐ%@ 9  9 +0"x$!0$+A $0!8 !8  $( 489!,<,'$0$$0+ D$% 08!Č8Č0 Č8' !0C+ #-D$0%p!0 %#$+D @48!8!,<,'`> S 8%p!0ǐ88+0#%5  %5  5  5  += %w ' ab+ "3c$(p!(e%0p!(f$+8 88%&88+0  '$ '%5  5  += %w ' ' +'+= %w 'b d$*(C8`C8`C8`%B%N/@A8 & Acc0)`    ,'*A *" '$'$'$'   & "& #'*0#"!0#B0@8+@$@!@*@$+8"8!8*8$%'$'1  %1  !$*(""+("((!(*(e%$+0(!(*(!AC'$'$'%1  1  += %w '!!0$+A.@"8@ "8@$' !, '"8@ "8@$' !, '!8u ' !, '"8b@"8.@"$$+b @"$+b@"$ $+@$_!8!,D$+ d D$+d`C$ $+`$_B8B,&A ' !87 "$$+b @"$+b@"$ $+@$_!8!,D$+ d D$+d`C$ $+`$_B8B,&A!8 '' !, '<T!$<8!$  += %w '  ' S %#+A@$('`> S += %w 'dD%4$D%*($b+("t4b$#p'!CX $  #(Z`$+ aZ$$'$ $#(a<$! &@ AG<  '(H$ #P!J%+` 0T@ @#`@Č<Ō$8nj+H$ dtp $@!('8`%%H$!`! 8,H4pd$ $T%8%0Y%9`(# `$#`("$+"!`$!%$%%%%%<T!$ S 5  %5  %5  %5  1  += %w '7  b+ "b!A!'"B8@!''1  += %w 'p+xd|0V0SD@0,G<$TX\HLP$*@<0$`*'dT'hH'l`'p$+$0*@,*H& 4,*P&w@ b+@!hHX!@(+H" TP!H*)*@(%[b+@hH!H($)+P@\Xk%8!8T+`K<8 $<@U!$   \T4x@|D8<Xj%P !@  0$0PL%H+P@ $e$%0D'%8%!$7W!$B$p''!$ !$p'D'X'!$7W!$B$+@$ $P&q!HG<lh 4  4P D (,4 <2  "C(`$@$+ @ "#+ C$$0p!0%\`dL'\`dL'8p!0ǐ$+@ 88nj%G8 8ƌ+8$H<d 0<3$!(*(@\`dL'$1  м %%5  %%5  += %w 'H@a$,$"pF<3B$!A! A b*Al@`Î֎Ď#(A#"$"!a 8!A <+04,(4 `+@0!0ƌ+H +H #0L!P&#X_ $ ! dD+`jlDhl <~$! `0+  E<~$$9$%8 $*0 0&(9$*889$%8E<< $$><~$9$8_'8 ,($ +@d !c}c8`#$ <@DHLP0'%%%(<@DHLP0' $Hp!8$B$*8A!8%@0 - 9 $+@(<6*@$! 08$*8$+8#f#0$b!D<@DHL$P0'%%I  %%1  %%9  %I  += %w 'L"B PTX $(,04] 8 LBB$<@@D%%%\`dH'e$(!(%$*(bc$+( $<@V!$   D%%(%%+= %w 'HLPTd"B hl $(H',0$4] 8 \d!!$D<X<TB$  Dlh\X%8 ptx`'$*@-@@*H +H8 H!PJ@%+X+`@!@+Xh"`+X `!H)#X +#@HG$@H!@G<@*  (*(ptx`'% %I  %9  %%1  %%1  += %w 'L"B PT $(,04] 8 LBB$<@@D%%%X\`H'e$(!(%$*(bc$+( $<@V!$   D%%(%%+= %w 'L"BPT  $(,04] 8 LBB$<@@D%%%X\`H'e$(!(%$*(bc$+( $<@V!$   D%%(%%+= %w 'X!PC$P%$(,0'@'!$ !$@`$#@'G$@(!(#+8f,4 <T!$  8G<   "!,4%0%H$!"AG< A  %!E<'%I  %9  %1  %%1  += %w 'H!D"$DH$(,@ S += %w '- <! ! @aX\`L'-< }6& W><]B$& ",4(abd <]B$'  (<4@DH += %w '<@ 3  ,@C/<6& w ``",!( b  E B$'j< (, 0Q @%%   < += %w 'd  E,+("7,$( %<%%8%(%0 s!8 <%!$ TC#CDEB#$%"< B$X\`dL'< &!$ TCD!#CDEB#$%"< B$X\`dL'X\`dL'a8r a8F a87 AC%aC%aC%a AB%"* % "0+$&CB8@`!4$$7 $ > (,'(,'(,'+= %w '$$( ,Q ( $+A @"8@E  %S` %%G ,48$@ LPQ (*@0$+b `C8`E  88FGAt^  t''!$ !$At'$ f$$@$ ا $( Mx  A @$8  ) 8  <0<%  D %@,  T! !8  L<8XP8njH@ #7 LH8Ō @ #7 L8 $+@O*-9$@ +@W&X*+H*j-$P %H*  %T'p'!$ !$! $+H  T'  <88 )4 $+& 8 A8 A8 A 8 A8m AB %"+-> 8>  ):  $+& 8 A%"8 A% 8. A% 8 A%  8 AB 8 A% %A+->  8(  )$  8 8 ABAt^   b  !8-> W4T8X T88 DF  C 8XT48F$*8 0818BF8T89f8wt83w83T8 R)9 U)9 E)9  r9 u9e9t8Sr8Ou8Ke8G% $%88?F8A)9 L)9 S)9 E)9& a9 l9 s9e9f8a8l8s8 e8% %0%8Q% %0H( \ tH(  t%#(+# % %0$D 7dhlpd <TB$dh  $% l@p<!$$d' $ ' -> ' 0<$ D T4%0%8XP00 <@!$ $"@"8;@`P!  T!  d <TB$ r8fe8fm8fa8fi8cnc8`'$%I  += %w ',"0C$$+`$C$+`$ C$$+` $%$+ $+ Jd8B8@$( n (!!80 'a, $+" A8 (!A8 (aA8 (aA8 (aA8 (ab%A!,0 ' $+#:  $+" A8 (!%'A8 (A% A8 (A% A8 (A% A8 (AB A8 (a%%A!,0 ' A8 A8 ("!(!t^   b 0 '$+( e8Bc8 `Re8:e83+ `C$$+`A8 D$+b `C8`(!+!8C84`"0@% !0 (!(+A80 '$+`B8@(! $( #7 !,0 '0 '<@!$ $" P. *%`% %(|L',| S <T!$$$+@t!($$$($g $8%  8 $e$0,1 8`$$0+P(E@,!XIe%%E<&C` E<  E  `D.8d8/B$c$(!$,+(8<08 $<T!$   %(% <0&$0!0ìG<㎱`Ì  "#%@E<&"@%@E<@  E S 'G%c$`%P#Xk1 $hl$1x k- h - x %X?0"!B   <@!$  "G<@"  #"# lptx|`'a$$+d <TB$ <@VB$< !$$' $ |<@c$  "!9``'&d` ''!0E+@fx  S <T!$<!$ $"<1B$"lpt S <T!$!$PT <]k%!PKJL-eP!HI $( Hi7P> <]k%!PKA*,@7a$DHbW$   <@!"!$,%L "!. <B$PTH'@%%* a0LD o  d(LD0<&,!EC!$%$,d80; LDd%$<,(! $$d80L$$% c80`0L$ $% 8(f$@GHF J, @ %$0!( H if#0f!0%,*0L "!. <B$PTH'<!$P<!$TH'PTH'LD!7D <$ . LD,<$+0b8+A2`0$@C$$#!% ;$#"  L"D#c*C@#PTH'L "!. <B$PTH'I  9  0(L8f+0rm   PTH' ab. <B$PTH'H!0Ĭ$!$Df׀<), <$1  %<$1  <$1  $1  4L$@< i)- m   PTH'% $1  += %w 'Ll8@   (A@PbXa+("Le!(Xd$XbPe&(% \a+(ATeLf\b#8%?$8Ph!0#(#&@X`\`$`b!$aeG< |ahb  &!"|f<8A4C `dE<ۥ$njcs <aG< @a  "!@b'$@g@%!@ &P$ @c$  $@g@%!@ &P$@c$  %8D4B @EE<$njB  c  `$HHH )%!H*&XE`B$@ " $$m  D"B0L#M$"%c0&b@%NE'+" %w xx'L"@% P!'%D@<"@!B  @L+("G<P  #&PDF<Z$ c0d8  0 ><Z$! ><Z$d8  d8c8`!$$$'$'%I  += %w '' $ L  $*" "8@"8@$!,('('+= %w '%  @ G<$! a$"(@'+= %w ',$(%!"*0#+0#!0Ɛ%8, @0G<$!0ȐƐ$##$"!#ax $*A[` ,$(G<$%1 9 00> <Z)%!0&Ȍ> <Z)%$P - P%@ $1$91 -N`@> @B<>@,.02.`<>@B$&(*)0,% d v K dd$+(Ay$&$7$0=D!H#PA!(p+0ii+0(b#07$0h!0&*X`%8 &P @H  $pdHDh<>@B468:6!0'$$4 ,_ $t`'t`'% $1  P!PD   KLMH%8$ (,@!@ +P@ ,@ $%1  $1  %% I  % A  I  += %w '$+(A$&$7$0&9#@A!(4!'(0+Hb +HAz ##$a!*0%8&0e"  $+0ba+A\` #07$0!f*0%8&0e  8:<>(`c$f$ ,`!$"#$%'% $1  8!8ȄɄʄƄ%($ &,0!0ǐ+8g , $%1  $1  I  9  I  A  I  += %w ' d%$+(A>e$&$7$0&#8A!($$+@-$  $  e$ee ,!bE$%0%!$ !$DFbB$b'% $1  %%1  I  += %w '$w( $,: !$%($+0E/c$$7$0#(E!f,$+8f$  $ %#$!$ !$adb '%%1  %I  $1  += %w '$( %,-(!(!00$+0b%+(A$#A#a%$/$%!  , 'I  9  $1  += %w '4<T6! w/I<$4 ! d<T6! !# $(p7a'!$ !$A '4 @  8:<>8:<>'+= %w '8'>'!$ !$A '4O @  8:<>8:<>'+= %w '('.'!$ !$a %(4+,`''!$ !$A$0`A0 A0!0(*,.(*,.'%K#,w`B< cc$!0#Ɛ$$8>>4 ''!$ !$!$ -,:?0! $0K&,V!0#ƐFF0%840J,&K, $0K$,=!#!0 (*,. (*,.' (*,. (*,.'('!$ !$a$)'K$1  K$1  K$1  += %w ' d b$+(A4cE<#(##A#a/$! N (,'b$+ AE<c# A#"$A!a M (,'I  I  += %w ' d b$+(A4cE< #(##A#a/$!  (,'b$+ AE< c# A#"$A!a  (,'I  I  += %w 'd@ b +(Ac#A#(#/$(! #aC(,`e,(f8%c,c8f,$+`%e, c8`c,% `  <$'b + ADc# A#"$A!a(6@"C,2`#E8%B,B8E,$+"@%C, `B8@"B,%@ B8@$'$'$'I  I  += %w 'ld"C$$* dG<\$  $<<$\$$d$DH!$P r lZdTeVfXg468:e$+(468,.02d0! 0d+ `%  468:$&(*)0dd$T'P!$7W!$B$vĎdc'T'd'!$7W!$B$ " <>@B<>@lTVXZ㤔G<`\  6!\  ptxh'lDHd##$L!$ L$  $+b Lptxh'9  <T!$:@@BDF02465c0c,%`P "$d%% l@p@G< hA\C  !#h@<=1$%.8A.83+@$#pO$$xO!@*x.%H&ph  K$<<$'$B < cJ% $Vd+0 % |$d  px!0$*8f0d! d䬀|GB$$  d"B$d"$* D6  $%0#d$d*H   +X &`!H )+P @!P I)1)-< &$$%8%d䌬* $$W&'!$7W!$B$aÎd'''!$7W!$B$ `" XZ\^XZ\TVXZXZ\^HJLN$+`XZ\^02464!(0+ $% HJLN(*,.-0$%$8!$8 V&+ K$% <<$$B < cJ% $+ 'lpG< h\  +!"h<<! 0+ $% @BDF024650$%$8hG<\  $<<$\G<\d  $<<$\dddd%8$d%%!!$*(%> %,V(!((*,.$+(bDE$/$(E()!@1#Hb!(+Ph5@+P.@$#@$_ $0!0F*P @%@ &H \X`  \X$d`଀ࠀ$+b '9  %%I  %9  %%I  $1  <T!$@BA0$%$8$8 V++ a% kG<\  $<<$\䬈% !% `G<\  %&\G<\  %<<$\dd+ b[+ AV# #'$ #A#a!"+(bH+AC`#(A#"$A!#(@$$&A `  $%%'d$$'!$7W!$B$aÎd'''!$7W!$B$ `" tvxztvxTVXZtvxz468:9c0Zc0fc$c0c,`Z0%(%%% %K%,B< c$!0%Ɛ?0!0$0K$+0b$0+ A$$'$ #A#a! |Ŏ''!$ !$   "dfhj''!$ !$A|'''!$7W!$B$adfhj "$& e|+Aq`#Alb# Apd#"$"!AG<@hb\d  !"$ha<<!ef0+`$%`@BDF02465c0$%#8 `#8j`G< \  !< e,X(!(%(*,.$+0F$7$0()!@1#H!0F+P6@+P/@*$#@$_ $8!8G*P @%@ &H \X`  d\X$`  $+d '%9  %%I  %%9  %%I  % $1  <T!$'@'P'!$7W!$B$a8:<> "$& X   \`dT'X'+" %w '4'D'!$ !$a0<4@8DE<\,+8" E=09QR\! %(f&  %$`'`'$*0]l+8<h!0Ɛ,QX`'\%\%X`' $`'X$`'<T!$@BA?!0 > %%$'<T!$B$ $<Zc$!bA"8@"8@ !8 $$'$'!0!8!,$'+= %w '%%%(%0%8%@%H%P%X %6%0%83P3*`# +`a@xXHpD6<E<#aT##$a!t x.  846% 63@$ tT " 46%8@!0%g0g0g00 $+P(@ 9 @@$*$'9"$$ 9@( 9@$9 @$$%@3P1+H( ] 9 9<+H  #HD!XI#`g $@ !@H+ppTtp 0!@E+Hh +Hz #HO $HI!H8*J9 @+k9`+k9`$  @%8%8$E<..+0ME<(0!(,A !('08%+("5!&%& 0"8@!8" <@!$ 4"G<@0  0""$ "B$ $  '+= %w '@`0dD0`(d e+(T,Df<g0$$  ' !+= %w ' ,A C+#`$0C A> '+= %w 'L $P @$%4B$8+ b0+0 $  '0A+= %w '7G<@ ("  #"(#',A,!+= %w ' A> '$A+= %w '\w0'`'p'!$7W!$B$ def04cO!d!(%+ d! c$,c,!d( X'+= %w '$%d$0%p! $ '%8%!$7W!$B$d!0# $d$d e+ b* "+ " ?I '1  += %w '<#TX\`d<@!$ D("8E<`c$$(,$'<$#<!$ E<B$"G<@D8 D(C  8$!#$(AHL P? M DD"L##C@$T"%%D L P <!$ $"<*B$" 0H8A4<AG< 84A  8#!4CLPD'<!$ #$"<&B$"ab##$!" Mx %% ( 0  E<B$<`VB$ Q (L P$T,X4'@D Mx LPTX4'%%I  <!$ += %w 'G<؞!$! G<؞!$<8!$&Q F< 8<% %(%0%8B$c$ `(H:%8$$t04$! $!#0A04 %(%03!7 $#P%J1XG J- X j1P !A! *"@*+P @`F H#0&0E] < G<  $&Q@@@0#0F+F$+0%###"!$!&!%%8",@$+g$C*%" <!$ +$"<®B$"6&W`<B$&" @7=<6&W `<@B$&"-@$$'t '''!$7W!$B$a|x 2F<8 B$2''x'|'%%$%(%%% 53D1x!<E!$$ %  8B\ A ``Hd4e&0$ Da Y !8%`@% %\8=/ #`%% DdHc%% `% %H|! <@!$ D"G<@  ##xG<`   #`$% &t#$%HH#D&pdG<  $p$de$G<  %%3- (v*   "G<@$&  $&$$`w(G<(f  %&(e,0,e0d313@U`|ccd&0$ a Y !81%3`3`|!!BӇ  %$%5 !$X!<.!$$ % X+"`|!"!!B Ls E @!<.!$$Ӛ X<!$ @"G<@  ""<]!$ X $""G<`#  $#$"@<4B$|F % E#8`An!84 Ao!80 An!8, Ae!8( $HA$%!8 As!8 At!8 Ar!8 Ai!8 Ac!8 At!8 $HA$$HA%4TH$HA%4THx<.!$$ Y  <<bG<\8d  \%$8e''!$ !$a' C$+(#t $ S <T!$B$$ \`d$h8'PTX%H 0kD) EB$$ 8<<: $PATD+G<LG  %'LE  !$ $  $G<+G<,G<-< '+= %w '#, `E< FB$!A"! '$1  += %w ' $(,4d  A `dE<(ƥ$njh<`H!$ <@B$D"G<@  "#H""#<4B$"G<-d"G<,e"<4B$p"t"<`$$$$ $<9!$   $(#$,#%$  x P'''!$7W!$B$a%D >d\x" !B @ @B\ "%dx <4!$7$'$   t' t'HD D "$Hx0C 4D''!$ !$,E''!$ !$8F<B('L'!$ !$H'L@'D8'<0'4(',(',' $$L< @`dV<4+0#>#< 6& <`r!$&a @x(@ ~V<6& <!$&a@x m׋<|6&0Y<`z$&0dF P'''!$7W!$B$ax*4''!$ !$a'@ @8'''!$7W!$B$ax'8'L'!$7W!$B$aV x'$'4'!$7W!$B$a> `4 D  !  %% x - D xxd'$* ddd8% Df G<*+haLlaT L&#T&b%A D x+'$fg!0,%0 dd><><  D x'$ x" !B @  $@B $G<+ x H'''!$7W!$B$a'4'D'!$7W!$B$%H'X'!$7W!$B$ ,&`'4'D'!$7W!$B$a'H'X'!$7W!$B$a˻ hdc,0 d'$hAA$`$  <@ !$ \h#$% `!$7W!$B$a$& $&%b7@48<@$"(!.  @"5@<"B8$@$L$PTX<)@'!$ p'''!$7W!$B$aD'p''!$7W!$B$aH<$7@D@ @(%e@( c$'% <6! <6+(!LPD?<6$wDHT'D'T'!$7W!$B$a<"c$$ $0\!< B$<.!$ $R "!@ @*#`'#$'$<$<bc!< $   <*#`*c8%@`$! \   <  '*#6`4 P'''!$7W!$B$a'l'|'!$7W!$B$%P'`'!$7W!$B$a ,; <!$ I T'''!$7W!$B$a'ph!$7W!$B$%T'd'!$7W!$B$a˻ PD"H!B,0 @Wx!> T'''!$7W!$B$a'ph!$7W!$B$%T'd'!$7W!$B$a˻ ,804<!$ P<B$"G<@P  P""xB84  PDaG< Ha  "!Hbt't'+= %w 'xd0'|''!$7W!$B$40<$@@@7%@0 !$%<6!W<6+0W!8<D%" ?<6$* a!!> `'''!$7W!$B$a'|''!$7W!$B$%`'p'!$7W!$B$a ,; <!$ I T'''!$7W!$B$a'ph!$7W!$B$%T'd'!$7W!$B$a˻ PL"P!B,0 @Wx!> T'''!$7W!$B$a'ph!$7W!$B$%T'd'!$7W!$B$a˻ ,804<!$ P<0B$"G<@P  P""xB84  PLaG< Pa  "!Pbt't' += %w '7 '+= %w '8!N  "C `#H  %<( 0 E< &"@(, E<$  (DTX( , $0A !@  (BTAXC$0<@4'<T!$B$" $A #E<Ƅ$!t: $<!$ $ ! H''h'!$7W!$B$aG<  !  "!<!$H' H''!$7W!$B$a %$$A'$$ $<9!$   $##dPe%8 * +8,$8% @$@,!0%0%(%0%(% *8,% < ' % *0,% %(D,x$ $<9!$   x$$%$$t8$+0D $<9!$   t$0!0&$ǤŬ|!E<E< E< H !|  !  4!7HAA#H "d@,C0D%( PC`ed%% %%(1lp$#($@"8)@"8@!8 Ec$$ av (, '+= %w ' $<!$ $x+  $< !$ $x+ *"('+= %w '  !   #$+ #"!#<!$$ Y   $('$ ('%%I  '+" %w tt'%%!$%*8& !8琀,G$G$&8F* $+88G-$8`'|'!$ !$ $+8`', <~)%!@ `1+@E <~)%0_8-`$9$$"$*@d 0(9$* 89$% E<< ,($$ $9$> <~)%8$9$0$'$0$'+= %w '$($ /*  $,(0 ',0 '+= %w '( ", d& D!c Y  (, $!$$$' $ d <TB$  '+" %w XX' " d& D!c Y   $ S <T!$ S <T!$ S <T!$ S <T!$    *@8PC` G<@PC  !#PA8"P''!$ !$a<*(^` G<@<<C  !#A ACmC$ E+0d< $!$ $  <G<    "! ,%(%% D $DpB$!DCG<`@ CD  @%#! $EAH8'H8'A<@B$@ D 7G<@,"  ,#"#%#4 $($<!`(4#$B<@$!0  7G<@0"  0#"@@G<  A  ! @ c$$ef&8%(40a@ Y  D<4(0%+= %w '@ 8C` CDB<@B$<  !8 !DH LP1  $TX\`4'DH LP1   $TX\`4' c$$ef&8(0,a< Y  @80(,%+= %w '< D@#` #$<@!$@  ! # PTX\8'HL  - D!84 @"HB8/@"EB8+@"AB8'@!D!8# <"@ "#M<@!$ 840;WN 9$`;>% $? efnjE<% *ƌTLeP$c$+0?80808E (!$I !,!#H !$! " ! B @!T! B '+= %w 'P"Z@"Cc8`CdH8 dE8 dA8cDc8#`D#H$'(`'0%(%?L%$c$+0808 <%&e@%& %` '!!  A<c$&# $A_`   '$ ' ' '<T!$ G< ,"  ", '+= %w '  " ! B @'+= %w '   "! #E<DŽ$!  ! ><><~ '$8&8$!8&Hh !$ += %w 'H",T`d$$+  1 H,T $ 1 H,T$+ `I 0'''!$7W!$B$a'0'@'!$7W!$B$a<$7@@@%A@ !$%C<6!W+b!" $T'H@$n< 6!w2>%n< 6+w!$!a %% L X ,@6 LPT D'D'<T!$ G< 44$"  "$ , 0'<T!$ D !H 8,!c Y 3 ,`۰  #8`% (!$ G<@D  "D#X"0" # $0  <!$ M<@B$"G<`XT  X#T$#@" $  %%xE!$$  $\bbG<@ b  !" a''!$ !$A  PT'% 'L'!$7W!$B$d'''!$7W!$B$\EW EG<X`<>!$d' \`Xd'%'!$7W!$B$*<8!$ "G<@\  "\#"#<6B$ F,  ' 'p! '%%1  += %w '$T"=@<!<@B$!8 B$"x|!$($, 'B$"<$%(<!$ $"<>B$"<$%( 8 ,(p@xL C !@Pl|&8 $<>$&8 $<^j$ $  <!$$ av %0%\0<@j!$ 0"G<@\l|x !  \"#l$| %x&" "#@"$P"%L "$&$&8 $<^j$ $  <!$$ av %0%`4<!$  $"$&8 $<^j$ $  <!$$ av %0%d8<@j!$ 8"G<@dth !  d"#t$ %h&" "#H"$X"%< "$&!$$ $*A@!8 < !$$ @$"$ "8@" @, 0 G<@("  "( ,"@("Cc8`%A<^/!$$ Y %$%@$"$ ""@ ,"@("Cc8`% A<^/!$$ Y %$ @G<@8"  "8 <@D0'$G< $  #$ #$C D E<($nj$G<$  #$# C`<$&d`%$AG<B$ 8%$$`%%,C0B% C$$# "+A,"(@K  $<^/c$$ <!$ $"<^/c$#$$,0G<(  !$($<^/c$%( %  dc  $<^/c$$$$HA$<^/c$$%$$HH )%!H*&XE`$@  $8 h$e$HH )%!H*&XE`$@  $8 6$3$G< $  #$ #$C D E@bAB8:@bRB86@bCB82@bHB8#@,D8B8&@!$x' T<$%(< KT $LD@< !$ <"G<`T  T##@"D " ;x   0<`!$ P@btB8:@btB86@bpB82@bsB8.@(C,BH  1 H $'t  @$`%l''!$ !$A< B$l' %+$ , !H , '(",!LB @ !  %4'X'!$ !$$<<$8D@$4BL@A|A< y!$ |"G<@  "" CB #G<`  "P"<_!$ $"$PTL`Cpc86`BsB8.@"B8&@"Chc8`Ctc8`Ctc8 `BpB8@%%+'#  %(% 8'% '!$ !$A $bf(,04b8'+= %w '$" !  <!$ $x+ +b (, '9  += %w 'd@$D%($,!<  E<&A@0$ E<  $8QA $0 $08TEXF#8TG+(?#0#(XEHLP4'A  Dx  += %w '7|"$|#$% $%0W%0F GM !D$W$ WN + '+= %w ' $7|"$%$%(Ww%(E|!$GM N<\B$ |"$ '$ "! $  ' '+= %X ' "'C'""W$7B$@WN '+= %w '7|"$|#$% $%0W%0F GM !D$W$WN  '+= %w '$7|"$%$%(Ww%(E|!$GM $N<_B$|"$'$("G<@,"  ,#"#F<>< O`CRc87`BIB80@"@B%$@" Cc8`BB*B8@"B8@%  !<|E!$$ Y %%% %%%% $,"$0"$@" ' '+@'>ip!@#$`'!$7W!$B$aG<`<$!$@ <$!$H`' HD4@%!$7W!$B$%`'p'!$7W!$B$at'% %1  % %1  %%1  % %1  %%1  % %1  %%1  % %1  %%1  %1  1  += %w '+"@`$ ap|! $%8`'%@%!$7W!$B$+H') HDHap!%@G< <$B$ <$!$@`' @$H|D)$%!$7W!$B$!@`'p'!$7W!$B$!%)%*$@!$7W!$B$A<`'p'!$7W!$B$A%)%48@+P@Php!@*$`'!$7W!$B$A+P'@Pip!<G<@<$B$@ <$!$<`' <$H|D84%8*P(@%;`'%!$7W!$B$+P@hp!#$L'!$7W!$B$aÎ'`'p'!$7W!$B$'L'\'!$7W!$B$ `,*`c8H|D84%$ )%4*P(@%<`'%!$7W!$B$+X'A`3ip!#$L'!$7W!$B$aÎ'`'p'!$7W!$B$'L'\'!$7W!$B$ `,*`H|D843%$ >t'% %1  %%1  % %1  %%1  %1  1  += %w 'd$%%&(g8j&0#02(+0$$@p!P(K%%`l'%h% !$7W!$B$a+X`%!(T#@G<`PD@<$B$ <$!$Tl' T<D$@P8+$% !$7W!$B$aTl'|'!$7W!$B$A) #0($}'$<*0%C+0a$8p!H*%%Xl'% !$7W!$B$A$+H+K $!#$X'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,*`c88<%@K'$'TLH!$7W!$B$Ll'|'!$7W!$B$0%<$8*@+@b0p!iT$$Pl'!$7W!$B$c$!iL#$HX'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,#al'TP!$7W!$B$aG<㎚`<$!$TL <$!$Ll' <$8%% 1  TLH!$7W!$B$Ll'|'!$7W!$B$4%<$84p!#T$$Pl'!$7W!$B$c$!iL#$HX'!$7W!$B$aÎ'l'|'!$7W!$B$'X'h'!$7W!$B$ `,#al'TP!$7W!$B$aG<㎞`<$!$TL <$!$Ll' <$8%% 1  %1  % 1  %1  += %w ',d`#"!a@ $(ep!b! !%(i2!(S 40P!!e$f$$H$DD$@B$<TX \,' h$p P!!(8TX \H4D,' h$p P!!(4TX \@0<,' h$p (84P!TX \,' h$p (,  !8 l$pL'lpL'l$pL'+= %w 'dwlx+"`$ aph! $%8L'%!$7W!$B$t+ 'ap!e#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `, ad$dxttxl|+0$8ph!8$%PL'%X%!$7W!$B$!+8D40p!h#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `,ad$d|0l+ "L$(ph!($%@L'%H%!$7W!$B$4+((50p!#$8'!$7W!$B$aÎ'L'\'!$7W!$B$'8'H'!$7W!$B$ `,aCc$C40`'%1  1  % %1  %%1  %1  1  += %w '\X#de(/(@(!($ 0fp $#0$8 ,$ 8PLD')$,!$7W!$B$!(0'@'!$7W!$B$!%% $*H( $@c &`L@k T %P&PjY @n %X&Xa &PLc @l %`&PL@d &Xl$Hi*P#@#H#+P;@!H$ $XHq!,+$%`0'!$7W!$B$a+X,%`H*q!(G<鎰  <$B$, <$!$(0' (X$L  $P% % 1  %1  += %w 'hd#a,d$0/!($C((TBX\ `l  (%$d,0l`\XT'($% !$7W!$B$8<'L'!$7W!$B$   $d$d\l`XT;+@"@!@ $P!q!PK%%`<'%h% !$7W!$B$a+X )`$@(q!8G<莻4<$B$ <$!$8<' 8l$`XT4\dP'%% 1  1  += %w '|H@<!$7W!$B$!@`'p'!$7W!$B$!|8@H*%*XD`+%*`dP!H#!%+`' $hq%!.$`'!$7W!$B$!%+H' 480(%!#$L'!$7W!$B$aÌ'`'p'!$7W!$B$'L'\'!$7W!$B$% `, a|08|04!+@'i$Hq!H)$`'!$7W!$B$!!C+X'U`D8q!@#$<L'!$7W!$B$aÌ'`'p'!$7W!$B$'L'\'!$7W!$B$% `,#a`'HD!$7W!$B$aG!8 $ Def$g+@#(0, $ Def$g+@#(0, $ $$$G< ,(<`oc$ ,(44$!$7W!$B$4 +(b+(A###A$#! Mx 8<0'I  A  !  += %w 'hLd$Ld,'<'!$ !$e8f#(4 ee8 e<<ee$8<e<$8<@','!$7W!$B$HvÎ','!$7W!$B$lp `d'TX\`<`o!$@' <`oB$TXlpd <TB$\`F<~B$!A!`!0+ E 0O> 0 A8  A8  A8  A8 a8d#$@aa8d#$Xa a a\a a`aa!$\a<a`a(D  ($ $+(.$*(["$*($"8q 0A $,8$-8 .8^ 0> !$ $+A $0+A 0A $0> !$ $+A 0O> 0w@ 0<ΐ!$ $ D %[$*( :8$[8 $]8${8 ${}8$u ' Dz  ed8Ed8 0A $8,'.d8^?`0d%0  *8#( %%<!$ J$"<(B$"0% 0A $8,'!  += %w '$% O> $#$ $+`G@E  d%0  *8#( %% <!$ J$"<(B$"  +A '+= %w 'e"8@E"8@O> -"8@+"8@O> +A '+= %w '%% O>  "8E@C A ""8:@@$#8`% > {!8!,%% `@{#8 `B$ O> "$@}#8`B$\!8  PB ' <5!$$ D '+= %w ' O> f$*A7@U$*A&@""8p@"$$+b@U"8@@ O> $ $B Y $ $B N\"8K@"$$+bF@f"8C@t$*A @n"8:@r"87@t"84@ u"8"@v"8,@x"8 @ <!$$ D  O> $ $B  O> $ $B $'+= %w ',$(0 O> &$,$%$ $+@$$+8$ $+8$$*8 <!$$ D $f%8  g*@#0 f`%%<!$ J$"<(B$"$% $ #"4O> D  $D  -8@4%8  *@#0 %%<!$ J$"<(B$"4% $$$G< ,(<~B$!A!`!0+ E h''$'!$7W!$B$a"$G< `\<'!$h' \h''!$7W!$B$0'h'!$7W!$B$L'Ph'0'!$7W!$B$ahc8W`P+ 'P+ ' '+= %X ' " 'C'"H"B$H"<TB$ ''$'!$7W!$B$a"$G< `<'!$' %''!$7W!$B$\''!$7W!$B$|LTx'P'\'!$7W!$B$$*P@8n@$Xa$ c$'!$7W!$B$a'''!$7W!$B$a; '$'D'!$7W!$B$a<`Lc$ XP+(G<K< !$' XPK''!$7W!$B$%|P| $ ''$'!$7W!$B$a"$G< `l<'!$' l%''!$7W!$B$,''!$7W!$B$%(H'L','!$7W!$B$aL$* -a8 a(- P  <0$+ 'E<جE<ܬ⎼+ ' a8B  a8* x|<'!$L' <'B$x| ''$'!$7W!$B$a"$G< `l<'!$' l%''!$7W!$B$,''!$7W!$B$%(H'L','!$7W!$B$aLd8> a8 N  + 'x|<'!$L' <'B$x|<u!$'$x' $ + 'E<جE<ܬ⎼+ ' '+= %X ' " 'C'"H"B$H"<TB$ l''$'!$7W!$B$a"$G< `X<'!$l' Xl''!$7W!$B$,'l'!$7W!$B$TH'l','!$7W!$B$l$*8N$$+888 P  @T0d,e$(f+8P $<`K!$  T0G< (  "%(P%(%0%,e$ ! <0$G<  !&$W $*@I 8P 8e N  N@T0d,e$(f+8L $<`K!$  T0G< (  "%(L%(%0%,e$ ! <0$G<  !&$ 8+ '+ '8& dhl <`B$dh += %w 'lo "% %1  %% Q  <@!$ $"`\lC%`# Ï 122<38!1! 40%<謵& D <0$<0$D\`Chl<8%Lk%% ''!$ !$A''!$ !$A88$b,a+ A_(d e#0$7$0&#A!(#% 4a!$4a$a,a<`H'$*0!0Ɛ,8#$!#D' Mx D<%% 4a!4a$b,bbB0@!$4a$*(b!(a$*(c$@  D<@$8! $LI  += %w '8'!$i >@ $Hd8 DF8l8u8s8h8 <m $ HDD<@$&(E"!@bG<@b  !"a8'8'(,04d <TB$(, 0$4=<' $ x'$;,89:<=>?(o&8 + !x%' '!$ !$!@%%'!$7W!$B$A'''!$7W!$B$x''h'!$7W!$B$!$o$p$h'%%!$7W!$B$%?>=<;$(A(o&x},:98' $ ;,89:<=>?(e+xD#(/$(%!(#xD%%%&(' $ ;,89:<=>?e %&(!(E%x''!$ !$A`$$%('!$7W!$B$a'''!$7W!$B$a%&G<`<`o!$' ''%%!$7W!$B$A y  |<%%%0%8 $B<$B'1(e+x)x!(''!$ !$!@$$'!$7W!$B$A'''!$7W!$B$&G<<`o!$' ;,89:<=>?''!$7W!$B$!(e+ !!kz d >% %(%0%8 $A>$A'>H?$%H%P%X '  $$<=>?W%1& ''!$ !$aSR% +' $ h'!$ t$&`' $ +;5234<=>?&a$G< <`oc$ $c$!$7W!$B$a'?%0% %% ,9%(;[(rRR:V@kz C' Mx %$$* d' '!$ !$ƌ׀$$'!$7W!$B$'''!$7W!$B$''!$7W!$B$T'd'!$ !$(ŒG$&85%+8"ƌ8!0ƌ''!$ !$Ɍ ƌƌ׀$$T'!$7W!$B$!'T'd'!$7W!$B$T''!$7W!$B$4'D'!$ !$7(Œ%+8"rƌ8!0ƌ''!$ !$Ɍ ƌƌ׀$$4'!$7W!$B$!'4'D'!$7W!$B$4''!$7W!$B$$`&8'F$+P'@ $;+ $*XG`;  ''!$ !$!' $$ $H-?t$H%+h( $*x@%H''!$ !$A% ' $$ $H-? %!H $*$%0h*@1$+H 7 $*P(@%(''!$ !$%' $ $ $?) %!H $*!$%0*@(1$+HH 6 $*P(@`%,'H'!$ !$%,' $ $ $?%%% ;,8j%;,89:<=>?Y;,89:<=>?H1  1  %I  s&R&%5432Z@t&&&4'%%!$7W!$B$T'4'D'!$7W!$B$4'%!$7W!$B$<\*@`*+4'%!$7W!$B$T'4'D'!$7W!$B$4'h'x'!$7W!$B$<\*$@`*x'%' $ ;5234<=>?x'' $ ;5234<=>?x'*(T'%!$7W!$B$'T'd'!$7W!$B$%(G<$5%%%% '! 9;$!/B$%2@0A % ;=E<,!8+% ?x'0p0'+ $*  ''!$ !$' $$ $?x'02u @%%%8% $c$c'P3$%%% &!`%` 9&-'?%% =4/;% :7!<+`4l /x'|,'+`4 $*h@%PL'h'!$ !$% >L' $ $ $/x'4s'  ;<=>?x'$$5234<'! $!$%*9@ Y$+1 $* @%l''!$ !$%l' $ $ $?x'1%%8 $%%1   '+= %X ' " 'C'"4"B$4"<TB$<@$<$ d  @b a+ A0dc#($#A# /$%!aPTX\`H'PTX\`H'PTX\`H'PTX\`H'I  += %w '< G<咿%&<,"0!,   ><` E<` E< !#$+b   d;4d0e$,f+8!8l $<T!$  4G< ,  "!,l%(%08%0e$ ! G<@  !"%%<!$ 8$"<࢈''!$ !$A''!$ !$A<@ @D0'@D0' $(,. <VB$ $8<d <TB$(,<`@H8'(,04. <VB$(,@Dd <TB$04@\"82@,0 ,  ( ' Dz < <<+7@d('(`,$E%<4+ *(f,$ % %D@<D0' $(,. %0B%8D%8F%8%0<6$0%0%%%*E`+E`!c%0, ?<$!cH`C$?<$!c%88eg0!@*HX c0@I$> <@J%!C+X%k`k!H)+X+?`c+i;`8`C$+HeV !dcc$c0? $+#$`8 `C$+8eC!dcc$c0+#`?<$%!"$ '!"$ '!"$ '!"$ '!"# '!"$ ' '%%1  %%1  % %1  %%1  $B$G(1%8?<%! !A$ '+= %w '{ d%(,%?<@$! $+0AIg+0+  '8$+ A1d$0?$+ 8 $+ A a!$!0+  ' ' ' ' '%1  %1  %1  %%1  += %w '"@"@C`%@!CG<`#  "#"$"!+ '!!!,!"@@!""@@!"++= %w ',"C$$+`"@%@!"04('B8.@"@%@!" "@%@!"04(' c8`H k ( $,LPTX\8'04A !$$ Y %u@e,%l''!$ !$ $lx$|)% +X "` $d$0p! &!0Č%$"b+0(f8p!0Ȑ $Ƞb+0a!   " + b'%1  %1  %1  1  += %w ',d$/ `d$d<!$$$  $,b$dG<d  !$a$e\e$eRa&0"E8E8B8%@ 48(' 48('  48(' $! <@B$ $<T$!(!FB#*C @DHLPT4'8<@ <!$$  $(DHLPT4'DHLPT4'DHLPT4'DHLPT4'+= %w '0% 4%% $@Gpi0!($!$*0%*%0cc$g0 $+8"$+A%`8#"#A$#!$ <5!$$  $(<@D,'<@D,'I  '+" %w XX'''!$ !$A  084@<'%8p','!$7W!$B$H'p''!$7W!$B$uZ"8@z"8 @a$#B0!$E,'%'<'!$7W!$B$p'l$h  S <T!$ S <T!$ !$$  ,r $+$ 8 X!Xa8 Xa 8 XaXab $(  $  $ $+$e  $+$ 8 X!%8 XA%XA%  8 XA%XAB $ C$+(#p $ \b X`c$#c0!C $!$$!a.$"T X> H"$ $<!$ <H$FG+@@, $<~$!dc`c0+ E<~$`$*(a 0%(9$*!89$% E<< $$><~$9$ , '$, '+= %w '48< !$ $ ' @#$8+ C#AB$# '$d4!%(%0%84<8@DEF0'%0%84%(%%y@ (< !$ $ @ + boA$+ ah#bc$# '$$(!( %%E8iB8F@nB8B@lB8>@iB8:@nB86@eB82@$ B8*@,$<\!$ $ Y  ,$$(``%'''!$7W!$B$a048j= <@DHǐ$%:L ' '''!$7W!$B$a<'''!$7W!$B$aH T`X\d ' $%% j{x$|'%P%!$7W!$B$! %tp 8 tpxj |$ '''!$7W!$B$a<=@DHLP7 `"`\X$T+0d $ "$ $!$^*@#@HI7 $+X-`_ $*`j% ''!$ !$%' $$ $$' $ '|d <TB$| !`L PTgl $ (04DǐHCd8c8`$O 04 LPT = 04X\@'X\@'X\@'8<A <@B$8< LP4'%%1  += %w 'D "#! \  P"0 E8QE8EE8. < $><><+= %w 'H "#!   T"0$+($$+(E8D<+w('0,$F%<4+(*0,$(%(%E@ <><&0D+(*D,$(%E @8<. "0@ $'<26&7 <T!$& Č%8Y$* N$8Y!8 n$8y!8 %8;N$*(N!8 O8v o!8p O$* O!8 N8{ n!8u n%8o8Ro!8w n!8d q!8n O$*(O!8 F8F85[ f!8W f!8+ QY$* Y!8 E8S82? e!8; s!8( 5o%8f8f8 -> $'y!8 e!8 s!8  $-> $'!, 1 <謥$ D |%(%8xF<&H %(F< x|%()f F<<@B$   jl+ p"C,`L'$!! !8  2  0"B$" 4'  ,   "@$"$ #c$#"$4'4'1  '+" %w HH'7#$0'!$7W!$B$aldhe$df+8 $$'("&G< @"&  %"( &%$'(  0"#$%&'"#G< @"#  $"' #$%&'4<,'4`"\$$X%+0D $(t!(|x$+(b1x\A$+(")X!!T`\"$+b \$8,'8,'8,'8,'8,'A  1  A  1  м 1  += %w 'g A  5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ8!$+0"$!$!!8 $Ta $Ta$ ' ' '1  1  += %w 'g A  5 d%@d"8hbpa# A(+ "+dd$(p!0Ɛ 8!$+0"$!$! !8 $Ta$Ta$ ' ' '1  1  += %w 'hbpa+ "pdd$(p!0ƀ%8$*80"8@aI!8S a bd!Dd!c!b: '08#0A(!$+0"=$!!!8 bd!Dc!b ' 8!#0A(!$+0"$!! !8 bd!Dc!b$*A!8 ' ' '1  1  1  += %w '"@"B,%@dd$",$"G<@"  "$$'$ ֻ 1 ( '( '( '$( '#$ R  $" @#$   $( '( '( '+= %w ' "%$*,`B0C8`B8_@"#$% 8 $'"#$% 8 $'B0C8%`C8` B81@"#$  $'"#$  $'"#$% 8| $'<T!$8" ?8 %x$S@8N]$+ [8]8 B`8&0$+89$$5%?$+,$+ #8;%%%,';! :';%x$?';]$+8 ['; ]'; {';}';$8'%%8 8$>0<&$ !#" `  <d$+ DDL<D$LP0H! "$#&'%8%%D/%, :4 $&HI)-%`%p.%x%H%@  :8 :5: $+ !@9):L$+Ȃ !;$+~`!cc8`DD4n 0$+e!@9'%@*2@ $*2J9@ $*2J9@ $ *2J9@ $%P!XE&Xbk-%hm%0 $ $c%H%@ _j$bbbb``````` @```@`@`` ```T@'%1  %1  %1  %1  %1  %1  %1  += %w ' G< @"#$%  "#$ % $4C`8D0E#$G<`#  %#%@C`DD<E#$G<`#  %#%LC`PDHE#$G<`#  %#%XC`\DTE #$G<`#  %#%C% $* bc0d8Kc8`dC`hD`B g 4  $pC`@$DDlDtB    $('xC|DB   ('('`CdDhB $g k ('c0d80dC`hD`B g   $pCN`@$DHlDtB  = ('(' c80`dC`hD`B g   $pC`@$DlDtB   ('('$('+= %w '(d$ e* oO & (a b+ "*d! $ b$$+(e! $ b!$+ "b!"$"(a!$(a$ ' '1  %1  1  += %w '"A%# `#* C&C `# `2  #&C`2   ''#*b` $ '$" $#'+= %w '4 $"@ $  $8 '$$,*C@( 0'  8 '5""6$C" $8 '+= %w ',*" $( 0'  4 '$ $4 '+= %w '$" @ $  $4 '$,*C@( 0'  4 ' $4 '+= %w '< ,d $  ,@(',$404,0$*("+("!(%0=$+8,$+8 $8j&,+e$0$+8_$0+8Z=8U[$+8 $0$+8K[8 F]8C_8@~8=0,9$+85A,Z$+8.a,z$+0 %_8"-80$708$008$)08$"% 8$' t @('``$@(' $4,0` $+0C !$!$%$ 0 C0 c,`0B$7B$,  "0!0 B,@0!$7!$, @('@('@('%1  1  += %w '0 (d $  0(<$'( 84,%%8(4,%%808 *H +H !H) *9S@?=@iHj*HI8 %+H !B B8/@z   0+"`,! a0$08$08$ 08$% !   '  0,$ *94@ *91@*9 @ %+XA`!PJJ9%@*9B@ %+`a!h9 %+x!pΑ9.@*%+Pu@!@9! '9 2 D 0(4,  'n 0 ($ z 2 0(4,  '  (`%%,% 0&<$'<$'<$'<$'<$'<$' ``a $a$<$'%%1  %% 1  %%1  %% 1  %% 1  1  %%1  %%1  += %w ''$('$ $ֻ   40,(8%%8 <$'4(8%8, *H +H@ !H) *9Y@EC H*HI> <I$*H 8 %+@"%!! !8/ z   0+"`,! a0$08$08$ 08$% !   '  0,$ *94@ *91@*9 @ %+XB`!PJJ9%@*9B@ %+`b!h9 %+x!pΑ9.@*%+P@!@9! '9 2 Z 04,(  'n F ($2 z M 04,(8 +8"g!!'!8 '$ 2 04,(  '  (`%%,% 0 <$'<$'<$'<$'<$'<$'<$''$'$ ֻ  ( $<$'<$'1  %1  % 1  %1  % 1  % 1  1  1  %1  += %w '"$4'$ $ֻ  (%H0'(<* CC8@ `  4Ld<8 (<+ "8!($+(@8$+("8 $+08$$$(+8u!8 8 88 $+Hc !@98"$+P"T@!Xkk9 `$+hH!`9<@ `$+H3 !@9"8\8 8,eDRO iHj*HIJ HI$*0Dz  (a$<+"`8! a 8 4\$  <8(+ "! a0$08$08$ 08$% !( @(' V <8 @(' K <8,!,$$$<48$(+8!8琀00$090$090$ 090$%@%8 $< !(\$ :  $*AV`$* a$ $8 $84b$ 4a$ 40$  $*( !8 4t$ 4n$  !8 4v$ 4f$ \$* a5$*( %8 %8N4e$ 4r$ w"%8 \%864\$ h4"$ _$*(%8 %84_$ L4N$ C( %89) %8-$$$*(4*0 4u$ $4U$ $ 4x$ $B$ 4h4P$ 4L$ M <8%H0'H0'H0'H0'"$4'$ ֻ  4 $H0'H0'!PJY?J1!8j)%*P(@!P&+XB`-H0'H0'$$ 4 @$ A,$ C"0!0 B, @0!$ 7!$ % 1  %1  1  1  %1  % 1  % 1  % 1  %1  %1  %%1  %1  %%1  1  += %w ',W (d 8? 89 838 $+(ABe8-$8>+(A2f8 $+@&h9$*&+ d8$$$$D#0c$' ֻ  ,$($%$4 '$+0!0eƐ08 84 818 $+@!8g琅8%8-$+@!Hg))9 $+XA`!PjJJ9@ $+8!0fƐ8 $%+$$-$ ' ֻ  $4 '4 '$+0Z!0eƐ08 84 818 $+@C!8g琅8%8($+@3!Hg))9 $+XA&`!PjJJ9@ $+0!e!!8 +$$$%%1  %%1  %% 1  %%1  %%1  %%1  %%1  %%1  %% 1  %%1  %%1  %%1  %%1  %1  %%1  %1  %1  %%1  += %w '|$('$ $ֻ ) (,0 4n  (  $( 40,$8$'8$'8$'0$(4, *@v+@!@ 94  91  9 $+P"u@!H))9% 91$+P"f@!Xkk9 `$+hZ!`9N@`$+@E!8琩8  'n ! ($ z  0(4,  '  (`%8$'8$'8$'8$'%1  % 1  % 1  % 1  % 1  %1  += %w '>$('$ $ֻ ) (,0 4n  (  $( 0,$$8$'8$'8$'$%0, *@+@!@ 94  91  9 $+P"y@!H))9%  9- $+XBj`!`9 $+p^!h9 R`$+HI !8琩8   9%0z |  0+"`,! a 8$ 8,$,%(F +8o!8 8=$+8c!0Ɛ 84H*0/z =  0+"L`,! a0$08$08$ 08$% !  4 '  0,(%(:8$'8$'8$'8$'1  %1  %1  1   4 'n  0,($ 8$'!0+8!8%@ 94  91  9 $+P"o@!H))9% 9@$+P"`@!Xkk9 `$+hT!`9,H@(`$+H? !@90$09$09$08$%84 |a  (2  0(,x8$'%1  % 1  % 1  % 1  % 1  %1  %1  % 1  % 1  % 1  % 1  %1  += %w ' 40,(%%40,( *@+@!@ 94  91  9 $+P$@!H))9% 92$+P$@!Xkk9 `$+h!`9@`$+@!8琩8  'n I ($% z J 40,(#@ +8$Y!!#!8 #$  $ ( $ !8 40,(  '  (`%$k8$'8$'8$'8$' 2  ($8$'8$'%1  %%1  % %1  % %1  % %1  % %1  %%1  += %w 'C*`C`$CCDC0A$G< `  :, |t  /8|t 5 88y|t  |t ; ' A D !  #d0 c0`4% %%|t  '$X' $ d <TB$  8 C '+" %w TT'"@ $$ y !,%($'%0<!$<$!$7W!$B$0"$ G< ``Cfc86`8Y$*`CYc8 `DE8DS8$&`Cec8"`Csc8`Cod8 Df8Df8 yc8 `Cec8 `Csc8`$%c8%%% %% "8@ B$X \`$ $(,048<@DHLP T'+= %w 'p!0T$+A@"8@l!"8B@la"8@la"8@la"8*@lab $  \ `d$ $(,048<@DHLP X'<@!$ $"!@ 9&@$!H) )9 #H# )%$di# '$$ ! G<g  $'d# #@%$dh# '$$ ! G<h  $(d%@%0%@%(%%%%1  '+" %w dd' h $8 8 888I(E$+0Y($!( ,($+(bL(# $%' x4($|tpl,%p%x % `dX%H%P\T% %`%0 %X%(% %h%8J 4`dh0,@PHL@%<% %H%P''(E$+0($!( ,($+(b(%$''!$ !$a$$E FG(,0EFG48< E$F(GWG<  $pB$0e!EEFB4d$ '!$h $$hG< h  (<% h(e,f0b#$bG<@b  "<+)B$badgTD'TD'TD'%1  1  A  A  %1  1  1  <'+" %w 'H  $8#$%HnjȌ%ȬŒ+@"0,(ŒH$#p!A!!8!,!$ H ~ #d8Ad8>d8; c88`H,"(#c$$$+(C $d8; c88`,"(#c$$$+(C $ $pB$0!EFB4# '!$$$G<   (<ø% (,0$G<@  "<jB$'''%1  1  A  A  %1  1  1  '+" %w DD'  #c8`#$%nj$ǬŒ+8"0,(ŒH$#p!A!!8!,!$ { #d8>d8; c88`,"(#c$$$+(C $ #d8? c8<`,"(#c$$$+(C $ $D C<$DC<c$C$$<B$8f  t l''8"8\c |a  pCpXb`a+ "qTd! -87?84:81,8.[8+]8({8%}8"#8&8*8!8|8>8'8 "8 %8@8`8cXb`a+ ".Td!(-8 &$+8!!0Ɛ 8 8Lf?8:8\c !$|a !8p%%0 abd$e!$$eG< e  %<$ e(d,a0b+$aG< a  !"$,(p$!EE FB$'$$'G< '  '<7$ '(%,&0"$G<@"  #"#"#$"#$'$'$'%1  '+" %w TT'd$ $'bh*H= biJ$%A%d''!$ !$ $dhlptx|'d'!$7W!$B$$' y bA$+ "3 e! dde$+(#$'J%%8% @+XB`T $`Kq!`,$*   %&h% %A  1  % 1  '+" %w HH'$bde$f+8 $<`!$  G<   "%%(%0%e$EpB$!"$!$ !$A G<`d  "$b$ ddp''!$ !$$pefgtx|efg|e('p'!$7W!$B$$(' y $''+" %w TT'"@ "B$""#$$ c } bA$+ "}d$(p$! B. $e$$eG< f  &<$ f(d,a0beG< a  !ab!B<c$ `d''!$ !$$defghlpefgtx|'d'!$7W!$B$$' y $''1  1  += %w 'h"#$$ c t hbA$+ "td$(p$! B. $e$$eG< f  &<$ f(d,a0beG< a  ! @\$' y $`X'`X'`X''+" %w LL'd ef% dg $ [  g+XgTh )9 $+HG  )9 $+8'8  $$  $$$$$dg0  $$ !gg*@GhH $8'qp$!8D$l'%!$7W!$B$bA$+8"e8"q$h!D'$$'!$7W!$B$bA$+8"QT$@p%jl!@Hj9h@$J9d@@ a@Xb`a+X":`Tk!`+ 9V 9S9 -$+p'!hm9G9"-$+p!xm9 0$+  !p:2 !$+`"!Xakk9#`D < 4 8 G<@0 <   ,*+0 @D< kl%&P @jl   T$H $Xb`a+@"Th!@(#9 D   T$H $Xb`a+@"Th!P(J K94` K91`K9 `+$+`b!X kk9%`J9}@+$+`b!h 9 .$+x!pΑ9i@te!$+P"l@!!!8\ da!( $ K \  "@$ #$''$$ Xg`h+H] Tg!8 8 h h 8  d"@$  ''$''1  % 1  %1  % 1  % 1  1  1  1  % 1  %1  % 1  % 1  1  1  1  %%1  %1  %1  %%1  '+" %w dd'","("$  <@D,( $<'U#  @"8@% <<B$ Y  @"8k@<<B$ Y ` HLP048,( $H'0'% D defT' HXb`a+ "Td! 8= 8:$a$$aG<  a  !< !$ aL(aP,aT0a $aG< a  !!8/ $a$$aG<  a  !<!$ a4(a0,a,0a$aG< a  !08 @%d  d!$%3$"$$"G<@ "  "8"'$+@n!H))9 *$+XBb`!PJJ9)@V !$+0"N! 8  d"@$  '%P@X$`%+0$T&!8 86 83 8 $+P$@!H))9' 8" $+XD`!`9 $+p!h9 ` $+P$@!H))9 4 818 $+H !@9%8<$+H !PJJ9 @$+`d!Xkk9`( $@$+8! 8d$( $ \  P@'$%&DHL< `$!<<tx|<'t' plhD'3  dd $ %%%(%0%8%@%HB''$"$$"G<@ "  " $+P5@!BB8@    dXT$  TX'''%1  % 1  %1  % 1  % 1  %1  %1  % % 1  %%1  %%1  % %1  %%1  %%1  % %1  % %1  % %1  % %1  % %1  %%1  1  %1  % 1  %1  %1  1  %%1  %1  %1  %1  += %w '(def@,% (efh@, de$  (,@f*@&%% *@% Xb`a+@"Th!@ 9Xb`a+@"Th!H) *94@ *91@*9 @*$+XB`!P JJ9%@)9 *$+XB`!` 9 -$+p!h9 `!$+H" !(!!8  da!( $ | (0"$!   0G!@9 )$+P"2@!H))9 &!$+("! 8dd $  $48HD0,)ddL* L, '% '%h <~k%!H+)`)1+H E <~k%+PL@1!PKJ`J1+P !E@$#+ b@Ď%  '  !   d@$h($ `d0 0 4 %(%%%(%%08 0 0D%   :,  ,  , "(@!$$ ' $ 04('"#@" @ "@"@"@ "@$"@4"@<" @D"@H"@L!!,%+= %w ',V $#(`% !(e8%8%&$+8/!@f9 )$+P"#@!Hi))9  !$+("!a!!8 $, '1  %1  % 1  %1  %1  1  += %w ' ",'C'",0 !%@%E<*C`<@B$ !0<`B$!A$<!$$ ' $ E< !dab04(' += %w ' "'C'" ! ' += %w ' " 'C'"  "#! $(I ,' += %w ' "'C'"7 "+ b/$ $p!f+8"$p!"$%ghbG<@b)*k-  $"% +')(*de&'( '1  %1   "d&DB8 @b$&B8@b$&D@b$&D @ b $&D@b!&"!,%  "d& @b$&D@b!&A!8  += %w '"d& D!c   " d& D !c Y % '+= %w ' !8 Ai!8 Cnc8 `Ctc8 `C1c8`C6c8%` Cnc8 `Ctc8 `C3c8`C2c8` An!8 At!8 A6!8 A4!8 x!  d <TB$)  <@VB$'#8` #8#`!8  !8 Ai!8 Cnc8 `Ctc8 `C1c8`C6c8%` Cnc8 `Ctc8 `C3c8`C2c8` An!8 At!8 A6!8 A4!8 t!  d <TB$)  <@VB$'#8` #8#`!8  " #+ C)$!#a#C$a! Mx E<!$<`V!$ Q ,0$',0$'%I  <!$ += %w '$v!8 %  ! +$  8 "E '$0%0$!0nj&@ !$   $0%0$!0nj&@ !$ += %w '4"!$   8< m ,"$$!$% $,DE` (E !$$  8($0%"G<@"  #"#4'+= %w '4"#! 8<f$$@ ا (,$4G<   #!0'!!"#! += %w '"! Mx  $' += %w '4"#<!(d&+8E( < <`$! $(,< <`$! $(, $+## a8 @E<#!$ <!$ <!$ <!$ <!$ $88$!8&H $ %Dc  `<'!$ $88$!8&H $ % c  `<`'!$ += %w '$H&"k  D&Aa@@ Y W $$+A @D $+A0@!8 ;"8"@8 !$$  @(,4%"G<@"  #"#D'+= %w '<"Cd$oE! ,$+0  8e,8b :8][8Z{8WDc$+0, $$%6D860D8P8A8 N8 I8C8d8p8a8n8i8 c8$%$0%(_8  $*aT`: !8K AW$*a" AI#8 `CNc8 `CFc8`COc8"`W!83 AA!8/ AR!8+ AN!8& %Ai#8`Cnc8 `Cfc8 `Coc8`, w!8 Aa!8  Ar!8 An!8 $,A#8`AP$*aW`E$*a* AD#8`CEc8 `CBc8 `CUc8`CGc8W`E!8 AR!8 AR!8 AO!8 AR!8\ AF#8`CAc8 `CTc8 `CAc8`CLc8_`P!8 AA!8 AN!8 AI!8 AC!8d e$*a2 Ad#8`Cec8`Cbc8`Cuc8 `Cgc8`$,Ae!8 Ar!8{ Ar!8w Ao!8s Ar!8o $,AgAf#8`Cac8`Ctc8`Cac8 `Clc8`$,ANp!8N Aa!8J An!8F Ai!8B Ac!8> $,A6!86 AD#8`CPc8`CAc8 `CNc8 `CIc8`CCc8`d!8 Ap!8 Aa!8 An!8 Ai!8 Ac!8 $,A$% <@(' $048  <4+ << 6& wY<@$& $ ''!$ !$a $/|''!$ !$| $'|'!$7W!$B$|''!$ !$|$'|'!$7W!$B$''!$7W!$B$a''!$7W!$B$a'><6& w <W$&($ CB|''!$ !$|$. <Wc$'|''!$7W!$B$a'|'!$7W!$B$a'A<6& w8<$& $Z "#!  %|''!$ !$a|$< \!$'|'!$7W!$B$a'|'!$7W!$B$a'E!$8$ ' $ 48<@('0" !, %! 48<@('<%!$ 0$<{!$($ ' $ 48<@('<%B$ $< !$3$ ' $ 48<@('<%B$ $  dhlH'$!@!$ $+@4 $?0<%!8+H !H%'$0!0+@ Mx LP<'%%1  %%1  Q  += %w '8'L'!$ !$A33'$  :@3N?0<%!8+H !H%'$0!0+@ Mx l'%%1  %%1  Q  9  += %w '<'P'!$ !$8'3'!$ !$3$+(b$'  %<'% '3'!$7W!$B$<''!$7W!$B$TX4'9  !$+A@"8 @!8 ?0<%!8+HC !H"'G$0! +@  Mx %%1  %%1  Q   += %w ' "'C'" ?0<%!8+H !H%'$0!0+@  Mx %%1  %%1  Q  9   += %w ' "'C'"/ !$+A@"8@$ %%1  Q  += %w ' AG< A  #!C'+= %w '!rP  $'+= %w '! $ O $d&(*, c+#!8$%A('+= %w '0!48 LP{O D0$AH(C<(D@,E%0$FB48 LP $T(U ,'"B8@p"t!% %"@\"X#$&(*0,!+8#$(%( % %X"\!% % &*D+c,$#%"+= %w '4$"<& b*b, %8+($ %D@X"\$p%&Et% &$#& %@p"t$X"\$!& #0' $(, "$!. @*Hf %X&0 P$aq  ,P$ `e`P$ba+ " d('p!4''!$7W!$B$d$de& `a b&A $a('1  % % A  %I  %%I  += %w '' `'0% nj nj+@ Ɍ&Pi*iI-$@(%h` '#Őnj nj Ȍ*H #8#@Ɍ!8 *8g8, Čnj& 8Č Č Ō*8# #(nj! * d% Č!dŒ@b+"`ŒP$#p!A"@ ' ' '1  м <T!$`b a+("6e8&p!L%$ '!$7W!$B$b a+("#e8&p!L%$!$ !$ e$ eg&( `  ab&A $a$ a\'1  1  <T!$<!$  1  <T!$<!$  += %w '`dlhg i$j+8G!8 gg hi&@(\h i'P'X %PjU@&P*H%+@J-$@H%@(M gh&8[b a+8"TgP$Hq!8g$gg gi&8'8`b a+8"0gHq!L'$ '!$7W!$B$b a+8"gHq!L'$!$ !$ g$ gi&8 `k \'1  1  <T!$<!$  1  <T!$<!$  '+" %w ``' ! ok 9 @L#$!$% P'!$7W!$B$a'P''!$7W!$B$% ` "B$""&b #&%b@ Bk $'''+" %w PP'' `'0% xu nj@ǐȌ Ȍ Ɍ*P @#@ #H ʌ!@IɌ ʌ%!X +`e9+XiG!@ !@ &Ph*hH-$@ %h`#Ō Ō nj*@#(#8Ȍ!(#ez`:'%`''!$ !$a$`HE$%d'!$7W!$B$ '`'!$7W!$B$aHn $ $''%`''!$ !$a$`HE$%d'!$7W!$B$ '`'!$7W!$B$aHn d$d$'\ 'X'!$ !$AHn \C$`+= %w ',ddm07bde$@0$!\!  ,bbG<d  !$a d+0s#0P$@p# '$ $! *P@%0&P$@ P$p  , P$$b+ FNdj#PXpW $PK k#0F! +P+>@*Hf %X&0 P$aq  ,P$ `e`P$ba+ " d('p!4''!$7W!$B$d$de& `a b&A $a('1  % % A  %I  %%I  += %w 'w &0M  *@#0#8!0cw &g,`  *8e#e#(e!$*` !@c$b+" ` !A '1  м <T!$ %%1  Q  += %X ' " !c  dc ] c (,$'+= %w ' AG< A  #!C'+= %w '!rP  $'+= %w '! $ O d&(*,c+#!8$%A('+= %w ' +"!8 & b*b,$a%A '+= %w 'D"!(B @ %A* @c,%`,(;<!4   $(,;<!4  04 $c <804c  AC,7`#$$p!CCD& & %`CDL!@H+?! !CC D@!@H+?! ! C EF@C CLCC ] $'%$1  %$i  += %w ',(A0CD D . <a La c L H$,$  L$"L<H"pL!"Loc `?<a D04$  oc ><a Da c  $#D8CpD!"DP<L L T8D L $"40!d+(d!(C0LB/%D#$ !$T L TDL L X'X'!+= %w '7(!$ L '+= %w '"@'"$!$ L  L '+= %w ' "$#$#$ !$<!4 L <!4 L <!4 L  L '+= %w '<!$ <C#C$$$4D$0$$,D$($$$ D$ $$(B$(!$L 4L 0L ,L (L $L L L L L @8'&"* "+8c,$8% (*A+$C%A  &"* " +8c,$8% *A+$C%A $$$$$$$$$+A & C*(b,&8$0%(&8 +@(*(,9$0%($*C$$%" $$$$+= %w ' $(,48.  !8%""E< &$ `E<  E " E< &A@`E<  E "`E< &# `E<  E n +A`#0%7$0&D&@@+P#*X-$@ #A#!(%0hA### +0#  k%# +`K)(|x, $  +A`#0%7$0&g$(+H,!8,&XG*8Gk-$Hi#A#!(%0'TP > (P#",T#d+"#a#$D$,!_+8#PW $P&X+`*hhk-$Xl#0#(%!HI%Pm=@#8G#(+G#"$G,!$  k%!'+`Ky8tp<lh $ " E< &A@XE<  E " E< &A@XE<  E " E< &A@XE<  E HD @P "!@$  HD@ > HD @P ,HD@ !$> P"@ !% &'#8+(! ##%>  ,P$401!0&nj<#8+ Ȍ#(# $,$! nj#88ƌ4 >   <4#"+"8#A>  0$,P*8$+H? A!@(+P@3+' >  P  >  P$( >  dhlptL'%%1  %%1  %%1  %%1  += %w 'Xdza"( !, (?$+A,,c8$$e`$ ?$+8a8$8$?<4+@9$($ ?<6&(,0?<6+@%(7$ X "!@$  ?$+ aE,8$ ?$?<4$"?$+08$0?<4$?<4+88$($ ?<6&(W,0?<6+8W%($$$G+Hg -)9 !Xa$H* $+H)9$H* $+H)9$H* $ ?<6&H)-)1?<6+P%HI $!8+X@ *+(#P,#X+`#Xl+`jm-9$`$+`9$`$+`9$`$ ?<6&`w-1?<6+hw%`h$!8'$$!8G!$*P%l@*$+XBU`Q !PI+X"N`KJa!`#pm+Xn #PO#PK%n-J%!P#p#`+h+xkP-9#h$p $+p9$p $+p9$p $ ?<6&pW-1?<6+xW%p $+Xl-k9!8G$Pn@ $+PJ9$PN@ $+PJ9$PN@ $?<6&PJ-J1?<6+X%PK@ $E,+H+P$PE%HI   +X +P )-$HI%H+ ( $ +X +P )-$HI%H+v +Ha)9$H% $+H)9$H% $+H)9$(%$ ?<6&(W,0?<6+HW%(|$ +Hb,)9!'$8*$+88$8$+88$8$ ?<6&8,0?<6+H%8C$$(+e,c8!A$h@$+B8$H@$+B8$H@$ ?<6&B,B0?<6+%C @$!8A`dT'<0 #`E< &# X@E<  E #`E< &# X@E<  E # E< &A@X@E<  E # E< &A@X@E<  E  4 >  4  > ,( $4"!$  ,($ >  4 >  HLPTX0'+= %w 'D"#?$+(f,8$(?$?<4$"?$+88$8?<4$?<4+@9$0$ ?<6&0w,0?<6+@w%0$ # &+@,9$@ $+@9$@ $+@9$@ $ ?<6&@-1?<6+H%@($"!$  ?$+ aE,8$ ?$?<4$"?$+08$0?<4$?<4+88$($ ?<6&(W,0?<6+8W%(H$DEB+eG,c8$g`$+c8$g`$+c8$g`$ ?<6&Wc,c0?<6+ W%`$ !d!#!A!$LP@'<$ # E< &A@0hE<  E # E< &A@d,E<  E # E< &A@0hE<  E  8  >  8 > 8"@G<B$ !!(+8e0,(  # E< &A@8$E<  E # E< &A@8$E<  E  8  > 8 d!(Dc+8%,0(  # E< &"@40E<  E  @DHLP('+= %w '"!?$+b$,c8$d`$ ?$+bc8$d`$? # E< &A@(4E<  E  <"!0b!+804,  @d!(D<g+@%  ,!A, `0+ aH4#8&?$8'#a#8!0%8$($+$,!8$# P& 08%018%0&$8%0 ! 8%% 8%% `%0$+8$+08$f`8%e`8%e`.8x$+88$8$+8+@8$8g,)9$H#%H($8',8$%h`a8%8 $+8+@8$8,)9$#%h$Q`<@DH. <@B$<@<`E!$D`<`B$!"H  h+A`l# p#($$#@G$+@O&P#+H#J-$PH|!a%H*a TPplhd|O   '48p##!"'E  <@DHL$'$ h'+" %w ' !   ,  # E< &"@,$E<  E  @DHLP('+= %w '"!?$+b$,c8$d`$ ?$+bc8$d`$? #`E< &# @8E<  E # E< &A@@8E<  E  ,  >  @DHLP('+= %w ' "#?$+(f,8$(?$?<4$"?$+88$8?<4$?<4+@9$0$ ?<6&0w,0?<6+@w%0E$# !+ &,8$ $+ 8$ $+ 8$ $ ?<6& 7,0?<6+(7% $!A"$(B,!A,' #@E< &A ,$E<  E  @DHLP('+= %w '"!?$+b$,c8$d`$ ?$+bc8$d`$? #`E< &a t`E<  E # E< &"@t`E<  E  |  > |"$$#$ %8>'%@%!$7W!$B$aR% $*"z@$+P@lSh $ # E< &A@0,E<  E 8d!(Dc+8%,0(  #`E< &# TDE<  E #`E< &# TDE<  E #`E< &# DTE<  E # E< &A@TDE<  E  ,04 $$>  ( >  (  >  ( > ("!+* E,$ % ` >  <@DHL$'+= %w ',"#d,+($(*0%(1?$+08$0?$?<4$"?$+88$8?<4$?<4+@9$ $ ?<6& w,0?<6+@w% $B$?$?$?<4$#$+@i,9$@ $+@9$@ $+@9$@ $ ?<6&@w-1?<6+Hw%@(|$$ (+H -)9$H* $+H)9$H* $+H)9$H* $ ?<6&H)-)1?<6+P%HID $(!+(),8$($+(8$($+(8$($ ?<6&(7,0?<6+07%( $!C!!"48('$ # E< &"@40E<  E  @DHLP('+= %w '"!?$+b$,c8$d`$ ?$+bc8$d`$? #`E< &# @8E<  E # E< &A@@8E<  E  ,  >  @DHLP('+= %w 'HLP > #`E< &# @8E<  E # E< &A@@8E<  E  ,  >  @DHLP('+= %w ' "#?$+(f,8$(?$?<4$"?$+88$8?<4$?<4+@9$0$ ?<6&0w,0?<6+@w%0E$# !+ &,8$ $+ 8$ $+ 8$ $ ?<6& 7,0?<6+(7% $!A"$(B,!A,' #`E< &# <`E<  E # E< &A@`<E<  E # E< &A@\8E<  EB$"  4@  >  @/ >  @!0E+8f08,  #0#H)O $H)!8*H %0&P' @$  , $+0a !"!+"!a <$@('<$@('<@('%A  %I  %  A  %(x  <!$ += %w '"@"B8%b@F #@E< &A ,$E<  E  @DHLP('+= %w '"!?$+b$,c8$d`$ ?$+bc8$d`$?= > `+(## C#b$C!b >  + A#A#8&?$8G+HD&P+@J-$PI#!0%8 l~$+XH` $. $*`h  ''!$ !$A' $$ $9%-98%h<@!$ "(@& C $  $#(/0!G<  "&"$$ $ $$$%0=>% $+-R:$Pa 9%%H $)% $$%=> 9%h79    ~| #($/$(%##!0%$ $ $$$=>j$+1:$09%9%hY $+p+,$p%pH+(dB$*p6%pT'h'!$ !$h0*@%%% T'&&@  $~ $ $ $$h'e$%%%T'!$7W!$B$ #c$a#S#s!0$$= $9$++,$%0r 9%5<6&%/d$ $1, #(/$(#D#d!0$$%=>O   ~ #($/$(%##!0%$ $ $$$=>#E$' $  ' '<!$ $"B$"gT %@ L %8'hR %8GN %@(5%0F<\%''!$ !$!''!$ !$'%8'!$7W!$B$!G<  @l&" d$+Ahd,B8$Dt@$+AB8$DW@"8%b@<@B!40*<c4+bp0!$$* %8,$e%`$*<B4TDbHa"8%C*@,,$A T,%0&8<. <VB$8<@?$+%+,$#%" <@B!40T bp0!"$a@DHL. <VB$@D<!$H   030> 3c$c0! b$c$+0$     >  C8`$< $>   $> C$+8# $  P$d$%0'%8%!$7W!$B$ >  % '%(!$7W!$B$$+0"!0C+8   L0$D$%0'%8%!$7W!$B$)!$)$,! > L"WC$ %8'%@%!$7W!$B$a,''$'!$7W!$B$aFǠ &$L0$D$'!$7W!$B$+@f $  e$y$%0'%8%!$7W!$B$ >  % ]'%(!$7W!$B$q$+0"`!0C+8   |$%0'%8%!$7W!$B$ > |"C$ %8H'%!$7W!$B$a\$+b !F+`    >  E"$   <c4  $(,B8"@F<@E%(D''!$ !$a<@ c$D' '@!  D' @D6Hnj?ƌ >   > ! b+0$  @?$+ADd,B8$D@$ ?$+AB8$D@$?   @D>  HLP$'  4 $  $(,4  $  $(,4 $  $(,4 $  $(,4<@ $  $(,448  $  $(,4 $  4"#' `'(@$(,%   $  $(,4!  ,m   >  DHL0'+= %w '48< > F e8%(!8+AB`0<# ##A#a'$$4! $$h  @D,'$(. <VB$$(<!$2$$' $ @D,' @D,'I  "#' `'(@% '8'@%8 &8*+,$e%b@ %&0*,&+fc8$%CL@  %&0*,&+fc8$%b?@%&0*,&+fc8$%b2@%&0*,&+fc8$%b%@@<@%&0*,<&+fc8$%b@848%&0*,4&+fc8$%b @$&D!&a%"!,% "#' `'(@% '8'@%8 &8*+,$e%b@ %&0+,&+fc8$%CO@%&0*,&+fc8$%bB@%&0*,&+fc8$%b5@  %&0*,&+fc8$%b(@%&0*,&+fc8$%b@@<@%&0*,<&+fc8$%b@848$&(*,4!+a!8$%"% '+" %w 44'TX\`7<1$!dc#B0!DB"H"! B$  @9 e< !$ 3"H"! B$  @" \H"!E?0<%!8+H !H%'$0!0+@  Mx :%%1  %%1  Q  9    H $('f $('?0<%!8+HC^ !H"'G$0!0+@O Mx %\''!$ !$`d '\'!$7W!$B$ 04'E?0<%!8+HC !H"'G$0! +@  Mx %%1  %%1  Q  % %1  %%1  Q  += %w ',%$+b`C8 `B8+@<"Y!$0 $4('$+A* e,$%D@%>$*`d,%,$ %@%$$" bp !A(CD4!(+ 8!+(!%&(#*#,$%# $ A%@*B,<,8$%C@ !%D$'$D$'A A"# &(D*D+d,$%C@ ! += %w '|@x@!.%E N$D@(pD!(<$G<$ $ $@(,04?h 8Hpt  X  T$  P<!$$  h@$\d$h`<`!$ ?">0"G<@XTP   X"T#P$"#$hd\` $#"G<@H%  %"#H $&'%"#g!@+HW!PE!HI4,!7  ,4" @2"@,"(#<`+0d&@G*H-$0%0&y#`#+#Cd2 < <(4 $# dc $c$?`% %H%P; $'0@+0JF $@p#XF_ $XhL%#hJ#0!P++XL6`(40< !$ %$# %$C!" 0#"B$+ b"<(48' f%J%*XB`%X̌ƌ&0&`%0A  % I  % I  <T!$<@!$  += %w ' 7"$Cw$Wc$ a|!$ R h#l$E$W$ p!$V $('+= %w ' 7p!$V $8! B(<c$ $ "E%0GHB%8HD%8HF%8HIJ %@ IL %@(IN %@(IJR %H*JT %HIJV %HIJKZ %PKK\ %PjK^ %Pjlptx|%l''!$7W!$B$de*% e,% e.% ef2%(f4%(f6%(f g:%0 g<%0 c%$Ĭ(Ŭ,ì'<!$ $"3&u>?3&u? ss& s8!34!<b&Da&|xt@H@S(p`@3(m`HDP@<L apah iJ %@  iL %@( iN j kZ %PKk\ %PKk^ lmj %`ml %`mn noz%po|%po~pq%q%0qrs%Ss%rctu%u%uvx%x%xy |%< |%ș |  a %a %s% %(%0 %8K%@%H%P0%r%X%`%h<%p%pa%%q?%%q@%rA%rB%rC%r!%!F+%!t! +h!(m$hF%F'$Q%h-o !0+h!8%p%@% } h L P} d |L P} ` xD H} \ tD H} X pD H} %"`%` CDE FGH'<T!$ $4,8(@0DC L'`'!$ !$A $,(0PlG< `ph  %"& #pdh,E@4'H'!$ !$A  ,( g 048$'048$'+= %w '48< @;   0$C`G<` C  !# A$D,'D,' ! ( <!$ $( d <TB$$bG<@b  !"a04"8!B l L+Ao`P#0%7$0&g8#A#H!(%01T'`($,<!$ @,( $1  X\`D'@X\`D'X\`D'048<. <VB$04<@V!$8!$$$ $ @C8R`C8`p!| $ $pA4A8B !  4! P 0<!$ LP0d <TB$LbG<@b  !"ap4"8!B<>!$$$ $ @pB|  p!@4| $ ( 8  ( g ,04$'+= %w 'DHL >  H+A`L#0%7$0&g8#A#D!(%0S($,<!$ 8,( $1  @7G<@8"  8#"#PT<' !  04d <TB$04<><&0++e,c8$f%C @d"`#&0D++e,c8$d%C@$( 'G4\D `@ $ ( ,4ptx3T X'4ptx3T X'(ptx3T X'%A  A   X'+= %X ' "'C'"ŽW<`B$ Q '+= %w 'P3lpt`%B$*A`E<` !$O  d< 8B$DE<` B$HLD'P$3XCc8`Cdt8 dc8cpc8`<Ec$%<7\` d @$8 <$$X  h} $5 8+bA d+ ":4@ \ $ ( ,4lpt3P T'4lpt3P T'(lpt3P T'%A  A   T'+= %X ' "'C'"ŽW<`B$ Q '+= %w '<#!$ $ $$ \    <!$ "$(!$ ,<`L!$ d?8@DH(' $d <UB$ $<3!$$ ' $ <>?@DH(' $d <@B$ $?@DH('"d&@b$&D @b$&D@ b !&"!,  "d&@b!&A!,  "d&@b!&A!,  "d&@b!&A!,  "d&@b!&A!,  += %w ' "'C'" "#$! ' += %w ' "'C'" "#$!  ' += %w ' "('C'"( "!$ -  ,./048$' += %w ' "'C'" "!!  ' += %w ' " 'C'"  "!k" $&'(,0' += %w ' "'C'" "!"  ' += %w ' "('C'"( "! $ -  ,./048$' += %w ' "'C'" "!P#  ' += %w ' "('C'"( "!@$ -  ,./048$' += %w ' "'C'" "!$  ' += %w ' "('C'"( !$$$ -  ,./048$' += %w ' ",'C'", ! $ += %w ' "'C'"7$"$Cw$Wc$a !$ R '7!$<$B$ += %w ' "'C'"7$"$Cw$Wc$a!$V '7'!$AA AA97'!$AA AAWG7'!$AA AAC7'!$AC7'!$A?7'!$AG@7'!$A?7'AE7'A9F7'AeE7'AE7'!$AW7$"$C`d$%(Ww%(E*`!87'!$AfW7'!$AA AA97'!$AA AAAAJ+= %w 'k !B&"!,''+= %w '"d&D@b$& @b$!$V %'+= %w '"d& Dc!  "d& @ !$ a$?V % '+= %w '\ E<`M@" @E<><掌<pFtB%8F $$L4@$ z !$H!  D!  gcl488%@'%H H!$7W!$B$AD $(L,048<@ D$HL! T(P @CE<ׄ$G0%G<@  !"<`!$ l$ $ `,'+= %X 'ÎĎ Ŏc'$'3'!$7W!$B$<>$ ` ''+" %w XX''''!$7W!$B$'''!$7W!$B$''!$7W!$B$;l'''!$7W!$B$$+@b@@ $+@9O)-$@(''!$ !$ $+@*'<><玌<pgtc%@g $$4 `|$ z |l488'''!$7W!$B$ $(,048< D@ E<(B$E%DG<D  #$CAA< 5!$ G<@ C!  $%& !#$%&A0A$ $ `,'+= %X 'ÎĎ Ŏc'$'3'!$7W!$B$<>$ ` ' "B$ "+= %w ' "B$ "@ '<T!$<(!$  += %w ' "@1h '+= %w ' "C$ #`B8@1h '<T!$<0!$  <T!$<(!$  ! ! += %w '"C8`PB8@F'!$7W!$B$a $Ym pc<@$t x/ xt%d`l'pm  l'l'+= %w 'tde%A%*@%@A!@ %0'%P%!$7W!$B$!40&X*@+Hk-$Hi%@  $' @jP'l'!$ !$PTX'x''!$7W!$B$de c<`p$ P'$  (,$tì ĬG<`  %!Ŭp''+" %w dd'"!B @$ %G'% ''!$7W!$B$2'G'['!$7W!$B$7`"# !<@$b$ B,!A 2'F'!$7W!$B$a!G'% 2'!$7W!$B$a\''!$ !$A<& ><&(% W DTdXeX`\`G<Tf  &T`%   `DKDde><><&(& % ?D0bd ec%0''!$ !$'T' $$L<  @C8`C8`C8`uD r `D$y'F<0!$F<@c$!$7W!$B$a Ddc  %(d&$+* $B,$C% @DCBc `  D  %A` & C+*b,$%"\ Df"@t$x&<'# #0f+@#0@H+ 8G@8%8&@*0-$ % $&|'(%H &H*P+X)-$H+%HI %@%8@<$#8+ 8#@h+8#8&@*0-$ % $@à +A!8 &(d*d,$%a%%(%D%#@ZD<"@!B<7!$7$  @D!<+!$G<!$  $DA%h! n D4"B8@\"$B@' D j DH"L! B @ DH"L! B @D  $k#uD4"$C[`k  n  DH"L! B @ D$%DH"L! B @D@@$kC%DB''!$ !$a?%@%% %0%8%H %X=?>@@HD|<x$ b $  |+Ao`x#0%7$0$+@9,$@ +Pk,k9$Xi%Xj#A#!($0h$>$+@9$@ k,k9$Xi%Xj$@h>$k8%Xd ` $+`c9$`m,9$h%h$` $? $|x?>m,9$h%P $+p9$H$HI i8%H$ i8%H$ 8ƌ  0 ,e (|+A`x# #'$ $$#A|#ax!HD<<@+!$y D!$ H+(t $? P' $ % @+ =>?f  k  >?'''I  I  I  I  I  += %w 'T<"@!X \V X "^y  %%%5<& e*e,><+($ %d`$ ' $ DH8'DH8' $(,<><0ab48 ޻ <@,'04 8  ) 0H"L! B @ 0 !#'% <@,'048 n <@,'<@,'8'+" %w 'L4"B8$@g"!@\"$B@)% 0$,(4%8'%@''!$7W!$B$!'''!$7W!$B$!LD@<'4'!$ !$A< B$ CCG<`<@  <#@$C DLde(8c'%(''!$7W!$B$ $$(, x|'0't'!$7W!$B$''4'!$7W!$B$L@"D!B @ <!$  !AG<   !AL<#@!c<!$!$ $ `o L%p'%x''!$7W!$B$ $(,048<@DE$FHLPS L'''!$7W!$B$a$PPTTX L@"D!B @"#! D f L !'% X\H'X\H'g"@"@%!BPT @%L%@"!BPT @ $%8'4'!$ !$L() 8!  ltp% '%($'h'!$7W!$B$''4'!$7W!$B$`X\H'8L"!B$ @ 8w L%x'%''!$7W!$B$! $(,048<@DEFHLPS L'''!$7W!$B$aPPTTX LH"L!B8  @L !'% X\H'"!BPT @+* E,$%`<><LabL"!HB @ %A`><><LabX\H'X\H'(X\H'@"D!(B @  LPT [ X\H'LPT F X\H'+= %w 'F<><㎌"#X\H'X\H'L"!HB @ %A`><><LabX\H'X\H'E<,&A@<4E<  4<X\H'Dg X\H'<!$ += %w 'F<><dabH!8+%2d"!B$ @ 32+@4<& d8@&0% % 1%8& T!@g+H?!8!8+@(9O &P*8I-$@(%8p TT14T1dH"L!B  @2 dH"L! B @p d"$#$% $%0W%0F LXGM dXL% $,&%0$&('&0,G$W$ 0WN d% $0'F<><㎌"#pt`'pt`'pt`'<!$ <!$ p'+" %w 'g"@"!B$ @ rC`4Cc8`<Cdc% % $ A b @ % ' '!$ !$EF8B  dlh'%('`'!$7W!$B$x'' '!$7W!$B$ E<& tE<  t $' $'x|'''!$7W!$B$ $(,048<@DErFHLPS 'x''!$7W!$B$arPTX HdLc r $'"!B @ sC`4Cc8`<Cdc% % $ A b @ % AE!8B$  $   s W  $' $'( $'+= %w '\%C8`$ C8`$B8@$3% 2 $; <"!$ g<@B$"G<@($  ("$#"# <B4 $ ,04 ',04 '<!$ $$"<9B$",$ $4 ,'D!,"0! += %w 'T!X 0P8"B<! @PDB%4'H'!$ !$0D<44'$' $$L<  !8 TXW \`dL'P`!{ P\`dL'+= %w '"!@B @'+= %w '@"D!B @'<!+= %w 'D "0e;B$.$W'!$7W!$B$c d efghijklCmDn$o(c'W'k'!$7W!$B$ $(,048<@DEFHLPS '$*(e<pa!!!"8@$ "8@$!8  $V<@!$ "@!!!T"X!. V %04%dF<\䎠''!$ !$ C@'T'!$ !$@''!$7W!$B$T'@'!$7W!$B$X'@'!$7W!$B$@'X'h'!$7W!$B$aF?$0'8%0%8,n$'%!$7W!$B$a'''!$7W!$B$a!c ''$'!$7W!$B$aX'''!$7W!$B$a c@'T'!$ !$@'X'h'!$7W!$B$T'@'!$7W!$B$X'@'!$7W!$B$@'X'h'!$7W!$B$aF;:6<L%0&D%8=J%0&F%84>%0F<\''!$ !$! FP'd'!$ !$P''!$7W!$B$!d'P'!$7W!$B$'P'!$7W!$B$P'''!$7W!$B$F%F8'A8 'L8 'S8'E8&&a8 &l8 &s8&e8f8%a8%l8 %s8 %e8%%;5` $+(87,$(%'8'!$ !$ $+(b' @ %%1  Q  0"@" #%C @<"@#'`'@%b@(!++= %w 'H,"(#P!($&+8E8 8+8D2$a#8#Dd #D$D!"G<@  !"a b! &d!E+!" a&A&D%A  a$ at't'%I  %(%  % A  %(% x  $!$&('@'H%@(0l@<8 4,!A"!,b0ad# D+De#%#"$+D* B8!,$"% a7!$L 4"!$!C8+(8+b p!!a!"<&"*"b,$%"@0'$1  += %w '84d0d$a$0'!$7W!$B$'%Aabd! + e!!A! D+!"B'%C<d@d ba%%%% %0%@%H%8%(H8 E<&($E<  !8PH%(4 E<&($E< !8PH%(4'%nP'p'!$ !$a #C# +C#  $x('%P'H'!$7W!$B$T'P'p'!$7W!$B$tp+ *(B,$D%@* 'T't'!$7W!$B$a0M 4L8HHcP `L!(d!8+0+ H!!d!!PHx% %(HP%@>$HH )%!H*&XE`$@ 4P4$1H8 E<&($E<  !8H%(< E<&($E< !8H%(<'%##L#(+##H %P'p'!$ !$aL#"+#H#b#A $%"!,  $P'%('H'!$7W!$B$'P'p'!$7W!$B$* +!,$A% * '''!$7W!$B$a0M 4L8HHc `L!(+ H!!d!(!+ !dH(H%X$HH )%!H*&XE`$@ <$'+" %w @@'' '!$ !$AF|dxDEHB lpt#HI+PI  #+#*$(,0 L4@8<DHPx|lpt!A!+A!ad'l'!$7W!$B$'l'!$7W!$B$'B$|*CC`x!!d<+$d"e<6&0 <+$& <,$Z< 6&( <,$& <+$<,$<,$X$<-$fG< g  $' d<+$'a gB @ !#+#!D!#V'#+8#@(#8*@,k,$Pj%@ >XA$  1 6@|$xXnj+@dh` $'E'!$ !$A>'$  hCD$E+0d $<`!$  hG<   "%% %(hD$!>'% %E'!$7W!$B$ f~a$bB$$ f$b#B0!"G<@b  !"a h!G'% < !$ l>'E'!$7W!$B$ah !'%)'='!$7W!$B$<+!$lǐ$<Ǡ$ ;ǐ$<Ǡ$%8%&(0,%% $WN %&(,0D$Œ!Ì Č %&(,0D Œ!Ì Č < B$ &(,0D @Œ ! (,0TX\'< @' @'+= %X '`! '+= %w 't8d$d$;aEd&=dPdLeXf&8* ,Tg+(8$(% Dd|%% DaHb p'$;a@a<0B$ p'%*("8D$e(e4f*( , 8|tD$e (f4g*@+@AP#H(O $H)#PAx!Hi+`B,l#0#`g $8!(*8%0 ,&8   8|tD,x=e PeLgXi&P*(I-Tj+8$8%( lapb! @$t:$t 8|%D,x4e!(4eLePg!HLi+(%W!8G!(Pe!08=gXg&P*(G-Tj+H*)9$8'%( lapb ! |tD8x4e(g*(^8e['DaHb p'=b@PbLdXe&0E*,Tf+ 8$ %D@$;b@b<0!$ p' p'8|%DDee>eT=ePeLfXg&@*(-Th+08$0%(Ddehf%8@z40l'F<0!$F<@c$!$7W!$B$a 4&0* 0+g,$f%d`l 'F<0!$F<@c$!$7W!$B$a 0#+ l4#e#d  l6'F<0!$F<@c$!$7W!$B$a 0#+ 4#e#d D<@wc$ i<$dG<D  D!a D|t@% 8D$e8fe$w$ WN 8|tD@\a \aHLPTPHH'$' $$L< %$t%0w%0GM %$t$ , %$t (`,`G< $a  !$`0v t8$;aEa $%8Da $%1$>a;b@=b@%&9a< 0!$  C D#$$#( # G<`@C  !#@A\A'% $ $<d%d e' ?<6&(% %>d<a$ ;d<a$%d$w$ WN  @ab!d e < B$   lapb ! "#B$ ! @'+= %w '%$,% w7% dGM ,04 8- ,<d% d e' ?<6&(% % >d$<d$ ;d$<d$% $ e$w$ WN $,lapb ! ,"#B$ ! @ $<@('+= %w '8" #4lp$&!!8",+!#!A( <@ S 8"@,4b( b4>b>@d$<d$ ;d$<d$% $ e$w$ WN $, ab!d c $<@('+= %w '(D"@l"p!$B,dc $04 @q ,"#( =@TX%b @"#X&0E*E,T+f$e%b@"#TXPLX&0*,T+fc8$e%b @lp ! ,(=5@>,@$=< 0!$ (C D#$,d c$ #$#G<`@C  !#@A\A$'% 8<$'8<$'8<$' 8<$'8<$'+= %w ',@DHLPQ%$4% w7% dGM 4i< !$$($',$9a :bW@% 9`<`!$ 4C D#$@Cd c$ #:BHL< -c$@D$PQ, 0':`lapb!8<  @ !"$!!@ <& b*b8+a,$a%A!  dT abB$$db#B0!"G<@ b  !" aD$H,'DH,'DH,' d$abB$$db#B0!"G<@b  !"a x@8C'%(d'@D%@&!@#! +f!D##!cB' `'8@PdDd@e,&8(+(* ,8$(% %D0&('4& % % $'ab!  '8@% <@!$ @(C,D#$@CDD# $%% '8Ye `eleZe8%(E$ZePTX<'PTX<'PT$X<'PTX<'+= %w '<l"@@D P H+"L&0*8,$f%`%% %@<lCG<lE  %0l@e+0%/&8*(,$0%(c(,F`+X7`*%+P@ $<`!$   \T@0,P %P !PjG<`K  )+Ih('G<@"  #"#%.% % A  %( % % x  <T!$B$"G<@l  l""  <!$ i<=B$"G<@l  l""  !  ! x `!  ! t \<@!$ px`d <TB$pbG<d  !$at\d <TB$pbG<@ b  !" al"!B$ $ @" @''!$ !$a<4B$$<B$' CBc!$4L86 < T@!<@B$   cdcpT@!<@B$  L!$  P'P'D\Î `<!$  !AG< D  D!AT#!c<8B!$8$ $ `'X''!$7W!$B$aT@!<@B$  Tp!%'L'!$ !$a'% '@'!$7W!$B$L`''!$7W!$B$a`'%  g P'@<@B$  Tt!%'L'!$ !$aX'% ''!$7W!$B$L`''!$7W!$B$a`'%  Xg P'Tlc`''!$ !$`'X''!$7W!$B$`'% `Xg P' $c'X''!$7W!$B$ `P'Tx!$$W <@#!$ j h4d8eHf!+ FLf!($0(TL!(m+"g Xpd\`L,P $E<٥$l-8  6 4C)`P'('!$ !$a $(|t $ $'''!$7W!$B$a?f @<-\`<!$ \ $% $G<@`  `""tCBcH% !  H" !B  @"(@$#'& b  H" !B @d'#'2'!$7W!$B$a3@ D'%%9   D'+= %X ' "'C'""W$7B$@WN '<8!$$$$Fy  ,0 ',0 '+= %w '("!$ >y    !(, 0 48 '48 '48 '+= %w '("!$ >y   !(, 0 48 '48 '48 '+= %w '!EA4A+= %w '@'x'!$ !$AF%F8'A8 'L8 'S8'E8&&a8 &l8 &s8&e8f8%a8%l8 %s8 %e8%%;5` $+(87,$(%'4'!$ !$ $+(k' < %%1  Q  += %X '($$ 0$g$ $' 'N (aG< a  "!b,'+= %w '8"$<+ b44 $%F8'A8 'L8 'S8'E8&&a8 &l8 &s8&e8f8%a8%l8 %s8 %e8%%;5` $+(87,$(%'4'!$ !$ $+(1' < %%1  Q  += %w 'T,!X  L` 0T!X  (,04D@ $x8 89 )1 $+PI @  $  $)9  $ $xZ8W LHTP''!$ !$A  $('% ' '!$7W!$B$`|'''!$7W!$B$aj<;c$HL$j<;c$H L$G<$ƌ G s " #% bN$O<<@!$ l<`B$"G<@  ##pdte`fdghh,i0j4kl%l'%p% !$7W!$B$(l$m  $(,04'l''!$7W!$B$aTX\`aM dG<l"  #"l#k 'k 'E<(E<,⎸k '!k ' '<!$ $" f hi W hJj @d <TX \`ä F< F<HpdtcT X%'('!$ !$,04 @"3@4#cHLP B$"G<@"  #"#p"W$7B$@WN  TX\8'<p"t!B@D HLP $(* @,04TX\8'H'+" %w '<CxD '4'!$ !$|B''!$ !$''!$ !$ '''D' $$L< -@C8D`' '4'!$7W!$B$a' <pdtc   $(* P'''!$7W!$B$a<'P''!$7W!$B$a1 8'+= %w 'H&TXP> P N P"0@p"*@(I 4'''!$7W!$B$aPp"t!B4'%'D'!$7W!$B$ `j$ $ @07<%!$ k<(B$"0"G<@8  8""<B$ "G<B$"  $XD'XD'XD'XD'%%1  += %X ' "'C'"Ž ÎĎ! ''+" %w \\'wd$;c'''!$7W!$B$'% $`0C `L''!$ !$a<4B$$<B$L' 0C4Bc 7"$C`p<`I!$ $i G<@C  !#A$pa! C% ''!$ !$A%t''!$ !$|'tt'$' $$L< < #8(`4'''!$7W!$B$aL*(d%H& A0  08<'!  '<!$ $"B$><!!$ k<B$"G<@`p  `"p#X"t $x$#ADA4< 7!$ G<@XD  X#D$ #4#$<>B$H8`w8d$T8e$@%0$%@%@ GM H8`T@d%8h fP)%<H%%%`T@d%0 (<P$'%!$7W!$B$@c<$' n 8dG<He  H&%7$!$ WN <!$ Ldhl  $#G<`#$  #$  $DaH('"$#G<`#$  #$  $DaH(',!0B4 8<@DǮ G<@00C  !#A),!0B4 8<@DǮ G<@00C  !#AH(',#wC`c%D% ..66*(%c$C #wD%(Fǀ%8#(..$*8Ew`c%%(#e%!a!ų G<@00C  !#A,! H('! H('(EwÌ`c%Č% #d%!`! G<@00C  !#A,!ų H('!ų H('H('%b@bd ef&"$ %,B!def c DǮ G<@00C  !#A$Da+= %w ',"/@0B!  ,"" "G<@"  #"#0$Ck<„$ $" @8a' '$ ,"# !48<('+= %X 'wĎ+(" !Abde c"$% #$ '1  += %w '$! %(B, 048(  < '< '+= %w '48$a$ b$@ $"#$ !0, ְ  @('$@('+= %w '48$a$ b$@ $"#$ !0, ְ  $@('@('+= %w ''0!,B4 8<@'' G<@,,C  !#A' A!$A@ @G< A  !@D('+= %w '0< ,Ž#$ %!48< @ @$6 $!,!0B4 8<@D G<@00C  !#A240A8A<A@ AD H(',!0B4 8<@D G<@00C  !#A,7A !%C`c%&&..* %!$A 7A #%D%(#e$*(Oa(e  48< @ $)  0J0!,B G<@00C  !#A,!ų H(',!0ų H('Ž#$% !48< @ @$,  0H('0!,Bų G<@00C  !#A,! H(',!0 H('$DA< !$ 4"8"<"@ ",W$"  H('+= %w '(!$f   (TB'$  ,0 '+= %w '+ ,(@! $B$ ($ $(B (Cc$Cc $$  '+= %w '+ ,(@! B$ ($ $(B (Cc$Cc $  '+= %w '"CG< D%  !$# %A# `c%%%(66>>*0%c$#7A !%C`c%&&..* %!$A'+= %w '"CG< $E  !%# $A# %%(`c%66>>*0%($#7A !%C`c%&&..* %!$A'+= %w '<"#$ !@$ DHLP $ <! @BD HLPTq y!<!s @BD HLPTq a<"@@!D HLPTq <TCD$E& '()+Pd&@40,(@T! $  TG<   "!<0,4(%(%% D$!hif g! @cD HLPq 8'+= %w '0,CDE B48< @ $!,! %-0B4 8<@(  ,! %0B4 8<@( ,D(''+" %w ,,'"@#`m@#j`!P8!A P8B'$  !BL8,78BA L8B'$  4(''!$ !$A<T!$<!$8,d <TB$<!$4(d <TB$'$  o#7`!H8!A H8B'$  <Tc$<c$d <TB$'$  6!DW8!A D8B'$  <Tc$<c$d <TB$'$  % $-+8D0D <3!$   0%8%(08,#0$Fp"p!  HXPL,08% %0D+@$#@$0 $P$q#X_ $Xj!X*`h%@%X($4T&h00$ap  $HP(L4X0 $0!+@##@#H#q#e$i#D# '$ D!D! *0H%&0 0$Ap  $(4`dh<'+0!0a+80@0$Hq#07$0D!0&#PA@%XTGT%` h q%!h/%+X=`%Xhhp%!h/%+06+0{#0EHp7$!"&0L0$ap  PX0L@0$D#0%#(8q7$0!0&#B##  D`0dLh<'%X+0C##0%q7$&!!*0J%0%0% &8a,80$Ap  8X0L,DT*f@%& @0$ap  0LD`dh<'D`dLh<'%I  %%I  %%I  %%A  %%I  %%I  X I  += %w 'TP+ bDD$H%@p!<,($%!$7W!$B$< '8'!$7W!$B$A%$% *0$+0"0$8p!8,$%H '%P%!$7W!$B$+@L+0#0#C0$@p$!$%Pq!C<,*$% !$7W!$B$A< '8'!$7W!$B$!a%%*H( +H&W H'p!H#,*% '%X% !$7W!$B$A+P@A$%@gp!<,($%!$7W!$B$< '8'!$7W!$B$!%c$*0#+0$0'p!0,$ '%H%!$7W!$B$+@d@'%%1  %1  %%1  %1  %%I  %% 1  1  A  += %w '8% C8`L8%(`8$L@8$ @8$%( (''B"" "> AA!" "+= %w ' "'C'" ' += %w ' "'C'" ' += %w ' "'C'" !  48'+= %w ' "'C'""! B @ ''+" %w xx' "'C'"''!$ !$AL''!$ !$AB @DH'% L'@'!$7W!$B$'L''!$7W!$B$'L'!$7W!$B$''+" %w xx' "'C'"''!$ !$AL''!$ !$ACBc `DH'% L'@'!$7W!$B$'L''!$7W!$B$'L'!$7W!$B$'+= %w ' "('C'"(,c'H'X'!$7W!$B$ ` \`$'+= %w ' "('C'"(dc','<'!$7W!$B$a  @D$'+= %w ' "<'C'"<@!\` dhlpt x$|(~* ,048'+= %w ' "<'C'"<"!B@D HLPTX \$`(b* @,04dhl8'+= %w ' "'C'" <><4  $ %%1  Q  += %w 'D $ B$(<!$ $Ӛ 8$<!$ "G<@(  ("4"<]!$@8 $ $""G<`4#  4$#$P9 <!$$Ӛ 8$<!$ 4$"<B$"<]!$@8 $ $""G<`4#  4$#$KHL $ +  0<!$$Ӛ 8$<!$  "G<@0  0"4"<]!$@8 $ $""G<`4#  4$#$><><4  ,$ >",@ Mx PTD'>$1  Q  += %w '@ "E<><4 T?$+ aE,8 $ $?$+88$8$ ?<4+@9$($$<8?4+e,c8$h`$?$+ec8$h`$ ?<><4 X?$+ aE,8 $ $?$+88$8$ ?<4+@9$($$8<?4+e,c8$h`$?$+ec8$h`$ ?$+ "ud$$+ "la!$# '0! $B$ c  "$0+ bQ4#(#0a$$#(/$(E( ,!(%*P@%@&P@   04( ,!($+0a(##ec$B$#$"!)* C%& a    !E!$8$'$8$'%I  %%I  %1  1  %1  1  += %w '% $+8A&Ġ$<% $+8AĠ".% $+(AĠ$+ Aà$@('%1  %1  %1  %1  %1  %1  %1  %%1  $. <VB$ $LP  H"CD$E+0d8 $0$+(A7,F$#8D# d$# '$$!%$+@f@<X8  d"CD0B#$+0e $ !$$  d,(8!%#G<`#  "#"^hl 9 <4 @E<c$dF%8,`hl > d!"#!  $ d! $"#G<@"  $"$hl ? . d! S > > <!$ $8 $8pi$!8'&P!2@$  %  $@D               S > > <!$ !  !  'l'Mx   '2   L' Mx $Ap!bC $+CB8',$@%''!$ !$ $+0' S > > <!$ @h  Th h <!$ $8 $8pi$!8'&P!2@$  %  $(,  S > > += %w '<] " _ S > > <!$ > S > > <!$ $P $PKq %!PL&h$0 <$0%C` $$@G $@(q$!@H &X*`B$@ _ !$$  tx'88@8  g$$@$ ا $(,'  $  $'0'O'!$ !$A0'   $+A `#A#$$#0'!#P' Mx !"+0p  S > > <!$ @h  h h <!$ $8 $8pi$!8&P!2@$  %  $  S %%A  += %w '"d&D"@ " e&@b%&E@!b Y  !C B Y % '+= %w ' "<'C'"<9 !~ D!AH+0@,4@   ' += %w ' " 'C'"  "#$ ! > $(' += %w ' ",'C'", "#$ ! 048< B $@(' += %w ' " 'C'"  "#$ ! ? $(' += %w ' " 'C'" > "<@c$&C0@"#'& ($` !$OY  % #+# $(,'@h  h h <T!$6& w$"<@!$$"G<@"  #"#  c#,+ f8,$0% WR` $ F<@$!%&' !DHLPTX\`d0' DHLP8T<X@\<B$`d0',DHLP8T<X@\`d0'E<@Z$ c0d8  0 ><@Z$! ><@Z$d8  d8c8`!$$$'$'%I  += %w '%o  @ G<$! a$"(@'+= %w '$F0!@E+Hh +Hz #HO $HI!H8*J9 @+k9`+k9`$  @%8%8$E<..+0ME<(0!(,A !('08%+("5!&%& 0"8@!8" <A!$ 4"G<@0  0""$ "  HLPQHLPQTtPT H'LH'   t"LBc@$(D"@% ! C+0$(  X4@0(tLnj,DH8L##P<K!$D'A tL"P!B<(/!$ @X40(,t<4+@X$d%"$T%@ $%P%P @@@GM @(t$Ì<$ C !dd$w$ '\TWN \'t@08+ Ci<# a#C##'$d`!  _3$  hl4 "%hXl  ( >  8<@$'+= %w ',04 $>  ( >  8<@$''+" %w ||' $+A+ e,$E%x@ "C,* e0\X T% 2$?$+H)9$H# ? $?  "C,c0* %b@ $>   >  "@ 3$>   $>  "@ $>   $>  \XT "`''!$ !$a   ,4> \X T`' TX\`'08 0"#?$+ e,8$ $ ?$+ 8$ $?<4+ 8$ $ ?<6& w,0?<6+(w% $$  >  0 >  @DH,'($$+H# ,< $`4!"!,' "T@="?@$"!e(:(% &+8( !$$  ''!$ !$A  PT%'% 'L'!$7W!$B$`'''!$7W!$B$G< \<>!$`' \`''!$7W!$B$F<`R!$ $""G<@  " "    'o<dB$'$[#!   [ ' ' '+= %X ' "'C'"Ž '+= %w '0#DH8 "< @  DH4'o!$  X`G< X  "!X%% \# $bpB$!@`CG<`\C  \$#D>X`C\D$XE+0d( $<>!$  X`G< X  "!X(%(%% \D $dpc$!a`aG< \a  \$!d%_ dhT'E "@< "$$!'   sD@ <,ADDt#$E<Ē<$||' ( @"@|x@="_@!< B$0!$ $ "#c$$+(C0 $<T!$  0G<   "!%% #a$!,"G<@4"  4#"#PT+@ D'Ec! 4  " d&D-@"d&D(@"d&D#@"d&D@"d&B8@ " d&D@$"$d&B8 @%"%d&B8@&!&b&A!8% '+= %w '0w%a$8*"`@Ž $ap4!##$! @ 8$' `#$@44DH<L,'$% @% *(b;+(bX $#p!$"(#$!Ď  8 $4 8 +"8` $ #p4! $G<(  ('&!$+A`<#(# $8&p/$(!(#A @p <4DHL,'I  1  %1  += %w '"d& D$c!  "d&D@ " d& D% c! % '+= %w '"d& Dc!  !B&"!,% '+= %w '"d&B8@"d&$e& %@b$& D  c ! Y % '+= %w '"d& Dc!  !B&"!,% '+= %w 'u  ! "d&D@"d&D@"d&D@!b&A!,%%''!" !<@!!" ! += %w ' "('C'"('`'p'!$7W!$B$aq  tx$''b$d''!$7W!$B$aq+= %w ' "<'C'"<$'t''!$7W!$B$c'$'4'!$7W!$B$a10  8'+= %w ' "<'C'"<c$'@'P'!$7W!$B$c'$'4'!$7W!$B$a10  TX8'+= %w ' "<'C'"<$'t''!$7W!$B$c'$'4'!$7W!$B$aG  8'+= %w ' "<'C'"<c$'@'P'!$7W!$B$c'$'4'!$7W!$B$aG  TX8'!(",!<@!!(",! += %w ' "('C'"(`d &q  !hlptxy$''B"" "&q+= %w ' " 'C'" !X\ `J. dh'+= %w ' " 'C'" !!$( ,J. 04'+= %w ' "'C'"!HF '+= %w ' "'C'"!!F '+= %w ' " 'C'" !X\ `F- dh'+= %w ' " 'C'" !!$( ,F- 04'+= %w ' ",'C'",!dh l(=  $ptx|('+= %w ' ",'C'",!!04 8(=  $<@DHL('+= %w ' "'C'"!LP E '+= %w ' "'C'"!! E '+= %w ' "'C'" !HL '+= %w ' "'C'""! B @'+= %w ' "'C'"!HL '+= %w ' "'C'""!B @'+= %w ' "'C'"!  HL'+= %w ' "'C'""!B @ '+= %w ' "'C'"!  HL'+= %w ' "'C'""!B @ '+= %w ' "'C'"! D '+= %w ' "'C'""!B @ '+= %w ' "('C'"(,,c'\'l'!$7W!$B$ ` pt$'+= %w ' "('C'"(dc,','<'!$7W!$B$a  @D$'+= %w ' "('C'"(,0c'\'l'!$7W!$B$ ` pt$'+= %w ' "('C'"(dc0','<'!$7W!$B$a  @D$'+= %w ' "('C'"(,4c'\'l'!$7W!$B$ ` pt$'+= %w ' "('C'"(dc4','<'!$7W!$B$a  @D$'+= %w ' "'C'"!"! B $ @'7'AA AA}+= %w ' "'C'"!"!8B @ '+= %w ' "'C'" "!  ' += %w ' "'C'" "!  ' += %X ' "$'C'"$( ,0 48 '8!+= %X ' "$'C'"$  <a$hlptT'X#(n`N '+= %X ' "'C'" '+= %w 'lpt#7q<@B$\`\'l$#dhP  dh`|#`DH%0%(, ! c <!$ `|,48q<@c$HLPT4'XH'p$#  dh|dc dh{$(WqB$"$"G<`(0   (#$0%# $%  < |!$ q<=B$"G<@(0   "(#0$"$" #$  dh0d' dh48$#t $#p #l x'48$#p #l x'#l x' x'+= %X ' Ž4ÎĎ E<$nj<@ P  $(YJ 40!@dh@Bdh<!$$d' $ x|:l p'$;P;'$ dM !@dh@Bdh< !$$d' $ x|:l p'!8 <s!$$  x|:l p'x|:l p' p'+= %X ' "'C'"M '+= %w '< !$ @$" "$G<`  ""<B$'+= %w '<!$$  <B$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$ $ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "< >B$"<!$ $ 7G<@"  "<>B$"<!$ $ 7G<@"  "< >B$"<!$ $ 7G<@"  "<>B$"<!$ $ 7G<@ F<#  ##"<(>B$"F<'+= %w '<!$$  <B$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$ $ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<=B$"<!$$ 7G<@"  "<$>B$"<!$ $ 7G<@"  "<>B$"<!$ $ 7G<@"  "<>B$"<!$ $ 7G<@"  "<>B$"<!$ $ 7G<@ F<#  ##"<,>B$"F<'+= %w '` *0"E '+= %w '(iY  #0 `BB%A' '`B'%B#,D('(@,$e%d$+ *(F,$ % %d`,04 @ '$"!< !$' < B$  += %w '(iY  $+a+ E,$%`,04 A '$"!< !$' < B$  += %w '(iY  #0 `BB%A' '`B'%B#,D('(@,$e%d$+ *(F,$ % %d`,04 @ '$"!< !$' < B$  += %w '(iY  4+a+ E,$%`,04 A '$"!< !$' < B$  += %w '(iY  #0 `BB%A' '`B'%B<+7D('(@,$e%d<4+ *(F,$ % %d`,04 @ '$"!< !$' < B$  += %w '(iY  ,04 A '$"!< !$' < B$  += %w ' iY  #0 `BB%A' '`B'%B$(, @ '+= %w ' iY  $(, A '+= %w '84".% <6$ <6$W<6$w<6$7 *% %a%A,%c0B00!0 ,$%%%A$ b  <&7 $< GB$"@,!`   w @,!|X`  T! F<<c$ K !p<~B$!A!`!0 !8!,E< '+= %w '"!  "! ',!  TB @!8 T! !8 T! !8  '$ '+= %w '48r " !,0T  $<@DH('+= %w 'F<<@B$H'  > HL<@D  $ $,0(4F<<@B$H' n ("G<`0#  0$#$%%4,PTX\8'"!PTX\8'+= %w '&"`|'dhlp <@VB$dh <@VB$lpF@"5@",@ "#@"@"@! "!  G<؛<!$$<`B!$ > G<ܛ<!$$ G<< !$$ G<< !$$<`!$ > G<<!$$< @!$ > G<<,!$$<`C!$ > G<-  G< G< G< G< G< G< G<  G<<!$$  G<@F<  !"FB$X\`d#D H'X\`dH' H'+= %X ' "'C'" !m '+= %w '`#ptxh"WB@<C@B%%<$&(d  :LPLP<9!$$$L' $ <T<@j!$ $"<B$"< "G<@T  T"$"pxT< !$ $""G<`x  #x$#> #T#$t%(p@B !$$av Z <!$$1O x !4$ ><!$$1O [ G<` $5 B t8Df8:Dr86Dm82<@!$ p<1c$HDb8Eo8En8Ed8 琬 h,2F h,FB%8$98 g,,B%8$*$'a, FB%8$l8 g,,B%8$]$Za, F%08f,6B%0D%0>%0(8 G<  '&8G<  '&'$A  $A  <!$< C!$ += %w '$<1$& $.,0!$$%8 #e,!F`F "@%('D'!$ !$a$,<'4c$($('$%%%% E%$+($ $<T!$   L$(!(e$G<  '<$$E&$+($ $<T!$   L$$(!(e $G<  (<]% $E$$+($ $<T!$   L$ $$(!(eG<  '<$]$E&$+($ $<T!$   L$$(!(e$G<  ( $*# a8 $ <"# !,04F`$%$F'+@#t $$  ': 08!8 %08 08&%%%p!73/+E<E< ⎽$  '@l$fK9 ` 9:`9%@ 9 ` 9.`%@%0%8)<840,E<E< ⎽!$ $$'<!$ $$'"8(@"8@"8@ $   $'< !$ $$'8,08'''!$7W!$B$au % 0123012,-./,*-<%g4%(.:%6%(4%dF<\''!$ !$'''!$7W!$B$''!$7W!$B$F8,08'''!$7W!$B$au % 0123012()*+(*)<%g4%(*:%6%(4%dF<\''!$ !$'''!$7W!$B$''!$7W!$B$F$ K 9 $0$ K PTH'+= %w '<#!$  <!$ w S <T!$et87cec80` Cc8)`Ce|8!c1c8`C<$&e`%-@4A@X";@\!B @3 < X!$i G<@C  !#HA< ,!$ w<B$"G<@H  "H#"#  + '#$  "$8#$8`8AT<`+!$ w!$<`DdH\@<'P$+<@=!$  S <T!$>0!80$#@), (''!$7W!$B$ah'('8'!$7W!$B$aF<\x&a`'T'c'!$7W!$B$a!c (''$'!$7W!$B$ah'('8'!$7W!$B$aT'('!$7W!$B$a@'('!$7W!$B$aF%04%(F<\ 8'!$ !$a@DH8''!$7W!$B$$'+= %w ' "p'C'"p& $#$D'!$7W!$B$a'D'h'!$7W!$B$at,x0|4? 8<@l' += %w ' "p'C'"p& $#$D'!$7W!$B$a'D'h'!$7W!$B$at,x0|4y 8<@l' += %w ' "p'C'"p& $#$D'!$7W!$B$a'D'h'!$7W!$B$a,'t''!$7W!$B$a @l' += %w ' "0'C'"4'D'!$ !$a0! $#$'!$7W!$B$a4'''!$7W!$B$a4''!$7W!$B$a,' += %w ' "\'C'"\ $#$0'!$7W!$B$a'0'T'!$7W!$B$a ,`X' += %w ' "@'C'"@ $#$'!$7W!$B$a'G?|'d'x'!$7W!$B$a'd'!$7W!$B$ac$''!$ !$'|''!$7W!$B$t ''0'!$7W!$B$a|'''!$7W!$B$a'|''!$7W!$B$aZv $+"`de*% e,% c'd'x'!$7W!$B$$%d $+ D'`'!$ !$%_%%'$+(NDE*% E,% E.% ' %&,2<=>?<=>@ABC''!$ !$a@*&A<% 4%(B:% 6%(4C% F<\掤''!$ !$''!$7W!$B$a'%%1  !$$(,D'!0$$Ǡ$D'!0$ ,$@ @'8Ǡ$%($D'1  += %w '(,$? x<0  8!<+(bDP$4+8XTX $%04E%(hlF<\pP$+0%LǐȐ%H'`'!$7W!$B$"% ''!$ !$'''!$7W!$B$''!$7W!$B$>?@A$+ Id>$+ )d?$+8d@$+8dAT$#8?0$L'\'!$ !$A>b ^ ?t %Xnl %`@r %Xn %`5A%XTXF<\\!8$+X(^`'L'!$7W!$B$A"%d''!$ !$'''!$7W!$B$''!$7W!$B$''!$7W!$B$'''!$7W!$B$a|q `'''!$7W!$B$at'''!$7W!$B$a<wt'Dc$$$ Y `'''!$7W!$B$a<&(,'<%('''!$7W!$B$a `a$ ,d$'!$7W!$B$'''!$7W!$B$''!$7W!$B$F<\厘&(!'''!$7W!$B$aZv d($@ $&8  @' !$7W!$B$d$46L'%!$7W!$B$'''!$7W!$B$''!$7W!$B$F<\厘&(" '''!$7W!$B$aZv d($@$&8  @ L'%!$7W!$B$$&<'''!$7W!$B$a(,04<T$(<$,d <U$04('$  H<c$ HdG<  !a''!$7W!$B$Zv d($&0  (>|d$468'!$7W!$B$'''!$7W!$B$F%04% F<\*% ''!$7W!$B$a''!$ !$a' '0'!$7W!$B$''!$7W!$B$a ''!$7W!$B$a' '0'!$7W!$B$a|q `2%(0+(bE,E$c$#070! ''!$ !$&`' '''!$7W!$B$a''!$7W!$B$a'''!$7W!$B$a' '4'!$7W!$B$a''!$ !$'''!$7W!$B$ '''!$7W!$B$a''!$7W!$B$a'''!$7W!$B$a' '4'!$7W!$B$a''!$ !$'''!$7W!$B$ 'd'!$ !$a(''!$7W!$B$H''!$7W!$B$' x''!$ !$x<4$x|'''!$7W!$B$)T %@HL %8'*R %8GN %@(5+%8'ptF<\xh'%8@'!$7W!$B$$%&'$+0G$$+0G%$+0G&$+0G','<'!$ !$$JF%\ %@hT %HI&Z %@hV %HI)5'%@H48F<\<h','!$7W!$B$T','!$7W!$B$F<\d&0!'h'x'!$7W!$B$aZv d($ $&8  h'@'P'!$7W!$B$T'@'!$7W!$B$F<\d&0 'h'x'!$7W!$B$aZv d($"$&(D      |'%1  %1  %1  %1  %%1  %%1  %%1  %1  %1  %%1  += %w ' 8$+(A'$E,$#070!0h,hl'|'!$ !$A$ j l'' '!$7W!$B$a('l'|'!$7W!$B$E,$#8?0!8, dl'!$ !$$ j l'' '!$7W!$B$aP'l'|'!$7W!$B$a<'l'!$7W!$B$aF E<@D  `HL8't$<$<t<t$P'%!$7W!$B$a'P'd'!$7W!$B$aW  > E<@D  `HL8'+= %w '<" @#!,c `<4  4<5 <B@<1c$%% 0$($'$  ,@!"!0L+A7`$(#AP#"$"G<!$ J !"$+ b,.%$ $p''%1  I  %%I  %%A  % %I  %%A  %%1  h %% I  % %1  %% A  % %1  % 1  %% 1  $I  %I  %1  h I  %1  += %w '`XT%A$*0$ f( $8p!8 %*H# 4L#PjW $PC#@!H*( )@*^ _ k1k9 `J1J9@ *J9)@<) (FG19(9%*\ h$> `XT $L%4\ d> `XT $L%4G@%*'2'!$ !$a$+H #8#@ % $#8?$8!8' )EL%8,x|%' pH!@2P0& $L4d`T,h $x|* & p!(*@%% d#n!S+ !+ $r!u+#Ș$ș## !+" *V %%%HD80<@XP&  $4D`T,Hh $x|Pd80 $X<@Lm;d.&'#3!$+`%`!` .&'#3!$+`df +`{ J < A,m D$@e$#(/ 0X!($+8$^' <>4D`T,Hh $x|Pd80 $X%@$.9&'#3!#y$+"+  n+ r+A#8$<!#A+`"#`)g $`!`&   4D`T,Hh $x|Pd80 $X<@$p`q1r'3!`+##8$!+B   &`$ r %1+`6!`$$n+`#`8g $`,#!`+$+# '$ ! *\%%%&  84`T,Hh $x|Pd0 $X<@$nr# 0!f! $+`"p#`ig $`l@!C##!`+<b +[ $ #I#F#0"$A! FJ 0@+bC r+ A=$(#0##A#a7$&X!& J rt!A!0<+A#`#A@# $'$ X! $+("0F!$$  j CD!(|G+@e8\ <*!$   8\X!  AAG< X|A  X#!|C%|`d@T$$  j  $<@>$ Xi HLP,''+" %w dd'%d d,d(e$%&'t''!$ !$$2.%D%(<%0&B%(>%04'%(|F<\厄't'!$7W!$B$'t'!$7W!$B$F('H'!$ !$%%% %%% e8e4f%8%@%(%%(''!$ !$F<`''!$ !$'%8'!$7W!$B$F LBX `Xi @dP+0% %(%0<8D4L!$   <B$ P$"4% $%08D!$#!0!acB$ dhlH'!$B$%*@'c$(+Hg $+H 8@<0,L! $   @8<,0$H !H#$#T+a@$+((L! $   T(G$8!8c$%dhlH'%%1  += %w 'X!\` dXi 8 HX!PDhl pXi  D$#(/0c$#070P!(H$JK!F!$%0%`%hPtHxD|T'tx|T'%@PHLD@,0<4(+p*0+p(!%+pX! $   HL<@PD04(,%p!pȭɭA$#@G1!($+p #%+pX! $   HL<@PD04(,%p!pȭO%ϭH%+p+ h% c$#pw1JK!N!$%p+( %+@0XB $   PD04"$!HI% !'+`8 <@+!$   8PDPHD!  X!PH DXi tx|T'+= %w '("(d&)@,b,$&$@.b.$&@0b0$&@2b2$&D@3b3$&D@4b4$&DB8 @($ Y % '+= %w '$  !$$   '+= %w ' !$!$  % 0!$0!$$ Y  '+= %w '"d&@b$& D% !c % '+= %w '  "d&D@"d&D ! c&#%"!,''"@W!&"@%"@W!&"@%!+= %w ' "'C'"<@!$ .g '+= %w ' "'C'"<@!$ g '+= %w ' "'C'" "&CJ@& AFD&B`#w$G<e  $%d#w$G< e&  $%" &d"CG<$  #$#WG<`C  !#A"WG<`C  !#A'+= %w ' "'C'" "&CM@& AID&E`B&"A`#w$G<e  $%d#w$G< e&  $%" &d"CG<$  #$#WG<`C  !#A"WG<`C  !#A'+= %w ' "'C'" "&CF@b&"B`#w$G<e  $%d#w$G< e&  $%" &d"CG<$  #$#WG<`C  !#A"WG<`C  !#A'+= %w ' "'C'" "&CI@b&"E@&aA@"W$G<E  $%D"W$G< E&  $%# &D#bG<$  "$"wG<@b  !"a"WG<`C  !#A'+= %w ' "'C'" "&C@%M<`!$<@!$ <`!$& aCG<   ! AG<    !A#G<$  #"$C"A7G<` #D  "## $"Ca!$a$'<!$ += %w ' "'C'"$"&C@%O<`B$<@B$! <`!$& aCG<    ! AG<   !A#G<$  #"$C"A7G<` #D  "## $"Ca!$a('<!$ += %w ' "'C'"<@!$ bh  '+= %w ' "'C'"<@!$ h  '+= %w ' "'C'" "&C(@"W$G<E  $%D"W$G< E&'(!  $%& '(D   bB$b !'"@%!"@%!!+= %w ' "'C'"7G< @"#  !"! #!! '+= %w ' "4'C'"4"@<`!$  4"@%!% %%%8<@0'. $ %+0D(,<`!$ $   (,$0!0fG<nj  %'Ŭ%!&(%%%%+= %w ' "'C'""@%*"CwDG<e  $%dCwDG< eFGH!  $%& '(d@@@#c$# A '+= %w ' "'C'""@%*"CwDG<e  $%dCwDG< eFGH!  $%& '(d@@@#c$# A '+= %w ''','!$7W!$B$ac,0'+= %w ''','!$7W!$B$a0'+= %w 'X"z< c$D\H`LP"zB$'$"+*9@8-'$8@8@)- %@* ,)TX\L%@4%@='$$d `d<B$hlP'$d `d<B$hlP'#%$"#!$*a`$d `d<B$hlP'"$+A`$d `d<B$hlP' @ ``dhlP'<@DH<'@# X\T% $*(+(K!(d%0%8o$+0=!(e$0 $+8$0$+0$ $0+0$%0$+(!(d$0+@ $0$+8$ $0+8$%8)%(<<'&0<'<<'HD%@+P@8* $ S <T!$?0@4@  , (8< !$ $"h< !$ $x+ ( #$l+ C),# AD$#07$fh!8g:8 <T$@#@G1!@X%H%8$<!$ $"<5B$"ptX'Xd`!(D\+8e@(D  S <T!$ S P L!  PL !$TD$d0T%l&83||'&8|'||')%+X` $B8"@(B$,+ b$$ $,B8"@(B$,+ b$$ $@#$$B$"$#B0!bG<`#  "#"<;<( 4<;& @%0%%(TPLX\`D'LXP\T`D'$%I  $%I  $%I  += %w '<dd8XD$H+0@@ $B8"@hB$l+ bdd $!$ $  "@#$$B$"$#B0!bG<`#  "#"d88\ !$+ A $!$ $  T"G@#$$B$"$#B0!bG<`#  "#"8,DB8@`\XX\ `<!$$<!$$  \"@#$$B$"$#B0!bG<`#  "#"0@PC8Z`dB$h+ b`` $ S > > += %w 'F<(&A- 04&C%@!`$OY  ,% #+# 80<@$'@h  ,h h ,0 4< !$$o  d <TB$  += %w 'F<(&A 08$',0 4<@!$$o  d <TB$  += %w '0$4($*`dE<$nj$@ $@ q$!@H &Xj`$@ %% 04`@D,'8 <<4!$$o  d <TB$  += %w '0$4($*`dE<$nj$@ $@ q$!@H &Xj`$@ %% 04`@D,'8 <<!$$o  d <TB$  += %w '0$4($*`dE<($nj$@ $@ q$!@H &Xj`$@ %% 04`@D,'8 <<!$$o  d <TB$  += %w 'F S %I  += %w '4"##C<*d` S %I  += %w '4!8 <! ,@ 4<! (8 <<!@ &"  % !, !8%`% a( !8% &$@ % !, !8 % `%a( !8D0' % !, !8%;@`% a( !8%*@&#@$ ,( !8%@!, $!( $*AD0'4l!8  <l!@  *AD0'4<!8  % <<!@ !8D0'+= %w '(<!, 0<!4 &A (<!,  %0<!4 8$'(<!,  0<!4  (8!, 08!4 *A8$'($!,  0$!4   Y * 8$'+= %w '048 <L  ")f%0$@,E N ($,  04@DM 04HLPTX8'HLPTX8'+= %w '  !  $!   $'G<!$ $'+= %w 'D&  !H  4568< @N ( $,LPTX\0'8L<P@TX\0'+= %w '@DH8<456 N ( $,PTX\`0'+= %w '4! D  #>`y@#c0c,c09`z`C4%%@'T'!$ !$@D|HLPTV` !"* a@ *(e(yy$z| O ( $,<\8!@x @t'1 \<8t'X4!$$$4' $ d <TB$  += %X 'P@!ŽDŽ0T 3 0(!DPT   4HX\` d 4H PT_ PD!T W 0(!DPT  ' ,@X\` d' P`!$8T ( <<!$ }<|B$"("G<@<@  <"@#", "#$(B8 @rPd!T / 0(!DPT  y 4HX\` dy 4H 6] ;PX!T  !8 X\` d` 0<! DPT  0<!DPT X\`d $hL'+= %X '(Ž<d! Î,Î@ E ,$!@ L H84 y 0Ddhl py 0D 6] ,,!@TX \`LH8 4$ C(X!<  !8# dhl p` ,,! @TX \` $ ,,!@TX \`dhl p$ $tP'+= %w '`!d $%(b$$*A`(`!d hd! PL<8l = X !\ H D40 y ,@PL< 8y ,@ 6] X !\HD 40 hX!l  !8 PL< 8` X ! \  X !\PL <8 rT'+= %w 'F<0&AT 8<&bK@G`$OY < 4% #+#/ 8 %G<$G<B$ tx h p $v $'!$%(%H% tx *A ''!$ !$a c ` |c$$ c$$$+@ $c$$$)!(G<c$$ b$""<@!$,"' n }$"G< ,F !$ $   S %%I  %I  %%I  %%A  %I  $%I  %%A  I  > S += %w 'lp y % 'd'!$ !$TXP`d\'|  tx|h'+= %w '4$= 4"#d$%+0D( $ !$$  $4A(AG< ,A  ,#!C0'+= %w ',$= ,"#$&! 04w $,G<   #!('+= %w '\c$`+(X%X $  )8 $+H  $ !$$' C8;` B8@F<㎠&bT`&FM@Ix$OY < % #+#/ x   '  '#0 d8F@$%0 $+ D)%$+P,@0+* $*XD`%(8'T'!$ !$%8' $$ $ S %I  > S %I  I  I  <!$  '+= %X ' "'C'"E<B$<B$ Q '+= %w 'dh`%%% D48  4+A`8#($/$(f0#A4#8D! D8W0  4+A`8# #'$ #(A#aD! 028\dǀ09Y@<L$$H '!$7W!$B$ ' '''!$7W!$B$a ('''!$7W!$B$aH('/'!$7W!$B$a<L@ '$ 4+A`8#8&?$8#(A#D! oX'I  < j!$P0<`B$!"T S I  I  '+" %w DD'7G<@ "#  $"" #$ #"$ n"$%('%  ''!$7W!$B$%('/'!$7W!$B$a%(%0%8%@%H%P%X %0 %H%P%%(%8 %%@%<8HD  @L4  +A`#($/$(f0#A# !(8\  +A`#($/$(#@A# !( $*XIP`+9`&948 D@#8\#8#8D8L$LH@<0 ! %#0+# (( aG< d  "$b $LDH@8<c+9`48 LU@#8\#8#8L@L$% DH%8<F+9`48 H0@#8\#8#XH<L$L% @8D*+9 `LDH@8< *  $LDH@8< '$ +A`#H&O $H!#@A# !(& $L $DH@8<"8<Ì!%+`b+`A4̌8¬#h##pa ($xqo $h!`G<  ,-($!DHÌ!'+`b+`A@̌D¬8#ha<| $x-p##Ç$x!`G<4  ,/4| $!PTÌ!(+`b~+`AyĽP¬T#xaX4$/p##$!G<P  #,P4$+IX`#(#/$(%#`I#Hi!(%+J`#(C/$(E#8J#Hj!(E8%+Kk`#a$c#K#+!eT%8'#H(O $H!#A#! l%4$*@xl  x+A9`P# ##A#a'$!$  T"l+ b"`P&4$8p!0  S <T!$<8!$  I  I  += %w 'hld% %% HDX  D+A`H#($/$(0#A4#8X! Le0v8V  4+A`8# #'$ $#(A#aL! 0 8:@<T`wug$na$P '!$7W!$B$ ' '''!$7W!$B$a ('''!$7W!$B$aP('/'!$7W!$B$a<T@%%%` '$ 4+A?`8#8&?$8'#(A#L! %%%`i  4+A%`8# #'$ #A#aL!08% + `mK8% + `lB`?\'I  I  I  I  += %w 'h7G<@| "#  |$"" #$ #"$ h&"$%$'%  ''!$7W!$B$%$'+'!$7W!$B$aptl%(%%V LH`  H+As`L#($/$(0#A4#<`! Te0 8  4+AS`<# #'$ $,#AL#aHT!`0888h ؿ HL`$.8 $# '0$8x  #P*! X*(G" S > S %I  <T!$<@!$  I  I  += %w 'hld% %% HXD  H+A`D#($/$(0#A4#8X! Le0v8V  4+A`8# #'$ $#(A#aL! 08:@<T`w-g$&a$P '!$7W!$B$ ' '''!$7W!$B$a ('''!$7W!$B$aP('/'!$7W!$B$a<T@%%%` '$ 4+A6`8#8&?$8'#(A#L! %%%`i  4+A`8# #'$ #A#aL!08 % + `)K`H\'I  I  I  I  += %w 'T7G<@ph "#  h$"p" #$l #"t$\`X% %(%0Tpl|<8L  8+A}`<#($/$(%f0#A(#,L! D8E$  (+A_`,# #'$ #A#aD!$840H@ l !p @%# +#9 d(( TaG< a  "!b04H '$ (+A`,#($/$(#A#D!~P'I  @> S I  I  += %w 'E<!$<!$ Q '+= %w '" #$     ''+" %w dd'Dd`%%!$*($De+0%L@e|$8p!(dx\%@'%*H x*+X `) $XHq!H+E+`HhP!+l%1 $+`)k1k9G`|!x$ R hxaG< |d  "$|bP$L`d|$\Hh $#!$ $ haG< d  "$bP$L`d|$\Hh $L+F<`&`lF h!#x$|!T A t' 'D'!$7W!$B$ahH"$G< l<`!$t' lt''!$7W!$B$aLX`d|$\H $9@h  ph h  < !$$o  d <TB$  %% 1  %1  '+" %w pp'PdX%%!$*($Pe+0%HLLe4$8&p!(\%$1 $+@((08E0P$T! $R \0"PCG<`TC  $#TDLb$HX\4$"0X$\! $$ \0"XCG<`\C  $#\DLb$HX\4$0,F<`&H  F<408&H g G &@`\dTP$OY N d% #+#A \%#0!P$T!P A h' 'D'!$7W!$B$a\0!7("$G< `<`!$h' `h''!$7W!$B$aHTX4$?'@h  dh h  < !$$o  d <TB$  %1  += %w '@\d0%%!$*($\e+0%b$Xe$8p!(4,%@<'(b (%("%$@04$,*H *+X ;` (!0$ p!$8$ ! $$ 8aG<  a  "! b$a(b@ $($ 8$aG<Ꮋ (d  "$%% 1  %1  += %w 'L0d<,e0 E<$ % 4b8e<f@gDhHcX\  $ ( 0L<8e8PT%,`dH'4%0L<8PT*@E&8h+HH^ 44a($Cp!"@  @" &C`! Y   S %I  1  1  I  I  <!$  '+= %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$! <$%)%  $ ' Q (CB04,'+= %X 'Ž ÎĎŎƎ'vD8<04! ,!  K  P1 N@E<(c$dF$88$!8&HH $@ %@DbG<@b  !"a8$"(!dc $ <04 $3 ( H',!  <`K!$ <T!$ S %I  I  I  += %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$! B$"G<@\XxL   \"X#x$L %"F S I  I  += %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$! <`?)%  $ ' Q (CB04,'+= %X 'Ž ÎĎŎƎ'vD8<04! ,!  K  P1 N@E S %I  1  1  I  I  += %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$!  S %I  <T!$<@!$  <T!$ S %I  @> S I  I  += %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$!  S I  I  += %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$! <)%  $ ' Q (CB04,'+= %X 'Ž ÎĎŎƎ'vD8<04! ,!  K  P1 N@E S %I  <T!$<@!$  I  I  > S %I  I  I  += %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$!  S %I  <T!$<@!$  @> S > S %I  <T!$<@!$  I  I  += %X ' Ž(ÎĎŎƎǎȎ '$'!$ !$! 8B 8$4a 40+ bx4x $<@U!$   %% 4x,0B$!A8 ! @8CDE<$nj$4a 40+ bx4x $<@U!$   %% 4x,0B$!A8 ! [@8CDE<$njZ 8 $%A`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ǭ''!$ !$A'$X $Xq-%!Xm&p$ $%''!$ !$A'$@ $@ q$!@H &XC`$@''!$ !$A'$@ $@ q$!@H &XC`$@ 8 $%`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ȭ$''!$ !$A'$@ $@ q$!@H &XC`$@ 8 $%`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ȭ$F''!$ !$A'$@ $@ q$!@H &XC`$@ 8 $%$`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ǭ&c8`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ǭ$$''!$ !$A'$@ $@ q$!@H &XC`$@ 8 $%`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ȭ$$pp%!pύ& % %0ƍ< ,!$48!+ 40+ bx4x $<@U!$   %% 4x,0B$!A8 ! 8 + `b #$E<$njc #$E<$nj ''!$ !$A'$@ $@ q$!@H &XC`$@ $%8`,c$0+(xx $<@U!$   $%(% 8f$0!0$Ǭ$%''!$ !$A'$@ $@ q$!@H &XC`$@ $%8$`,c$0+(xx $<@U!$   $%(% 8f$0!0$Ǭ&c8`,c$0+(xx $<@U!$   $%(% 8f$0!0$Ǭ$$<!!$ 8!8'ɌȬB$c$*0C +0Es0!0+8eh  <''$'!$7W!$B$a|'<'P'!$7W!$B$a<'t'!$ !$AZ  !<@B$|'   ab+ ".c<$ $p!d8#$<'!$7W!$B$a<'t'!$ !$a'<'t'!$7W!$B$a'<'!$7W!$B$a'1  %%1  %%1  ''!$ !$A'$@ $@ q$!@H &XC`$@ 8 $%$`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ǭ&c8`,c$0+(xx $<@U!$   8 $%(% f$0!0$Ǭ$$n+= %w '7`<$= <"#c$$$%+0C. $%%($$ + P' :l$OY - % #+#  $ E<$nj l\ $3 ( 7#$'!$7W!$B$ax'''!$7W!$B$a4'<c$$ pT< Є$v $X t$= deX!8h+H h Ǡ0$,$% %(%%%& ,0H<&@!B( ƣ B$+ " $Ǡ0$% %((%%*0AC0P@<,!D L8H4P@< txƣ FǠ0$,$% %(%%%& ,0H<&@!B( ƣ B$+ " $Ǡ0$% %((%%*0AC0P@<,!D L8H4P@< txƣ FǠ0$,$% %(%%%& ,0H<&@!B( ƣ B$+ " $Ǡ0$(%(% %%*0AT0XD@,!H T<8PXD@ |ƣ F $ %%%   48& b51`$$OY % 0% #+# $ "p+#4%a !p $##!A $Ap@!$ !#<!AD('@h  0h h 04 8< !$$o  d <TB$  += %w 'HLP dhƣ F< T&d \/`&8[W0@,8$OY H X% #+#; @,0 \8ƣ \! C+0$4 $+@ 87787 87%(h+@"p!a"B0P!+`C8`!C8f`!C8`!C8`!C8Q`#"%&+*c,$#%Al`' $+8k $+@8%@8%@%@ 8%@  8%(%@h+0"p!a"B0P!+`C8`!%#C8`!% C8`!% C8`!% C8`"#% C8`!%&h++B,$"%#l`'$$+8> 8 DXt^  DX $h+8"p!a"B0! C8`C8`"! LH!t^  LH b l`'8/h+8"&p!a"C0$c8` @T! C @T Y * l`'1  E<+ E<!""!!$<\>!$< h!$ <B$"#G<  $$< h!$ <8B$"#G<  $$< h!$ <B$"#G<  $$p'l%8%t+H HL$ql! p "p+#l%a !p $#a#b!A!"L'' '!$7W!$B$aHLPT! X\`d  !  $Cp!8 $4! k ! %P''!$ !$alplpA8!,@B$P'% ''!$7W!$B$Hh tx|kG< @!0"8@!8 T!  !8 'E<`!$E@!0"8@!8! 0T!D  !8 'E<!$E<c$!$7W!$B$a'0T!D !8 'E<`!$E@!0"8@!8 T!  !8 'E<@!$E@!0"8@!8 8T!L  !8 'E<!$E<c$!$7W!$B$a'8T!L !8 'E<!$E<c$!$7W!$B$a'!0!8 8T!L !8 'E<!$E<c$!$7W!$B$a'8T!L  !8 'E<!$E<c$!$7W!$B$a'$*b;@!0!8 8T!L !8 'E<!$E<c$!$7W!$B$a'8T!L  !8{ 'E<!$E<c$!$7W!$B$a'!0"8@!8 8T!L !8Y 'E<!$E<c$!$7W!$B$a'8T!L !8 % { 8T!L !8` 8T!L !8 8,!L  T! !8 % , 8T!L !8 8,!L  T! !8 'E<@!$E 'E<@!$E D!0 "8 @"8!@@"!@!t^   ^ t^ F`$OY 3 0% #+#& 4  <"0 !0 B4(dc<$ L  <@D$'@h  0h h 04 8< !$$o  d <TB$  += %w '$(, 0L !f !$[3 xd!D4| !$[3 8@x !  "C0 B0@c4| %%%%%% Z; lp !$$$,"!mK  $Ni  @E!$0P!< @ $vf! 0,!< @ $vf! <8!$LAG< @A  @#!C% I  %1  1  $8f $8p$!8&PI@c$ D %D`a8 0< 4\! LaG< a  "!b B @ !  LaG< a  "!bu0<VN! LxaG< |a  "!|b%(2$8f $8q$!8&PI@c$ H  $%H` B @ LxaG< |a  "!|bI  %1  %1  @ B @ \)@0d`!@+H (<4   $'+= %w 'D7("$B@~! D" !B @ !H (P! ^  D!( 6  d!( $ , l!( 8<$0,4D4B<c$ K "!8< ,0',0'+= %w '!  !( d!   $@ ,0',0''+" %w hh''''!$7W!$B$at!  '''!$7W!$B$aĊ! P'''!$7W!$B$at>$X2B$P"B$T"u<g!$ < {$&(Ž! @( $,B<c$ K !,68B <,CB    8$0 < {$x< {$t< {$p4'4'XVŽ! @<c! 4'+= %w '," W(C$c`~! 04 t!  6,B 8('$ X6,B $ "! 8('+= %w '0" W(C$c`~! 48 t!   60B $ X60B (p!$ (!<Nc$ ,'+= %w '0"$W(C$c`~! $48 t!  60B  <@DH,' ($X60B  ( ! <@DH,'+= %w '0"$W(C$c`~! $48 t!  60B<@ DH  ($X60B  ( <@DHm! ,'+= %w '0"$W(C$c`~! $48 t!  60B  <@DH,' ($X60B  ( p! <@DH,'+= %w '$!7("$B@~! (, t!   6  048< '!  !  048< '+= %w 'H"8W(C$c`~! L !P 80! <$ R !i <"L& C% !P L%< @ aP 4 @<6HB 4!@ TXD'aP @ 0H!" B ! @  T( $XAq!H++X(3`PY!@h <@'1  1  1  1  += %w 'b# D$+ "> d(!( !+("3(4!08! * &#%+"$`<8B$<|$"p0!A@'b+ "b!A"!@ <@'1  1  1  1  += %w ' "'C'" "#Cc$+ b$!dc!+" `!$! '1  %1   += %w ' "$'C'"< !@DH LPTX '+= %w ' "$'C'"$" B!(, @048< '+= %w ' "$'C'"<!@DH LPTX '+= %w ' "$'C'"$"B!(, @048< '+= %w ' "'C'"4!8<@ DH'+= %w ' "'C'""B! $ @(,'+= %w ' <G<G@"#<!(d&+8E$ <+B$!A! $CpC$'<4!CB$C#D!A!$+= %w ' $$ " $ $*A@% $*A $$><+B$!A!  "  % !d!!$!0! $ "  $*0%+0^!0dƐ$0$d$0q+HP !8g$0 $8'q$!0+8?#($8+(4!d!!$!0$ " 8+(!(d$0$ $(p+0!d!!$!0!$ " '%%1  %%1  %%1  %%1  %%1  %%1  += %w ' $,0d <TB$ $<2s!$ $ ' $ 48('+= %w '% 4*"?`0! a$*0!$   <+B$!A! $CpC$!bB$C!A!$+= %w ',$$ " 0 $*A@% $*A $$><+B$!A!,( " ($%-$Cp$!A!<,B$!A!!"!$+= %w ' $$ " $ $*A@% $*A $$><,B$!A!  " %!A! $ " !$*"`'+= %w '$+ "$$+ b+A`<B$!A $$' $   $'I  9  += %w ' " A $( " -  $ "  (" ,04',04',04',04',04'+= %w '$K $*A `  " ;  " "#B0$#bd$'B'!dc$ " %  $$ " "$*A` $$ " "$*C@'<T!$<+c$!bB $ap#$'<4!a!$C#$!"!$' += %w ' "'C'" "!o"  ' += %w ' "'C'" "! " ' += %w ' ",'C'"," "! $d <TB$ $<+c$!bB $ap#$!#!$C!"!$' += %w ' "'C'" "!"  ' += %w ' "'C'" "! =" ' += %w ' ",'C'"," "! $d <TB$ $<2s!$ $ ' $ 04(' += %w ' "'C'"  $*b`% $*b@$$!><,c$!bB!A!$' += %w ' "'C'"  ' += %w ' "'C'" "! " ' += %w ' ",'C'"," "! $d <TB$ $!$ ''!$ !$A"#$ !  PT%'% 'L'!$7W!$B$`'''!$7W!$B$G< X<>!$`' X`''!$7W!$B$EG<\\  '&8%%(%8`"#! < \"WG<8F  $&8D` ' ' ' '%%1  '+" %w pp';WC$XcTx''!$ !$ad't'!$ !$a&" 40'% x''!$7W!$B$d'','!$7W!$B$@'x''!$7W!$B$x'd't'!$7W!$B$d'@'P'!$7W!$B$@'x''!$7W!$B$`T !''TM #$$$x'%!$7W!$B$'x''!$7W!$B$a%d't'!$7W!$B$aɮ ,`T&Ta$(c$x'!$7W!$B$a'x''!$7W!$B$a'@'P'!$7W!$B$aɮ ,`T% Cd0%D$e4%0w%0$% `!'C$% $%0w%0fA$GM TtDuEvFwGyC>`F< G<Dd  $<8$DdF<$$+"(`F< G<Hd  $<8$HdF<$$+"`F< G<@L"  "<8B$L" '5  5  5  += %w ' $ y0" < OB$$( '+= %w '0$ y0" < OB$$( '+= %w '@$ y0" < OB$$( '+= %w '\"\d&DJ@`b`$&d$de& %A@(b($&<@,b,$&7@0b0$&DB81@\$ Y ( h!$h!$@$ Y  !$!$@$ Y  !$!$@$ Y % '+= %w '<@V!$ <8!$$"  $HLP(''B"" """">"+= %w '`"8@\Cac8 `Clc8`Clc8 `\#8`C*c8`<`l!$ $"d$hlX'< !$ $$r/  %% %(T$D$%(%@DL04T"P!8D%!#C#0#(e/$e!# <!$ 3@"B(@l@6&Wx@<B$&"s "!a# #(+0#(% %(%b@%% $'$'*`'u F<, <u F<, 8<d <TB$8d <TB$<!$$' $ 'F6&W@<B$&" <1 !$$$ ' '+= %w 'TX" *   G<!$  0''/'!$7W!$B$aF<0' $ , \`dhP'\`dhP'+= %w ''@'!$ !$A`\T<@ACB jb <!$@+(TXT $<~!$   X&$1!0$Ǭ ìG<`ÌȌ  #"(&'H'!$ !$AL'h'!$ !$A'H'!$ !$Atx| '''!$7W!$B$aL''H'!$7W!$B$aL'`" L`DX LqB$ ''!$ !$Atx| lhl X\'% 'T'!$7W!$B$'''!$7W!$B$G<@h<>!$' h''!$7W!$B$DHL'DHL'4DHL'DHL'DHL'DHL'$DHL'+= %w 'F<+"3`F<!! d +H"%  !a"# )* G<@  *"&' (G<@"  %"% '1  1  += %w '"d&@b%&E@ b %&E @!b Y % '+= %w ' "h'C'" 'h''!$7W!$B$aX`(,(,%8G!%E1!@+P"3@!PH>0!8+@"'!@& g'8(? ! # $  ' '!(& g$(!+("1  % 1  1  %%1  % 1  % 1  %% 1  % 1  %% 1  % 1  % 1  %% 1  % 1  % 1  % 1  % 1  % 1  % 1  % 1  % 1  %% 1  %% 1  %% 1  %% 1  %%1  += %w 'L E'(T<48!88@ $8'q#88$7 H!8$8#0!0 T$<5@!@%@?#80 $+88G-$8$'@'!$ !$ $+8*$' <@B$>' n $"G<`#  #<B$"$<<@!$<' n $"G<`#  #<B$"$:<@!$:' n $"G<`#  #<B$"$8<@!$8' n $"G<`#  #<B$"$6<@!$6' n $"G<`#  #<B$"$4<@!$4' n $"G<@ F<#  ##"<@!$H>' n $"G<@"  "?0<%!8+H !H$'$0!0+@ Mx tx|h'%%1  %%1  Q  !8'Ɛ$B$$@>?0<%!8+H !H$'$0!0+@ Mx tx|h'%%1  %%1  Q  !8'Ɛ$B$$@>?0<%!8+H !H$'$0!0+@ Mx tx|h'%%1  %%1  Q  !8'Ɛ$B$$@>?0<%!8+H !H$'$0!0+@ Mx tx|h'%%1  %%1  Q  !8'$$B$>?0<%!8+HC !H"'G$0! +@ Mx tx|h'%%1  %%1  Q  !8'$$B$>?0<%!8+HC !H"'G$0! +@ Mx tx|h'%%1  %%1  Q  += %w '"b$b"b@ " b"b`"&@<`!$ ""@!#$ %!CD EG<`d  !"$A$a ab'%%1  += %w 'E< A$ A< L!$$  $b bG<@b  !"a "$"$ "G<@"  $"$('+= %w '$A$AE< A< L!$$  $b bG<@b  !"a "$"$ "G<@"  $"$$'+= %w '"b$b"b@ " b"b`"&@<`!$ "$@!#$ %!CD EG<`d  !"$A$a aba '%%1  $A@$A@!A += %w 'E< A@$A@< L!$$  $b bG<@b  !"a "$"$ "G<@"  $"$$'+= %w 'E< 0A< L!$$  $0b bG<d  !$a<@!$  $04b8bG<@0b  !"0a<_!$ '%''!$ !$D$I$%(>'%8 ''!$ !$e$$%'%8 h$!@. $ %%(%0%8 %B+@m=!c  $ $ C$+(# $= $*0= @''!$ !$' $$ $?0<%!8+H( !H$'$0!0+@ Mx paG< a  "!b'%%1  %%1  Q  A  A  += %w 'B$" ,P P !8  $0$H\BD# @8\! THD# 8!A @+0TL`T %% H$ $+(:E< E<$LPTX@' d8H8'E< E<$LPTX@'d8H8E< E<$LPTX@'d8H8$+( b8 @b,@ e8+F!!.!8 $<@!$4`4E#  -@0@ #  "!0bG<@b  !"a S <T!$ S > S \'+" %w '("!$  $  F<l   ?0<%!8+HC) !H"'G$0!0+@ Mx @aG< a  "!bPT<'%%1  %%1  Q  "! += %w '?0<%!8+HC) !H"'G$0!0+@ Mx @aG< a  "!bPT<'%%1  %%1  Q  "! += %w '<`!$ C#CB#G<`  "" P<# @(,PT"  Td$T% ( %80,$#(/0@!(&$P%%%@%HV%%%(%0X\`L'X\`L'+8d8+1`$#(/$(P!(# +0#<H $<T!$   <Hf$0!0FĬG<Č  %$ŬX\`L'%%I  %9  $$% <K%+`k@+`a:)%#XAk%#` g $`,!`+hI<D48H $<T!$   T0D<P48H-%h !h G<`  ,+%( %0%%}% I  % 9  += %w ',"8@(C.c8` (4d8 0.88$'<# !$ 04<# +"`  ! ,+0d$#@G$@# d(!@(+P@ X!XKk4+h#h#plw$X0!X&h$8$'%+x!x%2!$+P 50&12+Q  621&xD$$ $k%!$$$%75+hrh!h+x"kx!x+ob+Z#Ç$#h!x0+N!P+E !Q1+;@+03@#0#Ï$!& %8$'1& +-@!/RS&s2!0$+` R6t&2+ s6R2s2&r@%% 1  %%I  %% 9  %%1  %%1  % %I  %9  1  %1  % %1  % % I  %%1  %%I  1  += %w 'C8 `d.8 '%% % @%($%$$$ !$E$*(%+("(!(#.8%$ #(0 '$+0 !0Ɛ\8%$%%1  1  += %w '4"8 @0C.c8`8<@,'<@V!$$$  04% $$$8!8'!`% $$$.$+8( $<@V!$   04($g$*8+8+!8D.8$#808<@,'$+@ !@\9$%8%%1  %%1  += %w '&F@: \:8 %+P-  $*0@@ 8'T'!$ !$8' $$ $% I  % %9  %I  %%9  % %I  %%A  %%1  += %w '8 DL*"`+"D`@!A@PTX0'EF# (04,8hlptxT'+= %w '<!$ LG< <!$T' LT'd'!$7W!$B$aF4A@@ABuO# !$t*A`xpt D S <T!$B+00#@+hlm0m0!h%%+X5`DD%c0 1+c-`1!k$*XK`+XG`!Xg$+X"?`!Xha$+"`5 $*PI@%H%<$+P@!!%808-8 <:`b %X8%` $!'E<E<'%B%`d>< $:810+p*pB {@# $'$@%`d%0< $:8%( %h0!p!p1+`<*`<@ {@# (  d$a$* %$+ Ak# C#0$$#07$0&!0$+@$ZĐƐ2% 0! c$$'*(B$<' ^  S B$*@D0!@ %)1%P^ $+Hi +" $+H*  I9 "I9 e,I9 ;I9\ L &H LXTJ%P+`* $ S <T!$?0 <)%!8'+P'@!P$G$0!0+H  Mx |,aG<(d  "$(bB&aI%%1  %%1  Q  <`+!$<@!$ 1  <T!$<@!$  += %w 'I H'''!$7W!$B$a4'H'X'!$7W!$B$a8<$7@4@@%A@ !$%C<6!W+b!"<@`dh lptx| n< 6!w$n< 6+W!$!"(# ,0\'+= %w '<@D # a 4 PTX# ,F  $(HL 4 . 4"\# b+(d &`#@&H+Pb+X)-$H*#(%@i# C#+D#(b$!+$+,$#%A E`H$tx|d'ph +0dtx|d'E<0E<4tx|d'%A  1  $I  <`+!$<@!$ += %w 'Tw<6!wX$w<6+(w! ('8'!$ !$04E<8<'('!$7W!$B$@<$ w<@@('%@  c$/% <6!(+ !dDH<?<6$w<@L'<'L'!$7W!$B$a<>c$$ $\`P'+= %w '8"!< @D $m=# (,@#$@* C+ A# AD#0%7$0<!0$+@$8LN ɠȠ%0%@ S <T!$ S <T!$ S ,@'# ,0!"4@'(*(D0< #  <T!$ 4 B!d$ p&d'`HL. Bi00#H+@*00!@%%(+@IB$H00+@ %%(0!!"!$,'+= %w 'x7" 0 $x! $  x!,  $  x!( $  %4'p'!$ !$$804 @,<$H S <T!$ S <T!$c$$ $lpd''+" %w '0"8w@@!8 %% $. <VB$ $<\3!$$ ' $ a, d,d,d, d, d,d,d,C$D$E$F$ G$ H$''!$ !$! $ $  d,8C$D$E$F$('|'!$ !$$,($4 <)%0<8D@LHTP\Xd`lhtp| B$x(' $ u  ' $9  $9  $9  $9  $9  $9  $9  $9  $9  $9  $9  $9  $9  $9  += %w '<$"@%D<@!$D  <(@D,CG<$D  !$$A@4$($%%Z`(4"! B @0%% %%(%% %%(%%(%%(%% !$%0% +8",!%!%%%(#A # $'$ $! $+("1%A%A%A%% #A # $'$ $! $+("1%A%A%A%% S$  <`!$ W$  "d&D@"d& D c! Y % '+= %w '>W$ '+= %w '>W$ ) "d&D"@"d& D$d$%& c! Y   ! C$B Y % '+= %w 'HY$ '+= %w '>W$ ! "d&D@"d&D@"d&D@"d& D c! Y % '+= %w '>W$ ! "d&D@"d&D@"d&D@"d& D c! Y % '+= %w 'Y$ '+= %w '>W$ ! "d&D@"d&D@"d&D@ " d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w 'Y$ '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d&D!c&#%"!,''+= %w '>W$  "d&D!c&#%"!,''+= %w '>W$ !B&"!,''+= %w '>W$ 6 "d& / d %& *(d(%& %c! Y  !C B Y  $"$c(! Y % '+= %w '>W$ $ "d&  d %& c! Y  "c ! Y % '+= %w '>W$ $ "d&  d %& c! Y  "c ! Y % '+= %w 'HY$ '+= %w '>W$  "d&D@"d& D c! Y % '+= %w '>W$  "d&D@"d&D!c&#%"!,''+= %w '>W$ * "d&#@"d&@"d&D@"d&D@"d&@"d& @ ! b&A!,''+= %w '>W$  "d&D@"d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$ $ "d&  d %& c! Y  "c ! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d&D@"d& D c! Y % '+= %w '>W$ R "d&DK@"d&DF@"d& A$d$%& <,d,%& 74d4%& 2c! Y (  ! C$B Y  (!(C,B Y  0"0c4! Y % '+= %w '>W$  "d&D@"d&D!c&#%"!,''+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$ & "d&@"d&D@"d&D@"d&D@ " d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$ ) "d&D"@"d& D$d$%& c! Y   ! C$B Y % '+= %w '>W$ ! "d&D@"d&D@"d&D@"d& D c! Y % '+= %w '>W$ $ "d&  d %& c! Y  "c ! Y % '+= %w '>W$ G "d&@@"d&;@"d&D6@"d&1@"d&D,@ " d&D'@$"$d&D"@,",d& D4d4%& (c(! Y  0!0C4B Y % '+= %w '>W$  "d&D@"d& D c! Y % '+= %w '`$ '"d&=@b$&B87@b$&D2@b$&B8,@ b $&B8&@ b $&B8 @ b $&B8@ b $&B8@ b $&B8@b$&B8@b!&"!,  += %w '"d&@b%&@ b %&E @!b Y % '+= %w '>W$ X "d& Qd%& e &&(% H$$$e& C&$&e& >,d,%& 90$0e& 42$2e& /4$4e& *<d<%& %c! Y  (!(C,B Y  8!8C<B Y % '+= %w '>W$ ! "d&@"d&D@"d&D@"d& D c! Y % '+= %w '>W$ = "d& 6 d %& 1$$$e& ,($(e& ',$,e& "0$0e& 4$4e& c! Y  !C B Y % '+= %w '>W$ ! "d&@"d&D@"d&D@ " d& D c! Y % '+= %w '>W$  "d&D@"d&D@"d& D c! Y % '+= %w '>W$ ! "d&D@"d&D@"d&D@"d& D c! Y % '+= %w '>W$ $ "d&  d %& c! Y  "c ! Y % '+= %w '>W$ T "d& M$e& H $ e& C$$$e& >&$&e& 9($(e& 40d0%& /4$4e& *<d<%& %c! Y  ,!,C0B Y  8!8C<B Y % '+= %w '>W$ ! "d&@"d&D@"d&D@"d& D c! Y % '+= %w '>W$ !B&"!,''+= %w '>W$  "d& D c! Y % '+= %w '>W$  "d&D@"d&D@"d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '>W$ ! "d&D@"d&D@"d&D@ " d& D c! Y % '+= %w '>W$  "d& D c! Y % '+= %w '"d&@b$& D !c Y % '+= %w '"d&@b$& D !c Y % '"d& @b$&D@b!&A!8  "d& @b$&D@b!&"!,  += %w '"d&@b$& D !c Y % '+= %w '"d&@b$& D !c Y % '+= %w ' "'C'" ! #  ' 7'A#+= %w ' "'C'"7<@!$ G< <@!$ <!$ #$!$7W!$B$a#$!$7W!$B$a;$'7'A2$7'Ao#7'AG#7'AA As#7'AA A #7'AA AAA#7'A#+= %w ' "'C'"7<`Pd8P$4D% L!#! ]|$ Lh $  (,"0!Tx<:$ Y  <!$$ T<`d8$8D% @!#! ]|$ @h $  (,"0!Pp4:$ Y  <!$$ P<><>< f=% F<<B$ 0 7G<@"  #"#%G<><"#G<@  C  !#A$'<T!$`cd@$$h'!$7W!$B$<@ 'h''!$7W!$B$LPTX1{" \`' ''%%1  += %w '4+%$<% w7% dGM <<N!$,0,'4$+a  G<@<<C  !#A%H b!$`' \`''!$7W!$B$a\8d!d*`"#! < B G<@\\8C  !#8A%% D<) 8&8 8 T<!$ 8"G<@\T \<C  T$!#$$@CDC<A%D!X'< !$$  X'P$8$%D%W@8P%<'&0(@8 Y  \(@&8 \D"@#c$<$ +8C 4T $<T!$  \DG< <  "!<%T4% @#b$!FG<`C  %#EP $8$%D%`@8P"#! jb D<C&a`,H8B Y  \,H&8 \D"@#c$<$ +8C T4 $<T!$  \DG< <  "!<%T4% @#b$!FG<`C  %#E P$8$%D%W@8P%<'&0L08 Y  \0L&8 \D"@#c$<$ +8C T4 $<T!$  \DG< <  "!<%T4% @#b$!FG<`C  %#E $P$8$%D%X@8P!<7 D<C&a 8BY  \<7 \D"@#c$<$ +8C 4T $<T!$  \DG< <  "!<%T4% @#b$!FG<`C  %#E@a abc $ \\aG< Xa  "!XbX'$ $DH('+= %w ',04 8<@$>$ $DH(''+" %w ' >$   %% %($ $('%0x''!$7W!$B$$p$%(% pt`dCB''!$ !$ $ PL'% 'H'!$7W!$B$x'''!$7W!$B$n`''!$ !$A  \X'% 'T'!$7W!$B$x'''!$7W!$B$4``c$d+(tdt $<>!$   <$0p$!G!$x' hl<$]t`d $('t`d $(' $('+= %w 'T X<D!$G<B$H4\P`D$0$4HP!0Dfg(8 % h$   lpL'lpL'@I%,H%4HDP08(,@!" ?  4HDP0  J% +`*%< $<T!$  < G<   "!408(%@%P%XHDP H%@!@hG<  &'tx'+" %w ' ` $ ,  `X\d|4 |'$$ $ @0 %(%0%8%@%H''''<'D%p%H0%P%% h*X`xtl%!  t+( $<T!$   % pe$(!(G<@  !"x!$4 Blptx <@VB$lp <@VB$tx<\!$$l' $ l!  %''!$ !$<!$$$  `@0''+" %w @@'|''!$ !$A$<><㎐|' " @ C%$ %0+4,   <><LP8' "  $'+= %w '\ %%%F<!!$$' $ '@ !T<,!$$' $ ''+= %X 'Ž ÎĎŎ48<  & $(,@DH0'+= %X 'Ž ÎĎŎ48<  & $(,@DH0'+= %w '(, $ n 04'+= %w '$"!<c$ $ av (, '+= %w '8<@DL"!<8$D< !$@8'$ ^ $ PTV% (,04 ,$( < !$$av 40('$ ^ X\H'+= %w '4'`'p'!$7W!$B$a '`'!$7W!$B$a$ <$(w@@(7%@0 c$/%(<6!(<6+0!(,%e`?<6$ `4'L'\'!$7W!$B$a'4'D'!$7W!$B$a $*( T<4+8,$%tH'+= %w ' $ $ ! < d!$ <`B$" "G<@  ""  $('$('+= %X ' "'C'"Ž$ '+= %w 'H<5!$H$*<!4$~ PTK$  @ ,Z% L'8<@D@B8<PTd <TB$@D '4'!$ !$A$ <$ @($ $  %''!$ !$a''!$ !$%L$<$'!$7W!$B$ nj8% <% '' XtL''!$ !$$L'0'!$7W!$B$''!$7W!$B$+ gX%X $<`!$   $ gpt$! DG<($<`!$L' $$(%(%%0L''!$7W!$B$%`%%Xt lpt  %''!$ !$a  !  \8 &@@B''!$ !$A% '+= %w 'p7% d$He$D%0$%@%@ GM xHD%0$ ba+@"d$(%p!$$\'!$7W!$B$dc'\'l'!$7W!$B$ \' '0'!$7W!$B$aHd$w$DWN '\'l'!$7W!$B$a-  @cx$LPTXTLL'8' $$L< `x>% _@"@^ 7D[% t'7D[% t'<T!$ C8BL"`!@<!$ 8"G<@L  L""<`!$X` @ $""G<`#  $#X= P4aG< 0a  "!0b7  H!%<!$$ Y  X\HX\%(H*@%#@+H #H#PW $PH!P&X`%HDT Y X\HTD%H %0$+H @x!<!$$ Y  @X\Hx@< !$ X"\#G<  $$<'p'!$ !$A$@<2?B$< $H<^B$DHPL $X `aE@b$&D9@b$&D4@b$& D/d%& * $ e& % ! c Y  !CB Y  !C B Y % '"d&@b$&D@b!&A!,%  += %w '"d&D4@ " e&E/@"e&*@b%&E%@!b Y  !C B Y  !CB Y % '+= %w 'X'h'!$ !$ATBH@4I <'''!$7W!$B$a'<'L'!$7W!$B$a4;<c4#8Cp8!" <' '0'!$7W!$B$aX'<'L'!$7W!$B$aX'<'!$7W!$B$aP'P'+= %w '4 "8@0Cnc8`Cuc8`Clc8 `Clc8`<@('<]!$ $048 !$ `G< <>!$h' `h''!$7W!$B$a` a$\0d$H'!$7W!$B$LH<$8@(@8G%(@@/ $?%8<6!8<6+@!(PT%( ?<6$(% %W'\!$7W!$B$- 8<;<c4   $8<;<c4  (, $c D@(,c  A!$ G<@C  !#Ap8< < C!$ @@B!$ $?   "@! $'<`>B$$$ $ t@<@.!$ <TB$"@b%&9@ b %&E4@b%&E/@"e&E*@ " e&%@!b Y  !CB Y  !C B Y % '+= %w '"d&D"@ " e&@b%&E@!b Y  !C B Y % '+= %w '"d&D4@ " e&E/@"e&*@b%&E%@!b Y  !C B Y  !CB Y % '+= %w '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@!b Y 5 !C B Y ( !CB Y  "c! Y  $"$c(! Y % '+= %w '"d&v@ " d&q@b$&l@"d&g@ " d&b@("(d&]@0"0d&X@4b$4!$& O !CB Y B !C B Y 5 "c! Y ( "c ! Y  $"$c(! Y  ,",c0! Y % '+= %w '"d&D/@ " e&E*@"e&%@!b Y  !C B Y  "c! Y % '+= %w '"d&4@b$& /$e& *$e& %!c Y   ! CB Y  !CB Y % '+= %w '"d&D@ " e&@!b Y  "c ! Y % '+= %w '"d&Dj@ " e&Ee@"e&E`@"e&E[@ b %&EV@("(e&EQ@0"0e&L@!b Y B !C B Y 5 !CB Y ( !CB Y  $"$c(! Y  ,",c0! Y % '+= %w '"d&DS@ " e&EN@"e&EI@"e&D@$"$e&?@!b Y 5 !C B Y ( !CB Y  "c! Y   " c$! Y % '+= %w '"d&D@ " e&@!b Y  "c ! Y % '+= %w '"d&DU@ " e&P@"e&K@b%&EF@b%&EA@$"$e&<@(b(%&E7@,b,%&E2@!b Y ( !C B Y  !CB Y   ! C$B Y % '+= %w '"d&D@ " e&@!b Y  "c ! Y % '+= %w '"d&D@ " e&@!b Y  "c ! Y % '+= %w '"d&DA@ " e&E<@"e&E7@"e&2@!b Y ( !C B Y  "c! Y  "c! Y % '+= %w '"d&D/@ " e&E*@"e&%@!b Y  !C B Y  "c! Y % '+= %w '"d&De@ " e&E`@"e&E[@"e&EV@$"$e&Q@,",e&L@!b Y B !C B Y 5 !CB Y ( !CB Y   " c$! Y  ("(c,! Y % '+= %w '"d&D4@ " e&E/@"e&*@b%&E%@!b Y  !C B Y  !CB Y % '+= %w '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@!b Y 5 !C B Y ( !CB Y  "c! Y  $"$c(! Y % '+= %w '"d&DF@ " e&EA@"e&E<@"e&7@ b %&E2@!b Y ( !C B Y  !CB Y  "c! Y % '+= %w '"d&DX@ " e&ES@"e&EN@"e&EI@ b %&ED@("(e&?@!b Y 5 !C B Y ( !CB Y  "c! Y  $"$c(! Y % '+= %w '"d&DX@ " e&ES@b%&EN@"e&EI@ " e&ED@("(e&?@!b Y 5 !C B Y ( !CB Y  "c ! Y  $"$c(! Y % '+= %X ' "('C'"(, 04:&  8<@$'+= %w '("z@<`n!$  & ''+" %w LL'2!"4!\I '''!$7W!$B$a0!$$Ӛ <$<!$  "G<@(  ("8"<]!$,< $ $""G<@8"  8#"#D"!BH @@'+= %w '$"!0 #E<(΄$!$8&8$!8&Hh !$  !  (,048 '<.!$ += %w ' "E<8c$d&@% < !$  ""G<@  ""<9B$$('<lB$"F<(<'+= %w '<@!$$  4$<@B$' n $"G<@"  "< B$"$<@!$4' n $"G<`#  #<B$"$<@!$4' n  $"G<`#  #Ǡà!$C+00 $Ǡà!$C+0. $Ǡà!$C+0, $Ǡà!$C+0* $Ǡà!$ B+`( $& $ (Bc$L+0C2 $ǠŠc$+(C0 $<!$  & (,l'%'$'!$7W!$B$'l'|'!$7W!$B$''!$7W!$B$%$<6$<@$<@!$  & l'%''!$7W!$B$'l'k'!$7W!$B$''!$7W!$B$%$!@Da$%8+@"!@Ba$%+8"!@%@%%80 $*8C E<ЪE<Ԫ%%H% +8$!8+H" >!H)L $%8'+H" !H)J $% +8"!H)%H$%%8 d$*8D E<ЪE<Ԫ%%P%  +8ba$!8+P"|@>!PJT a$%8G+P"p@!PJR a$%+8"f!PJ%PC%%8~ $*C`E<ЪE<Ԫ%( +N`$!+8"Gc!8<$%+8";!8:$%g+ "1!(%(%% ,`($<!$ $"<B$"$"G<@(  (" "%@'P'!$ !$a<0c$TX,'@'P'!$ !$a@'$'#'!$7W!$B$a@'$'#'!$7W!$B$a@DHLPTX,'$(<!$ $"<B$"$"G<@(  (" "%@'P'!$ !$a<0c$TX,'$(<!$ $"< B$"$"G<@(  (" "%@'P'!$ !$a<0c$TX,'$(<!$ $"<1B$"$"G<@(  (" "%@'P'!$ !$a<0c$TX,'$(<!$ $"<B$"$"G<@(  (" "%@'P'!$ !$a<0c$TX,'$ (<!$ $"<B$"$"G<@(  (" "%@'P'!$ !$a<0c$TX,'1  1  1  %1  1  1  1  %1  1  1  1  %1  1  1  1  %1  1  %1  %1  1  += %w '<".@"C`G<c$A s& 'G'!$ !$;<!4 $>' $>' P B$#PW J1!(% % <̄4@HPP $PKq#@ ^@0%109&@F $*P@$$$$' Mx "# !LH & %P'|'!$ !$$T 48:$ Y  <!$$ 48DV t>@DV <!$dDhd'l$?t4!@  t"@E<E<⎄?l p't"@"#$ %!<DB$G<B$ x |$( ' 8,04zH@t8 $$%(P'!$7W!$B$'P'`'!$7W!$B$a @Ht< $$%(P'!$7W!$B$ 'P'`'!$7W!$B$a @Ht@ $$%(P'!$7W!$B$$'P'`'!$7W!$B$a @HtG<   #!4Y |?l p't4!Y ?l p'!(Bx|  @?l p'E<E<⎈p'(ax|  p' p'+= %X ' " 'C'"fW '+= %w '(,$7,"$Cw$Wc$a(!$ R $c$:B8@!$vc$ $ < !$ C`C`$$$$  S %%1  += %w 'L%8D%0J%8'F%0$0%8B%8D%8F%8$8 R %@HN \ %HiT %@H Z %HiV %@H$@ %H* R %H*T %H*V %HI$H$b %PL^ l %PMd %Xlj %Xf %P$PC%Xb %Xld %Xlf %X$Xdr %`n |%`t%hz%hv%`$%`j %`l %`n %`$ ,z%hv%h|%p%p~%h$h%0%hr%ht%hv%h$h%8 z%hv %h|%p %p~%h$h%@  %h r%ht%hv%h$hM%Hz%hv%p|%h%p~%h$h%P%hr%ht%hv%h$h%Xz%hv%p|%h%p~%h$%#%j %l %f %$C%&%d$d% bn%`jt~ % %2 %r    % %  %ș   ^%X\%X^%X|    $''+" %w \\'!0#+#de2% .f<%(4% f:%(6% f%(f2%(f4%(f6%(f gB%0> hL%0&D%8 hJ%8'F%0 h%8 hB%8hD%8hF%8hiR %@ N j\ %@hT %H*jZ %HiV %@Hj%HIjR %HIjT %H*jV %HIjkb %PL^ ll %PMd %Xlj %Xf %Pl%Xllb %Xlld %Xlf %Xz%hv%h|%p%p~%h&x$x& &h%pz%p|%p~%p&x$x&(&p  %x %P%x/ %P%x/&$!&0&x %0 %0%%0&$"&8&%3%4%S%%q&($a&@&3%r%r%r%r&2$b&H3&S%u%v%%%&S$&PA&a%t%t%t%&s$&Xb&b%%%f%`d%`f%`> %8< %8 >%8   | N %H<x L %H<t N %H p l h ^%X|d \%X|`^ %X\XTv%pPt%pLv%pHD@%<%8%40,%\(%\$% dstuevxyf d d l d dddhddgddd|djxdtdidpdldhdmdd`dk d\dXdTdoP dL d n dH dDd@dq<d8dpd4d0d,da(a$arb aa|'+= %w ',"#"%D$,%E$%$*%&%$%d$"%$$%$&%$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@ N *\ %@ T %H**Z %HiV %@H*%HI*R %H**T %HI!%)0*+b %PL^ ,l %Xd %P,j %Xf %P,%X,b %X,d %X,f %X, -r %`n .|%ht%` .z%hv%` .%h .r%h.t%h.v%h./%p~0%x/%p0%x/%p0%x0%x0%x0%x01%2%q%P2%q%P2%22%Q2%Q)N %H1!J!c+PJ!P*$c%c'X@$c%q! !X+`!Xl! d+!c$X%('``$(%(e/!0!X+`!Xl!0+(!(e$X%8'`$8%8g?!@!X!+`!Xl!8+@!@ $X!%!'H$!%+#&!0!"+"!J'H@$H*O ! $+H!H#'P $C!0f+!e'P`$(E/!(+8!8'P$@ G#@&1!@+!"V%JT\%PKZf%Xblvz %x %0 %2   %%% %<%<%ș (   $'+= %w ',"#"%D$,%e$%$*%&%$%$"%$$%$&%d$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0D%8(J%8F%0(%8(B%8(D%8(F%8()R %@ N *\ %@ T %H**Z %H+V %@ *%HI*R %HI*T %HI!%)0*+b %P^ ,l %Xd %P,j %Xf %P,%X,b %X,d %X,f %X, -r %`n .|%ht%` .z%hv%` .%h .r%h.t%h.v%h./%p~0%x/%p0%x/%p0%x0%x0%x0%x01%P2%q%P2%q%P2%Q2%Q2%Q)N %H1#PJ#k+J#"'`$q&k'`$b%q#X#`+ # #c+Xc# 'X$X&('($(%(e/#X#`+0#0#(e+Xe#0'X$X&8'8$8%8g?#X#`)+@ #@#8g+Xg#@ 'X $X+&)' $%a#&!0#A+HA#HI'@$I#b+b#' $ d'# +(#('0$07#0+8#8'@$@G#@&1#@(+(#!JV%H*T\%PKZf%Xblvz%x%%Q%%%8 %ș%ș%< (   $'+= %w ''3'!$ !$A'8< ' <8 4' 8W' $  4''+" %w '"#"%$,%$%$*%&%$%$"%$$%$&%$ %2% . &<%(4% &:%(6% $% %*% %,% %.% $%2% .&<%(4% &:%(6% $% %*% %,% %.% $%2% .&<%(4% &:%(6% $% %*% %,% !%$$%2% .&<%(4% &:%(6% &%(&2%(&4%(&6%(& 'B%0> (L%8'D%0 (J%8'F%0 &%0 ':%0'<%0'>%0&'B%0>(L%8'D%0(J%8'F%0&%0':%0'<%0'>%0&'B%0>(L%8'D%0(J%8'F%0&%0':%0'<%0!%& } t\x ` } Tlp X } Ldh P }  tT!(xX!H+(!(%$0%8'($(%(/lL!0pP!P +8!8G!(+(!($0 %8 '($(%(/d!0h!@+!!(H+(!%$(%' $a%!"+A! } tx  } Tlp X } Ldh P }  !0!H+(!(%$0%8'($(%(/tT!0xX!P +8!8G!(+0!0$8 %@ 'H$@ %8?lL!@ pP!`K+H !H!8+@!@($HK%PK'X$Pj%HIO d!PAh!`c+A!!H*+P*!*$Pc%c'X $c%j!b+C!! !XF+ ! $(F%0F' $ % 'H!(!P+8!8! + ! $(%0' $ % '!(!8&+@!8! + ! $(&%&' $$%!"|+A!# } tx  } Tlp X } Ldh P }  !0!H+(!(%$0%8'($(%(/tT!0xX!P +8!8G!(+0!0$8 %@ 'H$@(%8?lL!@ pP!`K+H !H!8+@!@($HK%PK'X$Pj%HIO d!P*h!`k+A!!H*+P*!*$Pk%k'X $c%j!b+C!! !XF+ ! d$(%0' $ % '!(!P+8!8G! + ! $(%0' $ % '|!(!8+@!8! + ! $(&%&' $%!"|+A!# } tx  } Tlp X } Ldh P }  !0!H+(!(%$H%8'@$8%8?Tt!H Xx!`K+@(!@!8+H!@ $HK%PK'X$Pj%HIO Ll!XKPp!p+Pj!P!H++X+!PK$X%`'h@$`%X_ d!`,h!pm+!!Xl+`l!,$`m%m'h $%l!b+C!! !h +8!8$h %@ '`$@ %@G!`!p+H!H!@ +` !H,$`M%PM'h $PM%PW |!`!p-+X!X!PL+`L!Xl$`-%-'h`$%!"+A!#\`  $(,048<@D' '`'+" %w '("#"%D$,%$%$*%&%$%$"%$$%$&%$ %2% . &<%(4% &:%(6%  &%( &2%(&4%(&6%(&'B%0>(L%8'D%0(J%8'F%0 &%0':%0'<%0'>%0&'B%0>(L%8'D%0(J%8'F%0&%0':%0'<%0!%& }    } ` d } Xx| \ } Ppt T  } Hh Ll  }  `!(d!H+0!0&$H%8'@$8%8'?X!@ \!`K+H !H!8+@!@($HK%PK'X$PK%H*O xP!PK|T!p+XK!X!H*+P*!Pj$X%`'h@$`%Xl_ Hp!hLt!+`!` !Xm+hm!`$h%p'x$p%ho h!p+hl!h!8'!x+!$x% '@ $ % '!I!@j+HI!@ ! +!H$@j%j'H@$#%!@k+!l'H`$H,O !H.+P.!PM'X@$X_ !h!x+`!`'`$`%`g !h!p+(!(!`+`!('($(%(/!0!`!+8!8!(+(!('($(%!(!0B+ ! !%+%!$' $"%"!! c+(H! !"+"!$' $a%#!)!J+ I!d!"+"!#' $A%*!k+K!"+"!# }   }   }   }  !(!H+0!0$H%8'@$8%8'?!H !`K+@(!@!8+H!@($HK%PK'X$PK%H*O !XK!p+Pj!P!H++X+!PK$X%`'h@$`%Xl_ !h!+`!` !Xm+hm!`$h%p'x$p%ho !x!+p!p!h+x!p$x%'$0%x!0!q+!2!x+!$q%q' $q%!P! $+P! !b+b!D$  $(,048<@D' '+= %w '("#"%D$,%E$%d$*%&%$%$"%d$$%d$&%d$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@ N *\ %@ T %H**Z %HiV %@ *%HI*R %H**T %HI*V %HIW $#Xj $hLJ%pL o- J- p Pl P%P<6$H7!XM!`j+b!$`j%j'P@$j%! d+!'``$(/!0+(!('h$8?!8+@!@(O#H 'H )1<6$@#Hi+Xi#K$PJW #P+ #d$ l'# +0#( $07#0+8#8B ^%@h\ d%Xbn %`jt~ %0 %Q %S%%8%<.%(,%( .%()(+,"-./* 0 1 2 # 345$689 """"&" "%'""<$'+= %w '&$ } L4P 8&$ } ,DH 0&$ } $<@ (&$ }  L,!(0P!H+0!0&$H%8'@$8%8'?D$!@ (H!`K+H !H!8+@!@($HK%PK'X$Pj%H*O <!P*@!`k+A!!H*+P*!*$Pc%c'X $k%C!b+C!d4! |8!hl+ ! x$P%X' $ d% D'!(E!`f+P!P! ,+ ! Dt$(%0' $ % '!0!P+(!(E! $+ ! p$(%0' $ % '!0!@+(!(! l+ ! h$(%' $$%!"+"!b&$ }  |!#x!(+#!$(%' `$D%,!D+ Dt! '0$(/$!(+0p!0'@$8?l!8+@h!@('P$H*O #H &)1!H!+!!a V%CT \%PjZf %Xlblvz%x%0%2%%%|l%d%`%\XT |ld`\XT'<3B$&" CB%% &A@% %(%%"8A,!0Ɛ!8d&0%($*00B$+= %w '<@$!@&0><@$ &,!%B!0Ɛ+F@'c'!$ !$A' -' C@<@!$ @$"/l*    |r*  s* /l* E<($nj<(N'$HH )%!H* < k%&`j %@ %(% ç'  $ |r*  |r*  |r*  s*  $J' $''!$ !$Ad''!$ !$A'K'  a,) $'' $B$ ' $'d' $ ҳ' d' $ Y ' $A  $1  += %w '0, 8r %8G:<6% *($0+8F%8+@#@G$@!@(#0, '!8 $+P&@P'% %1  %$1  %%I  %%A  $1  % 1  %I  %A  '+" %w '"#$ %&'()@ *$+(,,-0.4/80<1%%%%P%Xhl`dX\PT\!4 &<1!4} < D]<>!4 &<1!4} 0 4x|]<>!4 &<1!4} ( ,pt]<>!4 &<1!4}  %(%8|%(%x%8't%(%p%8'#H#8+8#8'%(/#(+(#($0!84!X*+(!(e$8*%H*'($(%%(/(!H,!`K+8'!8!((+(!($8K%HK'($(%%(/!8'!Pi+!A!($+(!$(i%i' $a%%!"+A!y/6$xM<6$y/%0B%0D%0F%(%0g, J%8F T %8L %@  R %@ N %@H R %@ T %@ V %8'%@Hi,y Z %H+V d %H,\ %PKb %PL^ %Pb %PLd %PLf %Hi%P k,Y`j %Xmf t %`l %Xr %`n %X%`j %`l %`&% ,d,0$:%(6D%0<%(B%0>%0B%0D%0F%(%0g, J%8F T %@HL %8' R %@HN %@H R %@HT %@HV %8'%@Hi, Z %H+V d %P\ %Hib %P^ %Pb %Pd %Pf %Hi%P k,`j %Xmf t %`l %Xr %`n %X%`j %`l %`&% ''!$ !$T''!$7W!$B$D<%T'!0!E "$!E"$!E!$!%*%%4%,%%2%.%%%*%E,%E %A} 4LP 8 } ,DH 0 } $<@ ( }  L,!@ P0!`K+H !H$`K%PK'X $Pj%PW D$!XlH(!x+`l!`!PK+XK!Xl$`%h'p`$h%`g <!h@!x+!/!`+h!$h%'p $%!b+C!d4!88!p+ ! $p%0'h$0%07 !8!h+@!@ !0+8!8$@%(%'H$(%%(/!8!@+H!@ !(+8!8$@%0'H$0&%07!8!@+H!@ !0+8!8$@%'($%!(!+!C!%+%!CD<%(%$+0b0+8F#8F#@G$@!@ $+P'@}T'$' a,p XT*6%(4<%0:F%8BLVdefgahija,S `\*6%(4<%0:F%8BLVd e f g a hija,7 hd*6%(4<%0:F%8BLVdefgahij a, pl&%$,% *6%(2<Fbcdeafgh' $A  $A  $A  $A  % %1  %I  A  $A  $A  $A  $A  $A  $A  $A  $A  += %w 'P8 '@'!$ !$`X%(H''!8#@G$(!(R %@ N \ %HiT %@ Z %HiV %@H%HIR %H*T %H*.%(%!$%( ($+0b+0E'"' $LUA% '! ?g0 $#@H $0F J- 0 - H , % $% 0!0A@ $Ġ%U#(`#$!,Y%'!d%$(!(*!$0!0njƌB=5%0f%(e#(`@<*%% 48V$D!A!DBc0Cp"'$ C$' D!$L#(`A_<}c4a C!V$ p# $,AK%$1  %$1  %I  A  += %w 'd0$,$%%6$?$8><@%!8!0fɌʌj %Xmf t %`l %Xr %`n %X$X%`j %`l %`>%8$8!PK!`'+XK!X!PJ+`B!X$`'%8''H`$8'%8ʬˬ!$&(0$+@  a$d!"+"! a$b '%%I  += %w '$% B8H!H#)ȬG %8Ǭ$*8&+0%^0!0njȌB@O!$%@ +H% N+ G!#"$B(B %"%bd#( #@G+ # '@@$@&'@$%?ed$(!(e#P'#X+H*#Hi#XB+PK#H*'P$PG&@'@$@ %@H$*(#$#(g# +e##+ #d"# '%%1  %1  %1  '+" %w ll' C8`}''!$ !$a}'$ B' '|'!$ !$A"$ #$@$$`%$&$'$($?)$_*$!$ !$A%!$ !$!$ b%!$ !$A@b%!$ !$%!$ !$*$!$ <' %''"$+A!$'' 'õ' "$C(`+$ bp# $$,X}'!($%@..+$?!(&(,@! $#@ $@(q? <@AB$ 4' ><@AB$ 4' '+= %w '07@!$(؏' 0 "$`"$$"$ "$?"$_"$( ' ( ' 0[' [' (!$ !$A$0@A%$ !$7W!$B$a!$7W!$B$a,'+= %w '@r' ';'!$ !$AL a,= @7D $ !$x' & ' $ @x'  H$+"`!0DC %aAPT<'PT<'PT<'1  $A  '+" %w DD' c8`w d$W&8  $  W?e0?e'><@A!$><_A$!$7W!$B$7''5'!$7W!$B$$!$ !($7'!@'&(7' %,!$B!('+E@x''!$ !$AX'w'!$ !$A''!$ !$A$x'' X'x'><AB$ ' x'' 4' X'' ' x'X' ' [@W6[' [' G<@AB$ 4' `"$#$!$7W!$B$ab$?d$!$7W!$B$@a$_d$!$ !$$@d$''' $1  <T!$<@A$ 4' 4'+= %w '074W C$( $$@$$`D$$D$`$$@D$  ' (4 4' $ ' ><A!$ '  '   ' ,'+= %w ''/'!$ !$A8W C$@D$0< ' '><@AB$0 4' 0'< !' 4'+= %w '$7(W #$ C$@#$@C$, !' , !' , !' '<@V!$ r' 7&A`8$  $('<!$  $"<@V!$ r' 7GL%8'D%0J%8F%0$0%8B%8D%8F%8$8 R %@ N \ %H+T %@  Z %H+V %@H$@ %HI R %H*T %H*V %HI$H#b %P^ l %Xd %Pj %Xmf %P$PD%Xb %Xld %Xf %X$Xcr %`n |%`t%hz%hv%`$`%hr%ht%hv%h$h !%p~"%p%x#%x/%p$p$%x%%x&%x'%x$x()%*%%2+%3%P$,%Q-%2.%Q/%Q$#01%T2%u%3%u%T$ D4%S5%S6%r7%r$CST%uU%v%U%%$a%0fS%tT%tT%tT%$b%8S T%u U%v% U%%$a%@h S%t T%tT%tT%$b%H3ST%uU%v%U%%$a%PjS%tT%tT%tT%$S%XsST%uU%%U%%$a%`lS%tT%T%T%$b%hm S!T%"U%%#U%%$a%pn$S%t%T%&T%'T%$S%xo(S)T%*U%%+U%%$3%p,S%t-T%.T%/T%$S%30S1T%2U%%3U%%u$3%$4D% 5S% d6S% d7R% D$D%C&%$% D%S % %8 %<  | x N %H<t L %H<p N %H l h d ^ %X|` \ %X|\ ^ %X X T Pn%hLl%hHn%hD@<~%x8|%x4~%x0,(%<$%< %  |xtplhd`\ XTP L!H"#$D%@&<'(8)4*+,0-,.(/0$1 234567''+" %w 't!0#+#lde2% .f<% 4%(f:%(6% f%(f2%(f4%(f6%(f gB%0> hL%8'D%0 hJ%8'F%0 h%8 hB%8hD%8hF%8hiR %@HN j\ %@hT %H*jZ %HiV %@Hj%HIjR %H*jT %HIjV %HIjkb %P^ ll %Xd %Plj %Xf %Pl%Xlb %Xlld %Xllf %X l!mr %`n "n|%`t%h#nz%hv%`$n%h%nr%h&nt%h'nv%h(n)o%p~*p%p%x+p%x%p,p%x-p%x.p%x/p%x0p1q%P2r%p%Q3r%q%4r%Q5r%Q6r%Q7r%QpST%uU%%U%%&d$& &uU%U%U%U%&$&(&,U V% X%% X%6%&$&0&$ X% X%X%X%&$&8D&(XY%\%#%8Y%%8&$!&@&Y%#Y%#Y%#Y%#&#$"&H9@&y Y\%y\%x%Y%%#&j$!&PY&yY%8Y%Y%8Y%8&x$"&Xy<& Y!\%8"\%%8#Y%%#&l$!&`&y $Y%8%Y%8&Y%8'Y%8&ȸ$"&h8&(Y)\%8*\%%+Y%%#&n$!&p&y,Y%8-Y%.Y%/Y%8&$"&x4&0Y1\%82\%x%83Y%%y&p$!&&a4C%x5X%x6X%7X%&q$&"0&b%%8%șd`\%\X%\T%\PLH> %8D <%8@ >%8 < 8 4 N %H<0 L %H<, N %H ( $  ^ %X| \ %X| ^ %X   n%hl%hn%h~%x|%x~%x%<%<%%%% %%%%%% %%%|xtp%l%h%d`\%X%T%PLHld`\X T D P LHD@@<840,<($  !"#8$%& '()*+4,-./012304567psddq,dddd$d d d d( d ddddddd dddddddddddd d!d"d|#d$dx%dt&dp'd(vl)dh*d+t,dd-d`.d\/d0aX1aT2a3u4bP5aL6aH7ah''+" %w ||'"#"%D$,%$%$*%&%$%$"%$$%$&%$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0&D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@HN *\ %@ T %H**Z %H+V %@H*%HI*R %H**T %H**V %HI *!+b %PL^ ",l %PMd %Xl#,j %Xmf %P$,%X%,b %Xl&,d %Xl',f %X(,)-r %`n *.|%`t%h+.z%hv%`,.%h-.r%h..t%h/.v%h|0.1/%p~20%x/%p30%x/%px40%x50%x60%x7!%/t%P%q%P%q%P%Q%Q%Q%Q % %% %% % %%%%%%%%%%%%%6%%6%%6%8%8%8%8 ! %9"t%p%!#%p%!$%p.%%p.&%p.'%p.()j%h*d%`%h-+%`%h-p,%`,-%`,.%`,/%`,l01b%`2l%h%`,3%h%`,4%h-5%h-6%h-7~%h!P!x#+P!x$#%#'$#%! D!e+!! d+!p$e%(e'`$(%%(/!0!+!0!(+0!0$%8'$8%8?!@! +!0!8+@!@$ %H '$H1%H O !PA!+A!0!H*+P*!A$P%X'p $Xn%PKW p!Xn|l!+pn!p!PK+XK!Xn$p%'`$%pwx! t!-+` !`!p+!` $-%h-'$h%h o !+!O'@$x! +x!xo'$#!(e+!'`$07!+!2!0+8!8'$%@ 'h$@ %@G!H +@(!@'h$!P*+A!a'h $Xm_ !Xn+hn!h'p$`g !p+!P'$Q! D+!'@$x!(+x!xh'$#!+!2!f+0f!0&d$%8'`$8%8?!H+8'!8`'`$@G!P +@H!@\'`$!++X+!Xmbn%`l%h-%2%%%|x%<t%<p%șlXT~%xP|%xL~%xHD@ 6%0< 4%086 %040, >%8( <%8$> %8 F %@D %@ F%@    |xtphlXTPLdHD@ <!8"#`$4%0&,'(()$*+\, -./01234 567''+" %w ||'"#"%$,%$%$*%&%$%$"%$$%d$&%$ %2% . &<% 4%( &:%(6% &%( &2%(&4%(&6%(&'B%0>(L%0&D%8(J%8'F%0(%8(B%8(D%8(F%8()R %@HN *\ %@ T %H**Z %HiV %@H*%HI*R %HI*T %H**V %HI *!+b %PL^ ",l %PMd %Xl#,j %Xmf %P$,%X%,b %Xl&,d %Xl',f %X(,)-r %`n *.|%`t%h+.z%hv%`,.%h-.r%h..t%h/.v%h|0.1/%p~20%x%p30%x%px40%x50%x60%x7!%/t%P%q%P%q%P%Q%Q%Q%Q % %% %% % %%%%%%%%%%%%%6%%6%%6%8%8%8%8 ! %9"t%p%!#%p%!$%p.%%p.&%p.'%p.()j%h*d%`%h-+%`%h-p,%`,-%`,.%`,/%`,l01b%`2l%h-%`3%h%`,4%h5%h6%h7~%h#xP#q+O#'`$0&#'`$b%p##+ # $#+# '$p&(e'($(%(/##+0#0&#(+#0'$&8'8$8%8?##8+@#@(#8+#@' $&H 'H $H(%H O #A#n+PA#P #H)+)#A'P`$P&X'X`$X+%PKW p#pn|l#+Xn#XK#P+p#Xn'p$p.&'$ %pwx#` t#-+ #P#p+`#` ' $&h'h$h%h o #+x#xO'@$O#b+b#' $ d'# +(#('0$07# +#2#0+8#8''$-&@ '@$@%@(G#@(+H(#H)' $!#A+PA#Pj'X`$Xj_ #X+h#h'`$`g #p +#'x$x#xO+O#b'`$C#+ # h'($(/#+#2#(+0#0&d'$,&8'8$8%8'?#8+@#@(`'H $H O #H)+)#A\'P@$PAW #Pj+Xj#Xbn%`l%h-%2%%%8|x%șt%șp%<lXT&% P$% L&% HD@6%0<4%086%040, F%@( D%@$F %@   % %  %<    |xtphlXTPLdHD@ <!8"#`$4%0&,'(()$*+\, -./01234 567'+= %w ''K'!$ !$A'PT >' TP r' PW'8$  L''+" %w TT'CD*%e&E4% ,%E2% .%pE% E*% E,% E.% lE F:%(6 GD%0<%( GB%0>%(h E%( F2%(F4%(F6%(dEF:%(6GD%0<%(GB%0>%(`E%(F2%(F4%(F6%(\EF:%(6GD%0<%(GB%0>%(XE%(F2%(F4%(F6%(T E!F:%(6"GD%0<%(#GB%0>%(P$E%(%F2%(&F4%('F6%(L(E)F:%(6*GD%0<%(+GB%0>%(H,E%(-F2%(.F4%(/F6%(D0E1F:%(62GD%0<%(3GB%0>%(@4E%(5F2%(6F4%(7B%E<EF:%(6GD%0<%(GB%0>%(G%0G:%0G<%0G>%0G HJ%8F IT %@HL %8' IR %@HN %8' I%@( IJ %@ IL %@(IN %@(IJZ %H+V Kd %P\ %HiKb %P^ %HiK%PjKZ %PKK\ %PjK^ %PjKLj %Xmf Mt %`l %XMr %`n %XM%`Mj %`Ml %`Mn %` M!Nz%hv"O%p|%h#O%p~%h$O%p%Oz%p&O|%p'O~%p(O)P%x*Q%P%x/+Q%P%x/,Q%0-Q%.Q%0/Q%00Q1R%32S%%33S%%q4S%r5S%r6S%r7B%R\`dhlptx|$'X'!$ !$A\` }  hd }  `\ }  XT }  PL }  HD }  @< }  $(!0!P +8!8$P %@ 'H$@ %@HG!H*!hl+P*!P!@ +H !HI$Pl%Xl'` $Xl%PKW !Xl!x+`l!`!PK+XK!X$`%h'p`$h%`g !h!+p!p.!`+h!h$p%x'$x%pw!x!2+!p!p+x!x$2%2'$2%‡!"!D+"!b!+!Q$D% D'@$ % $'!+ d! $z4,$ (0 8\'!A"!pl }  hd }  `\ }  XT }  PL }  HD }  @< }  $'8!00!84!X*+@!@ $X*%HI'P$HI%HiO (!PK,!p+XK!Xn!H*+P*!Pj$X%`'h@$`%Xl_ !`$!+h!h!Xl+`l!`$h%p'x$p%ho !p!+x!x!h+p!p$x%0'$0%x!!S+!4!x+!0$S%r'$r%2!S !+S!v!2+2!r$%'@$%tŸ!!+!!t+t!4$%' $u%!!+H!H$%P' $P%PW !!+X!X !PU+U!Xu$%`'`$`%`g !!+h!h !`+!h$%p'$p%pw!!+x!x!p+!x$%'$%‡!!+!!+!5$V%V' $%—!!+!!U+U!u$6%6'`$%!b+C!d!"+AǬȬ! #!$%8 %0%H %@ %X %P %h%`%x%p%%%%(tx|$'t' ' ''+" %w pp'" #$%&'@@O *@X %Hi_ $,@h %Xo (.,/|@@%h-%ST UVXY\O$N L,J (G4J0R0*x@ %Qt— 4*p@ %2— l*h!d!PT!a+T!T$3%3'@$a%!V!+v!!3+3!$%'`$%§!!+ȹ!!+!$%'Ƞ$%·!x!+!!+x!x$%@'$@%@G!`!n+H!H !@ +` !H,$`%X'p $Xn%X_ !8 !p +h!h!Xg+8g!8$h%`'p$`%`g t!h!0+p!p!`+h!h$p%'$%pwl!p+!*!X+P*!P*$%'@$X%2—!!y+8!!A+2!$y%y'@$y%Ÿ|!x!+!!t+!$5%5'`$%¯p!h!+!!+!$/%x/'$x%xd!!"+@!@(!x+!@$I%I'H$I%!k!H+Xk!H+!C+C!#$H% '8`$ % $'!(!8+H!8! +(!($8%0'H$0%07!0+8!8!H&!XG+`1!Xl$`G%8G'P`$8%8?!+8'!8G'P$PJW !`T+P!Pj'h@$hmo !p+!p!h+!p$%0'$0%07!x+0!0'$@G!+@H!@h'$p! d+!'`$(/!+H !Hi' $Xq_ !a+X+!X'`$8?!`+8!8G`'$PQW !+!2!PM+hM!h-\$%('p$(%(%/!p+(!(X'x$07!+0F!0T'x$@G!@+ !d"~ % | %x/ %2    % % %    %< %<| %șxtp > %8l < %8h > %8 d P Ln%hHl%hDn%h@<8.%(4,%(0.%(,($6%0 4%06%0 |`xtplh\dPL H!D"#X$@%<&8'(4)0*+T,,-(.$/0 1234567'+= %w ' "T'C'"T 7#$'!$7W!$B$a'8$ X' X\P' '+" %w xx' c$ * g0N#(aa#+#@L <WB$ (' '' ' PH''+" %w ||'L''!$ !$A'K'!$ !$AL'><WB$ (' '><WB$ (' ' L'' ' ' '+= %w '' \l ' Xd ' T` ' T >' '\8$  P ' P\ r' PX r' LX' >' X' r' \TL r' T\X ' \P ' XL ' \ph'+= %w '' Xh ' T` ' P\ ' P >' '><@V!$X r' L ' LX r' LT r' HT' >' T' r' XPH r' PXT ' XL ' TH ' Xld'D'+" %w 'D9!(A <!$ 8$"<@V!$><@V!$ r' 0'  N% 8 L<@VB$ r' 0"$7#$!$7W!$B$a0b$od$4!$7W!$B$pb$'M'!$ !$$'!$7W!$B$LPT<'L<@VB$ r' ><@VB$ r' '+= %w '0'g'!$ !$Ah''!$ !$A,WpB$$<' ,8C$C$ 7C$C$oC$$ ' $ ' ,><@VB$ r' ><@VB$ r' $%0:DNCDEFBGHI "#".% ,4%(2>%0:DNC D E F B GHI"#".% ,4%(2>%0:DNCDEFBGHI"#".% ,4%(2>%0:DNCDEFBGHI$" #".% ,4%(2>%0:DN C!D"E#F$B%G&H'I,"(#".% ,4%(2>%0:DN(C)D*E+F,B-G.H/I4"0!&%d$,% *6%(2<F0A1C2D3E4B5F6G7H+= %w ' ,*(% ,((%@%H!PGMIO %*P@P!Xlk!h!h!x+X!X!h-+H!H+$X%`'p $`%X+`'!(O$*(+((!0%Ȍƌ!0+H!H('P $@ +P@48 '%1  %%1  %1  += %w ' ,*(% ,((%@%H!PGIKO %*P@P!Xlk!h#hm#x+Xm#X#H+h#Xm'h$h&`'`$`%`+h'!(O$*(+((!0%Ȍƌ#H +@ #@'0$0+P@48 '%1  %%1  %1  += %w '< 8  <%%% - 08!H*+,!`!h+0!0$hg%8g'X$8%8?!8+(!((!X ,!h+@h!@$h%0'`$0%07! +0+(!%$%%H*0E$(,0D!A"!P T} <$+"`+0 8!"$#4'%%1  1  += %w '0'd'!$ !$A0'$ ><`AB$$pt ' lW$ 0' $2' (,0'$ ><`A$$ ' l$ 0' $2' h''+" %w \\'h''!$ !$A0'd'!$ !$Ah'>%0%8@D $'' 'T' P'X '!XlJ%h !hnm@%1  %I  %I  += %w ' '@'!$ !$A 'H' '' 'H' D'h'+" %w '0'd'!$ !$A''!$ !$Ah''!$ !$A' '!$ !$A' ' h'$' 0'$ 'h' $2' (,'$ 0'><`AB$$ $2' ##+ #d% 0'!0njȌ'H@$8'H`$@ '! $PB%8Ǭ$ % Ĭ!$$(0'' 0'' 'h'+" %w '0'd'!$ !$A''!$ !$Ah''!$ !$A' '!$ !$A' ' h'$' 0'$ 'h' $' (,'$ 0'><`AB$$ $' ##+ #d% 0'!0njȌ'H@$8'H`$@ '! $PB%8Ǭ$ % Ĭ!$$(0'' 0'' 'd'+" %w '0'd'!$ !$A''!$ !$Ah''!$ !$A''!$ !$A'$' h'(' '$ '$ ' 0''8$  0' {' $3h'!""!'$ '$ ' 0'$ ' $$2' (,0'!#!D+#!" {' !$ `d$(040' {' ",@0'' 0' ' '(0'!($8!8$1  @'+" %w 'D 78$ ' $U' H 7 8 $ 8$ ' $U'  * #(# a# +(#,  <@U!$  , %< , #d!A  , < 8 5* a1# #)4  $ +(a8 , 8  <@U!$  , %, < #$!a   4 , < 8 8  4 8 ''!$ !$AL '$ ' \''!$ !$A B$( $\$'['!$ !$a$<@Vc$ r' P'T ' '><@VB$H r' H'T ' L'+= %w '$78"$p#$#$$$ >' $ '  '  '  >' $ >'  '  r' $ r' $ r' $ ' $ '  ' '+= %w '7p!$ >' ' '+= %w 'dWhw8D$TpD$PD$\B$X8e$Hpc$L'G'!$ !$a' ' XTd r' Td >' dXH ' Th ' 'L ' \Td r' XTd >' dP' r' TP' >' PdT ' d\ ' TX ' `'+= %w 'P7#$o$$'!$7W!$B$aP8A$H!$7W!$B$H'G'!$7W!$B$aPpc$><@V$ r' L'+= %w ''G'!$ !$APW8C$pD$HT ' '><@VB$H r' H'T ' L'+= %w '$7(W8#$8C$p#$pC$, ' , ' , ' '+= %w '7Wp!$B$ ' ' 'x'+" %w '&  S' "$% '!$7W!$B$a '' $''!$ !$A$' 'S' $' $'' $"p!A S' !$*"`+= %w '074W8C$(8$$p$$D$$D$$$pD$  >' (4 r' $ ' ><@W!$ '  >'   >' ,''+" %w @@'$l$p$tK$x$|$'l''!$7W!$B$a'l'!$7W!$B$a(p%Cpp&" ' 7G< v'!(&0f&(e'($(&(Ee'(`$(&(e e'($(&(e'($(&(ee'($(&(e'($(&(e'($(E&( e'($(e&($e(e,f&(&0PXB/%(B7%00j4k&PG&Xi@s @{ T %P\ %Xn8n<o&p&x@˜%pp@%p@oDs&x&r%%xoHsLu&v&%?%'`$&(u' $&,u'$U&0u'$u&4u'@$&08f'0`$0&(<e'($(&(E@e'($(&(eDe'($(&(He'($(&(LePeTf&(&0S\%PK,3%(Xf\k&0&Xi@p @x7%0_ %Xo`ndo&p&xv%p~%xhpls&&r¡@%@™%ppstu&v&%y%'$&yPy'$4&Ty'$ȹ&Xy'Ȁ$y&\y'Ƞ$ȹ&0`p'`$P&dp'$p&hp'@$&plp'X`$X&(pe'($(&(Etexe|f&(&0QY/%(e7%0jk&PG&Xir z U %PN] %Xono&p&xBt%pB|%xps&&r%%ttu&&B%?B%'$u&xu'$U&5|u'`$&u'@$&u'$&Xuk'X$Xk&PKj'P`$P*&PN'X$X&Xokj'P $0&0f'P$(&(efef&(&0@R@Z-%(e5%0jk&8G&HiP X?%8GO %Hijk& D&@hW _% d@%@ jk&Xr&PQe BR m %PBZ %Xllm&h&`q y Bf %`Bn %h'p`$p&p'x@$x&xon'p$p&pn'x$x&xOon'p$p&h'p$p.&`lm'`$` &0'` $`&(ef'($(e&(' $ D& $de $$( (d,ePfTgxh|ijkl mXn\opqrstu8v&<v&`v&dx&y&4y&5y&4y&5y|@&?D&h&?l&P&bL&\a&9a&< a$bH&?La&Apb&tb&"b&_Hb&AD@@§%T%"@@%_%b& D& & & D&0$@@'j&(E&(&(%&(e&8@H% $& /%(&(0h&H &H.&H &HI@X g &H4n&h&h&h-&hm@x %` %Xo&h&@&p{E%@u%p&x& B%B}%xOqH&2&Xr@—&KuD&&`@%&X·%&v&PP&L&@%<@%&%&%8%'$&'$& >< v'!??&?x&x'$8&'$&0|4x' $8&'$&x`odp'x $xO&x/'$&po'P@$P&P*'p$@&@hjPhTj&PL&@ p xBG%@BW %POno&x&p@@|%xt%p.pq&-& @¨%€@%0qu&&3%%HuLx&&%<%' $&'$\&<P|Tx'$&'@$&|x'$&@'$&PXjh'@$@&@'P$P*&Pjh'@$@&@'P $PU&P HjLhhj&PL&@ s| %pDS %@Hj o&x&PF@@ W %PP%x8p<q&-& %%5htlu&&±@%@©%ux&&%%'$6&Y' $&|y'$ȹ&'$&<| y'Ƞ$&6'$&48t<v'$T&'$&hult'P@$P &P'p$p.&@hj(h,j&PL&@ qy W %PNG%@Xn\o&x&pu%p}%xpq&-& B%B%5tu&&%% u$x&&B%<B%'@$&8'$&(|,x'$&X'$&X|\x'$&p' $&xon'p$p.&p'x$x&xon'p $PN&P'p$@&@ h$jxh|j&PL&@ @Z@b U %PKE%@kl&8&0fX`7%0f?%8kl&`&Hi_ h %XH g %H@lDm&h&`u Bz %pBb m %`pmto& &(iyB&% B.%('h$h&hm'x$x&x/xo|m'h$hM&h'x$x&xom'h@$h& 'h$h&(ed' $ d& D'($(%&(@eDd'@`$@&0P'@ $@&8Lpgtf(h,iPjTkxl|mnop q0r&P4r&QXr&P\r&QrH&Ps&qt& t&tu`vdxy|abr& D&(Ehr&(Elr& Dr&(Er& DD r$bHd& Lr&B&F& b& Db&Rb& Db&R@@87%0F&0F%8&8@@'% D—%Pr&@H&@H&@&@@Pgn&H&Hi&H&H@X %Xlg %PL&`&hG8n&x&x&x/&x@§&x<p&&&&5@%&H§%T&@H& &iH&h%T%t&(@·&(EjD&X@%6&·% &&Xx&&pB%Bu%p&PD&²@ @R P&yL& '@$'(`$( k%%%PT%%!&L&(|-X >< v'!X|&(ke&(ye'($(&(E'X$XK&Xkke'($(&('X@$Xx&X8k<e'($(&('X$X&PKje'($(E&('P$Pj&PXpjteej&PF&(X `B/%(BW %PLXk\l&`&Xh@k @s d %`\ %Xmn&p&h@ %Ph @w%hnr&D&p%tw%pNHrLt&&X%?%' $&t'@$_&t'$&'@$&X\t'$&('`$&PTje'($(e&('P$P&Pjje'(`$(&('P$PR&PHjLexe|j&PF&([d %Xl,S %(E0j4l&`&PH@h @p W %PMg %`mn&p&h n %hv%phplr&D&™@%t@‘%P r$t&&X%Y%'Ƞ$3&Y'$&x|y'`$Y&ȹ'$&04y'@$y&3'Ȁ$ȹ&0ps'`$P&P'$&hrlp'P@$P&Pj'X$X&( e$jPeTj&PF&(Ya W %PK/%(k l&`&Xhj r ] %Xme %`mn&p&h Bl %hBt%p@pDr&D&%%Prt&&XB%?B%'@$t&4'$&PTt'`$&T'$& t'$t&Xt'$&`lk'X`$X+&Xm'`$`L&`@lDk'X $PK&PS'X@$(&(ej(e,j&0F&(@:@R5%0-%(Egj&HI&8@ P?%8G %@H`idj&PQ&H5_ ` %XH W %HIjl& &POe Bj%`BR %% jm&h&PXq y Bn %hBV %P'p$p&p'x$xO&x/(o,n'p$p&p'x@$x&xon'p$p&h'p$p&PN`jdm'P$Pj&0F'P$P*&(ef'P`$P&8P'H $ & Ldg(h,iPjTkxl|mnop q0r&P4r&Qrstuvx8y&6<y&8`y&6dy&8y&6y&8@yH&(%DD&0ha&(%la&0&a&(%a&0&a&(%a&0& a$bH|&La&"pb&\tb&A&'&b&\b&A@@ ?%8G% @@%_%Yb&@H&@H&@&@@Pgn&H&Hi&H&H@X %Xl&0f_ %PK&(Xj&XP&XK&X@` o & d\k&xq&xo&x@%h &h-‡%`&`&8&p&xLp&@Ÿ&9t&@%&HiŸ%S&@&&Xi&PH ] %XsU %P&&B%tB%D&H&²@@¢P&L& '`$b'(@$( $%%%%!&N&(,d0>< v'!0ߌ&(ƌe&(e'(`$(&('0$0&0FXf\e'($(&(e'0$0&0fe'($(&('0$0&0@fDe'($(e&('0$0F&0fexe|f&0&(PXB/%(B7%0j k&Xi&PH@s @{ \ %XnT %P`ndo&x&p@˜%pp@%pos&r&x%%xoHsLu&&x%?%' $&'`$&x|u'$u&'$_& u'`$&('@$&0`fde'($(&('0$0&0Ffe'($(&('0$0&0HfLe(e,f&0&(S\%PK,3%(fk&Xi&0@p @x7%0_ %Xono&x&pv%p~%xhpls&r&¡@%@™%psu&&x%y%'$4&'$&(,y'Ȁ$y&'$&y'`$Y&4'Ƞ$ȹ&0pt'@$&p'$s&uhslp'0$0&0F'P`$P&(Eefef&0&(QY7%0/%(e0j4k&Xi&PHr z U %PN] %Xono&x&pBt%pB|%xps&r&%%ppstu&&xB%?B%'$U&5'$&u'@$&'`$&04u'$&PU'$&Xkj'P$P*&PN'X$Xk&Xokj'P $0&0'P`$(&(petfPeTf&0&(@R@Z5%0-%(ejk&Hi&@HP XG%@HO %Hi8j<k&8g& DWX%Pj ?% gk&Xr&8eBj %`B:] %8g k$m&h&Xxq y Bn %hB^ %X'p$p&p'x$xo&xPoTn'p$p&p'x`$x&xon'p$p&h'p$p&Xn8k<m'X$XK&0f'X $X&(ef'P@$P&@ P' $ & L d$h(g,iPjTkxl|mno0p4qXr\stuvx8yH<D`a@db<|8b4b0,(b$@|&D&hb&\lb&_&0&(|&(|&0H|&L&pb&\tb&_b&\b&_b&\b&_@@ G%@H% @@%Y%Ab&8G&8G&8&8@Pgn&H&Hi&H&H@X %Xl&0f_ %PK&(j&XP&XK&X&X@` o & d k&xq&xo&x&x@%h &h‡%`&`&@&p&xLpH&@&Q8&Q0&Q@Ÿ&!tD&<&4&,&@%&HiŸ%S&8&5&Xi&PG ] %XsU %P&&B%tB%$&(&²@@¢P&L& '`$b'0@$0 $%%%%!&N&0,T'%$1  %$1  $%1  !!+= %w '7$   '+= %w '!$+(b;+(A5$#A#aX%$/$! '  "' 8 ' "" $+ b !$ %' '9  I  9  += %w '$$+(bL+0EE$#EX$?$8!0#e+("9!(&(%$!8$*@+8$$+("!&"$&W";' $$AAA %' '1  %1  1  %I  9  += %w '8@<D%%%(%0($0#H / *P+@+@ ' 8"$+ b (#C$b"' $ #"(#b0!d8%8%0%(@$#PI*X`%%%( !@$+Ph\@+X T`$#@ XL%g $`!Xl+` G!P*XJ%W $PI#@ !Hj+P:@*P@%@%P%@%( &P&@   @$$80( #(/$(#8!(#0H&@I{,;' @$8,mHLP4'%%A  % %I  % %I  %9  %%I  %A  <T!$'9$ '  ' !'r$ ' `''!$ !$A`'!'r$ 5' ''_'!$ !$A`'t' ''9$ R'  ''!$ !$A$  @@@<c$( ,04' ''9$ ' 9C,|`!$B$#9c0! '  ' 'r$ ' '&'!$ !$A''r$ 5' ''!$ !$A''' (' '`' ' 9a,- ''&0 9$  9E,A$b$#9B0!8$*a`8$'& C  '9$I  9$A  9$I  !  9$%A   $  '?0!0ɐI %8' -# @!@0'$+@H$Ɛ670!8琀8%0- '%$1  %%1  %$1  %%1  $%1  %%1  %$1  %%1  %1  += %w '%%!0B9Ǡ !$B$&(wF,0!0ƌG$<5#0, 8!8I$#8*-@H !H#)J$#H K-`P !PCJK$#P l-X !XckL$#X -` !`M$#` -h !hN$#h -p!p΍#p+x$!x/$2@%0+!x&$+x!0xϠ&$:x %8+xs!0Ǡ&$9 I %8'+Hf !0Ǡ&$+8\!0B8 Ǡ&$B: I %8'+HN !0Ǡ&$+8D!09 Ǡ&$; @H %8'+H6 !0Ǡ &$9 I %8'+H) !0Ǡ &$+8!08 Ǡ &$: H%8'+H !0Ǡ &$+8S '%%1  %%1  %%1  %%1  %%1  %%1  %%1  %%1  %%1  %%1  %%1  %%1  %1  %$1  % $1  % $1  % $1  % $1  % $1  $%1  %$1  += %w '%%8!8 !$B$&(+0% &$!8a+@!0fȐB%80<5#8I, H!H$''$+H ƐB1!8g8)$%0+8%G$!Hi*R %0F0#0,@8!8&$+8G$)H !0fʐQ %HI)1#H ,@8!8'$+H Ɛ1!8g@8)$%0+8%G$!Hi*@R %0F0#0,@8!8&$+8'9!0fƐ1)$%0+8%qG$!Hi*S %0F0#0,c@8!8 &$+8XG$)BH !0fʐQ %HI)1#H ,H@8!8 '$+H= Ɛ1!8g琀8 )$%0+8%/G$!Hi*R %0F0#0,!@8!8 &$+8G$)H !0Ɛ@1%0#0,@  '%$1  %%1  %$1  % %1  %%1  %$1  %%1  %$1  % %1  %%1  %$1  % %1  %%1  %$1  %%1  $%1  % %1  %%1  %$1  %%1  %1  += %w '%%!0猂8Ǡ!$B$@&(FwF,e0!0+8$]!8ȌG$,R($ƌ28!8錀H %0&+HC !@F$,9($猂90!0ɌI %8'+H* !@G$, ($ƌ18!8錀I %0&+H !@&$+@ '%%1  %%1  %$1  %%1  %$1  %%1  $%1  %1  %$1  += %w '%$%(%8%@!$ )( +H$d !H %P<%%!j#$+Ha!"%C,),$i ` #$ i,PXBg%P+P #P %PK $#Xj`HhgN%x J- ` j- h %P - x %PO!("+Hd '%%5  %%n  J%K)`wX!XKX !Xcl, $pM O- p%`,k<6&Xw`%@H%8@Xg%(@ $%1  += %w '#$!$ !$a $+"`!$+"` d!e2% "$+0"u."f<4%(% #$+0"h#f:6%(% $$+0"\$f%(%$+0"S%f2%(&$+0"I&f4%('$+0"?'a%%@%( '$ (%0$ '$(!8e8 , 808!88!8$0#H <6$H7)9B8O% 'B$%1  %1  %1  %1  %1  %1  %1  1   % 7W(!0!80 %O )1!@ <6!H#8 $B;ɬw!(e$(+= %w 'o(  $G!$% 8G<Л8G<ԛ$( 'B$D($c$#(/0&!%8G<Л8G<ԛ$( '+= %w 'G< F<8  !<B$C(`3'!d%(&s'?!0fʐ@P J1%80#8*-'@H !H$'G$ɐN N )1#H ,@8!8G$Ɛ6B70#0,  '%$1  %$1  % $1  %%1  %$1  %$1  % $1  %%1  $%1  %$1  %1  += %w '%%!0 !$&( %0P&$+8,!%`B$C0Pc,`A0+$` '%1  $0,w:!8g0@!8G0+@ !8B$%%1  %%1  += %w '#$!$ !$a%%!$%&(P&$+8L!0Ɛ%8H0+H P $+H'+  'B$E0P,A0+(#!($ '$ '%1  J!HJ0!PJP !H* $*B$I0+P'@+H  I0!H)J$J1!PJ+HI  '%%1  += %w '%%>0!@iA)$%8+@%!@i 1K *$%8'+HE~ FG1!Hj)I *$%@(+HEo !Hj)?*1S +$%@H+Peb@N O )1!PcJP +$%HI+PeS@!PcJR %HI <#XF#`G#hH#pI_ <6$Xwg <6$`o <6$hw<6$p#0f#8#@#HK,.`?0!@$A)$%8+@#-!@$C%8<#H#PO <6$H7W <6$PW#0&#8GI, ( p'<'+" %w '"''!$ !$A'<'!$ !$A$|$LW' $ ' '"'$ ' H"$"#*%&$4%f,% %2% .&% '2% (4% )6!$ !$A%%$$%0(H!(8!8$I0#H <6$H7)9B8O%'!$B%0,@D'('"'$ ' @% , "'!80$+@%$1  %B$C(`7!#% (!(e=<6$0@C!0#0<6!8?<6$8!0<6!0$,%B$C(`7!#% (!(e<6!8?<6$8!0<6!0$( % $( w7W*!0!8!(%@ H!P&!X'k!H%)!HiI% - += %w '% W !A( !$"(@ '%c$d(7"! $%( $(0!0ƌ?<4#0G&0#0+0$  % $( wW7*!0!8!(%@H!P'!X%!H&),1%o 1!`<6!h#H, )%BK Mi% )  % $( wW7*!0!8!(%@H!P'!X%!H&),%a  $`q ( !$B$ (,$'(+8'%%I  += %w ' (,$%%w !a### E'$D! Z>( !$B$ (,$'(+8'%%I  %B$C(`7!#% (!(e=<6$0@C!0#0<6!8?<6$8!0<6!0$,%B$C(`7!#% (!(e<6!8?<6$8!0<6!0$( % $( w7W*!0!8!(%@ H!P&!X'k!H%)!HiI% - %c$d(7"! $%( $(0!0ƌ?<4#0G&0#0+0$  % $( wW7*!0!8!(%@H!P'!X%!H&),1%o 1!`<6!h#H, )%BK Mi% )  % $( wW7*!0!8!(%@H!P'!X%!H&),%a  $`q < A!$><DJ,-./+` $DJ()*++`8 $< A!$><<0A><4A><8A-./ 01234>< A><$A><(A><,A><< A!$>< < AJ%!X k %g $@!@  j %` l %`F%@ &@h($($ `( 8!$,b( 0,&"`$  $8 ade#0f+ ##$a(H!P$> < Ak%!`i-%o $H!H'-.r%h.t%h)N %H-&HI% ) c%I  %I  %I  A  += %w ' C^( $( '+= %w '"d&J@b$&$e& %A@ b $&<@$b$$&7@(b($&DB81@$ Y ( !$!$ $ Y  !$!$ $ Y  !$!$ $ Y % ''+" %w HH'$+AS@"8*@!8 @%8+@!0ǠF$<B=A%8+@!0ǠF$+8!0<<ǠF$<>@@%8+@v!0ǠF$<=A%8+@f!0ǠF$<=A%8+@V!0ǠF$+8L!0<B<ǠF$<B> @%8+@9!0Ǡ F$ <="@A%8+@)!0Ǡ F$+8$'w@('!(8!8@8!8:$:@%8+@E!0ǠF$<=A%8+@5!0ǠF$<=A%8+@%!0ǠF$+8w@( '!(8!8@8!8焀:$:! D$<=@@%8 A%8+@+! D$ <<"@%8+@w@('!(8!8@8!8@9;$8q<6!8=0$(%%1  %%1  %%1  %%1  %%1  ! !$B$ $(% =)% 0+0EF,!8D$A%8+@7! D$A%8+@)! D$ "A%8+@w@('!(8!8@8!89;$8q<6!8=0$(%%1  %%1  %%1  %%1  += %w '0"8@!8  $ (,/v(  $ (,v( '<T!$$/$ "'! B%0>L%8'D%0J%8'F%0$I%(UU $8p#0$<? 0!0$$(+= %w '7 !$ $ (( %B$C(`@!#% ;$C,"`A$(B$#B0 !b #(` $& b   a$$ <~( '$I  @(!(e%8N$8p> $8p#0$<? 0!0$$(x'+" %w '< !$   $8'q#0$<? 0!0$$(d'+" %w '' '!$ !$A''!$ !$A ' '!$ !$A'0 4 8  $Ӂ( 4 C,`'8 !$B$#c00 ! $q( %  @ '!An(  !$"(@ 7 '' ( %@ '!CD%(N$(p. $(p# D!$"(@ '6o( % @'!( '!fg#(e!$#(`%@ '!de%0N$0p6 $0p#($47 0!($e!$#(`( $ %!$ $( + "%! a%( '0!0@0 '!0Ƅ$#0LO &0&$4700 , 0 %0&$(1  $I  /@X'+" %w `' ''!$ !$A''!$ !$A' '!$ !$A''!$ !$A''!$ !$A''!$ !$A 'HL P$( %  @  '!"n( !$"(@%!$"(@@ '!C% Z'HL P$$( 'HL P$$u( %$,W@'!d B$ !A ' ( $!$"(@%!$"(@@'!C% % @ '!"6o( !$"(@%!$"( @@'! C'!%0,7' !$ ' ( %@'!CD%(N$(p. $(p# D!$"(@'6o( @<%c$ d(% % @'! C'!FB!E!$"(@% @'! C'!B!E!$"(@%!$"(@@'!C% U%@'!CD%(N$(p. $(p# $,/ 0! $D!$"(@'04 8 $r( 4A, '8!$B$#c00!d $s( ('$I  @(!(%8N$8p> $8p#0$<? 0!0$$(!(C( , (0!0@0'!00#(0Ť$(`+(a%%1  @8!@ !8G!8$(@(!(%8N$8p> $8p#0$(@(!(%8N$8q> $8'q#0$(+= %w 'G $8p#0$(%B$C(`7@!#% @(!(e%8N$8p> $8p#0$<? 0!0$$(+= %w '% W@ !A6o( !$"(@ '+= %w '% W@ !An( !$"(@ ' % $( w7W@*!0!8!(%@ @H!P&!X'k!H%)!HiI% ) t'+" %w '%%'($@p+HJ @J!H#PW $P +% '%`% !$7W!$B$a#!@%  '!H(T U *!$)( H@PJ%@P  $haq '!H.!P+x)J!x %L N %H0+ !x%+h"% 1  %1  % 1  %%I  += %w '%!$'($@p+HhA @J#PW $P !H#h!@%P '@p %@p!p.n o 1!`a %`̥J%K)` $`jq+h%!p +xx !xΑ!h 2%p%+p% 1  % 1  % 1  %%I  += %w '4$* d8$d8?$  d8@$ d83`$,0($%8׀@ !##H# $! s( '$,40($(@'p+HH  '%I  <T!$ $8p#0$<? 0!0$$(+= %w '7 !$ $ (( %B$C(`@!#% ;$C,"`A$(B$#B0 !b #(` $& b   a$$ ( '$I  @(!(e%8N$8p> $8p#0$<? 0!0$$(t'+" %w '< !$ < !$  '_'!$ !$Al''!$ !$AH$4@$$@l' ' l' '@$ '  '&"` $   "$ ( `'^'!$ !$A@' $ $( % d@ !"n( d!$"(@%B$C(`@!a% `'@' $ $$( % `@ `'!"n( `!$#(`%ha$#(`h B$@!b !A %( % d$%!$%(@*!0`'!(%b%!$%(@*!(%I%$ $)  'd$ a$`'!$7W!$B$ d$ a$!$7W!$B$`'^'!$7W!$B$$$(@0!0DŽ%@N $@ qF $@ q#8$DG 1!8$ǤB$F(@@!H*!@!@H(B$H(@!adI$0p $8'q#0$<? 0!0$$(d'+" %w '''!$ !$A''!$ !$A''!$ !$A'04 8 $H( 4C,`'8!$B$#c00! $q( % @ '!An( !$"(@ 7'' %( %@'!CD%(N$(p. $(p# D!$"(@'6o( % @'!('!fg#(e!$#(`%@'!de%0N$0p6 $0p#($47 0!($e!$#(`($%!$ $( + "%! a%('0!0@0'!0Ƅ$#0LO &0&$4700 , 0 %0&$(1  $I  /@X'+" %w '' '!$ !$A''!$ !$A''!$ !$A ''!$ !$A''!$ !$A ' '!$ !$A'HL P$( %  @ '!"n( !$"(@%!$"(@@'!C% Z'HL P$$(  'HL P$$u( %$,W@'!d B$ !A' %( $!$"(@%!$"(@@'!C% % @ '!"6o( !$"(@%!$"( @@'! C'!%0,7' !$' %( %@'!CD%(N$(p. $(p# D!$"(@'6o( @<%c$ d(% % @'! C '!FB!E!$"(@% @'! C '!B!E!$"(@%!$"(@@'!C% U%@'!CD%(N$(p. $(p# $,/ 0! $D!$"(@'04 8 $( 4A, '8!$B$#c00!d $s( ('$I  @(!(%8N$8p> $8p#0$<? 0!0$$(!(C( , (0!0@0 '!00#(0Ť$(`+(a%%1  @8!@ !8G!8$(@(!(%8N$8p> $8p#0$(@(!(%8N$8q> $8'q#0$(+= %w 'G $8p#0$(%B$C(`7@!#% @(!(e%8N$8p> $8p#0$<? 0!0$$(+= %w '% W@ !A6o( !$"(@ '+= %w '% W@ !An( !$"(@ ' % $( w7W@*!0!8!(%@ @H!P&!X'k!H%)!HiI% ) t'+" %w '%%'($@p+HJ @J!H#PW $P +% '%`% !$7W!$B$a#!@%  '!H(T U *!$)( H@PJ%@P  $haq '!H.!P+x)J!x %L N %H0+ !x%+h"% 1  %1  % 1  %%I  += %w '%!$'($@p+HhA @J#PW $P !H#h!@%P '@p %@p!p.n o 1!`a %`̥J%K)` $`jq+h%!p +xx !xΑ!h 2%p%+p% 1  % 1  % 1  %%I  += %w '4$* d8$d8?$  d8@$ d83`$,0($%8׀@ !##H# $! s( '$,40($(@'p+HH  '%I  <T!$ $8p#0$<? 0!0$$(+= %w '7 !$ $ (( %B$C(`@!#% ;$C,"`A$(B$#B0 !b #(` $& b   a$$ C( '$I  @(!(e%8N$8p> $8p#0$<? 0!0$$(x'+" %w '< !$  <!$  '_'!$ !$Al' '!$ !$AH$4 @$ $@ l'   ' l' '@$ '  '&"` $   "$  C( `'^'!$ !$A @' $ $( % d@  !"n( d!$"(@ %B$C(`@!a% `'@' $ $$( % `@ `'!"n( `!$#(`%ha$#(`h B$@!b $Ap !" ( % d$%!$%(@*!0`'!(%q%!$%(@*!(%X %%%(%$%4   '$8p!8@B!8$%H`'%P%!$7W!$B$@p!@@Z !  ($%!$7W!$B$ `'^'!$7W!$B$$% % (@0!0DŽ%@N $@ qF $@ q#8$DG 1!8$ǤB$F(@@!H*!@!@H(B$H(@!adI$0p $8'q#0$<? 0!0$$(d'+" %w '''!$ !$A''!$ !$A' '!$ !$A'0 4 8  $ޤ( 4 C,`'8 @!$@B$#c00 ! $q( %  @ '!An(  !$"(@ 7'' ( %@'!CD%(N$(p. $(p# D!$"(@'6o( % @'!('!fg#(e!$#(`%@'!de%0N$0p6 $0p#($47 0!($e!$#(`( $ %!$ $( + "%! a%( '0!0@0'!0Ƅ$#0LO &0&$4700 , 0 %0&$(1  $I  /@X'+" %w 翯'''!$ !$A''!$ !$A''!$ !$A''!$ !$A''!$ !$A''!$ !$A'HL P$( %  @ '!"n( !$"(@%!$"(@@'!C% ['HL P$$( 'HL P$$u( %$,W@'!d B$$ap!A' ( $!$"(@%!$"(@@'!C% % @ '!"6o( !$"(@%!$"( @@'! C'!%0,7' !$' ( %@'!CD%(N$(p. $(p# D!$"(@'6o( @<%c$ d(% % @'! C'!FB!E!$"(@% @'! C'!B!E!$"(@%!$"(@@'!C% U%@'!CD%(N$(p. $(p# $,/ 0! $D!$"(@'04 8 $}( 4A, '8@!$@B$#c00!d $s( ('$I  @(!(%8N$8p> $8p#0$<? 0!0$$(!(C( , (0!0@0'!00#(0Ť$(`+(a%%1  @8!@ !8G!8$(@(!(%8N$8p> $8p#0$(@(!(%8N$8q> $8'q#0$(+= %w 'G $8p#0$(%B$C(`7@!#% @(!(e%8N$8p> $8p#0$<? 0!0$$(+= %w '% W@ !A6o( !$"(@ '+= %w '% W@ !An( !$"(@ ' % $( w7W@*!0!8!(%@ @H!P&!X'k!H%)!HiI% ) t'+" %w '%%'($@p+HJ @J!H#PW $P +% '%`% !$7W!$B$a#!@%  '!H(T U *!$)( H@PJ%@P  $h+p '!H.!P+x)J!x %L N %H0+ !x%+h"% 1  %1  % 1  %%I  += %w '%!$'($@p+HhA @J#PW $P !H#h!@%P '@p %@p!p.n o 1!`a %`̥J%K)` $`Kq+h%!p +xx !xΑ!h 2%p%+p% 1  % 1  % 1  %%I  += %w '4$* d8$d8?$  d8@$ d83`$,0($%8׀@ !##H# $! s( '$,40($(@'p+HH  '%I  <T!$< n!$>'  ' H'' ' '+= %w '$78"$p#$#$!$( ' ( ' ' $ ' '  '  '  '  ' ''+" %w pp'W8C$pD$E$B$H''!$ !$A'G'!$ !$A' ' H' ' ' ' H'''  '  ' H' ' ' '  '  '  ' H' r' 'H'( ' >'  ' H'' ' ''+" %w DD'$'X'!$ !$a% $'! ȐɐR %@HN ʐ\ %HiT %@ ʐZ %H+V %@Hʐ%H*ʐR %H*ʐT %H*Ɛ6%0%$(w %$+0D#D$7$0!0f$+8"$(4 }  ,04 } | 484 } t x<@4 } l pDH4 } d hLP4 } \ `TX4 }  |!(!H+0!0$H%8'@$8%8'?t!@ x!`K+H !H,!8+@!@($HK%PK'X$PK%H*O l!PKp!p+XK!Xn!H*+P*!Pj$X%`'h@$`%Xl_ d!`h!+h!h!Xl+`l!`$h%p'x$p%ho \!p`!+x!x!h+p!p$x%'$0%x!!#+!2!x+!0$#%#' $#%!b+C!d!!q+ ! D$q%q'$q%C!e+(e!('$07!0+8!8'$@G!B+ !2!@ +H !H)$B%B'P $J%"!K+PK!PL'X@$X_ !Xm+`m!`'h$ho !h+p!p.'x$/!x0+!'$ '! +!'`$(/!(+0!0'$8?!!+!2!8+@!@($)%)'H$)%!!"+"!J'H@$HIO !H++P+!P'X@$X_ !Xm+`m!`$(,048<@DHLPTX%hcJV%HILT%HIJ%#%C(`7D$+(C#Ce$/$(e!(%$'!f$+@'%1  %I  1  %I  '+" %w  '><@V!$ r' H'>@<!$ !@<`!$ !<@!$T>' n  $"G<`T F<$  $T$#<B$"F< P!$F<$F<<@T!$F<`F< G<,d  $<:$,dF<$ $+"(`F< G<0d  $<=$0dF<$ $+"`F< G<@4"  "<=B$4" '5  5  5  5  += %w 'h% (#,$P%T&x'|()*+ ,X-\./0123485&<5&`5T&d6&8&8&8&8&89@<&D<&<h<&l<&<<`u'!<"9' '`'!\`'!\\'!X m %h'$ =%8'$B}%x/$&3&Q'Bu%p$&I&2'@%$ș&h'Ȁ@ª%$&8'%$&p'$H8&H& %$&x'$t&&120'4-`/d.3)#$P#T$& &j')&H&&8-.&p&h/0&&xH3L4 &&vB%x'`B'% 'Ȁ@@ L %H<$8' <%8G$'@ ¨%$&v'h @w%h$p&p'%Q$<&H2' %x$&8'%'$b&#&$\&%'`$ & &x3$&hP$T#/1.6')H-L2#$& &j' )&H&&88-<.&p&hh/l0&&x34 &&v%'#%' `@ @?%8$'O %H"$ $'  n %h'$&v%p'$&b‘@%Q$&8' @~%x$&H0'%u$r&h'`$&Q&y%v$p&p'`$p&o& d)'. -8#<1h$l2"<(#,$& &jX'\)&H&&8-.&p&h/0&&x 3$4 &&v'% '%#'` =%8$'M %H"$9'  Bl %h$&'Bt%p$N&u'%2$<&8' z%x$&H0'B%&$&hM'$ & $B%Q&9$0&p' $p&(2,8X5\6)'.- #$$x#|$& &j')&0&&(')&H,&8@(D*&PK&@ p+t, &`&Xm@j@r%% 'h%'p`x/%($h'x7%0$p' %Q$x/&x' 8O %8'$H&Hi'B %'`$r&(TBBU %@H'P$&0P Bf %`$&0'$ & d&`B^ %XK$Pj&8'P`$j&&@nx'|0#$(,@)D/p&t%(#,$P'T(x*|+,-. 001&p.41&0X1&p.\1&01L&p.2H&P3&pn 3&p34`5d689<"12&xO&H)h1&H)l1&x/1&H)1&x/D 1$2H/&xL1&2&%&x2&xO2&Q2&xO2&Q@@0/%(E&(%—%0&0@@p%xO%p.1&#&&C&@8W,& & & d& @@%@ W%8&P&X&8,&h&h&h &h@ — &h<.&&&3&S@%& D—%2&#&xH&$L&C3&Hi@ ¯ &8)D&6@%&¯% &&@ &p&`&H/&mT&P&`'@'`;C%8''$%@'$j zBu%h$p&p&p'Be %`$x&x&x/'@ %$&8'@J %H3$2&@' %$3&h'`$PQ&P &%y$S&`'`$Xr&H+&XS/.('8,<-)*p+t1'(&@&8X)\*&PD&H#+,&`&Xt-.&p&hH2L3 &u&VB?%8'BG%@'@ @ T %P\$X'@L %HI$9' @ ¨ %$&'X @g %X$`b&` '` %x/$&PQ'o q%h$p&H.'p%'$8&8&x$<&%r'@$@&@&h2$p&Xn('X-\/,6)*H+L1x'|(&@&80)4*&PD&H#+,&`&Xth-l.&p&h 2$3 &u&V%'<C%8'@@ @ O %H<$9' W %PB$@H'@ ^ %Xv'`$|&f %`'$&‰ @~%x/$&H1'@n q%h$p&PN'p%U$Q&Xq'@$&x/&Y%V$pN&`'p@$8&8&@Hx*|)0,4+'/h(l1 "$6& W?<$& $:a"B$@!!#!B%a%a%a%a%a@ !p $#a!A%,E<4<@B$  E<,C$B!bB$E<0\4%8E<߄$dhlX'dhlX'$8F $8p$!8&P)@B$ H H A  @CE<߄$Bf@ B @<6&w`<c$&b``( %H)-  %P+HI  %P+H* $+H 04* $<U!$   40@<*$@H !HI(DHL8'+= %w ' 9) $($$%%%(c%0%8 02'%B$% @%@!%H%P&C`0$2'('+" %w '\XC `X'T'!$ !$X'4DAHDLB ":) @&\C3``@?)  @8<@B8<6&W@<B$&A ,\%< B$&A  "(!@G<8c$d G<8!$<@.!$&Q @(G<8c$<(V$& E<  $M@(G<8c$d G<8!$<@.!$&Q @(G<8c$`W)) D D' dhX'`W)) D D' dhX'W)) D D' dhX'$$%0c'0&8E<$! ! .$+(bw+Aq`#A#"$"<8$! ! $+(b<+A6`#A#"$"<ـB$!"04('%"8 @<!$0$4(' $  <$!(! b$+(b0+A*`#"#A$#< c$!#04(' $  ?$?`Sx,l$(<!$ $"?lph<=`Sxl$(<!$ $"?#$?TSlO`$(<!$ $"?`d\<=TSl`$(<!$ $"' n $"$<`! #$6<BJ ^ %H+\ d%Xb n%`% !@(&0!$*0% +0"!8#+@&(,0'%1  1  I  '+" %w ``'"8@!8 3k %%1  Q  += %w 'H#P7"$Cw$Wc$a !$ R P+@'>ip!p#$'!$7W!$B$aG<`'% %1  %%1  % %1  %%1  %1  1  '+" %w 'd$%%&(gj&0#02( +0$t$@p!P(pK%%`'%h% !$7W!$B$a+X`%!(#@G<`B$" "G<@h0 h$C  0$!#$$Ad% H"M@D!e ;,(< H D<`C!$ G<@HD  H"D#@"#<( ,o  G< h@h("  @#"(#dhP"@X"@B$"G<@h8 h,C  8$!#$,Alp`'<!$ $"<B$"<B$L$P@<!j) ( @<!$ ("G<@@  @""F8A)9 L)9 S)9 E)9& a9 l9 s9e9f8a8l8 s8 e8%%:4 $+88G-$8$'@'!$ !$ $+8b$' H %%1  %Q  += %w 'tw)  %%1  Q  += %w 'E<̑E<ȑ'$  '+= %w 'H"#`$  H" !(&8   #8-`Ap!87 Al!83 Aa!8/ Ai!8+ An!8' <a!$LHAG< (LA  (#!LCPTD' !8 $ & <`!$ <Dp8:@"@#$! @d6'  F<!$ $"<%B$" I'<'!$ !$< $$ $$8<@''!$7W!$B$ PTLP'& \'+= %X 'Ž(Co`C`c8"`PD"H#d$h!Rc$ $ $ '+= %X ' "'C'"Ž ! ''+" %w pp';<!4  $(;<!4  ,0$(c 84,0c  A "d& 7 $ e& $%$f&(% .!c Y $ (!$(!$.K*  D!$D!$rK*  !CB Y % '+= %w '"d&@"e& % f&(% @!b Y % '+= %w '"d&@"e& % f&(% @!b Y % '+= %w '"d&D,@"e& % f&(%#@"e&@b%&EB8@!b Y  !CB Y % '+= %w '"d&D,@"e& % f&(%#@"e&@b%&EB8@!b Y  !CB Y % '+= %w '"d&DB81@"d&$e& %(@ b $&B8"@b$& D$e& !c Y  !CB Y % '+= %w '"d&D@ " e&@!b Y  "c ! Y % '+= %w '"d&@b%&B8@ b %&EB8 @!b Y % '+= %w '"d&B88@b$&D3@ b $& D.!c Y $ "d& Dd%& !c Y  !CB Y % '+= %w '"d&@b$& D !c Y % '+= %w '"d&B8$@b$& D!c Y   " d& D% c! % '+= %w '"d&@!b Y  "d& D%  c ! % '+= %w 'i) '+= %w ' '+= %w '     '<3c$)$ av d <TB$  += %w '}M*  $M* '+= %w 'DLR^%0%8(%@j+HC \XT0, $.$?P''!$ !$AP'%S* P'@'$ S* P' \T*  C8 ` ' Y  <!$ $"% #+ #(E+E%(2%(4%(6%(#0# #' $ d&'`$b%!8D('I  % %I  += %w ',8*A`%=@ *"L (& #% E$!0e+ %!(+-`%%%4&($%(F$!8+ %!0+ % %% X* @'@'k$?@'$ ,k* P7@'$ jd* P pe*  "8 @ ' Y  <!$ $"B4$"S<9B4("^<%B4,",+<lB4("DLR^%0%8(%@j+HC P,| $%(%0:%0<%0>%0EF:%(6D%(<%0B%0>%(%0:%0 <%0 >%0E F:%(6D%(<%0B%0>%(%0:%0<%0>%0EF#":%(6!D%(<%0 B%0>%(%0:%0<%0>%0EF+*:%(6)D%(<%0(B%0>%('%0&:%0%<%0$>%0 E$F32:%(61D%0<%(0B%0>%(/%0.:%0-<%0,>%0(E,F;::%(69D%0<%(8B%0>%(7%06:%05<%04>%00E4FCB:%(6AD%0<%(@B%0>%(?%0>:%0=<%0<>%08E<F&(# $  *%4%,%2%f.%%0%2%f4%f&%dACE$('<!$ &$"<_B$"$?$@)$A$BCT$D&$EZ$FGc$HI$J$K$Lf$M$N$OP$QG$Rr$S;$T-$Up$VWXYZ.$[$\7$]$^_p'<'!$ !$A@$<p'/l* p'`'$ |r* p' s* @C8 ` ' Y  <!$ $"A$?< !8 $ ><0!$G<@!$ $ Y  <0c$ $ Y J`L@  $  Px* &($$*@H8FC < )%!@(FTJ1!PIJT %@ RJ1!PIJR %@H0!PIJ%(HC < )%C<0%#8#<,s@8!8&(<',f%!$*%`#%  '$8!8GB$F(!0C$<,F$0!0ƌ. '$*8*>C< %!8琀8C <))%!8'TJ1!PHJP C <-k%!PjJ&8GRJ1!PHJP C <1%!PJ&8G0!PHJP C <5%!PJ&0G C< %C <))%C <-k%C <1%C <5%!8A<,@%<$1  %<$1  <$%1  %<$1  %$1  м %<$1  <$1  % %1  %I  += %w '%( %0 :%0 <%0>%0J%8'FT %@HL %8'R %@HN %8'%@(J %@(L %@(&% $'!$7W!$B$a '<!$ $d <TB$  += %w ',"#04 8<@D $%* ,"#@/! d!0+!f$0%'(`$%F$# ('@- $#@!0!%#@!0a%!,!&' $!$+$s@$  $(,p* !@"-$!("s!" )B - $# !0!%# !0a%!,!&' $&!+as $  $(,p* !@"-$!("s!")>- $#!0!%#!0a%!,!&' $&!+as$  $(,p* !@"-$!("s!"KS'b'!$ !$a3'B'!$ !$a)`% %  $S'&8h|x  S'|x3'$  $(,p* $*A@$3'& C  '$% e  $% e  @$% e  $% e  <!$"$d <TB$  %(!0'8$(/!(E+!C<BJV%H*T\%PjZf%Xflrz%x%0%Q#'(")*+%, - . & / 01$+= %w 'O* ,'['!$ !$Ad7hW,'0$  $^X* `,'* $`A@\'+= %w 'O* `<*Ay@XCD<+(+ <&wc,$d%X`h `% 'O'!$ !$ '* X`hP`\  X`\ d߇* X"C0`$$#0+(#(#C+C#c$f,!F$0% '(@$ % #"@P* X"#B$"B,!C"lT'$lT'* @D('$M* ,0 ,04 8<m $@D('$88$!8&HH $ ,%%+= %w ', "E* @D('$M* ,04 8<m $@D('$88$!8&HH $ ,%%'+" %w '$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$"$#$$$%$&$'$($)$*$+$,$-$.$/$0$1$l2$m3$n4$o5$p6$q7$r8$s9$t:$u;$v<$w=$x>$y?$z@${A$|B$}C$~D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T $U $V $W $X $Y $Z $[ $\ $] $^ $_ $` $a $<b $=c $>d $?e $@f $Ag $Bh $Ci $Dj $Ek $Fl $Gm $Hn $Io $Jp $Kq $Lr $Ms $Nt $Ou $Pv $Qw $Rx$Sy$Tz$U{$V|$W}$X~$Y$Z$[$\$]$^$_$`$a$b$c$d$e$f$g$h$i$j$k$ $!"#$%$&'()$*+,$-.$/$0$1$23$4$5$678$9:$;',* l'<' p* ''!$ !$A' $ <'* '' $ Y  '<!$ $"'''!$ !$a B/%.4:BN%@ LT%H*R^%Pj !"#$%&'('<'!$ !$a,T0L($8<'4HD(' $~* @'+= %w ',';'!$ !$Alph`d\<$#8?0L!0D$#@G1P!(D$H%%PHDL@<'(-t7XW,'$ k* tt* L@< PHD,'$ $^X* @A, .( t7XW,'$ k* tt* L@< PHD,'$ $^X* T'$I  "#%b #%b #%bB$$* # $%"+= %w ' B/%e780BG%0FLRZf%Xdl%`jv%hv|%Q%r%t<=>?@ABCDEFGHIJK,';'!$ !$aL'l'!$ !$aPTL\`X$hl<'d,'L' $~* Wtx| ,'$ $^X* p'h'+" %w ' ' '!$ !$A ' $ $*  @ $('<!$ #$!$7W!$B$a $(' $$+= %w '\ "8|@`C$#c0X!ef:%(6gD%0<%(gB%0>%('8h%0hB%0hD%0c%f'0`%0GHnj&@g+8g-Ɍ+H$@ %8.$+%!#O* HLP TX\`d h$l(p,t0x4E* 8<@|D'h%0hB%0hD%0c%(%fHǐ$ǠŬìnj&(nj&'8'@`%8Fnj&@+8g-Ɍ+H$@ %8.$+%!#O* HLP TX\`d h$l(p,t0x4E* 8<@|D'%( G%0 G:%0 G<%0B%F(,04$!!!  $$0 0 0% @0 0C 0% !! (&,&00&(4&8 !$"(0@!AC  0(0% @( 0C 0 c0B0%C@ c0CB0%C8'!CF GB@BH?JB_Bg % %(%8i%B@ 0<&@ $LP8<"#!8'' X* < !$8B$@$*2>%0<D%8BN%@(D#$%!&'("$ $*2>%0<D%8BV%@H# $ % ! & '("@'+= %w '%%%(%0%8!$(( h i*8@ih%P#gfb e 'i@X F %8G&8g!8+@"6 a b2% .D%(4% B%(6% &$% *% ,% a%&A av* A, '$I  1  %1  += %w '048 <$$7(@ѝ* <(&"*`%'''!$ !$@# D'$ $$ #b8!dD($'& a  04' $ѝ* ,''+" %w '$$$$$$$$ $ $ $ $ $$$$x'(D)J *+b ^ .lt/~!!+!!x!+h!!XoD!+`o!!A+P`!*!!!*!!*!!*!+(&! !A!d+"!C!!!+a!"!+`!"!!"!!"!!" !S+3!"!a!+#!b!a !+a!"$!A+`!"(!a!",!a!"0!a!" !A+A4!a!b8!+C!a!b<!+b!A@''+" %w LL'''!$ !$a#$'!$7W!$B$at''!$ !$aT'p'!$ !$a4'P'!$ !$aw'* t'' * 't'* ' * T''* $ 0T'* 0!$"(@T'' * 4'T'* $ ,4'* ,!$"(@T'4' * % (T'* (!$"(@t'T' * T't'* $ $T'* $!$"(@'T' * T''* $  T'* !$"(@t'T' * T't'* $ T'* !$"(@'T' * T''* $ T'* !$0"(@'T' * T''* $ T'* !$"(@t'T' * % t'* !$a"(@'t' * ''!$7W!$B$a'$A@@$ AAA$A@+= %w '8'W'!$ !$Ad8'R* X \'7'!$ !$Ah'R* X&b@ \% %(%l`'!0DƐ!8$&0%($*00B$+= %w '8'W'!$ !$A'7'!$ !$A\'R*  B8@ %%%`X'! "8'!0EƐ& %dB$ D(b0B$#$!$7W!$B$a += %w '2<(L D8*Z V 4,-n 0.t,/z(0$1 3589< " # $." &<4 (JF*+^ ,d -j ./z13!!+!a!T!!+r!!!TQ!+x0!!+p !.!!.!!.!a+X1!+A!*+H*!@ !!0+8'!0!A! +(%! !d+ !d!C!D!!D!"+!!A A!+8!!a!+#!b!aA !+#!b$!b+ !C(!!C,!!C0!b+!!AA!A+A4!a !b8!+C!a!bB<!+C!a@!a+@!#D!!#H!!#L!a+B!"AP''+" %w ll't''!$ !$a#$t'!$7W!$B$aT'p'!$ !$a4'P'!$ !$awt'* t' ٽ* t'* t' ٽ* T't'* $ 0T'* 0!$"(@T't' ٽ* 4'T'* $ ,4'* ,!$"(@T'4' ٽ* % (T'* (!$"(@t'T' ٽ* T't'* T' ٽ* 4'T'* $ $4'* $!$"(@T'4' ٽ* %  T'* !$"(@t'T' ٽ* % T'* !$"(@T' ٽ* % T'* !$"(@T't' ٽ* % T'* !$/"(@t'T' ٽ* % t'* !$"(@t' ٽ* t''!$7W!$B$a'$A$CC @A@@@ @$@(@,@+= %w 'H'w'!$ !$AH'* x |'G'!$ !$A'* x&b@ |% %(%'!0DƐ!8$&0%($*00B$+= %w 'H'w'!$ !$A'G'!$ !$A|'* 0B8@ %%%x'! "H'!0EƐ& %dB$0D(b0B$,#$!$7W!$B$a += %w '<` !$ *  $('+= %w ' '8'!$ !$A@W '* D '+ DW% /$# a! !0"ǐŠ!$#(`H0$LP<'@'+" %w 'L0C8s`'<'!$ !$A' '!$ !$A''!$ !$A$$''' ;* 'O'!$ !$A' '* HLP ZW* @P''!$ !$AP'H& C0$  %3<!$ $"2*(L D)*Z V (,'-n &.t|%/zx$0t#10p"3,l!5(h 89d<`"\#X$.$"T&< 4P(JFL*+^ H,d D-j @.</z8143568 9 < " $,$ &:6()N *T +Z ,-v j /|1!!A+A!!!!+x0!!x!+h!!+`!,!a!,!A!,!!+H!)!+8(!0!! +(%! !a!D+#!b!+ !C!"!C!!C!+!!A !+5!b!a4!+#!C!a8!+#!C<!b+ !C@!!CD!!CH!b+!!A!A+AL!a !bP!+C!a$!bT!+C!aX!a+@!#\!!#`!!#d!a+B!"(!A+Ah!a,!bl!+C!a0!b p!+C!at!a+@!#x!!#|!!#!a+B!"$!A+A!a !b!+C!a!b(!+C!a!a+@!#!!#!!#!a+B!",'T'+" %w ''('!$ !$a0,#$'!$7W!$B$a''!$ !$a''!$ !$al''!$ !$a<'h'!$ !$a4w'* '4 ^* '* '4' ^* ''* $ 8'* 8!$"(@'' ^* ''* $ 4'* 4!$"(@'' ^* l''* $ 0l'* 0!$ "(@'l' ^* % ,'* ,!$"(@'' ^* ''* l'4' ^* 'l'* '4 ^* <''* $ (<'* (!$"(@l'<' ^* <'l'* $ $<'* $!$?"(@l'<' ^* <'l'* $  <'* !$~"(@l'<' ^* % l'* !$"(@'l' ^* % '* !$!"(@'' ^* % '* !$^"(@'' ^* % '* !$"(@'4 ^* 0'('!$7W!$B$a08,' <"     $ ( , 0 4 8 < @ D '+" %w \\'Z''!$ !$AZ'+  'Y'!$ !$A'+ &b@ % %(%'!0DƐ!8$&0%($*00B$'+" %w dd'Z''!$ !$A'Y'!$ !$A'+ BB8@ %%%'! "Z'!0EƐ& %dB$BD(b0B$D#$!$7W!$B$a += %w '<`!$ +  $('+= %w ' 'P'!$ !$AXW 'b`+ \ '^+ \W% A$# a! !0"ǐŠ!$!#(``B$dhT''+" %w <<'BC8h`|''!$ !$A4'x'!$ !$A'0'!$ !$A<|'4'' _+ 'a'!$ !$A|' '+  ZW* @b''!$ !$Ab'& CB$  %3<!$ $"a?a@b %AAa'+" %w 'A"P@$ ?%.>&4=':<(;)V J :+d \ 9-r n 8/ 7061524334L26H19D0" /#.$$-%*,&+'F@:*)T <L )+b 8^ (-'.v&/|%0$1#24"40!6, 9<"#|$x%6(*t'D$<p)R N l+,f h-l d.r`/\0X2T4689 < " #& %4, 'B>)*V +\ ,b -.~r02!!a+a!A!3!+Q!!0!+p!!+h!-!!-!a!-!A!-!! +@)!8!!(+0&!(!!!e+ $!!C+ !A!!A!"!A!!A !!+6!!aT!+#!b!a!X!+#!b\!b+ !A`!b!Ad!b!Ah!b!A! !A+Al!a$!bp!+C!#(!b"t!+C!#x!a+@!"|!a!"!a!"!a!"!,!A+A!a0!b!+C!a4!b "!+C!a!a+@!"!a!"!a!"!a!"$!8!A+A!a<!b!+C!a@!b("!+C!a!a+@!"!a!"!a!"!a!",! D!A+A!aH!b!+C!aL!b0"!+C!a!a+@!"!a!"!a!"!a!"4! !A+A!a!b!+C!a!b8"!+C!a!a+@!"!a!"!a!"!a!"<! P!A@!+"!AD!''+" %w <<'|''!$ !$aD#$|'!$7W!$B$a4'x'!$ !$aw|'|9+ |' + 4'|'|9+ $ 04'|9+ 0!$"(@|'4' + 4'|'|9+ $ ,4'|9+ ,!$"(@|'4' + 4'|'|9+ $ (4'|9+ (!$"(@|'4' + 4'|'|9+ $ $4'|9+ $!$"(@|'4' + 4'|'|9+ $  4'|9+ !$ "(@|'4' + 4'|'|9+ 4' + % 4'|9+ !$@"(@|'4' + 4'|'|9+ 4' + % 4'|9+ !$"(@|'4' + 4'|'|9+ 4' + % 4'|9+ !$"(@|'4' + % |'|9+ !$"(@|' + |''!$7W!$B$a'+= %w '<!$ <!$  $"" "    <!$ < b!$ G<@   "#$"#$ '+= %w '$ $! $"$#k$$$%$&$'2$($)$*$+J$,$-$.$/V$0$1$2"$34$45$6$78\$9$:!$;@! '$ l* $ 7$!c$"$#$$$%#$&$'L$("$)$*$+$,C$-u$.$/Z$0$1G$2d$3D$4$5$6$7$89~$:4$;@! '$ l* @"@$CC C@@@@D<'b%$!$7W!$B$b%$!$7W!$B$b$$!$7W!$B$ $'+" %w 'hd8KdH'8'!$ !$a''!$ !$a$''!$ !$a'L'P'T`b'8'!$7W!$B$bP$$!$7W!$B$bT$$!$7W!$B$ptx\'d9b8{@B8w@''!$ !$A'lB$$$ l* Y`D''!$ !$A'lB$dc$$ l* :@<De+ ptx\'`bD$$!$7W!$B$b<$$!$7W!$B$d$ ptx\'ptx\'ptx\'b8@C8`B8@|''!$ !$A|'lB$$$ l* @@\'x'!$ !$a\'+ H+ `@<'X'!$ !$AHW<' * ';'!$ !$AH '3* $+"n`d!!0 BB0&A!0Hd$X <'* `"@d$%(%!$7W!$B$HX!$7W!$B$a $"" "    ptx\'<!$ &$"<^B$"p$?D7 ' $ * O$ $!B$"$#$$$%$&$'$($)$*J$+|$,$-$.$/+$0$13$2W$3k$41$5^$67$8$9@$:h$;7$<$=Q$>$?D !$ ' $ * $D@AD@H@$LAPATA$XA\@H@'#$ D$<%$ &$@G$\($@)$!$7W!$B$a%%!$7W!$B$%% !$7W!$B$ ,'+" %w '`d8B\?'<'!$ !$a$$ $X C$@D$''!$7W!$B$%''!$7W!$B$a% '<'!$7W!$B$aXhlpT'\Ab8@B8|@''!$ !$A'dB$$ $ * ^`H''!$ !$A'dB$\!c$ $ * ?@@H+ hlpT'H#$X D$!$7W!$B$a@#$%!$7W!$B$a$X@DH$LPT$X\hlpT'hlpT'hlpT'!b8@C8`B8@''!$ !$A'dB$$ $ * @D`'|'!$ !$a`'\+ L+ d@@'\'!$ !$ALW@' ^* '?'!$ !$AL 'R* $+"r`\!!0 BB0&A!0Ld$P @'2* D"$X d$%(%!$7W!$B$%LP!$7W!$B$$@aD`H`$LaPaTa$Xa\`hlpT'<!$ &$"<_B$"h(L%8'D%0(J%8'F%0(%8(B%8(D%8!%''8  <6!`7&h,<6+`F <=56!p!`&p 'x<6$x<6&'$`%`g #`l+Xl#XKX<|a6!`C8$?U$@$A$B]$C$DE)$Fl$G:$HI^$JKr$Lv$M $N$OT! '0$  * 6$ $!$"J$#$$&$%,$&o$']$($)$*$+$,-$.)$/$0$1$2$3($4$5$6|$7$8$91$:$;$<$=$>$? $@`$A$B$CD~$E$F$Gz$HC$IJK$L$M$N_$OT! '0$  * T"$C$DD @C@@@ @$@(@,@XP'b,%$!$7W!$B$b,%$!$7W!$B$b,$$!$7W!$B$ '+" %w 'd8TQ''!$ !$ap''!$ !$a$p$tx@'l'!$ !$a'p'@'b''!$7W!$B$b,$$!$7W!$B$b,$$!$7W!$B$ 'ab8@B8|@'<'!$ !$A'B$$0$  * ^`' '!$ !$A'B$1c$0$  * ?@+  'b,$$!$7W!$B$b,$$!$7W!$B$d$$  $(, ' ' '1b8@C8`B8@''!$ !$A'B$$0$  * @''!$ !$a'5+ R+ e@P'|'!$ !$AWP' ;* 'O'!$ !$A '* /$+"s`!!0 /BB0&A!0,d$ P'-+ ",d$%(%!$7W!$B$!$7W!$B$a$"$## "   $ ( ,  '<!$ &$"<:_B$"$-$.f$/#$0$1$2B$3$4d$5$69$7$8?$9$:!$;$<($=$>`$?k$@M$A=$B$C$DK$E^$Fw$G$H$IY$JK$L$M$N'$O$P$Q$R$S3$TH$U$VWXj$YZ$[$\~$]^1$_$`$a$bchB"'B$ A+ $"$#9$$)$%j$&x$'$(;$)$*$+\$,$-_$.$/,$0}$1$2$3$4$5D$6I$7W$8$9:h$;$<$=$>?'$@>$Af$BC$D$Er$F$G^$H$I&$J@$K$LP$M$NO?$P$Q$Ra$S5$T<$Up$V$W$XY$Z[$\$]$^v$_$`$abchB"'B$ A+ hC`<d` ````` `$`(`,`0`4`8`<`@`D`ld'bD%$!$7W!$B$bD%$!$7W!$B$bD$$!$7W!$B$ '+" %w <<'d8IF\''!$ !$a'X'!$ !$a<''!$ !$a\'''b\''!$7W!$B$bD$$!$7W!$B$bD$$!$7W!$B$'b8@B8@''!$ !$A'B$$B$ A+ c`<''!$ !$A<'B$Cc$B$ A+ D@+ 'bD$$!$7W!$B$bD$$!$7W!$B$d<  $(,048<@D'''Cb8@C8`B8@'8'!$ !$A'B$$B$ A+ @''!$ !$a'+ + j@d''!$ !$AWd' _+ "'c'!$ !$A"'+ A$+"x`!!0 ABB0&A!0Dd$ d'+ "Dd$%(%!$7W!$B$!$7W!$B$a <"     $ ( , 0 4 8 < @ D '<!$ &$"<`_B$"$%$&a$'$($)$*$+$,-!$.$/$0$1@$2$3$4$5r$6[$7$8$9$:$;$<$=$>$?@$A $B$CV$D$E9$FG$H~$I$J{$K$LR$M$N$O;$P$Q$R$S5$Ts$U$V$W=$X,$Y4$Z[$\E$]^$_k$`P$a?$bc"'B$ A+ G<@F<  !"F<d'd'+" %w '$%$&$'$($)$*k$+$,$--$.$/$0$1$2n$3$4$5A$6$7$8$9$:$;P$<$=$>Z$?$@V$A9$B$C$D.$E$F$G*$H$I$J$K$L$MN$O '0$  * G<@F<  !"F<P''+" %w ,,'<`!$ G<@F<  !"F<ᮄ''!$ !$AT''!$ !$A$T$X\dhlptx|$'P'!$ !$A'T'$''M+ %+ + + + !$`#(u`<$Ap $;'$<$=`$>K$? ' $ * G<@F<  !"F<@'+= %w '$$$$$$)$$E$%\$%%*$%=$%$F#8$?#d$@#A"B$F($?(@%()$*$+@$,s$-.$/j$0$1$21$3-$4$$5$6$78H$9:;i$<$=$>$?$@5$AB$C$Dv$E$FG%x''!$ !$a $H$|<^ c$xd't'!$ !$$hdA$ptlL'`'!$ !$A$PL<5!$TF%8% ,0[ c=%8LQ %PZf%Xldl%`jv%hr| %2 %r %t   %%ș% HD %"@ %"< %A84X HD@<L84\ $`dP'+= %w '8'W'!$ !$Ah8'+ X \'7'!$ !$Ad'+ X&b@ \% %(%l`'!0DƐ!8$&0%($*00B$"#&(E&0f #@$(&E+H?#8#8$0&f"#&E&" #&(E$( &0f$0&&E" # &f&E %&$H&&$&0&(%&&&"#&(E$(&0f$0&&"#&f&E "$# &(E$($&0f$0&& "$# $&F&% $+= %w '8'\'!$ !$AF<8'l + `'7'!$ !$Al'+ P@`"#l 0#@$'H$(%%E+(?#8#($'8$0%fh¬ì"$ #$$P*%B ¬$%C ¬"$#$$P*%B¬$%C¬"$#$$P*%B¬$%C¬ "$$!$ $#%b$ ¬$%A$pd'%%1  += %w 'l"!p -+ XPT\l" !p -+ H@DLl"!p -+ 804<l"!p -+ ( $,l "$!p -+ $`P!0Fh+ p`! T! !@X!DD\!(+D! 0H!D4L!(+D!E 8!D$<!(+D!E(!" ,!d+"!#$td'+= %w '(,0 }  4<6$w8@@# %"%D<@$''+" %w \\'`''!$ !$A8'\'!$ !$A'4'!$ !$A`';+ 8'`';+ 8';+ 8' + `'8' + `';+ `'8' + 8'`';+ $ 8';+ !$"(@`'8' + 8'`';+ $ 8';+ !$ "(@8'`' + '8';+ $ ';+ !$"(@8'' + 8';+ $ 8';+ !$ "(@`'8' + 8'`';+ $ 8';+ !$2"(@8'`' + '8';+ $ ';+ !$d"(@8'' + 8';+ $ 8';+ !$2"(@`'8' + `';+ `';+ `' + ' '+" %w ' '0'!$ !$A''!$ !$A';+ ''!$ !$A '' + '| ' + ''!$ !$A '';+ '' ' + l''!$ !$A ''W+ l''+ D'h'!$ !$A 'l';+ D' ' + '@'!$ !$AF<'| + pD'|`+ D'p`+ F<%DD 'p + D' '`+ H'l'!$ !$aF<%D# @'(<+ ##D8'@4H'l' + H@$CL8$ l<$0%Fp4$0% lpP$CT$ t$0%Fxt$%xX$C\$ |$0%|$%D`$Cd$ $0%$%Dh$Cl$$ %$%Cxl'+ xDt'+= %w '8<@ D}  (!,!8+(E!($8%'0$%0!&4! +0&! !a+#!dHLPT$'+= %w '8!A+b<(B7%(!(!E@(!+(%@%b!D!@ D}  (!,!8+(E!($8%'0$%g0!&4! +0&! !a+#!dHLPT$'+= %w 'D@@@%A8 !(+ <8BG%8!8! @8!+8G@ /% ! !  }  (!,!8+(E!($8%'0$%g0!&4! +0&! !a+#!dHLPT$''+" %w PP'"#$x $|$p$t$h$l $`$!d$\%X&P &T&H&L&@&D &8$!< }   x|8< + $(,0 pt@D + $(,0 hlHL + $(,0 `dPT + $(,0<6$ 7@@#%C %$P T}   x|X\ + $(,0 pt8< + $(,0 hl@D + $(,0 `dHL + $(,0<6$(W!(!04+!%<6$(7 @ @#%a %$H L}   x|PT + $(,0 ptX\ + $(,0 hl8< + $(,0 `d@D + $(,0<6$(W!0!(+!%<6$(7!0+0!( @ @#%a %$@ D}   x|HL + $(,0 ptPT + $(,0 hlX\ + $(,0 `d8< + $(,0<6$(W!0!(+!%<6$(7!0+0!( @ @#%a %$8 <}   x|@D + $(,0 ptHL + $(,0 hlPT + $(,0 `dX\ + $(,0<6$(W!(!0+!%,<6$7!0+8!@#@;%d%G !8+ @BO%@(!@! @@!!H"+P"+H@ ?% !!C!C!B<6$W4! D+!G8!@+8@P!(E!X%+Hi+(@8G%8!(!!#  $''+" %w pp'"#$L %P&D&H&<&@ &4$!8@T@7%&@@'%$ }   LP48 O+ $(,0 DH<@ O+ $(,0<6$ 7|@@#%Cx %$tTL P}   DH48 O+ $(,0 <@ + $(,0<6$(Wt!0tx!(+!%<6$(7x p@ @#%al %$hTD H}   LP + $(,0 <@48 O+ $(,0<6$(Wh!0l!(+!%<6$(7p!0p+0!(d l@ @#%ah %$`T< @}   DH + $(,0 48 + $(,0<6$(Wh!(`!0+!%<6$(7l!0l+0!(\ h@ @#%a` %$XT4 8}   <@ + $(,0 DH + $(,0<6$(W`!(X!0+!%,<6$7h!0+8!@#@;%d%G !8+ @BO%@(!@! @@!!H"+P"+H@ ?% !!C|!C!J<6$Wt! D+x!G8!@+8@P!(E!X%+Hi+(@8G%8!(!!# pdl\ $'+= %w 'F< O* ,!04 8>+  $<@DHL('+= %w '0"4d& !c Y  4"8d& u!c Y k 4 "B8P@06 ,8C DB  3 $,V$B4dec  @  <@DHL(',6$!$  <@DHL('<@DHL('<!$ /$" +b #(%0 8!@ !8&8$8&8'$*84$'A  ` !h!x&$&p!`!+p!0+0' #h,#h$L&`,'`$`%`L!H_ J%*`BA  A  A  %A  += %w '( *0b*8F%0+8fv   ( +0be @I80 ($d ''!$ !$!@Ht $*PI@$ '$$$$$$)$$E$%\$%%*$%=$%$F#8$?#d$@#A"B$F$?@$ABy$CK$DE$F$GH`$I$JKL$MNN$O0'$$?$@$AG$Bp$C$D$E$FG$H$I$JK;$LMNO0'F#?"@%A$ bbG<@b  !"a" $?"@$'"#! 7" #! += %w 'F+00!0ƌ1`dhlP'$O+0x0!0ƌBX6 HX!@+ T H  @`dhlP'$+8!8@ , @ $!HI) $#XEHi k- H %@  $%(% %U%%1  46&W`<` B$&" `dH p!0|!0i$q

46&W`<` B$&"& "H dp! |! !${<-66&W@

46&W`<` B$&" `dH p!0|!0i$q

46&W`<` B$&"& "H dp! |! !${<-66&W@

!$PlTpXd\!hP' &, Z 4dŽ @h!< ,(4+ 8$ <!$ hCD#G<`<8  $<#8%0$, $($#$# #%dcR$? ' $ + G<@F<  !"F<<@!$ % '?'!$ !$a$  ' $ R, G<@F<  !"F<<@!$ X$ f$!"#$%&'()*+,-./0123456789:;<=>? ' $ R, G<@F<  !"F<<@!$ F< &+ G<@F<  !"F<7W(#$p(C$P#$lPC$|x#$hxC$xFh,  '+= %w '7Ww `,  '#$!$7W!$B$a += %w 'P@!8 <!$ 2$"<B$"X(L%8'D%0(J%8'F%0(%8(B%8(D%8(F%8()R %@ N *\ %HiT %@H*Z %HiV %@H*%HI*R %HI*T %HI!%)C<@C%8*'!$'($($@ , ( , @ $#H# )-  %h$i$ -!H*%%% *,{@?*0@ $#`di+`L-` 8'!`#x`LNR%pN J- ` - %` O. p %P3-r` 8'!`#O`LS%xo T- ` s. x . %`% %`-Vh !h#j#hMoOV&x R. h  r. %h . x%h%-%P8'$` $PH!PB+pBO1-!`1*$'Bp+x&`-Bp%p+pN$`%`'!p,ʡ%'!p,#PEʡ$!P$l''!$7W!$B$l''!$7W!$B$`'$$5  % $5  % $5  <@!$$d <TB$  ?0!$ %(%8'!(#$>?A#0!$!(#!0?#(`'8'!$7W!$B$'8'!$7W!$B$x'< !$!$d <TB$  1  X'+" %w '0" "" "$"""!4dc }  4"! } lp 4" ! } H L4"! }  H!E$L!8+E!G $(% '@$%!(!@+ ! !E+E!$ %('@$%l!(p!@+ ! !E+E!D$ %('@$%! D@+! T<~!4 <!4}   <}   <֜!4 2<(L D8*Z V 4,-n 0.t,/z(0$1 3589< " # $." &<4 (JF*+^ ,d -j ./z13!!+!a!T!!+r!!!TQ!+x0!!+p !.!!.!!.!a+X1!+A!*+H*!@ !!0+8'!0!A! +(%! !d+ !d!C!D!!D!"+!!A A!+8!!a!+#!b!aA !+#!b$!b+ !C(!!C,!!C0!b+!!AA!A+A4!a !b8!+C!a!bB<!+C!a@!a+@!#D!!#H!!#L!a+B!"AP'+= %w 'H<!$! H<!$<=!$&Q G<!$ ''+" %w <<'s, `, H''G'!$7W!$B$aH''!$ !$A'D'!$ !$A0''!$ !$A','!$ !$AF<᎜#$'!$7W!$B$a','!$7W!$B$a$$p!#H'!CBH' ;w, 'H' &W, '7T, "$@C( `7!CC d,(#$P$$$%$L&$t'$0'!$7W!$B$X'%!$7W!$B$'%!$7W!$B$'0'dX, 0''S, '0'dX, 0''S, '0'dX, 0''S, '0'dX, '7T, %$Dp!bH'!#!H' ;w, 'H' &W, '7T, !$@$( w'! $C  ,'% $1  % $1  += %w 'GZ, ''+" %w TT' ''!$ !$aF<᎜#$ '!$7W!$B$aGs, '?'!$ !$a ' R,  C(` $ d$ &0   D,A$B$# B0! $( $`c$& C  ' $I  s, H''!$ !$A@$H'/l* % @G<B$H' |r* H''$ |r*  G<!$H' |r*  B$c''!$ !$Ac' R, H' |r* H' $ |r* H' |r* ''!$ !$AH'' @$s* ('D'!$ !$(' l[, p@@c$'$'!$ !$' Z,  d,VC'b'!$ !$AC' R,  C(` $ &(   C,1`c$# c0B$!#'B'!$ !$A#'6^, * C% & a  ' $I  $A  , <!$ -$"$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N $O0$13$2$30 $4,$56$78 $9:X $; $<$=}$>$?*$@$A$Bc$Cr$D$E7 $FG$HIJ$K$L+$M$N$Ov$P>$QR$S$T $UVt $Wi $Xb$Y'$Z$[$$\$]$^_ $`a? $b$cM$d$ef $gh-$i $jk$l|$m$n $o $p $q# $rg$s9$t.$u$v$wS$x$yz5 ${|}^$~$$$$$$C$=$$p$$\$$$$y$$$$$a $! $; $ $ $$$<$6$$$$G$O$B$$e $ $ $ $Q $0 $@ $2$q$$$$$$$$$$$$$M $ $ $4 $$$ $n$m$$$$ $ $N $ $$$$$$Z$$,$$T$x$$'$E$ $ $ $ $ s$"$$$$ $R$$o$F$$$ !"]$#$$$%$&$'$($)v$*+,-./X?@$A$B-$CDEF$G$HIJ$K$L$MNO^$P$Q$R5$Sc$T$UVl$W$X$Y $Z $[> $\ $] $^Y $_] $` $a $b= $cd $e $f# $g $hi $jk $lm9 $nop$q$rst $uv $wu $x $y $z{|n $} $~$w$$$$$}$I$$|$$$$$$F$$2$$$e$$'$ +  $?e $@W $A$BCI$DED $FG$HIJKLM$N$OPQV$RSC $TO $UV $WXY$Z[$\]$]S$^ $_j $` $a! $b? $cde$fu$g$h$ijkl*$m$noU$pq$rst$u$v$wx$yz$zx${$|~$}w$~$m$$$d$1$$$a$$:$$$$$$$$$"$}$$ $'$ #+ $$$%W$&$'8$(/$)#$*+$+6$,$-$.7$/$0$1&$2$3$4$5N$6$7$89$:H$;$<$=$>$?]$@$A$B$CB$D$EF$G$H-$I.$J$K($L$M $N$Oy$P$Q>$Ro$S|$T $U $V $W $Xr $YZ $[\D $]; $^_$`ab$ci$d$e$f$g$h$i $j@ $k $l $mn$opY$q$r$s$t0$uv[$wx$y$zc${|$}~\$$$$A$}$$$s$K $ $O $: $, $f $$$$L$S$$G$E$$e$$$'$ + $$$%$&$'$($)$*x$+$,$-[$.$/0 $1$2R$3$45$6#$7$8&$9$:$;$<U$=*$>V$?$@?$AJ$Bd$C!$D$E $FG $HI= $Jl $K $LM$N$O$PQ$R$S$T$U$V~$WX$YA$Z^$[\$]^H $_ $`Z $a $b $ck $dT $e $f $g9 $hij,$kl_ $m $nopr$q$r$s$t$uM $vY $w@ $x $yE $zu ${ $|0 $}~ $X$$W$>$K$$$h$$$$%$+$$$$$$$$$8$]$`$$o$$'$ + C $?@ $A $BK $C $D $E $F$G$H_$I$JQ$K4$LM$N$O$P$QRh$STo$U$Vx$W$Xy$Y$Z$[\B$]$^_$`i$ab'$cd$e$f5$g$hi$j$k$l$mnP$o$pW $qu $r $sO $tuv$wx{$y3$z7${|$}$~z$E$$$$D$$$$U$+$ $$$$$b$$$ $/$g$$$8$$$$'$ #+ < !$  $"$#T$$$%#$%$%L$%U$&{$ &J$ &$ &$ &O$ &W$&$&$&$&$&k$&$&$'$( $)7 $* $** $* $*r $+v $+ $+ $ ,Q $!, $"-#($ %#$&#}$'($(($)(d $*- $+-t $,- $--$..\$/.$0/1%2$$3$($4$q$5%$6/$70n$809.:(;*h$<(/ $=* $>*?($@($A(B-$C(X$D($E(C$F($G($H($I(D$J($K(o$L( $M* $N* $O*P)G $Q*R/ $S*T%U&$V%l$W%X'I$Y%$Z%$[%\,'$]&i$^'4$_'$`'$a'x$b'w$c'd)e+- $f) $g) $h) $i) $j)9 $k)l#]$m#B$n#$o#p"q(p$r"s$ $t"N$u"v%|$w"$x"y&$z"${"$|"}'.$~"e$"< !$ $"$#$#z$#{$#$#F$#_$#$$$ $~$ %$ &$ &$ & '$&1$&$&$'$'$'b$'a$'9$'$(* $)[ $)P $)# $#3$#& %$!#$"%$#&( $$* $%*I $&* $'*H $(*o $)*; $**K $+*= $,*S $-* $.* $/* $0*v $1*0 $2*! $3* $4* $5*, $6* $7+ $8+4 $9, $:,f $;, $<, $=, $>,?(@%Y$A% $B,C $C, $D, $E, $F,G$$H$$I$J+$K$$L$$M$$N$O#P"$Q"\$R"$S"T*$U"$V"$W"$X"B$Y#Z#$[$p$\$$]$$^$$_$`)$a$J$b$$c$N$d$$e$m$f$g"$h"$i"5$j"$k"l($m"n%$o"r$p"$q"$r"d$s"t#k$u"?$v"w&$x"y)z$${#R$|#}'$~#"<f!$ G< @)  "#$ %&'("<B4"# $%,&$""'$"(" ($0"''+" %w \\' "(@O* "( @!"$$W#"B8@$M* <!$ $"@$|x<B4"$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N $O* 8 #C/ +@dd E,$F $b` ,  0 0"8@"$$t't' %%1  % Q  !$B@@!"\%1  м % %A  %A  %1  %1  1  4'+" %w '< d!$ 0PTX +  ,''!$ !$HD@$H'@$Œ*8bA%%+8a?   @$,$H+8-D$w$xy7$z${<'$ Mx iT L %8G%0& $+P"&@jZ V %0F%8g $+XB`' '!$7W!$B$' '!$7W!$B$ '% %1  % %1  %%1  %%1  %%1  '+" %w tt'''!$ !$A''!$ !$A$p@$x$t' jd* ''$ jd* #''!$ !$A'#'$  k* ''!$ !$A%1#'!c.7?0BG1O)1VJ1^k1B.0c0@`'!`!ec0!(j0*$@P !PM!@(1!00#e#(47 $0p!f470p!(E!$#( `!aCd,'''!$7W!$B$a''!$7W!$B$a'%$1  t'+" %w '''!$ !$a ' '!$ !$a%4 0 '! @P C< R&!PJJ!( rHq8r!8'HJ hn %HH.q#8i%)1H*q!H3PR X^ %PjPNq#H**%T W POq!H*)%$T W POq!8$!$$(&@ %$@('!8'!H)W!PACP X'q $hj pv%h $hq#Xmm%l o  $hq!!!XmM-' '!$7W!$B$a' '!$7W!$B$a '% $1  += %w '''!$ !$$$'! C$(%'''!$7W!$B$a''!$7W!$B$a '@ !dB$d(D,d@ !(aC< $! $+@W+@P@@i$O $@(!H%'!@ +XB`+X%;`@H$/$(!(%H-@X !`e!Xhn%xhq$%0 $r#h%‡ $r!h#p %‡r!p %l!`%l o hq!`%l)%*X!`%% I  % %9  %%I  %%9  %$1  += %w '''!$ !$$$@$*(%;%@'!e $(p$@BHN %@( $@ q#($DG $@ q!($e!$#(`'''!$7W!$B$a''!$7W!$B$a '@(!B$e(E,`@(!0#C< $!($+HS +HL @Hj$W $HI!P'!H++` >+`F7@P$7$0!0%P)@` !h!`!x%% $2r!x%#h %1hq$xz%x $xr#h%|xq!h%J%*`A%% I  % %9  %%I  %%9  %%1  X'+" %w '<':'!$ !$A@'$'!$ !$A$  $$@',0 4jd* 8:9;@':'$ jd* <':'!$ !$A"'9'!$ !$a$%!$$(<@'"'$  k* :'<%$+(p#(&$7$0&"'!0$+Ha %$ɐƐ2%0+HU  $#P!+$_ $(!(+X G`0*%( J- @j,8@0@P<'!PKFc$<'f(,-0 ,f,@0!0Ťc$e(% <':'!$7W!$B$a<'% !$7W!$B$a('%$1  %$1  %% 1  $%I  %%1  %I  P'+" %w '%@<8( 4@$@2!%$%0 '!$7W!$B$<Х$ ' ''!$7W!$B$a%,  $%(47 e$+0E( $* O* PL(' ,  $TX\`dhH't'+" %w ',''!$ !$AH$@$$W,' $ jd* W,' B$ $ jd* ,' pe*  b,-@ D,&(c$B$# ' 0!$@$ 0,  $ $ ($(,0 ' $I  $A  t'+" %w 'C8)`,''!$ !$a$ $$,' jd* W,' B$ $pe* % <!$ '$" $? $@ $A $B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z$[$\$]$^$_$`$hi$jklt$mnov$pqr$s$tuv$wx$yz{b$|}$~y$m$$$(';'!$ !$A(''' 1, '&'!$ !$A'h''!$7W!$B$a'''!$7W!$B$a(''5'!$7W!$B$a('g'!$ !$A(''' ,  $;;(' ),  ;; $8$;;;h' Y  ; "8@% ;h' Y  ;;;'<!$ $"$?t$@.$AI$BC$C$D$EFj$G*$H$I$J$K$L$MN#$OV$Pn$Q$R[$S< !$< 6!$ },  , , d<@!$ h%S* hT'$ S* d "#$!<0$ $1$2$345L$6$7$8D$9$:u$;$<$=$>|$?^$@AK$BCO$D$E$FG$H$IJ]$KL$M$N$O$P$Q$RST$U`$VWXh$YZI$[$\$]$^$_<'B$< 6B$ $`' ,, (0"8 @$0' Y  <!$ $">'>(>X)>cwbwwrstrwhsscctbrtwescmllccfrcszrrcpfdoNNN0NtN0NN\N(NNPNNNNNN`NNN$NNNN0NNNNxNNNNNOOpOrewe\)%)\()CA@oJc6|- Ph6|-ԫ Gr6|-THISi$6|->F6|-d`?6|-t~v^6|-t`HWQ6|-@ x6|-a@c{,6|-HPG6|-d6|-t?e/6|-4ZD6|-C@96|-] IKK6|-͠ ~y6|-+6|-TIZ,6|-c6|-4In6|-5@dM96|-H@JR6|-fJ̃͝6|-`@6|-@`g{O6|-d)X6|-t@ekS6|-K_!6|-s9ك6|-6|-gZ.6|-  8jM6|-s6|-ra`K n6|-aeP6|-QA6|-a#6|->@9|6|-~5RPW6|- JL66|-a.6|-06|-2Kn6|- LJn6|-a m+6|-rbL36|-L*6|-bb S_NH6|-& u6|-=f 36|-Ki6|-T<6|-^U76|-:X{S6|-`B޹6|-v`]6|-N$8 6|- OPa6|-sOa6|-B,6|-6|-oOG'6|-c@RB^6|-}RM6|-@^]6|-d7`Q76|-Q<6|- '~6|-w {"w 6|-bc R5f6|-Lĵ6|-C@X6|-u@hsX6|-r[6|-uR WP6|- `Df*%6|-̬ 6|-TRg6|- xRz6|-nse6|-@ 6Cd6|-#x@Sx*ld6|-DƮ6|-S;l6|-L`EH~6|-cE.6|-0?gdFe6|-T@Yo6|-4`q6|-c Q6|-!86|-t`!63D6|-4!&S6|-c`F6|-T؟6|-4`F6$6|-xF y6|-_x;6|-86|-5V;$6|-`W4\6|-=" "_I6|-MWc6|-i`H';6|-Q"HRZ6|-H ^6|-ȲSmw6|-$6|-d"ly6|-"}F6|-N )'6|-o XЬ6|-X;6|-!ZrJ6|-Y@#躿6|-jYjNP6|-5#6|-FOT|)6|-A%@TJ 6|-5T <6|-5Tcw6|-XOU=!6|- 5@Uu6|-aOU++6|-(5Ux6|-jOVgE6|-@V#6|-H%Vip6|-=kVM.6|-0Wr.6|-@W86|-GkW]r6|-QkW)6|-O%XS6|- @X;p6|-6H6|-+cy6|-eP$m6|-kf6|-|ZWc6|-~ /Q6|-"`Z6|- NI6|-Zx~6|-եL]6|-9X?K6|-4N:&o16|-6@m26|-e[S6|-e`A6|-KA6|-^:16|-^N`L* 6|-f\?86|-}eW|-LH6|-] 26|-rf8ս6|-^ t;6|-8XTj6|-v ӷ6|-N@_4q6|-*^wW|-v`MȈR6|-BD`6|-#YS6|-8rr6|- $`nԩ6|-8@Yq6|-z@l:6|-M(6|-$Y#Wi6|-x@CX*\I6|-N@s R6|-``% Ҡ6|-`Nu6|-6|- lx 6|-`mn6|-uYT6|-ba*W6|-7w  :s6|-@btn6|-OZ@v06|-W=6|-qw@ZE6|-3`$u6|-OO%$6|-wZ 6|-wZ6|-w[k6|-$;젃6|-D8#Q6|-r  A16|-$b\M`6|-0OcW6|-g@#m6|-#Q6|-~9 dr6|-$!j6|-@[Wgv6|-xQq6|-`;6|-Wd'U6|-9`R)6|-9@o1A6|-eƠWO6|-*oܱ6|-9`fCi6|-f߃A6|-f\6|-Of6|-)[k 6|-:g=C6|-K@h6|-b 虐.6|-Phf~6|-\`iW! 6|-m6|-~@ E6|-{r6|-oO`S?ʶ 6|-ti}<6|-9 %06|-7f6|-S0Lo6|-@IY6|-( @k46|-:A6|-`Tl6|-%y 6|-Zւ [6|-: -56|-%7&6|-?k6|-=' )q6|-\ OKZ6|-PҲ6|-Y`$H6|-Y$ 9*6|-w [6|-y'  sg6|-' %0)d6|-P[KAn6|-%䂻6|-%̯96|-Z[6|-ɩU;6|-ڔdWة6|-Q#-6|-"jm06|-m46|-(Q& Y,6|-@rkW6|-'믋'6|-@n_c6|-n6|-<@&ҫj6|-&b6|-H`WmP6|-'~'{Ym6|-< ٥6|-jG*`6|-L'M 6|-66|-e`'B?"56|-S{9ґ6|-+'|b6|-A([~6|-<\d6|-H (v6|-<(T6|-h`F.}6|-5װc6|-`6|-ƪ@)O6|-2k`'cO6|-[)6|-Q*0Wj6|-'^ 6|-\"6|- (e6|- F"6|-R>y8 6|-~`*W46|-*K6|-% +>[6|-+Rj6|-,@s76|-=ps3U6|-}(pxD6|-4`6|-Rk+C6|-@qto6|-(y!q6|-$R`og6|-= h{ 6|-ʕQh6|-@)-6|--`]WL6|-(K36|-Iw6|-zt@,}/6|-`r"6|-r 6|-E)@66|-k@\C6|-? 446|-Y)\c6|-\@{Jo6|-_<+@6|-\^6|-.{ 6|-hrH66|-h{`Y6|-s >#6|-{@v`76|-ds+Z6|-Bm,V_6|- *=X 6|-Z$m6|-׬u#q6|-mv}c6|-]*-GAO6|-2? +ɠ6|-?M_6|-X  6|-q*HU6|-$ @J6|-J`-6|-@wHY6|-'w'˿z6|-\x166|-|-yV6|-kv6|-BxA*6|-a+nl6|-HB .LPG6|-rn.N/^6|-V./6|-U@/?6|-n/A~CR6|-0J6|-`0H=B6|-06|-g 1 ь6|-Τx6|-|1|׋6|-]<$&6|-1 46|-@2Y6|-@]"6|-T@,V6|--U2f6|-s,i6|-+K6|-,_T6|-!3Bv[6|-,]6|-T-6|-^y}406|-] iC6|-),`3S'6|-3RL6|-z06|-:y W6|-S@w$6|-``6Vc6|- 4uq,6|--4#D&6|-}EE6|-U`{]6|-U iI6|-ί{P6|-&^ |j6|-}6|-~`'P6|-^^`- z݄6|-A-`{26|-@{$[6|-; `aT6|-}-@| C6|--|EeM6|--@}_6|--{6|-V|aD6|-|g6|-G6|-tC@}G6|-P~Q6|-S0"6|->Vb9n+6|-!YIgu>6|-~.-+6|-H v6|-._p6|-ڲ^ig6|-@^,6|- `S6|-d6|- ;6|-6|-d6|-N?6|-^@؆6|->mC6|-Hum6|-!/@5B6|-2p/&#>6|-5/!M6|-0g/6|-U8O6|-8Η6|-dK6|-sD^-6|-`06|-ʝ`e2у6|-D ' 6|-/(6|-c6|- p6|-5u6|-6י6|-p0hu6|-p`6yF6|-66|- 76|-7V6|-p1\6|-01c`6|-WR6|-p@2ur6|-77C6|-p@8lf6|-A2/6|-p8mL!6|-p9݆6|-R3_:6|-`30vv46|-6|-t '6|-(dj-6|-@T6|-2q`9,a6|-'E p6|-`̭M6|-3h6 6|-/9uG6|-/ :Bk6|-ɞ:3" 6|-ڞ:Z\'6|-hF6|-ur;6|-6k%@6|-rq־<6|- o>6|- @36|-6X_4f 6|-0@=16|-@rQD6|-$,6|-Q bG6|-j a"6|-p)6|-qF 4K6|-@_(?6|->*rE6|-"rJ06|-;`[36|-u0`m6|-_Wl6|-_w,6|- n6|-ٟ S6|-BrW5&6|-@Յ&6|-?J6|-A 6|-5c-?6|-\6|-!@XI̳6|-! Vt6|-&m6|-Ba?66|- aǡ6|-F 6fc6|-Vn6|-`d6|-`n<<6|-)1 ^/6|-=1*"6|-Y HM6|-n;k6|- 6|- ZuY6|-r ?M)6|- j>6|-  O6|-GY ml6|-=6|-k6|-1o YU6|-@06|-`o_6|-qY@`6|-@DŽ6|-6|-0`[6|-}2G76|-`H36|-v<76|-`q6|-a0?6|-@a"6|-a6|-pG-\6|-a=1 6|-vm6|-ɛq$r%6|-Hb0Έ6|-@b;|-Sxl|-s 6|-i[`>o6|-L 6|-mO6|-Νę=6|-m@i6|-a<-Z6|-t`<~j6|-@86n6|-"u*46|-,rS86|-[@i(@6|-J>#6|-?6|-bu<d6|-ruitu6|-#sK6|-a CUi6|-"#6|-a@S6|-`t6|-#[Lod6|-6|-&\[HI,&6|-;\@\P~6|-z`vzP6|-Xқ6|-@> o06|-u86|-`wϑ)6|-\YJ06|- )s6|-`x 6|-K)sB6|-E@' 6|-%6|-`yn6|-h6|-<`>6|-*]66|-;@c6|-4yP6|-0 VǺ6|-u?md%6|-Gzd)1Z6|-e\`zՓ6|-v`^6|-@ 6|-n Z! 6|-9Jմ6|-r&6|- +36|-K`n6|- I6|-v@E6|-fx6|-v`9.6|-1$9.:$6|-M5 ,k6|- =;86|-\@M`6|-OC=f96|-=E6|-a5zb6|- iM a6|- L@?gh6|-$ -xa6|-v :tD6|-0@>Y6|-zS6|-7]@$} k6|-ncE6|-:4e6|-{G6|-rw@"6|-L|}6|-/]>6|-6i6|-tj6|-] 06|-6d6|-> 96|-@ n6|-eNdn6|- \v6|-9o6|-Ɋ1C66|-@;,c66|-*;6|-3yyp6|-D42ڀ6|-@6|-ы~^6|-%yb6|-?ŧ6|-By<AN6|-v@f6|-U` ,856|-kE`6|-k@jU6|-U@e)06|-E`<6|- <t46|-k`?J^6|-`Ʉh6|-?7*6|- @'6|-c >V6|- 61?A6|-ÌF6|-Eje 6|-$X'|6|-CW6|-@M,6|-:}v+D6|- j x6|-1H6|- kFs6|-,  6|-a@B6|-" =g6|-7>Wa6|- @>/6|-rz6|- `f {6|-(F@x6|-V@A6|-AI]6|-CFB9\6|-Шfe[W6|-(!@-6|-Yɮ6|-6|-u6|-Ac 56|-s`6|-Mb>ʺ6|-t`P6|-#T6|-9`B`6|- P`?z6|-PB*[6|-b(I6|-9@6|-`36|-|!`!6|- E}6|- a*6|-d Dƀ@U6|-P [6|-9C6|-b`$!6|-_@ҳB6|-|`i-U2n6|-# A6|- (6|-6|-W6|-[(@6|-(m26|-=;`@dl6|- {6|-7Sw`6|-J0@6|-# a6|-8R@DU6|-GR`b6|-] T~6|-T 6|-(%6|- gU6|-꬝6|-@p6|-aa(6|-dBY6|-@1)6|-†6|-`a+$6|-H6|-e,Β6|-ch6|-` 6|-6|-HV@%6|-p>6|-(D6|-G@b6|-a6|-pV4E6|-K `6|-fb/j6|- r=H6|-5@Gg6|-ĭ2:q6|-U Ur|6|- @e6|-u6|-z6|-E)@M6|-L+6|-q! 6|-3@[6|-p`Cd6|-gpv6|-Ų3~6|-*@Ԣ6|-ܡh6|-e`uo6|-UW6|-)`,6|-6|-) rM6|-c 6|-)G6|-@6|-rg`<|6|-g V6|-6VXۓ6|-H6|- W|P6|-0W|f6|-@8F6|-)Ϙ6|-r Xy.6|-gX #6|-4 b-6|-)H Yy>6|- ` 6|-5 ٓ6|-`j06|-oa6|-HE 6|-lE701.6|-6hC#6|-`Ue6|-U@z6|-MA6|-@PƲ6|-A<Y~F6|-g Zc6|-#ǡC6|-̢w 6|-/*ƚ6|-yrL6|-{ 0?6|-DH@e`^6|-,t6|-g6|-c*`0n6|-bA6|-*@6|-Rhr*6|- \~-6|-i< G@6|- `s.P 6|-}<6|-.#6|- Zl#6|-N6|-eQf6|-h`"d6|-h7$D6|-e6|-`dz6|-J#e&6|-<B(h6|-h@%6|-g dbv6|-etm.6|-.  6|-R`Jq6|-_6|-f`OR6|-AO 5D6|-HQzg6|-htD6|-ic E6|-&`?s6|-X6|-+ @*6|-D @Mt6|-f# [*v6|-] |+6|-M+DRH^c6|-@u%tts6|-ռE]6|-EE>6|-[T6|-  lq6|-=f`d6|-uK6|-5C6|- \(_O6|- dgTE6|-s`6|- =`EGӦ6|-@6|-RmNs6|-8і6|-P@96|-7IѤ6|-ޫV6|-i6|-@=6|-gf@#"r6|-@-S6|- w6|-,S6|--x6|-`erD\6|- s6|- 6|-=`న6|-`m@6|-л6|-RI\ə6|-v߳6|-Y G6|-[6|- S w6|-fEEg6|-@96|-#w6|-o@]6|-`n;,6|-0@$V\6|-S`x)6|-y#5 6|-E?~@$6|-hFW6|-@A{6|-QB6|-7,Bk6|-.jT`E16|-ft߇6|-o c#P6|-ǒ Z6|-y6|-p6|- W6|-ƈ@.Ÿ6|-I6|-Jj$6|-ڣT+j$O6|- U`_ 6|-`UIˍ6|-  n6|-@Ix6|-6|-ʯ`6|- ]nj6|- `6|-k,ڡ6|-,;6|-u  6|-j>6|-8l6|-j.6|-I@t16|-j@6|-(A6|-f&6|-fՎy6|-I`q)_6|-*k~ i6|-`t6|-Fk6|-6|-I '6|-bk e{6|-13c6|-X6|-5i$6|-J"\Q6|-H@us6|-D]E;6|-@K_?h6|-f76|-pO}+6|-76|-UU` 1X6|-_)6|-U2`\46|-f u6|-K V`5}6|-`VU6|- '6|-a5F W6|- L=6|-k@5}6|-F6|-:K6|-f@}v6|-=6|-pƣ6|-% `6|-gV6|-> F6|-- /6|-*J}i6|-$g`(D6|-ʖ֙6|-A~6|- 6|-9gU̟6|-py6|-k 6|-W@d'6|-@|J6|-%6|-?6|-=V_6|-p  W` 46|-o-`Wn[6|--WY|Z6|-JW`Ds6|- 6|-KMh6|-ҽ3 z6|- m6|-Rb6|-w76|-=056|-^@F6|-賂6|-`%Op6|-~`a6|-=@ Bu6|-c :wL6|->AJ6|-@j(G^6|-~5kŲ6|->1f6|-S@ɜ#6|-2i>y6|-Tc6|- $Y{6|-:g@6|-2aC 6|-2R56|-@56|-$@zO>6|-ʤE6|-~k|8m6|-t`+6|-  Fcvk6|- d6|-l 6|-B`Ğ6|-@aT6|-{`BF#6|-hF*@6|-bF6|- %e~6|-Ͼ@l;6|-cTlL6|-hf*@6|-,b6|-Cv6|-]l͇٬6|-m76|- g6|-T@m6|-m 6|->m6|-%nǤ6|-T@n76|--B%f-6|-D 56|-@GU6|-^n16|-2`T6|-t@<6|-@@AU6|-nl`6|-/nx46|-i@I6|-@@6|->iq#=6|-a? i%6|-u?O36|-2G 6|-oS*y6|- H6|-@ocU6|-`H X 6|-/ |Y~g6|-KH|6|-@G[6|- S6|- ka6|->mo^ٲ6|-Zmo 6|-KpA36|-@p06|-p|]6|-~6|-vm@[6|-?pEI6|-L ipHV6|- q\F_6|-@`dPfy6|-2 `y9D6|-K l"6|-0 6|-@q6|-q66|-6|-̿`I뢪6|-jcuJ6|-mi6|-Q@q.6|-ɕY6|-~6|- eH6|-aL Io6|-(I6|-jI/j6|-!76|- K6|->a6|-W C6|- ]ѓJ6|-@t6|-ٰ Ui6|-@@Jd6|-@@"6|-j@rBb6|-7r P6|-)krIZ6|->kse6|-Sk@.6|-L_+o6|-y@sߡ6|-  n'6|-J 6|-2K66|-҂26|--C6|-<@06|-/sT6|-A6|-M~r}6|-t46|-!_6|-)H L6|-׾l6|-x6|-n`Kh6|-)/@ui6|-Ȧ6|-$s`iVY:6|-TM6|-Ci$d6|-ej~a6|-k@6|-j⡪6|-6|-`6|- κ6|-k@k6|-w/k2NY6|-s s`6|-@C6|-M`l8wy6|-UD"q6|-ulU6|-4`j}U:6|-no mtf6|-'DO6|-8>k6|-M;ڪ6|-C8N6|-A`6|-s>'6|-X) 76|-7\6|- B_6|-%ltNTh6|-k`26|-o {/6|-*@t6|-jt16|-dKC6|- s 6|-BDü<6|-t 6|-u06|-N@uy6|-6murc6|-@р6|-wFԥ6|-"x6|-@xD6|-[xGe6|-xܜ6|-OysO6|-@yb56|-yc6|-yn6|-zI6|- my6|-n &&S6|-`JEI6|-Ś`H։ |6|-2H7q6|-EH6|-ڌ`{6|-E@zM6|-[`o޹6|- L-6|-uPuo6|-[Le76|-z6|- *(6|-@&*6|-@AT6|-6|-MbAVv6|-tx46|-#p"6|-zb6|-{Qf6|-LӁؒ6|-[IkdJ6|-E``16|-)@M#d6|-"-A{a6|-;BB6|-%@{96|-L@6|-"@B'6|-K{V_y6|-[{6|-<^6|-o|˨ 6|-gɊ6|-@M8j=6|-҇M͋6|-N6|-K6|-0`NB'6|-BZ6|-~PNkUȍ6|- O" 6|-kO6|-By6|-PCgtx6|-@C.h6|-o]6|-2OJsh6|-"`Mx*6|-qY|66|-P DDY 6|- @P_l6|-Pk+D6|-o ’6|-@6t6|-- n&_6|-`J6|-2=;6|- scW6|- p6|-9 46|- V16|-`4=O6|-K6|-Ͼ|(06|-(~Cб76|-P~ChS6|-x~D7<6|-~@DVV6|-޵ D6|-rD6|-`K*ڂ6|-'6|-UF@66|-8 0E6|-}X6|-˂6|-V. 6|-2 u6|-Y%6|-@6|--]`E6G6|-b@+p6|-r&6|-QB,B6|-`QE6|-<]  6|- Oj6|-K]Ei{6|-K 6|- o26|-&@}46|-Q¿6|-Q6|-Yɬ(6|-&q6|-YG Rl6|-mGR76|-[@W#E6|-=}6|-]@-26|-G6|-@$I6|-x"i66|-#?^6|-RpB 6|-`U6|-A6|-zqp-'6|-q 6k6|-G6|-q1r6|-q@¿l:6|-`5B#6|-}A:6|-n;6|- u?V6|-s6|-R@M[`6|-@@;6|-¿s6|-93 S6|-~ 6|-*[|/6|-K@2]6|-a}xh6|-m36|-3Ӑ;x6|-G@q?6|- 6|-@ r6|-x` 6|-fy>6|-(@\RL>6|-F6|-/RHxx6|-@SH6|-%IS_ (6|-TKs6|-h`T b6|-yTA6|-^rmƇ6|-9I`J6|-6|-~6|- U`6|-v sMzʚ6|-ت6|-%Y6|-@~6|-޷p6|-I_`D6|-r C6|-"NO6|-6@6|-#8F6|-E OZ-6|-VO6|-ZU>B6|-v_~yl6|-~d{76|-rh6|-_@M*6|-sp6|-s tI6|-Ͼ!xO6|-xf 6|-^76|-_O(Q6|-6|-1@tg6|-*`@h6|-I GY 6|-f`ſH2 6|-u`@ſ76|-"`v6|- PinSHA256mapstructure:"pinSHA256" ClientKeymapstructure:"clientKey" FirewallMarkmapstructure:"fwmark" Transportmapstructure:"transport" Bandwidthmapstructure:"bandwidth" TCPTProxymapstructure:"tcpTProxy" UDPTProxymapstructure:"udpTProxy" SpeedTestmapstructure:"speedTest" Outboundsmapstructure:"outbounds""*atomic.Pointer[sync.poolChainElt]"*struct { key string; elem []int }"*[]struct { key string; elem int }"*struct { F uintptr; X0 net.Conn }]ԇ6|-zs`g!t6|-` B4F o4i6|-6OؓR6|-@ƿ \qƣ>@V ZXEb$ڻ6|-Tu >` NRaI < @ P@i6|-HF32K tl`W WW8t X  X 6|-} YEQ06|-׻/m6|-@ػ R_:Z@D xd 8Z6|-Rڻn6|-G`D06|-#g   h@ .R` ӍI-&La6|-ۻ R7u` x\c06|-` *հ)  >۵Ó^"*func() (*x509.Certificate, error)"*map.group[string]*tls.Certificate"*func(*bisect.dedup) *bisect.dedup"*struct { F uintptr; R *tls.Conn } ؽe .:~ o> L2sP d a F 2 |ۻej6|-` >EK ϿE L NL {0JL6|-K 1(N t%@ Ta& ` wJH, ,\9 H (6A@e - f  &9xf  g z{@S@h ;;i*36|-<E-6|-+p6|-p̿ 06|-Ǐ@R]6|-! @~6|-B ,-6|-Qc  ut fmV6|-t V }6|-B `I4M6|-  mC ` 0 `}v6|- ` ւ   q@ 5 KR\}6|-` h  @D 8:% m4 ^Y# ĽP K 06|-)4 6|-56|-& F"6|- ` I`   i6|-@h.P6|-A 8ԟ`o6|- [:6|-4"*func(*pkix.CertificateList) error RelativeNameasn1:"optional,tag:1" pIV  ( &56|- w옢` k% @6|-þ _F m <'O`7 ]o  d@ &ܷg :du`Q 57 %P=C ?_ :=* @n bp o  ٪*o HzVp QbQL` ){Ϳ`w-6|-2`vA*6|-`¹ k/ca6|- "*func(*net.Buffers) (int64, error)"*[]struct { key int; elem string } 2^; W(wM 3 V.P `rƝ6|-d sR`< ﶖ`> j@U< `^(5 U T'xH 5O $ t H`uY6|- 6|-$' y"*unique.node[net/netip.addrDetail] dfpmy> WXj  gx^ ` ? + VϐT,s6|-7fv6|- " &v `O Sd  L3w ` L 580 @x )M yK-B6|-ܒM6|-MҿrSy6|- @Q6|- `*6|-P/ c,{ y1 qZ6|-1 =_6|-V'6|-Pc6|-` 'yՓ6|-4W !  0 `~h.6|-\@z6|-" 46|-@ Z{ M ]P56|->7!2(86|-`2_6|-f KiRڨ6|-ۇ[6|-B `K86|-<8`6|-<@ίE6|-` @@-P6|- "*func([]uint8, int64) (int, error)"*func(string) (fs.FileInfo, error) K.rem6|-8k6|-y" xs1-6|-y bXiE6|-XV6|-P7(6|-9%2i6|-` ŁĨ# z"*struct { F uintptr; X0 chan int } ;OO@T e~#g`T "kT ;DeՌU ? )k@Um#6|-)k` ' UH"6|-ཹ W3kUW6|-3k` z V+B*6|-ྐྵ f2 @V AsOVry6|-sO $V  W :&6@W P< WcIZ6|-< kmHW6|-H` 8ð|O X'6|-|O `T  'E@X v!f ][k# ?\X"Z 6J0M Dr ੸ `DPy`Z 肼 gFyF W4? @{ -W8x RbD sKm] #w#D EN _}Iz ) J ~%` k3 46|-f` pNK mb7 | :IOz eKg ߩ>W`N R  y,,` onUMEl!6|-E`ɹ = g6|-8 Yu_r \6|-   (8p lO- `| /$ } ә/ }:U6|-Կ   ~ uh/ ` V8 @. 8_Q6|-` 206|- /Py6|- `" `\Va6|- "W16|- {@Q(d6|->#>6|- Ⱦ ~@  "*func(time.Duration) time.Duration w  }cS HF "*func(*cobra.Command, error) error"MarkZshCompPositionalArgumentWords"*func() func(*cobra.Command) error 9R[ ro`  2r@ y# "./0 xpє` ~ڹ\p. @"*map.group[string]encoding.Decoder"*map.group[string]encoding.Encoder ^t4 P ߑ z M`5"*func(zapcore.ObjectEncoder) error q%;%c6|-b0 @N*Կ6|-j չ ЉBj @7qX6|-$ֹ ֲ%d$ t̂x c Z U,7 ]| &GH "t6 X 6|-P _EZ7I6|-#16|-0< hJ ` Q ` s^IS A R^i +6|- @"@6|-I "%6|-ٿ P+ B6|-@ڹ u6|- 5=@ r( |N 룾H" ?H  f@ y @X c jf}m zRQƸ  ^R"Q6|-d9#6|-`#T-6|-C > 6|-hL6|-W` sE8@M(6|-0@ /0 56|-[k kw=jj   F(zpb"*atomic.Pointer[net/http.response] Rx5 Layoutjson:"layout" yaml:"layout" O  v_U(`o Ę"zy`Gh6|-u O ì}a1 oKK10 ` H\ۚtS F  K=` .JI w\g=@q tܿ D@o76|-]޿[ƍ6|-xJGT6|-?#?XA6|-`M"*func(uint32, bool, []uint8) error"*func(http.http2FrameWriteRequest)"*func() (*multipart.Reader, error)"*map.group[*net.Listener]struct {}"*struct { io.Reader; io.WriterTo }"*map.group[[8]uint8]chan struct {}"*map[string]*http.http2addConnCall"*http.transportReadFromServerError"*struct { F uintptr; X0 []string } O;0[9 D- @ %`Ir S T\ $` Z d!"1 t^ !TO`YEy6|-c@ M?cƣ6|- $ Ix $ ̣ ` 撝 ̱LЂ ߋgP1 ULv 42#U` * >6)` R2 ` 0h7 ˆv) yPD 'E 4-2 ` Zq  MJ bu m ` ,&HT DQx \ qW6|-D\Ÿ6|-WB@\  Z\_R6 {C ` X _" H' 8C  ` LDT |p ;(>C ]se ` ᬶLnT iw\ @]Hm6|-r}V 6|- $ꈒ6|-e !s..: u+B5"*func() (crypto.PrivateKey, error)  V`3   0` @ q]U~  0 ZR& bwF if^  @ @ ESñ |Dv C sX 1 @     5 Altitudejson:"altitude,omitempty"Priorityjson:"priority,omitempty"Protocoljson:"protocol,omitempty"Selectorjson:"selector,omitempty"Messagesjson:"messages,omitempty" 6|-_ @@|HR6|-@@@ +,9`6|-9 D4 >x w@ WE{@@| q6|- 4~ ߩM nU2@`-'6|-2 ha3X|NextPagejson:"nextPage,omitempty"LastPagejson:"lastPage,omitempty" i>W R)Nbo@   Z F^rInstancejson:"instance,omitempty"NewAuthzjson:"newAuthz,omitempty"NotAfterjson:"notAfter,omitempty"Locationjson:"location,omitempty"Wildcardjson:"wildcard,omitempty" $-; Ch .~ v%U@b"6|-j1  Dѝb`¹"*func(string, uint64, uint64) bool NO  6|- "github.com/hashicorp/golang-lru/v2 /x5@+6|-0 x.%@U6|-9& CB )6|-6R J6` - gxCCB&  גM$ uH"! %e @ [v .&]o =+|1 1 #ǻtb @ Hd\YH$6|-w *"*func([]interface {}, bool, error)"*map.group[dnsmessage.Class]string"*map.group[dnsmessage.RCode]string  \cK ,U YD5 @ޚn6|-5^6|-"sl>_6|-]7@[6|-#@5gP6|-`# ./5 5 @"*func(int, uintptr) unsafe.Pointer (n]Rs"*func(*abi.SwissMapType) *maps.Map"*struct { key string; elem int64 }"*func(*bool, string, bool, string)"*func(string, string, string) *int"*func(string, pflag.ErrorHandling)"*func(*int8, string, int8, string)"*func(*uint, string, uint, string)"*func(pflag.Value, string, string) X+z\6|- @ pr@7 @8s R"*func(parse.Node) (string, string) ` ?aԿ , 1J 9>Q@"github.com/spf13/jwalterweathermanٮ6|-$`& S .֢ Q-d=BM6|-|J "*map.group[reflect.Value]struct {} I$h @ T4 o 'BJ H)6|-!K` [>A4!K "*socks5.UserPassNegotiationRequest [uu F!36|-I* "* Y Z /B)T w<z\ cib0`  H  ~k @6|- ny_" kI16|-HCTlƩ6|-Q@ C._@ g6V6|-5@+ 6|-8@T 6|-"m+6|-@v6|-,?6|-,P.6|-8 bw]6|-2`,è6|-d `b _n"*func(io.Reader, int) (int, error) cy6  hl{x  Ϣb- B-˸$ W6|-   zӸ fO` {t "*func(string, string, net.IP) bool y{`B   m<0` ݟ @S6|-t EN04 @"*func(*dns.DNSKEY, []dns.RR) error"*struct { R *big.Int; S *big.Int }"*struct { key string; elem uint8 }"*struct { key uint8; elem string } q/ ^cA l ! H$ L lF?| Y ?:Y6|-< _Nv0  \ jZ P>7 ` &un !i >x+6|-~ @ {[e J;j"` E+@ }y ڸ &*Q Q sSߪExpiryjson:"expires_in,omitempty"Intervaljson:"interval,omitempty" k ''(C6|-x] 6|-}0C@)6|-44`C"6|- `Hostnamejson:"hostname,omitempty""*govultr.ContainerRegistryMetadata MaxStorageMBjson:"max_storage_mb""*[]govultr.ContainerRegistryRegionVersionsjson:"versions,omitempty"Databasejson:"database,omitempty"Usernamejson:"username,omitempty"Passwordjson:"password,omitempty" RedisACLKeysjson:"redis_acl_keys""*govultr.DatabaseMigrationStartReq"*govultr.DatabaseVersionUpgradeReq MaxRuleCountjson:"max_rule_count"SSHKeysjson:"sshkey_id,omitempty" V4SubnetMaskjson:"v4_subnet_mask""*govultr.RequestCompletionCallback"*govultr.ApplicationServiceHandler"*govultr.MarketplaceServiceHandler"*govultr.DatabaseAvailableVersions"**govultr.containerRegistryRegions"*govultr.objectStorageClustersBase  I W7 p -)R pYUfm |4@ =E` d T zQ;T e;@p q(@a !_; t`a Nb FFpD@b SO u@ d`C *Ng w]@ z%:` _|  b b0* T  EI* _I b ݄ie [_HZ >3J 3} ?Q F d W` ye z%u6|- 4X/6|-<`  P*< ,H@ ^1H sv E  [ jb<u g+d +2 ͫ + >›z \sWO@ CRD|f`e P!` ,v it  w =>B~w A"`x Txzfy4z6|-R` k6|- 0#:6|-F ^_6|-`Ķ6|- CV6|- 6|-v Cr6|-`d6|-w V6|-NgLM6|-U- 6|-`J`E6|-{Jk{56|-kZ6|-cg #6|-t(z6|-7 =*6|-X6|- J "github.com/database64128/tfo-go/v2 LK̬C06|-T"PreferSkipResumptionOnNilExtensionDatajson:"key_exchange,omitempty" r`#@ Wuy yDzP  2.a "3 >` "\uHY =# K2 y!>  [ @ o# z&E 8vv? |Ŕ h@a6|- -"*func(int) *nistec.p256AffinePoint #` 6c5h@? X$D' qJh? = ī_h? jth"*func(*bigmod.Modulus) *bigmod.Nat ){Lre rT@  L "*map.group[string]template.element 7T "*struct { key uint32; elem int32 } ~@ ͻtY:`K 8/n9 D> p3ה 9ܪ  ^_@G  JL  s*` j1i M6|-` JUi ѓPx  QMy` a  "*map[reflect.Type]*yaml.structInfo \PRV NJi@  h N >`d w;+L` Q/z=" t-jk gFLl 9?.q "iDY. CzBj  @(إo bߕȺx6|-d . ~w=C | fWV@ r? NWM  k\'q  -F@ us4t "*map.group[reflect.Type]gob.typeId n "*map.group[netlink.BondMode]string Aܫi   Z؋kE ;* ! Tx* @"  tD  # ֣X # )K_ $ R)C @% 혱$4l & t>5 & BT' ' O @( 7EB8 ) Iɣ ) H& A+ * ~YC @+ E  , e˝ , +ڕl - u6 @. x<' / l: / KH3 0 S.K K "*interface { IsMessageSet() bool } j6|-n + 1XNr6|-5"*protoreflect.ExtensionDescriptors"*func(int) protoreflect.FileImport"appendUninterpretedOption_NamePart"*func(protoreflect.FileDescriptor)"*func(protoreflect.EnumDescriptor)"*protoreflect.EnumValueDescriptors"*func() protoreflect.ExtensionType fiERos x/nl k % 4 v 4\ߺ6|-@ !z; 5"SetMaxAckHeightTrackerWindowLength"limitMaxAckHeightTrackerBySendRate"*func(congestion.RTTStatsProvider) Dy & ;@j s"*protocol.ArbitraryLenConnectionID"*func(time.Duration) monotime.Time"*func(monotime.Time) time.Duration bNv `Cs`7"*ackhandler.packetWithPacketNumber B P o6|-h  +f"@=B6|- !=P6|- kE` IC0t6|-^ z71"*func() (bool, protocol.ByteCount) VuD } :n  5x: @9 ` Ϙ#: fQ,"writeLiteralFieldWithNameReference |5U3Ҥ :D6|-  M!gQz`] r^O & ;nd^u6|-! 2 :ཹJW6|-{ ]6|-` j%` 0KB U̓RA  >"*map.group[string]syntax.charGroup ` ,I<) p9@< H%L: = U`q = Z #< >"*retryablehttp.ResponseHandlerFunc Ն   ? ܅_ `@ Lo8 A |5 At+6|-< gV< BFy#6|-U / C"*func(*hybrid.xPrivateKey) []uint8"*func(*hybrid.cPrivateKey) []uint8B6|--`(6|--b6|--v"<6|--` raDvnS6|-;Tb6|-Fr`Td6|-g:"*map.group[reflect.Type]*gob.encOp AD 1~: ~Ѹ`56|-Fo(y=6|-Fo96|-F p6|-F`p,6|- Gp'+/6|-GpbF6|-1G q P2 n XE Z2ԓ @F g-( G $k! G -* H Dx]@"*func(protoreflect.EnumType) error"*protoregistry.extensionsByMessage t0\\q I `T N2ވ `J r%e K 9UK ,# L D*Bk6|-* -6|--@"*func(*filedesc.FieldRanges) error wTZr l N HwH `O   #P P ?eKѼ f Wv` M/7 P  Q 9f, `R \b! .DN S uq| S  B T #| s8 `U aӼ L V $0f n- V  } W h1eq GG  \iLr `X (q  Չ} Y & V; @Z  s+D (| [ s9 [ o \ V:bX ]"*map[protowire.Number]interface {}"*map[reflect.Type]protowire.Number"*map[protowire.Number]reflect.Type6|-I DhX6|-3CT6|->CN&6|-e`AOO<6|-fA Fi@IE7~6|-džAA6|-ц B jT- `^ {uF+B9 _ Cc _ 3=sqHz _{ իW- ` % `a Mxh b pQ") b ѱ` c W߽}9 `d چ4 e Cq  In ($  ;'  46|-<16|-J1K^6|-X1@Ïl6|-t1 jZj+@F ~P2F 2hi ~I Ja޼@G >9޼G X޼@H O2H#*struct { key string; elem string }#*[8]struct { key string; elem int }#EncryptedClientHelloRejectionVerify#*func([]uint8) (*big.Int, *big.Int)#*[]struct { key uint16; elem bool }#*func([]uint8) (cipher.AEAD, error)#*[]struct { key uint64; elem bool }#*struct { F uintptr; X0 *tls.Conn }RevokedCertificatesasn1:"optional"#*map[string][]*x509.policyGraphNode#*[]struct { key string; elem bool }#*[]map[string]*x509.policyGraphNode#*[8]struct { key int; elem string }#*weak.Pointer[net/netip.addrDetail]#*unique.entry[net/netip.addrDetail]#*func(*abi.Type, interface {}) bool#*func(fs.DirEntry, fs.DirEntry) int#*func(interface {}, uintptr, int64)#*struct { key string; elem uint64 }#GenPowerShellCompletionFileWithDesc#*func(...zapcore.Field) *zap.Logger#*map[protocol.StreamID]*quic.Stream#*map[quic.pathID]*quic.pathOutgoing#*func(zapcore.ArrayMarshaler) error#*func([]zapcore.Field) zapcore.Core#*func(http.http2writeContext) error#*func(string) (*http.Cookie, error)#*func(net.Listener) context.Context#*map.group[uint32]*http.http2stream#*map.group[string]*http.routingNode#*http.http2roundRobinWriteScheduler#*map[uint32]*http.http2clientStream#*map[string][]*http.http2ClientConn#*map[*http.http2ClientConn][]string#*http.http2clientConnPoolIdleCloser#*map.group[http.http2ErrCode]string#*map.group[http.http2SettingID]bool#*map[string][]*multipart.FileHeader#*map.group[string]http.RoundTripper#*struct { F uintptr; X0 time.Time }#*func(context.Context, string) bool#*map.group[string]*certmagic.Config#*map.group[string]certmagic.KeyInfo#*map.group[string]certmagic.StorageZoneNamejson:"zone_name,omitempty"#*map.group[string]cloudflare.cfZoneAPITokenjson:"api_token,omitempty"RRSetTTLjson:"rrset_ttl,omitempty"#*map.group[string]gandi.gandiDomain#*func([]uint8) (int, string, error)#*func([]uint8, string) (int, error)#*map[uint32]*server.udpSessionEntry#*outbounds.invalidOutboundModeError#*func(acl.matchResultCacheKey) bool#*outbounds.PluggableOutboundAdapter#*func() (io.ReaderAt, int64, int64)#*func(*list.Element, *list.Element)#*func(*big.Int, int, uint) *big.Int#*func(string, int) (*big.Int, bool)#*func([]int) (reflect.Value, error)#*func(reflect.Value, reflect.Value)#*map.group[*reflect.structType]bool#*struct { F uintptr; X0 *abi.Type }#*struct { key string; elem uint16 }#*func(*abi.SwissMapType, *maps.Map)#*func(*int, string, string, string)#*func(string, int16, string) *int16#*func(string, int32, string) *int32#*func(string, int64, string) *int64#*func(string, []int, string) *[]int#*func(string, uint8, string) *uint8#*func(bool) ([]netip.Prefix, error)#*udpnat.Service[net/netip.AddrPort]#*func(netip.AddrPort, *udpnat.conn)#*struct { key int; elem struct {} }#github.com/sagernet/sing/common/buf#*[]struct { key uint8; elem uint8 }#*func(network.ReadWaitOptions) bool#*func() protoreflect.EnumDescriptor#*func(*quic.packetBuffer, net.Addr)#*func(protocol.StatelessResetToken)#*func(congestion.CongestionControl)#*func(*wire.StopSendingFrame) error#*quic.pathManagerOutgoingAckHandler#*struct { F uintptr; R *quic.Conn }#*struct { key uint64; elem uint64 }#*map.group[string]map[string]string#vendor/golang.org/x/net/http2/hpackRendezvousServersdns:"domain-name"#*func(dns.ResponseWriter, *dns.Msg)#*func(*dns.Header) ([]uint8, error)#*struct { key uint16; elem string }UserDatajson:"user_data,omitempty" IncomingBytesjson:"incoming_bytes" OutgoingBytesjson:"outgoing_bytes" ArtifactCountjson:"artifact_count"#*govultr.ContainerRegistryPlanTypes#*govultr.ContainerRegistryUpdateReqMinValuejson:"min_value,omitempty"MaxValuejson:"max_value,omitempty" InstanceCountjson:"instance_count"ScriptIDjson:"script_id,omitempty"BackupIDjson:"backup_id,omitempty"MinNodesjson:"min_nodes,omitempty"MaxNodesjson:"max_nodes,omitempty" ClusterSubnetjson:"cluster_subnet" ServiceSubnetjson:"service_subnet" FirewallRulesjson:"firewall_rules"#*govultr.BlockStorageServiceHandler#*govultr.FireWallRuleServiceHandler#*govultr.databaseConnectionPoolBase FirewallGroupjson:"firewall_group" LoadBalancersjson:"load_balancers" ObjectStoragejson:"object_storage" S3Credentialsjson:"s3_credentials" StartupScriptjson:"startup_script"#*map[danger.TypeID]map[string][]int#*map[netlink.BondArpValidate]string#*map[netlink.BondFailOverMac]string#*map.group[netlink.IPoIBMode]string#*map[string]netlink.BondArpValidate#*map[string]netlink.BondFailOverMac#*map.group[string]netlink.IPoIBMode#*func(protoreflect.FieldDescriptor)#*func() protoreflect.FileDescriptor#*func(protoreflect.SourcePath) bool#appendDescriptorProto_ReservedRange#*func(protoreflect.EnumNumber) bool#*func(protoreflect.OneofDescriptor)#*func(int) protoreflect.MessageType#SetAckAggregationBandwidthThreshold#reduceExtraAckedOnBandwidthIncrease#bytesLostWhileDetectingOvershooting#*func(time.Duration, time.Duration)#*func(protocol.Perspective) []uint8#*func(...interface {}) *slog.Logger#crypto/internal/fips140/nistec/fiat#github.com/hashicorp/hcl/hcl/parser#*map.group[reflect.Type]gob.gobType#*[]func() protoreflect.ProtoMessage#*map[protoreflect.Kind]reflect.Type#*func(coding.Version, coding.Level)#*func(*coding.Bits, coding.Version)#*func() (bpf.RawInstruction, error)#github.com/cloudflare/circl/xof/k12#github.com/cloudflare/circl/dh/x448#github.com/hashicorp/hcl/json/token#*func(*internal.Vec, *internal.Vec) BindDevicemapstructure:"bindDevice"$*unique.Handle[net/netip.addrDetail] Salamandermapstructure:"salamander" DisableUDPmapstructure:"disableUDP" ListenHostmapstructure:"listenHost" StatusCodemapstructure:"statusCode" ListenHTTPmapstructure:"listenHTTP" ForceHTTPSmapstructure:"forceHTTPS" Masquerademapstructure:"masquerade"$*func(*os.dirInfo, *os.dirInfo) bool$*[]struct { key string; elem []int }$*struct { F uintptr; R *net.Dialer }$*func(*godebug.value) *godebug.value$*map.group[interface {}]interface {}$*[8]struct { key uint16; elem bool }$*[8]struct { key uint64; elem bool }$*struct { F uintptr; R crypto.Hash }$*[8]struct { key string; elem bool }$*[1]map[string]*x509.policyGraphNode$*interface { As(interface {}) bool }$*func(int) (syscall.Sockaddr, error)$*runtime.goroutineProfileStateHolder$*func(runtime.goroutineProfileState)$*map.group[string]runtime.metricData$*struct { name string; called bool }$*map.group[string]*template.Template$*map[string]*forwarding.sessionEntry$*func(*http.response) *http.response$*func(zapcore.ObjectMarshaler) error$*map.group[zapcore.Level]color.Color$*map[*http.http2serverConn]struct {}$*func(context.Context) *http.Request$*map[*http.persistConn]*list.Element$*map.group[http.connectMethodKey]int$*struct { F uintptr; X0 chan error }$*func(context.Context, string) error$*map[string]*certmagic.soaCacheEntry Algorithmjson:"algorithm,omitempty" Proxiablejson:"proxiable,omitempty" NotBeforejson:"notBefore,omitempty"Authorizationsjson:"authorizations" Validatedjson:"validated,omitempty" HookedReqAddrjson:"hooked_req_addr"$*func() (*ed25519.PrivateKey, error)$*func(int, int) (cipher.AEAD, error)$*func(*rand.Rand, *big.Int) *big.Int$*func(string) (reflect.Method, bool)$*map.group[dnsmessage.section]string$*map.group[string]*singleflight.call$*[]struct { key string; elem int64 }$*func(string) (time.Duration, error)$*func(*int16, string, int16, string)$*func(*int32, string, int32, string)$*func(*int64, string, int64, string)$*func(*[]int, string, []int, string)$*func(*uint8, string, uint8, string)$*struct { F uintptr; R buffer.Pool }$*func([]uint8, []uint8) (int, error)$*func(io.Reader, int) (int64, error)$*[8]struct { key uint8; elem uint8 }$*v2geo.isDomain_Attribute_TypedValue$*[]struct { key int32; elem string }$*[]struct { key string; elem int32 }$*func() (quic.receivedPacket, error)$*func(protocol.EncryptionLevel) bool$*struct { F uintptr; X0 *quic.Conn }$*struct { F uintptr; R *http3.Conn }$*func(int, map[string]struct {}) int$*func(crypto.Signer, []dns.RR) error$*[]struct { key string; elem uint8 }$*[]struct { key uint8; elem string } SSHKeyIDsjson:"sshkey_id,omitempty" V6NetworkSizejson:"v6_network_size" Enumeralsjson:"enumerals,omitempty" NumberOfNodesjson:"number_of_nodes" NSPrimaryjson:"nsprimary,omitempty" SHA512Sumjson:"sha512sum,omitempty" Instancesjson:"instances,omitempty"GPUVRAMjson:"gpu_vram_gb,omitempty" Continentjson:"continent,omitempty"$*govultr.DomainRecordsServiceHandler$*govultr.FireWallGroupServiceHandler$*govultr.ObjectStorageServiceHandler$*govultr.StartupScriptServiceHandler$*govultr.databaseAdvancedOptionsBase$*govultr.databaseConnectionPoolsBase$*govultr.marketplaceAppVariablesBase$*struct { key string; elem []uint8 }$*func(*bigmod.Modulus) bigmod.choice$*[]struct { key uint32; elem int32 }$github.com/hashicorp/hcl/hcl/printer$*func(string) *properties.Properties$*func(string, string) (string, bool)$*map.group[string]netlink.TuntapMode$*bufio.syscallVectorisedWriterFields$*func([]netip.Prefix) []netip.Prefix$*func(protoreflect.ProtoMessage) int$*struct { pragma.NoUnkeyedLiterals }$*func() protoreflect.EnumDescriptors$*func(protoreflect.MethodDescriptor)$appendDescriptorProto_ExtensionRange$*func() protoreflect.SourceLocations$*func(int) protoreflect.ProtoMessage$*func() protoreflect.OneofDescriptor$*func() protoreflect.FieldDescriptor$*map[int32]protoreflect.ProtoMessage$*map.group[int32]impl.ExtensionField$*struct { key uint64; elem []uint8 }$*[]ackhandler.packetWithPacketNumber$*qlog.PacketHeaderVersionNegotiation$*func(ipv4.ControlFlags, bool) error$*func([]string, slog.Attr) slog.Attr$*map.group[string]internal.AuthStyle$golang.org/x/crypto/chacha20poly1305$crypto/internal/fips140/edwards25519$*func(*gob.encEngine) *gob.encEngine$*func(protoreflect.MessageType) bool$*func(impl.pointer) protowire.Number$github.com/cloudflare/circl/ecc/p384$github.com/hashicorp/hcl/hcl/scanner$*struct { key string; elem float64 }%*[]struct { key string; elem string }%*[8]struct { key string; elem []int }%*struct { key string; elem []string }%*sync.node[interface {},interface {}]%*struct { F uintptr; X0 *sync.Mutex } MaxPathLenasn1:"optional,default:-1"SubjectUniqueIdasn1:"optional,tag:2"%*map.group[*x509.policyGraphNode]bool%*func([]uint8) (int, net.Addr, error)%*func([]uint8, net.Addr) (int, error)%*map.group[net.hostLookupOrder]string%*struct { F uintptr; X0 *time.Timer }%*[]*unique.node[net/netip.addrDetail]%*func(*abi.Type) (interface {}, bool)%*map.group[netip.addrDetail]struct {}%*map[chan<- os.Signal]*signal.handler%*func() runtime.goroutineProfileState%*func(io.Writer, string) (int, error)%*[]struct { key string; elem uint64 }%*func(*cobra.Command, []string) error%*func(func(*cobra.Command, []string))%*map[pflag.NormalizedName]*pflag.FlagInitialjson:"initial" yaml:"initial"%*struct { F uintptr; R net.Listener }%*func() (*protocol.UDPMessage, error)%*func(protocol.StreamID) *quic.Stream%*struct { F uintptr; R client.udpIO }%*func(func(interface {}) error) errorTimeKeyjson:"timeKey" yaml:"timeKey"NameKeyjson:"nameKey" yaml:"nameKey"NewReflectedEncoderjson:"-" yaml:"-"%*map.group[context.canceler]struct {}%*struct { ptr interface {}; len int }%*map.group[string]*http.http2dialCall%*http.http2duplicatePseudoHeaderError%*map.group[http.http2SettingID]string%*func(string) (*http.Response, error)%*struct { F uintptr; R http.Handler }%*struct { F uintptr; R *atomic.Bool }%*func(string) []certmagic.Certificate%*map.group[string]certmagic.Challenge AutoAddedjson:"auto_added,omitempty" CreatedOnjson:"created_on,omitempty" RRSetHrefjson:"rrset_href,omitempty" RRSetNamejson:"rrset_name,omitempty" RRSetTypejson:"rrset_type,omitempty"%*struct { CSR string "json:\"csr\"" }%*func(string) (server.UDPConn, error)%*trafficlogger.trafficStatsServerImpl%vendor/golang.org/x/crypto/cryptobyte%*map.group[string]*unicode.RangeTable%*[]struct { key string; elem uint16 }%*[8]struct { key string; elem int64 }%*func(string, []bool, string) *[]bool%*func(string) (map[string]int, error)%*func(string, net.IP, string) *net.IP%*func(string, string, []string) error%*func(string, string, string) *string%*func(string, uint16, string) *uint16%*func(string, uint32, string) *uint32%*func(string, uint64, string) *uint64%*func(string, []uint, string) *[]uint%*func(string, ...interface {}) string%github.com/sagernet/sing/common/cache%*[]struct { key int; elem struct {} }%*struct { F uintptr; X0 *tun.System }%*struct { F uintptr; X0 *[9]uintptr }%*[8]struct { key int32; elem string }%*[8]struct { key string; elem int32 }%*func(*wire.MaxStreamDataFrame) error%*map.group[quic.pathID]quic.newConnID%*func(protocol.EncryptionLevel) error%*[]struct { key uint64; elem uint64 }%*struct { F uintptr; X0 *http3.Conn }%*func(int64) (*multipart.Form, error)%*func() (textproto.MIMEHeader, error)%*map.group[hpack.pairNameValue]uint64Reasonasn1:"explicit,tag:0,optional"%*func(int) (crypto.PrivateKey, error)%*[8]struct { key string; elem uint8 }%*[]struct { key uint16; elem string }%*[8]struct { key uint8; elem string } TokenTypejson:"token_type,omitempty" ExpiresInjson:"expires_in,omitempty"PendingChargesjson:"pending_charges" IPAddressjson:"ip_address,omitempty" BlockTypejson:"block_type,omitempty" PrivateIPjson:"private_ip,omitempty"DatabaseEnginejson:"database_engine"MaintenanceDOWjson:"maintenance_dow" AltValuesjson:"alt_values,omitempty" EnableVPCjson:"enable_vpc,omitempty" AttachVPCjson:"attach_vpc,omitempty" DetachVPCjson:"detach_vpc,omitempty"DDOSProtectionjson:"ddos_protection"AvailablePlansjson:"available_plans"CompressedSizejson:"compressed_size"BackupSchedulejson:"backup_schedule"ContainerRegistriesjson:"registries"ConnectionPooljson:"connection_pool"FirewallGroupsjson:"firewall_groups"ForwardingRulejson:"forwarding_rule"ObjectStoragesjson:"object_storages"StartupScriptsjson:"startup_scripts"%github.com/refraction-networking/utls%*[8]struct { key uint32; elem int32 }%*struct { key string; elem *ini.Key }%*struct { key *yaml.Node; elem bool }%*map.group[string]yaml.resolveMapItem%*map[netlink.BondArpAllTargets]string%*map[string]netlink.BondArpAllTargets%github.com/sagernet/sing/common/bufio%*map[protoreflect.Kind]protowire.Type%*func(protoreflect.ServiceDescriptor)%*func(int) [2]protoreflect.EnumNumber%*func() protoreflect.FieldDescriptors%*func() protoreflect.OneofDescriptors%*func(protoreflect.MessageDescriptor)%*protoreflect.ExtensionTypeDescriptor%SetLimitMaxAckHeightTrackerBySendRate%hasGoodBandwidthEstimateForResumption%github.com/apernet/quic-go/quicvarint%*func(*wire.TransportParameters) bool%github.com/apernet/quic-go/congestion%*func() (bool, protocol.PacketNumber)%*flowcontrol.ConnectionFlowController%*flowcontrol.connectionFlowController%github.com/apernet/quic-go/qlogwriter%*func(*net.Interface, net.Addr) error%github.com/apernet/quic-go/http3/qlog%writeLiteralFieldWithoutNameReference%vendor/golang.org/x/text/unicode/norm%github.com/hashicorp/go-retryablehttp%*func([]uint8) (kem.PublicKey, error)%*struct { key string; elem [2]int32 }%parseOptionalWhitespaceCommentNewline%*struct { key gob.typeId; elem bool }%*map.group[reflect.Kind]gob.encHelper%*map.group[reflect.Type]*gob.typeInfo%*func(protoreflect.MessageType) error%*interface { GoPackagePath() string }%*map[protowire.Number]*filedesc.Field%*map.group[protowire.Number]struct {}%*map[protoreflect.Name]*filedesc.Enum%*map[protowire.Number]*impl.fieldInfo%github.com/cloudflare/circl/dh/x25519%github.com/hashicorp/hcl/json/scanner%*func(*internal.VecL, *internal.VecL)%*func(*internal.VecK, *internal.VecK)&github.com/apernet/hysteria/app/v2/cmd&*func(net.Addr, string, string, error)&*func(net.Addr, string, uint32, error) HopIntervalmapstructure:"hopInterval" IPv4Excludemapstructure:"ipv4Exclude" IPv6Excludemapstructure:"ipv6Exclude" TCPRedirectmapstructure:"tcpRedirect"&*[8]struct { key string; elem string } DisableHTTPmapstructure:"disableHTTP" AltHTTPPortmapstructure:"altHTTPPort" RewriteHostmapstructure:"rewriteHost" ListenHTTPSmapstructure:"listenHTTPS"&*struct { key x509.sum224; elem bool }&*struct { key string; elem struct {} }Uc3`Tdy32#S3+2TZP3B t3YX@i3X3U  3H5s3cb3cwD3IIS j3iI 23ʌ @͂3ba @D{` 2|-+#=K 2|-گ 2|-I`K+i 2|-ی!g> 2|-|[ 2|-!dt3&*func(string, *tls.ClientSessionState)&*tls.handshakeMessageWithOriginalBytes&*func(interface {}, interface {}) bool&*weak.Pointer[crypto/x509.Certificate]&*sync.entry[interface {},interface {}]&*atomic.Pointer[internal/bisect.dedup]&*func(unsafe.Pointer, uintptr) uintptr&*struct { key tls.alert; elem string }&*map.group[uint16]func() *hpke.hkdfKDFpL 2|-m3%\H3DJ`d3  [3C6k13 )!3@V _3J3tR3@5J3RWv3b.5L3q6 lM3P@{h36Ax36`{/3K#lF3+ @D,36`3D7*63Dq^Ѿ3@ Na3= N3- pF3= @3, @Ix|3 fp<3T  ϶;3# \l3v J3(nh3:lN3hftU3eN#'3 ̿2Q3Nu3'L@g3`K<3@N|b3`xc3I7Xwu33V4`B*3O ùN3TgM3 @U3<#`34@U?jj3XN&34V򣢷3@V}(V3{x`&*struct { F uintptr; R *net.Resolver }QMΘ3a!s0)3d@DV~3Hy`6}3Up< 2|-] 2|-@V 2|-ƐFٌ 2|-@V %3k3RdVeW)3bM`3@u>63)"OX~3bdUHα3dU 2|-5 m 2|-@VUY 2|-yFH 2|-5:3QK3M`3H 2|-lv513`6&*unique.canonMap[net/netip.addrDetail]&*unique.indirect[net/netip.addrDetail]&*[0]*unique.node[net/netip.addrDetail]&*[]*unique.entry[net/netip.addrDetail]93!8>7Gk3  p3ּ b3! +N13Ў xq38+뮢c3> ʠ3@*3 `Ox(3f `O2G3& D3P3  3L D423h D:!o3W  3 r3E3y 83 ػZ"3-8Q3<8ҿ&*go.shape.interface { Error() string }3M_fi3T6UXt)3y"3őV\34X3P@E2$k3? y&*func(*runtime.g, unsafe.Pointer) bool&*map.group[runtime._typePair]struct {}O}3 Ve>3D7Urٸ~3PV3RfV>3@@X#3Y:43YT3;{G83@XT3gWYhU3$9UߖV 2|-xX48 2|- U[F3`"3EOaL3U83{ʹ<>w3E`tH3"X!33/9`@3@X3J93@tEF3#k"3$&*[8]struct { key string; elem uint64 }3W]3|ɣ_3@̹3!%Ӈq 2|-cr/ 2|-vcA3-|&*func() func(*cobra.Command, []string)]?b3+@l3e=33x`ѹZMߑ3!Q345B3ؽ gu35"3Y/ ,3`ѹ ޅ3 @+] f3`¹d3 @ 38¹ !3J`¹Kf3P\g35*l3g ݬʽ3S# `)3J@+h3:69R3+jȚ3,+g3x@ ~<3&3̨>lW3`¹9#3Կ&*struct { F uintptr; X0 *[]io.Closer }bm3kPGF (w3W 3| #3Y@cf3'GzU3|WW3R&*struct { F uintptr; X0 *http.Server }F9P 2|-i&github.com/sagernet/sing/common/x/list<3;lM3Pع&3@0̡3;qO83@3`&*map[protocol.StreamID]go.shape.*uint8rŹ 2|-Z-e`v3@/b>3 )=3 9e;3mژ43;u3}t"l3y y{L3Z y킐:3y cUw3Z cH`3;m͍.3;]ٿ3 zv`3 M34@ڹ}7{3Ƹ['Z3Ƹ^%%3X3Q'3'j^43 k!3% 4 2|-c&*func(time.Time, time.Duration) uint64-@3[@Wvʎ3WQ3jW 3T3@Tq}3p3~`w]3`&*struct { key reflect.Type; elem int }&*struct { F uintptr; X0 reflect.Type }E3@Zv3/޿&*func(uint32, http.http2PriorityParam)&*func(uint32, http.http2ErrCode) error&*func(string, *http.PushOptions) error&*func(*http.Request) (*url.URL, error)&*func(int, textproto.MIMEHeader) error&*http.http2bufferedWriterTimeoutWriter&*struct { F uintptr; X0 bytes.Reader }!>3}3=A͛3H`\73s V3$@,=f3I + 3xR dbZ3 @93RAs 2|-Xķ3R !1 2|-,^ 2|-`B 2|- ~p 2|-K{r/ 2|-)6M3{@ks3 .pk 2|-Z'* 3nɱt 2|-P| nr1 2|-hh 2|-M?M 2|-@#|K 2|-@3*  2|- eEh3@r:3{3A3}`r3m3f}3v%g3'`&*func(context.Context, []string) error&*map.group[string]certmagic.ocspUpdate&*func() (certmagic.Certificate, error)DomainKeysHrefjson:"domain_keys_href" DomainNamejson:"domainName,omitempty"gz3*  Identifierjson:"identifier,omitempty"&*map.group[string]acme.cachedDirectoryy3_4 k3<8k3 5tI3J@2ܯ_3$4J~3`ސ?3ZTD 2|-:`O 2|-z 9f 2|-z<3~@vlM 3n`A3 !&*func() (*boring.PublicKeyECDH, error)&*weak.Pointer[crypto/ecdsa.PrivateKey]JY3A@ t3x3 `8U3 95 3_ `)"3E3`B"`T3h`i3%0 a^<v3 30`3!݅F3!q3z5&*func([]reflect.Value) []reflect.Value&*func(func(string) bool) reflect.Value0M3AJE3; n 3go3`930@Wb 31ٻo#3 %3]"B3׾A3 ׾a3"Q=3w"=&vendor/golang.org/x/net/dns/dnsmessage&*[8]struct { key string; elem uint16 }&*func(int, int, *syscall.IPMreq) error&*func(int, int, *syscall.Linger) errori#3Ajm3#@@ T3o5 2|-dOml 2|-\BŲ3Y`ʹLsb3HT7]3"`%30ES3ۻa3*`&*func(*[]bool, string, []bool, string)&*func(string) ([]time.Duration, error)&*func(*net.IP, string, net.IP, string)&*func(*string, string, string, string)&*func(*uint16, string, uint16, string)&*func(*uint32, string, uint32, string)&*func(*uint64, string, uint64, string)&*func(*[]uint, string, []uint, string)e3³!3.R3݇@7pbz3-#?^a3ZG33&*struct { F uintptr; R *flag.FlagSet }R3a@iMK3@9H_3ģWfx%3'q3#@-dV3&github.com/sagernet/sing/common/logger&github.com/sagernet/sing/common/ranges&github.com/sagernet/sing/common/udpnat&*[8]struct { key int; elem struct {} }~A3@ +zG3C=~3~3f1@"Pd3<@ԕ{30=!38@3B"-531 υT3Ssc63wyD^1z3 2|-\FO395 Fi3\ Fh3\|#H36b3 %dʙ3jb*I4k3tak3- '3jC3)'53$'՚}3ӵ (=C38`(&*func(bbr.connectionStateOnSentPacket)C 3GH3FҴ3"]-e3) )3U,y(33,>j3s3Ctf3` uk3(Du3wUJ3Uw&*func() (protocol.ConnectionID, error)&*struct { F uintptr; X0 *quic.Stream }wJ3u@ni3 ]`3bubs3[ .A3.#AK3 ۤ 2|-/q 2|-C c;3О{ `3t@z!3>`p3b"3k`E3e^P3  \oNF3%HE3@bŴ3@lu=3 F0eR3@"ۘQ% 2|-BD 2|-:`3c@l/3ǵ 3`EP3 f9736 }[m= 2|-@ 6H3̸3ł̸e 2|- 3\Q3E@&*[8]struct { key uint64; elem uint64 }`30 θ3a_3= Y=3#b`f 45)3Ph36`38A6~3`ic3u&&vendor/golang.org/x/net/http/httpproxy&*map[crypto.Hash]asn1.ObjectIdentifier&*[8]struct { key uint16; elem string }fRr3`iP3{@av{3H@{3 M3`*yv^3scIi3#'A7 :3o  9W3{.3N`L353`WZ]3 `+G 3P\7Fl36GL3 `&*govultr.ContainerRegistryStorageCount&*govultr.ContainerRegistrySubscription Encryptionjson:"encryption,omitempty"ObjectStoreClusterIDjson:"cluster_id"&*govultr.BareMetalServerServiceHandlerV 3? 2|-sS#:0 2|-3F*3!XY3б< 3J@H3s7-36o@k=]3k(3ǣ@}M3 A3lFŢ73`luz3DiW3d`j/3ll3HV3< mN3cHU3`j3e@"cmY3MizY,G3!u3/Oj3!23[p3sD=^38 >g3sa Y3 h{3S1i3D/3N{33/~/l#3D4H39M&SetReduceExtraAckedOnBandwidthIncrease&startNewAggregationEpochAfterFullRoundppv<3|vH3~vt3u&*protocol.DefaultConnectionIDGenerator4'3@* 3E3o>-3uZ3?,3u3t&*[]struct { key uint64; elem []uint8 }*3,ty3mE3tfN3#E< 3[}9&i93w_3 ; EA3u 3@ &*func(protocol.ByteCount) (bool, bool)&*flowcontrol.connectionFlowControllerI&*func(*handshake.cipherSuite, []uint8) 633Ha3`H13 IX3)E@yH]3=E S23n`{3%3 Ldo)3n`{3w3o$3_` t3`o&*map.group[string]qpack.indexAndValuesv3qvx+v3{3c &github.com/google/go-querystring/query$3 @CݡT3IӜ3  s- 3pQ8d3@&*func([]uint8) (sign.PublicKey, error)3p n&*func([]uint8) (kem.PrivateKey, error):c3^Lc3F &github.com/cloudflare/circl/kem/hybridm3?p@a–93TpBA38 3hK&*fiat.p224MontgomeryDomainFieldElement&*fiat.p256MontgomeryDomainFieldElement&*fiat.p384MontgomeryDomainFieldElement&*fiat.p521MontgomeryDomainFieldElementPI3 QƷ 3;Q3VQR|3qQ3`o 3|k3쮷13~p wV3Q `Z3Fp*O3Fpv[3 nkc3 n3K&*func(protoreflect.ExtensionType) bool 3vP `3W_83:  m3$`&*map[protoreflect.Name]*filedesc.Field&*map[protoreflect.Name]*filedesc.Oneof<|QQ3@&*func() *map[int32]impl.ExtensionField&*func(impl.pointer) protoreflect.Value&*map[protoreflect.Name]*impl.oneofInfo&*func(impl.pointer) *impl.extensionMap&*map[reflect.Type]*impl.coderFieldInfob3!Ql:3Ȣ3 r@I]3J^ D`33z ¹$3>`sW3G `35H 3w@I<3 uWH3PCs1 3Z_"3IH @:3bC"3m@bh3]H%Q3"`AXC3~;}3tB32A3a&33plL3@[=3`Κ|3Ae3@b53 Z3 BV33 e;S33P63) >j3R Ej33 Ba3!S` k m3 $3Z~mƽ3rU<3gs<>A3hs3HsJ3]s&github.com/cloudflare/circl/sign/ed448;3rsuv%3s@g¤3`t= 3s@tyb3`&github.com/cloudflare/circl/math/fp448e r3s|N3V[3/@ſvl3EſƔ3sſ&*[]struct { key string; elem float64 }B3tc3t=3`'*func(net.Addr, string, uint32, string)'*func(net.Addr) (net.PacketConn, error)'*map.group[string]zapcore.EncoderConfig'*[]struct { key string; elem []string }'*struct { F uintptr; X0 client.Client }'*atomic.Pointer[internal/godebug.value]'*func(string, string) (net.Conn, error)DistributionPointasn1:"optional,tag:0"'*iter.Seq[*crypto/x509.policyGraphNode]'*func(func(*x509.policyGraphNode) bool)'*map.group[string]*x509.policyGraphNode'*struct { key string; elem []x509.OID }'*struct { key string; elem net.byName }'*[0]*unique.entry[net/netip.addrDetail]'*unique.uniqueMap[net/netip.addrDetail]'*func(...zap.Option) *zap.SugaredLogger'*map.group[string]*proxymux.muxListener'*struct { F uintptr; X0 io.ReadCloser }'*map[protocol.StreamID]*quic.SendStream'*interface { SetReadBuffer(int) error }'*struct { key reflect.Type; elem bool }'*func(http.http2PushPromiseParam) error'*func() (*hpack.Encoder, *bytes.Buffer)'*func(io.Writer, map[string]bool) error'*map.group[uint32]*http.http2writeQueue'*http.http2write100ContinueHeadersFrame'*struct { F uintptr; X0 io.ReadSeeker }'*map.group[string]certmagic.Certificate IssuerDatajson:"issuer_data,omitempty"'*map.group[string]*certmagic.solverInfo LatDegreesjson:"lat_degrees,omitempty" LatMinutesjson:"lat_minutes,omitempty" LatSecondsjson:"lat_seconds,omitempty" DigestTypejson:"digest_type,omitempty" ModifiedOnjson:"modified_on,omitempty"DevelopmentModejson:"development_mode"OriginalDnshostjson:"original_dnshost" ErrorChainjson:"error_chain,omitempty" ResultInfojson:"result_info,omitempty"'*map[string]outbounds.PluggableOutbound'*struct { F uintptr; R *atomic.Uint64 }'*func(*ecdh.PublicKey) ([]uint8, error)'*func([]uint8) (*ecdh.PublicKey, error)'*iter.Seq2[reflect.Value,reflect.Value]'*func(int, int, *syscall.IPMreqn) error'*struct { key uint8; elem *pflag.Flag }'*func(string, []uint8, string) *[]uint8'*func(string, float32, string) *float32'*func(string, float64, string) *float64'*func(string) (map[string]int64, error)'*func(string, []int32, string) *[]int32'*func(string, []int64, string) *[]int64'*func(string, string, int, string) *int'*map[jwalterweatherman.Threshold]string'*struct { key string; elem *flag.Flag }'*map.group[tun.flowKey][]tun.tcpGROItem'github.com/sagernet/sing/common/control'github.com/sagernet/sing/common/network TypedValueprotobuf_oneof:"typed_value"'*func(bbr.Bandwidth, bbr.Bandwidth) int'*func(context.Context) ([]uint8, error)'*func(*wire.NewConnectionIDFrame) error'*map.group[uint64]protocol.ConnectionID'*func(protocol.EncryptionLevel) []uint8'*struct { F uintptr; X0 *bytes.Buffer }Responseasn1:"explicit,tag:0,optional" NextDomaindns:"size-base32:HashLength"'*struct { key uint8; elem crypto.Hash }VerificationURIjson:"verification_uri"VerificationURLjson:"verification_url" Descriptionurl:"description,omitempty" SnapshotIDjson:"snapshot_id,omitempty" EnableIPv6json:"enable_ipv6,omitempty" AttachVPC2json:"attach_vpc2,omitempty" DetachVPC2json:"detach_vpc2,omitempty" EnableVPC2json:"enable_vpc2,omitempty"DefaultPasswordjson:"default_password"'*govultr.ContainerRegistryRepoUpdateReq PublicHostjson:"public_host,omitempty"MaintenanceTimejson:"maintenance_time" TrustedIPsjson:"trusted_ips,omitempty" TableCountjson:"table_count,omitempty"HAControlPlanesjson:"ha_controlplanes" AutoScalerjson:"auto_scaler,omitempty" CookieNamejson:"cookie_name,omitempty" PrivateKeyjson:"private_key,omitempty" InstanceIDjson:"instance_id,omitempty" APIEnabledjson:"api_enabled,omitempty"ConnectionPoolsjson:"connection_pools"ForwardingRulesjson:"forwarding_rules"PrivateNetworksjson:"private_networks"'*[8]struct { key string; elem []uint8 }'*[]struct { key string; elem *ini.Key }'*struct { key reflect.Value; elem int }'*[]struct { key *yaml.Node; elem bool }'*struct { key interface {}; elem bool }'*struct { key string; elem *yaml.Node }'*map[netlink.BondPrimaryReselect]string'*map[string]netlink.BondPrimaryReselect'*func(int) protoreflect.FieldDescriptor'appendExtensionRangeOptions_Declaration'*func() protoreflect.MessageDescriptors'*func() protoreflect.ServiceDescriptors'*func(protoreflect.EnumValueDescriptor)'*func(int) protoreflect.OneofDescriptor'*struct { F uintptr; R *bbr.bbrSender }'*[8]struct { key uint64; elem []uint8 }'ackElicitingPacketsReceivedSinceLastAck'*func(protocol.ByteCount) monotime.Time'*func(monotime.Time) protocol.ByteCount'*struct { key int; elem *ipv4.sockOpt }'*func(context.Context, slog.Level) bool'*func([]uint8) (sign.PrivateKey, error)'*[]struct { key string; elem [2]int32 }'*[]struct { key gob.typeId; elem bool }'*atomic.Pointer[encoding/gob.encEngine]'*struct { F uintptr; X0 *gob.typeInfo }'*func(protoreflect.FileDescriptor) bool'*map[protoreflect.FullName]interface {}'*func(func(protoreflect.EnumType) bool)'*func(protoreflect.ExtensionType) error'*map[protoreflect.Name]*filedesc.Method'*func(impl.pointer, protoreflect.Value)'*func(protoreflect.Value) reflect.Value'*func(reflect.Value) protoreflect.Value'*interface { XXX_MessageName() string }'*congestion.SendAlgorithmWithDebugInfos'*func(mlsbset.EltP, uint, int32, int32)'*[8]struct { key string; elem float64 } TrafficStatsmapstructure:"trafficStats"(*[]struct { key x509.sum224; elem bool }(*map[server.HyStream]*server.StreamStats(*[]struct { key string; elem struct {} }(*[8]struct { key string; elem []string }(*func(interface {}) (interface {}, bool)(*[]*sync.node[interface {},interface {}](*func(*bisect.dedup, *bisect.dedup) bool(*[]struct { key tls.alert; elem string } PublicKeyasn1:"optional,explicit,tag:1"(*func([]uint8) (int, *net.IPAddr, error)(*func([]uint8, *net.IPAddr) (int, error)(*struct { F uintptr; X0 chan struct {} }(*go.shape.struct { unique.isEntry bool }(*struct { key uint32; elem []*abi.Type }(*func(func(*cobra.Command, error) error)Samplingjson:"sampling" yaml:"sampling"Encodingjson:"encoding" yaml:"encoding"(*func() (map[string]*v2geo.GeoIP, error)(*func(*quic.closeError) *quic.closeError(*func(protocol.StreamID) go.shape.*uint8(*interface { SetWriteBuffer(int) error }LevelKeyjson:"levelKey" yaml:"levelKey"(*struct { key string; elem *json.field }(*[]struct { key reflect.Type; elem int }(*struct { F uintptr; R json.mapEncoder }(*struct { F uintptr; R json.ptrEncoder }(*func(http.http2HeadersFrameParam) error(*map.group[string]*http.http2addConnCall(*struct { F uintptr; X0 strings.Reader }(*map[string][]certmagic.dnsPresentMemory Subproblemsjson:"subproblems,omitempty"(*func(*protocol.UDPMessage) (int, error)(*masq.altSvcHijackResponseWriterHijacker(*func([]uint8, []uint8) ([]uint8, error)(*func([]uint8) (*ecdh.PrivateKey, error)(*func(reflect.Value, reflect.Value) bool(*struct { key reflect.visit; elem bool }(*map.group[unsafe.Pointer]unsafe.Pointer(*struct { F uintptr; X0 *reflect.Value }(*func(int, int, *syscall.IPv6Mreq) error(*func(*abi.SwissMapType, unsafe.Pointer)(*func(*[]uint8, string, []uint8, string)(*func(*float32, string, float32, string)(*func(*float64, string, float64, string)(*func(string) (map[string]string, error)(*func(*[]int32, string, []int32, string)(*func(*[]int64, string, []int64, string)(*func(*int, string, string, int, string)(*struct { key string; elem *parse.Tree }(*func(string) (fs.FileInfo, bool, error)(github.com/spf13/viper/internal/encoding(github.com/sagernet/sing/common/metadata(*func(bbr.Bandwidth, bbr.roundTripCount)(*func(protocol.StatelessResetToken) bool(firstAckElicitingPacketAfterIdleSentTime(*struct { F uintptr; R quic.connRunner }(*struct { F uintptr; R *quic.Transport }(*struct { F uintptr; X0 *error; X1 int }(*map[string]*http3.roundTripperWithCount(*func(string, string) (io.Writer, error)(*func(string) (crypto.PrivateKey, error)(*struct { key string; elem dns.Handler }(*struct { key dns.SVCBKey; elem string }(*struct { key string; elem dns.SVCBKey }LastPaymentDatejson:"last_payment_date"(*govultr.DatabaseConnectionPoolCreateReq(*govultr.DatabaseConnectionPoolUpdateReqFirewallGroupIDjson:"firewall_group_id" Certificatejson:"certificate,omitempty" Descriptionjson:"description,omitempty"(*func(govultr.RequestCompletionCallback)(*govultr.ContainerRegistryServiceHandlerMarketplaceAppVariablesjson:"variables"(*struct { F uintptr; R *govultr.Client }(*[]struct { key uint; elem sign.Scheme }(*ecdsa.blockAlignedPersonalizationString(*func(*parse.Tree) *parse.IdentifierNode(*[8]struct { key string; elem *ini.Key }(*[8]struct { key *yaml.Node; elem bool }(*map.group[reflect.Type]*yaml.structInfo(*func(int) protoreflect.MethodDescriptor(*func() protoreflect.EnumValueDescriptor(*func(protoreflect.FieldDescriptor) bool(github.com/apernet/quic-go/internal/qerr(github.com/apernet/quic-go/internal/wire(*ackhandler.appDataReceivedPacketTracker(*func(monotime.Time, protocol.ByteCount)(*func(protocol.ByteCount, monotime.Time)(*func(monotime.Time) ackhandler.SendMode(*func([]uint8) (*handshake.Token, error)(*struct { key *syntax.Regexp; elem int }(*func(retryablehttp.ResponseHandlerFunc)(*struct { key string; elem sign.Scheme }(*[8]struct { key string; elem [2]int32 }(github.com/pelletier/go-toml/v2/unstable(*[8]struct { key gob.typeId; elem bool }(*struct { key *gob.typeInfo; elem bool }(*func(protoreflect.FileDescriptor) error(*struct { key string; elem token.Token }(google.golang.org/protobuf/internal/strs(*map[string]protoreflect.FieldDescriptor(*map[protoreflect.Name]*filedesc.Message(*map[protoreflect.Name]*filedesc.Service(google.golang.org/protobuf/internal/impl(*map.group[protowire.Number]interface {}(*map.group[reflect.Type]protowire.Number(*map.group[protowire.Number]reflect.Type(*func(interface {}) protoreflect.Message(*struct { F uintptr; X0 impl.Converter }(github.com/cloudflare/circl/sign/ed25519(github.com/cloudflare/circl/math/mlsbset)*func(http.ResponseWriter, *http.Request))*[8]struct { key x509.sum224; elem bool })*struct { key string; elem func() error })*[8]struct { key string; elem struct {} })*sync.indirect[interface {},interface {}])*[]*sync.entry[interface {},interface {}])*[0]*sync.node[interface {},interface {}])*[8]struct { key tls.alert; elem string })*func(tls.QUICSessionTicketOptions) error Extensionsasn1:"tag:0,optional,explicit")*map.group[string][]*x509.policyGraphNode)*[]struct { key string; elem []x509.OID })*func([]uint8) (int, *net.UDPAddr, error))*func([]uint8, *net.UDPAddr) (int, error))*[]struct { key string; elem net.byName })*func(*unique.node[net/netip.addrDetail]))*func(netip.addrDetail) *netip.addrDetail)*[]*unique.indirect[net/netip.addrDetail])*func(func(*abi.Type, interface {}) bool))*func(string, time.Time, time.Time) error)*struct { key string; elem interface {} })*func() func(*cobra.Command, error) error)*func(...interface {}) *zap.SugaredLogger)*struct { F uintptr; X0 []zapcore.Field })*func(func(int)) *list.Element[func(int)])*func(*list.Element[func(int)]) func(int))*struct { key string; elem *v2geo.GeoIP })*func(protocol.StreamID) *quic.SendStream)*map.group[protocol.StreamID]*quic.Stream)*quic.incomingStreamsMap[go.shape.*uint8])*quic.outgoingStreamsMap[go.shape.*uint8])*map.group[quic.pathID]*quic.pathOutgoing)*func(io.Writer) zapcore.ReflectedEncoder)*[]struct { key reflect.Type; elem bool })*[8]struct { key reflect.Type; elem int })*func(net.Listener, string, string) error)*func(net.Conn, *http.http2ServeConnOpts))*func(http.http2SettingID) (uint32, bool))*http.entry[string,*net/http.routingNode])*map[http.routingIndexKey][]*http.pattern)*map.group[uint32]*http.http2clientStream)*map.group[string][]*http.http2ClientConn)*map.group[*http.http2ClientConn][]string)*func(http.keyValues, http.keyValues) int)*interface { IsHTTP2NoCachedConnError() })*map.group[string][]*multipart.FileHeader)*struct { F uintptr; R *http.connReader })*struct { key string; elem acmez.Solver })*struct { F uintptr; X0 context.Context } LongDegreesjson:"long_degrees,omitempty" LongMinutesjson:"long_minutes,omitempty" LongSecondsjson:"long_seconds,omitempty" RRSetValuesjson:"rrset_values,omitempty" BearerTokenjson:"bearer_token,omitempty")*map.group[uint32]*server.udpSessionEntry)*outbounds.errSOCKS5UnsupportedAuthMethod)*struct { F uintptr; R *godebug.Setting })*func(string) (reflect.StructField, bool))*[]struct { key uint8; elem *pflag.Flag })*func(string, string, bool, string) *bool)*func(string, []net.IP, string) *[]net.IP)*func(string, string, int8, string) *int8)*func(string, []string, string) *[]string)*func(string, string, uint, string) *uint)*[]struct { key string; elem *flag.Flag })*func(string, string, func(string) error))*func([][]uint8, int, []int) (int, error))*func(func(netip.AddrPort, *udpnat.conn)))*func(*wire.StreamDataBlockedFrame) error)*func([]socket.Message, int) (int, error))*struct { F uintptr; X0 *quic.Transport })*struct { F uintptr; X0 *int; X1 *error })*[]struct { key uint8; elem crypto.Hash })*func(string, func(string) string) string NetworkSizejson:"network_size,omitempty"SupportedEnginesjson:"supported_engines" DateCreatedjson:"date_created,omitempty")*func(context.Context, string, int) errorAllowedBandwidthjson:"allowed_bandwidth" BackendPortjson:"backend_port,omitempty" HealthCheckjson:"health_check,omitempty" SSLRedirectjson:"ssl_redirect,omitempty" GenericInfojson:"generic_info,omitempty"AvailableOptionsjson:"available_options"AvailableUpdatesjson:"available_updates")*[8]struct { key uint; elem sign.Scheme })*func([]uint8) (*nistec.P256Point, error))*func([]uint8) (*nistec.P521Point, error))*func([]uint8) (*nistec.P224Point, error))*func([]uint8) (*nistec.P384Point, error))*struct { F uintptr; X0 *int; X1 string })*func([]uint8, properties.Encoding) error)*map.group[danger.TypeID]map[string][]int)*[]struct { key reflect.Value; elem int })*[]struct { key interface {}; elem bool })*[]struct { key string; elem *yaml.Node })*map.group[netlink.BondArpValidate]string)*map.group[netlink.BondFailOverMac]string)*map.group[string]netlink.BondArpValidate)*map.group[string]netlink.BondFailOverMac)*func() protoreflect.ExtensionDescriptors)*func(int) protoreflect.MessageDescriptor)*func(int) protoreflect.ServiceDescriptor)*func() protoreflect.EnumValueDescriptors)SetStartNewAggregationEpochAfterFullRound)*func(congestion.ByteCount) monotime.Time)github.com/apernet/quic-go/internal/utils)*func(monotime.Time, bool) *wire.AckFrame)*ackhandler.skippingPacketNumberGenerator)*func(*jsontext.Encoder, time.Time) error)*[]struct { key int; elem *ipv4.sockOpt })*func(context.Context, slog.Record) error)*struct { A spew.t0; spew.t0; a spew.t0 }ErrorDescriptionjson:"error_description")*func([]uint8) (*fiat.P224Element, error))*func([]uint8) (*fiat.P256Element, error))*func([]uint8) (*fiat.P384Element, error))*func([]uint8) (*fiat.P521Element, error))*map[string][]protoreflect.FileDescriptor)google.golang.org/protobuf/internal/order)*map.group[protoreflect.Kind]reflect.Type)*map[protowire.Number]reflect.StructField)*struct { F uintptr; X0 impl.structInfo })*struct { F uintptr; X0 *filedesc.Field })*func(monotime.Time) congestion.ByteCount)github.com/cloudflare/circl/internal/sha3 BindInterfacemapstructure:"bindInterface" TCPForwardingmapstructure:"tcpForwarding" UDPForwardingmapstructure:"udpForwarding" RewriteDomainmapstructure:"rewriteDomain"**struct { key string; elem zapcore.Level }**struct { F uintptr; R *cmd.clientConfig }**struct { F uintptr; R *certmagic.Config }y/{3Q`r U3qTT4N3/tT#cHm*34a3#^3TЄ3h#|\Q @V`Htv3#<~3N*  o3 uTT3JUccID -`  -I`z{j3uIIf - @Ϗ3H @ @arsY -`B|`W``dl X``R=& X 9@WeY```j* `Z`\f8 [`XU(< [ `XULx \`X=tҺ`]R3(tT,xG: 0V I 0TT@% 0 V $$qL(&@D`IwkP$l 8.-`T`¹HH_T,9@D`.,-- -EV llNqX0L@D` 3$ 0RV  =M`\_@D`\(`ȵr@D`z1R-!u- nߕ-~¹ KKd¹ Vi,"hxT`¹ Tlm 0`T ѺlD¹ pH¹@@یtPƽ¹'^ j38T.}8 -V  0T**func([]uint8, []uint8, bool) interface {}**[0]*sync.entry[interface {},interface {}]**func(*godebug.value, *godebug.value) bool**func(unsafe.Pointer, unsafe.Pointer) bool**struct { F uintptr; X0 func() hash.Hash }FJ3V\#Hr}3#`;sеe`a(3ē`#``iYD d  3@<#]y3U#w3hT= gc 0 T Z^L3Ur31##cK 0`T { 2,T Jh3JX}|_  2#TH3c# 93KT#nH3v@V#d3@V#N3;# 3X# 35#ٓ 3v#3z3hO3U xpN - `$35UX\":3o[3=NNb -N?Arj3@@ĵ]V -S@ @@/ ``Y3M, -= ɀ` - ݀3  Wge - r?73I38Xi^3XgѨ3UX`\Wȭ~@e`̭C f u{\f@@WP g !tU@h`Ť ԭPiڮ 2ӉTf (2މTjr3X#6t63O#^ - P - `@@𚥓) `00( 82  0 {q @2T44K 2@7 0 @kMs H2)4V 44B6 2W`q{ |- V  - V  0&`V   0dVྐྵ X2`ࡹ`Ei zB -`ࢹ@* . `2T@~x+ h2K 03`Ѕ (.ȯ*OK0` }K L<;} |-]wRz ,.LT\| h2pT{ p2WT (2= 0`q 0 f1X x2 `@$? 04`T@ 27f}M`AdditionalPrimesasn1:"optional,omitempty"**[8]struct { key string; elem []x509.OID }**struct { sync.Once; v *x509.Certificate }3swX] 3 @Xnj3#J3. `䨧3*V@X?g3`XEf3@#G3`#:$3dX@<ݲX( m`z3' `7X``nDȷ @n>® o৹#)o `Xηp`($׿(`T`¹A L] 0ܰTBlWV 2TB 1|-ؤ` ó Ox` k $6h}+1Ϳਹ e |-_`(0l 02Vྐྵ l 0@U $ 3 T~' 2T,ƶ 3Tܚ35Xz3#XZy30T#/ *3;@UX`-3L@VX@x7|39!TX?-03NT@VT~3q@VXDi p3TDw}Y3exT@U83@Y@U**func([]uint8) (int, *net.UnixAddr, error)**func([]uint8, *net.UnixAddr) (int, error)**[8]struct { key string; elem net.byName }Jɳ3VT`F'e3M!@V@V'3u!@DXR3s@D-371#3#;O#3i#=3F#/3V#<37cXd6=3X|3HJ#wE3I#N3MMVXKP<3 W@# 3 #h38y@ViW3v`#}3XX9? `r }8P3xT`¹`\ȭ s `\ u ȭǗ s```&Zg tV8d`u୹TH'3+yX/32T#3@VTC3TXy7pY 84TPд-& `ǥC"e U`=-r3 @>Dq3\X**func() *unique.node[net/netip.addrDetail]**func(*unique.entry[net/netip.addrDetail])**[0]*unique.indirect[net/netip.addrDetail]P~% -b> :3  , - @@/E `@3=O33P++4 -]+LG3X>C -duZ3`O`O?V - `OО3zI{ - @@p`Z?3P -И @B_3``F( @xx;: y33OXp3 8Xbj3yO@Vo03TOb}3OTƔ3BWyX`^v -D @h -6\ -j `kY -\- @@Ä)( @ -j@I 4B V 4ņF h2V M -ñ@u 4гT`g3`I#>31#1%3#*3m#H3e"U#@BS3!#gZO3?`#VW} -=O@V`l 5T 0Uཹ@@xL/ z**struct { key int32; elem unsafe.Pointer }**[]struct { key uint32; elem []*abi.Type }**struct { key unsafe.Pointer; elem int32 }@@C})PГ @{Ĺ 1ri -zWx Ź44 G 2@N@X¹  `cY3VV B 7z`Ź 0 0r8]Źm3 VVJ 7 3zDŹ 0P 3( ƹl 5l_z JƹPt 5uz`Ź q1] 0O`ƹ]= -\Vྐྵ  7o ǹDkzH 77V  B 7f`V ~6M 27V 8K 7XKǹ{ 7 V p# 78Tަ - ȹen -`ȹJt 7v`Nȹ:u 2U ȹP* 78` ɹ pb 7TiU 3E$UU@P 7 T@  7-VྐྵDys[3o @NN3m$UXZ3VV@7 88 T@03}{VV s x2T $ 04TM 1|-$@X¹] -Uཹ5 X2 T@E! 0$VྐྵL&3{T`p)  8Tp7 2Vྐྵ 3+M -lUཹ@@~ȭPc? `| ˹@'D~ }`˹`\ORPʨ }˹a]T- ~ ̹(ct`N ``̹x'// ̹@<.X? ̹0< 82 T0^3lUX\= 7`T23$@U@Ui 0Uཹ S33_PXX@҈LhP͹ΙPT`¹$Ip 8 V ҟ` ι O 7 `T 1 P8$T ActG X8TA  3E@V`# 2> T ]tM\o9`Jz$3 %T#lfA H9@T`lB؂ -@U`hX3UU `1 08UཹGs 2ɐ@T``^ P9Ԑ@T`` , 0ߐ@U`87s 7P@U`3 0%o@T` h9T\3+3UcNB3ϧcX03|c@Vc3V@ccL3c"Nap3T@VB*3cc39Xt ( й[4 h2L@V`6/30VXA3I%@VƴI9@й ]%Sй**struct { key string; elem reflect.Value }Ly\3Ӕ@V@V@3w@`¹s3Yx@#3@#dZ3X:T35#N+p|3p`¹#\$wG3T¹@@O@ѹ``m|/ ҹ``p^hP `ҹ``|Twk ҹ9m,Yx? @ҹ00h p¹!T ӹ-3YTk,03^yTL3TW[N?3,PTU63APT`ƞ,3&TV{X3|TVt36#T8 ӹ+Tj Թw+O^`Թ**struct { F uintptr; R *zap.sinkRegistry }lt3#zy3T@c3¹@rr3Թ@$3T`F*3;TGG*3Ȣ`Gs;[3AԹG&30;WX =3{#``'f' ֹ``rG>ֹ3 G\U-i%ԹO C3c **map.group[string]*forwarding.sessionEntry``T# ׹ :3K;V#M)3y8#``Ӧ  ׹T@38#8x |-T@V`*}3\#n30 @@I$3Y`@ 3@`**func() (map[string]*v2geo.GeoSite, error)``. `ع`` ٹFLk3ٿ#ė37@ٿ#*github.com/apernet/hysteria/core/v2/client**func([]uint8, *protocol.UDPMessage) error**quic.incomingStreamEntry[go.shape.*uint8]f_3zm#$3-#@@QqRP @ٹ|R~@۹} ?3V/ mXTI3m#|/*@۹ܓu3 mt`` iu ۹43ھm ⾵63 #`` ܹ@<3vt#Tku3XQH3/@ڹXZ32V43a@ڹ{3hA v53P @ڹEL -}Ƹݹ*I3ƸƸh -@ݹs3N  ,3[X|ǩ<T@WqS3ETW'~3TWu3TW +3-(T@Vs3S~TT,n;3i~TU'e3|QT@TW03_Tc @Ϋ3QTV >'3jTU3TU\^$3TVe33~TT 3TV{C3Y<@DXtw3A `?Q3\` 0`o@M3[ B#^q 35(UY3cTɧqN3QW@VK3)AT+R `\j=ȭA `@`\lȭ ^l31=`**[]struct { key string; elem *json.field }**[8]struct { key reflect.Type; elem bool }**struct { F uintptr; R json.arrayEncoder }**struct { F uintptr; R json.floatEncoder }**struct { F uintptr; R json.sliceEncoder }3W#97G3U#`\y|ȭU M~3Bk@V@V.V03L=`X``!i @`\ȭI`\@ȭ@3[`#**func(uint32, http.http2OpenStreamOptions)**map.group[*http.http2serverConn]struct {}**struct { key *http.conn; elem struct {} }**func(func(http.http2Setting) error) error**struct { key string; elem http.muxEntry }**map.group[*http.persistConn]*list.Element**map[*http.Request]context.CancelCauseFunc**func(string, *tls.Conn) http.RoundTripper**struct { F uintptr; R *http.http2stream }**struct { F uintptr; R *http.persistConn }**struct { F uintptr; R *httpproxy.config }**struct { F uintptr; X0 *http.connReader }W=3U \3LU13z@X Ru( h3T 3U39# 3(#[é3_I#uF[3t#w`3#V^3Ζ`VHq3`]#o|@^3 `X@< ;X$ @O:63“)30#(#3=%#UN3[ #Rj3\ 3~T@UuM3l#``GR&`.!|3vg3ˣV\@<T2aX, @<{XSB @lt3]@@0P1 fO;3pM@P#r3@V9! 3tSU#``1 `-$ 33|T@,'nu3  Tл$жB @@rP @81ξ@| `62 @@#% @@$e 䬎S `@``Js`x bA3T-@@q2P} ``q2 Zv ``` xϽ& ``塸7X @|o3U#״3| `¹l 2DT{t =WBT`\/ȭ ``\è ȭ`2 `\SWȭ{ @@V)*Plk@ n2 ``\7ȭ 51(  5p @T2 `H\3%@9W3U%@EY3@,@, -@]((}Dذ¹(ZvH9_҈3}#-7y3;`¹%73%%**func(context.Context, string, bool) error**map.group[string]*certmagic.soaCacheEntry**struct { F uintptr; X0 *certmagic.Cache }ϷM3d#)ru3 YXlt @ [<3/T``?JD3 ``댑) ```G & ``[]i8 @L ```\=P` آxU t1fX3 @ BT+4 `;̬ nT2 04 8 Y] K@D`(^@D`  zsidq@D`N 2`3'#``T\ @`\%s|4  p|%Gl8 *github.com/apernet/hysteria/core/v2/server3 <L53U#sѿ3UT@@f3ZP~ @]b@3.@V'3˰T A!3.VX*github.com/apernet/hysteria/extras/v2/auth*github.com/apernet/hysteria/extras/v2/masq**func(*outbounds.AddrEx) (net.Conn, error)3&` T3 -XrX3( -&N<TQw %|` 3@ '\ =f`V ?m/ >?TmG' 2yW@ *github.com/apernet/hysteria/core/v2/errorsV3,#3d#~q3`#z3X}=m3;#ME -@@ G3 #83VX6x -D+ @ SD -P@ϹH ?'3c#AW3cX-]p -W ϸ}3%!> -ॹE3e3[3`9| 7VྐྵLLp P2Uཹ<g< 3Uཹ3``I33`֎W3+`<13UU Uat >T % >ͅ@= "f_ >@=  [>C >T**func(io.Reader) (*ecdh.PrivateKey, error)P 4` p 0`d3X@Ve3ȟ@VVVy3W@3``.33o3RUt&o3VR3V@VT=aVȬU@ *vendor/golang.org/x/crypto/cryptobyte/asn1**[]struct { key reflect.visit; elem bool }**struct { F uintptr; X0 []unsafe.Pointer }x3" XL3u@V`uQ3]``3@V kT31’f3N `Y 3C"@V`{3```~3T`@301`ө3 ``8C3@WX-F+3XWXC 3`XTG3``Tn43 B@V`@<;X]5 @<3KXF! @ ft/x) `@@MX ``fg @`̣3ě=XTj^3@V=`XJp4u ?:T`\Zȭ! `\hȭ! `\shYȭb @@=E13ZY#``^Te @'?!3N#|" 1|-56[03s@V@q3@Vi4 -VྐྵFM+ -2@X¹ˆ3Y@UU"3YUV3$`0t \3`0I?3`@X**[8]struct { key uint8; elem *pflag.Flag }**func(*bool, string, string, bool, string)**func(*[]net.IP, string, []net.IP, string)**func(*int8, string, string, int8, string)**func(*[]string, string, []string, string)**func(*uint, string, string, uint, string)**func(pflag.Value, string, string, string)te *@@nvPL@yD3Tf**[]struct { key string; elem *parse.Tree }``@ "3'¹TU 0@ Կ``\oȭEx |> 0LDQ3B`¹#N! 7|JTx}# @**[8]struct { key string; elem *flag.Flag }``N]Vf838T@i/Hc3{#TC(-# ù; ٝ# ùRy3[@VJݢ3F@U@T13HUA3`UU3xVRg35Um! 3LU!a3cV?[ BtT?xh |-Uཹk 32# ȐK3e`X#**func(netip.AddrPort) (*udpnat.conn, bool) (32b#*3bH `zIb ̻ y"7 !@@:kP @!F 03U༸7H"3d@@*3("@fcl3@"@ȷ"! 3qysH3@ @ =@r٫<#j@iȷx%૑ 1|-`@!wp D֞# ùHqbvT /33@VTZ3iV# &M3X;3e$ X]3$``\0ȭs(`X(_ 3$@VG3F3@V )EE3st廇3p `t'<3N" w H**func([]uint8, uint16, protocol.ECN) error**func(protocol.StreamID, *quic.SendStream)**func(*quic.Transport) (*quic.Path, error)**func(context.Context) (*quic.Conn, error)**quic.retransmissionQueueInitialAckHandler**quic.retransmissionQueueAppDataAckHandler**func(protocol.Version) protocol.ByteCount**struct { F uintptr; X0 *quic.streamsMap }**struct { F uintptr; R *wire.StreamFrame }**struct { F uintptr; X0 *quic.baseServer } 3T`¸Q3T`¸3'u3Os83HG#®>Z4 @@/t/3 3 @7x3 c#3 @@4 0ؚ3* m>nP3m a4 0;3 y#43Jc@l#r3D3 m5Z3X”3#3`#:$#3#9j! @1rd3 #z3Ͱ@XY&40#5 27 @2c3# 4Z}h3ÀZ3_V#E3#663 u `2 02Gs[3`E#@3_`Eˑ3c `EFd3Ⱦ`EX ԭf5 3_ԭt@3>L3$ m?o`3PE@lXmL 3-t#/3O`#U3 #=A>3X6 o#3' `Et -x 0|4P h2u4zE34$ ̸̸=$^' -&̸@5g3mu 1|-Fd@1Y( ٌ.+-yJ0١3uX**struct { F uintptr; X0 *http3.Transport }``$}P 7%lO7a%3;#r3\@#39& ##O3d>X``S 9X`3H7`=ߗ`37 |-ˍm@.n xCU`_ȏ3@V`:3d@V+x3f$ --L<{b@.j3}f#=37#) ATq3]#```x(7 :iP3#4a3T`¹YL 3 @:Ӹ:QDؽ`:'wP ;rO@3U#z -ǹ`B`;xKc:Ȭ9`xKW @<$@ 8L@V` LLQ <**func(*dns.zlexer, string) *dns.ParseError**func([]uint8, *dns.TSIG) ([]uint8, error)**[]struct { key string; elem dns.Handler }**[]struct { key dns.SVCBKey; elem string }**[]struct { key string; elem dns.SVCBKey }**struct { key uint16; elem func() dns.RR }**[8]struct { key uint8; elem crypto.Hash }{1o3`iXR 39@Xi=d3T(P3T޻ 3'1`3Ti^3c@#3N#]r3~eT" >S3F#`\j:ȭ4" ?`XMa" `?`XQG ?@@@PJ ` ?`\,v ȭ8R @@SL `@`\lȭ@ Z  L >(4|3!`#'d3e@V03@U@VRl3W`ǃ3f9`N'L3'`x(}3G9X`3e\Xoch -L@V`Ӵt3h @X3U #StartupScriptIDjson:"script_id,omitempty" Applicationsjson:"applications,omitempty"**govultr.ContainerRegistryRegionDataCenterRedisACLChannelsjson:"redis_acl_channels"RedisACLCommandsjson:"redis_acl_commands"te@9`G. 31#``VkD [.3#k{3Ur#k A+ۡ\۝3hTn35Ug``,]44=* 2W \i5 (.@Z 0@Z53K**func(*nistec.P256Point) *nistec.P256Point**func(*nistec.P521Point) *nistec.P521Point**func(*nistec.P224Point) *nistec.P224Point**func(*nistec.P384Point) *nistec.P384Point,3d^@Vr3l !y @ET!S 53@V =9*3``Ccޙ PETC(l HEDx@?^q3ĵ9/>Q `ET9 *b XE s?`_8G^3a/ pETa1'0 xET1UV hE?_` rL E ``F EV!k-3D`d M/3E lQ&3dyu3Xdl_33 V w3 ͹ ͹R338KFX2XE E$T2 @8TbD @8Vྐྵ*crypto/internal/fips140/edwards25519/field<4x7@`3"3^<ǰ3<`X! @a`XSE & a@ mx&=@b. 1|->bczq 1|-[ib߮pH @c``4?cX) d**func(string, time.Duration) time.Durationi[3k @d`cV3T`$3$8 \`**[8]struct { key reflect.Value; elem int }@@+ @ex.¯L`e**struct { handle []uint8; suffix []uint8 }**[8]struct { key interface {}; elem bool }**[8]struct { key string; elem *yaml.Node }6Wv3  #@<H;X@i`\lȭ j@8;k0 `j``# j``u,D@jPXж k`\ Sȭ& k*github.com/sagernet/sing/common/exceptions**struct { key int; elem *nl.SocketHandle }3Xt)3|L XrM 0X0,&L@k83LvX*N3X`\;ȭ !l`\?2<ȭW5 @"l`\̍ ȭ # m`\3<ȭ #`m`\yF*ȭV $m`\u#ȭ"' @%m`\/_ȭy & n`\Z+(Hȭpl &`n`\ɔlȭ9 'n`\غ ȭ @(n@@^PN ) o`XK³ )`o`XÝ5 *o`X)H @+o`X8 , p`X'yd ,`p`X'-z -p`XCl @.p`XOy: / q`X& /`q`Xw 0q%3b~3rnXK&3 8X((OH 028UA r~6 1r̐L3`K@Vf3:/3f3L@0@2**func(string) protoreflect.FieldDescriptor ]3zXw3 `{3Xu3qN SV3 S;3 !I3#@V!3, HVӧ3H@VHWZ+3 Wٴ3;@V3e @#3s@V@3@X'3m @ TE3m @ UQ3c@V s3Hs@V3@@V! -s t3@VѼ3?sX&36 @13$ s@xbi3l& @V@‚3д l3d@V3l@V`K&M -U`t&35@VӼFL3^X U3T!j93 !3߾ `j%/f3@V`j6#Y3 @Vp30 ! ,3!X:3(deUH3X 3Pd]` 3 !X3d/ `j!oE3r@V3@Vx</ 4t;[3' s`Td43@VC+3@V**map.group[int32]protoreflect.ProtoMessage``qm+ 4t֏{Xȍ 5`u**func(monotime.Time, congestion.ByteCount)93 vt&]Ŧ3@lv t` 0)g?f3uvXZB3v@lxl (>B sv?c)3oTEpϣ3NX35zu35@T3v@lP3v@l**func([]uint8, protocol.Perspective) error39 uúl3tX.B`7`w;&3BE^h3@"X**func(protocol.PacketNumber, protocol.ECN)3p3 tEo3 `E@lu)3R@X%h3 tty~U3"Xt>X30XEpy37@lu3au@lmd3@lǭ3 t`3 t`[ZP: {n3 A#x=3 v#2:3z#{jS3 A# 3 v#I 88Tz xHTƒ[3xXXi3x Xxx?p[`{L3`{`o;0r3qT`oZ3g¹23qT2T :{3@A=/3#NC 3 |`]@|ؽ|Y|P ;|ؤ 2,Uཹ| H{}@V`<L @;}@V`D r~ p3,@U`@ʠ 08@U`7u3!X.ǒ 2~ **[]struct { key *syntax.Regexp; elem int }**struct { key *syntax.Regexp; elem int64 }LE 1|-E`@<E4RXM' @<`X@-O =aWh( = `X O >`7K83O \3q6#`\mGȭ! ?`\=ȭ! `@@`\kHȭ A`\t_ȭb Ap  8\ B@**[]struct { key string; elem sign.Scheme }"vTz' CV^3QXy@3q pX|M33 iE!D3 +Ҿ H-@TN H-TЫ H-TO 9u I-TO Z( (8-T**func(*fiat.P224Element) *fiat.P224Element**func(*fiat.P256Element) *fiat.P256Element**func(*fiat.P384Element) *fiat.P384Element**func(*fiat.P521Element) *fiat.P521Elementq3L@Va3%3j@V3o3@Vr3|3@V 3eh3 @Vx 3)  t#]D@- 3 .38 `TTQb3s `¹}3`oX6>K3ߍ#**func(*gob.encEngine, *gob.encEngine) bool**[]struct { key *gob.typeInfo; elem bool }@Dy=3IT -EG n@w3Z n n@<,X' E@@ڲP< @F``_) G``Vq G@ٔw̭< H*google.golang.org/protobuf/internal/errors*google.golang.org/protobuf/internal/pragma**func(func(protoreflect.MessageType) bool)3XJ3 `@VsC37 `` .3#+*bT{ I@ u- `Jvi3lCX;3HDXxHZ3XH3  ` U3C#{3D#wQ 3k#``G} K``Ĝ?[K@**[]struct { key string; elem token.Token }`X' L**map[protoreflect.Name]*filedesc.EnumValue**struct { key filedesc.pathKey; elem int }**map[protoreflect.Name]*filedesc.Extension``[ N @@tP `O``XEy@p P``b!q P``@^ Q @@_ Pj7 `R`TTEp ST S ``PNT```؈*r `U%3`F#@Jۥ V```کV8 V``^>Z W ``6F} `X``zL Y` Y^2Q @Z``J]@ [``0 [ $ \``Y- ] **func(impl.pointer) protoreflect.RawFields**map[protowire.Number]*impl.coderFieldInfo**map[protoreflect.Name]reflect.StructField**struct { F uintptr; R *impl.MessageInfo } 3#bM7t3} `K`K¨F3 DyZ3։ DeVg3¿@I2BV3  )O3S3@IX$3@Ip;3Ҧ@I@@踬P9 `^e3@I``ĉr _``g _@#3, @IW5%3( @I3 >|3n+ >X"3% >-|S3`@I!H-3  @@X;P `G"m,) `a@;\IL b`\Iȭ b``h\8 c@3tbZK3`K3$```T]s `d@eO̭O eű3ÿ@V13WS@q@Vx$3E@qÿxĨ)3V@Vw8|3j@qR13%@lvZp3#**struct { F uintptr; R *socket.syscaller }]/3`#` C Jj0T` `KS Jx0T`` O J0T`  0J0T vx / 8J0T ^u3W4`oT'B3W4sT,;3sX(P `JxT PD 8<1T @ pJJ1@T@ {Z xJX1T  pI Jf1T "3 Jt1T Ţ3X}"3?  Xx3a X4i3>||!CԨ3@)@)\D3*github.com/cloudflare/circl/ecc/goldilocks}.Le3aſ@ſtȧi{ (I1Tt A K1Tt '{3#Q&3`Xo 13#{3#luv3@*@*qD;3``K{#3>````'3T+*[]struct { key string; elem func() error }+*struct { F uintptr; X0 *cmd.serverConfig }+*struct { F uintptr; X0 string; X1 string }+*func() ([]uint8, *tls.SessionState, error)+*struct { F uintptr; X0 *x509.Certificate }+*func([]uint8) (int, netip.AddrPort, error)+*func([]uint8, netip.AddrPort) (int, error)+*struct { key string; elem map[string]int }+*struct { F uintptr; X0 *net.pipeDeadline }+*func() *unique.entry[net/netip.addrDetail]+*sync.node[*internal/abi.Type,interface {}]+*[]*go.shape.struct { unique.isEntry bool }+*map.group[chan<- os.Signal]*signal.handler+*struct { key abi.TypeOff; elem *abi.Type }+*[]struct { key string; elem interface {} }+*[8]struct { key uint32; elem []*abi.Type }+*map.group[pflag.NormalizedName]*pflag.Flag+*[]struct { key string; elem *v2geo.GeoIP }+*struct { key string; elem *v2geo.GeoSite }+*func(string, zapcore.ArrayMarshaler) error+*func(zapcore.Entry, []zapcore.Field) error CallerKey!json:"callerKey" yaml:"callerKey"+*struct { F uintptr; X0 *context.timerCtx }+*[8]struct { key string; elem *json.field }+*struct { F uintptr; R json.structEncoder }+*func() (http.http2FrameWriteRequest, bool)+*func(uint32, bool, []uint8, []uint8) error+*http.mapping[string,*net/http.routingNode]+*[]http.entry[string,*net/http.routingNode]+*func(*http.Request) (http.Handler, string)+*struct { key http.ConnState; elem string }+*struct { key string; elem []*http.Cookie }+*func(*http.Request, []*http.Request) error+*struct { F uintptr; X0 *http.http2Server }+*struct { F uintptr; X0 *http.http2Framer }+*struct { F uintptr; X0 *http.persistConn }+*struct { key string; elem chan struct {} }+*[]struct { key string; elem acmez.Solver } LatDirectionjson:"lat_direction,omitempty" MatchingTypejson:"matching_type,omitempty"OriginalRegistrarjson:"original_registrar"+*struct { Status string "json:\"status\"" }+*func(server.HyStream, *server.StreamStats)+*struct { F uintptr; R *server.h3sHandler }+github.com/hashicorp/golang-lru/v2/internal+*struct { F uintptr; X0 *error; X1 string }+github.com/apernet/hysteria/extras/v2/sniff+github.com/apernet/hysteria/extras/v2/utils+vendor/golang.org/x/crypto/chacha20poly1305+*[8]struct { key reflect.visit; elem bool }+*func(string, []float32, string) *[]float32+*func(string, []float64, string) *[]float64+*func(string, net.IPNet, string) *net.IPNet+*func(string, string, int16, string) *int16+*func(string, string, int32, string) *int32+*func(string, string, int64, string) *int64+*func(string, string, []int, string) *[]int+*func(string, string, uint8, string) *uint8+*[8]struct { key string; elem *parse.Tree }+*struct { key netip.AddrPort; elem uint16 }+*func() v2geo.isDomain_Attribute_TypedValue+*bbr.entry[go.shape.uint64,go.shape.uint64]+*func(go.shape.uint64, go.shape.uint64) int+*func(protocol.ByteCount) *wire.CryptoFrame+*func() (handshake.LongHeaderSealer, error)+*struct { F uintptr; X0 *error; X1 *error }+*func(io.Reader, *http3.headersFrame) error+*struct { F uintptr; X0 *http3.ClientConn }+*func([]uint8) ([]hpack.HeaderField, error) Certificatesasn1:"explicit,tag:0,optional" PublicKey!dns:"size-base64:PublicKeyLength"+*[8]struct { key string; elem dns.Handler }+*[8]struct { key dns.SVCBKey; elem string }+*[8]struct { key string; elem dns.SVCBKey } RefreshTokenjson:"refresh_token,omitempty" ReservedIPv4json:"reserved_ipv4,omitempty" AppVariablesjson:"app_variables,omitempty"+*govultr.ContainerRegistryDockerCredentials ReadReplicasjson:"read_replicas,omitempty" LatestBackupjson:"latest_backup,omitempty" OldestBackupjson:"oldest_backup,omitempty" ResourceTypejson:"resource_type,omitempty" NodeQuantityjson:"node_quantity,omitempty" FrontendPortjson:"frontend_port,omitempty"AvailableVersionsjson:"available_versions"AvailableUpgradesjson:"available_upgrades"ConfiguredOptionsjson:"configured_options"+*struct { key string; elem parse.itemType }+*struct { key string; elem []*ini.Section }+*func(string, string) (string, bool, error)+*struct { F uintptr; X0 *properties.lexer }+*struct { key string; elem yaml.fieldInfo }+*map.group[netlink.BondArpAllTargets]string+*map.group[string]netlink.BondArpAllTargets+*map.group[protoreflect.Kind]protowire.Type+appendEnumDescriptorProto_EnumReservedRange+*func(int) protoreflect.EnumValueDescriptor+*ackhandler.sequentialPacketNumberGenerator+*func(protocol.PacketNumber, monotime.Time)+*func() (handshake.LongHeaderOpener, error)+parseLiteralHeaderFieldWithoutNameReference+*[8]struct { key *syntax.Regexp; elem int }+*[8]struct { key string; elem sign.Scheme }+*[8]struct { key *gob.typeInfo; elem bool }+*[8]struct { key string; elem token.Token }+*struct { F uintptr; X0 *[]order.mapEntry }+*struct { key protoreflect.Name; elem int }+*map.group[protowire.Number]*filedesc.Field+*map.group[protoreflect.Name]*filedesc.Enum+*map.group[protowire.Number]*impl.fieldInfo+*func(impl.pointer, protoreflect.RawFields)+*func(protoreflect.ExtensionTypeDescriptor)+*struct { F uintptr; X0 *impl.MessageInfo }+google.golang.org/protobuf/internal/descfmtMaxIdleTimeoutmapstructure:"maxIdleTimeout"DisableTLSALPNmapstructure:"disableTLSALPN"AltTLSALPNPortmapstructure:"altTLSALPNPort"UDPIdleTimeoutmapstructure:"udpIdleTimeout",*func(server.StreamState) server.StreamState,*map[string]*trafficlogger.trafficStatsEntry,*[8]struct { key string; elem func() error },*[]struct { key string; elem zapcore.Level },*struct { F uintptr; X0 chan cmd.modeError },*struct { F uintptr; X0 **certmagic.Config },*func(string, []uint8, int) ([]uint8, error),*func(func(interface {}, interface {}) bool),*func(*runtime._defer, *runtime._defer) bool,*sync.HashTrieMap[interface {},interface {}],*func(*sync.node[interface {},interface {}]),*[]*sync.indirect[interface {},interface {}] NamedCurveOIDasn1:"optional,explicit,tag:0",*func(string, string, syscall.RawConn) error,*struct { key string; elem []net.nssSource },*sync.entry[*internal/abi.Type,interface {}],*struct { key *abi.Type; elem interface {} },*[0]*go.shape.struct { unique.isEntry bool },*struct { len int; buf [128]*runtime.mspan },*[]struct { key int32; elem unsafe.Pointer },*[8]struct { key string; elem interface {} },*[]struct { key unsafe.Pointer; elem int32 },*struct { key string; elem map[string]bool },*[]struct { key string; elem reflect.Value },*struct { key string; elem viper.FlagValue },*map[string]func(*url.URL) (zap.Sink, error),*[8]struct { key string; elem *v2geo.GeoIP },*struct { key uint32; elem *client.udpConn },*func(protocol.StreamID) *quic.ReceiveStream,*func(context.Context) (*quic.Stream, error),*map.group[protocol.StreamID]go.shape.*uint8,*func(string, zapcore.ObjectMarshaler) error,*[]struct { key zapcore.Level; elem string },*struct { F uintptr; X0 *context.cancelCtx },*struct { key interface {}; elem struct {} },*func(uint32, http.http2PriorityParam) error,*func(*http.Server, *tls.Conn, http.Handler),*func() (net.Conn, *bufio.ReadWriter, error),*[]struct { key *http.conn; elem struct {} },*[]struct { key string; elem http.muxEntry },*func(*http.Request) (*http.Response, error),*interface { UnencryptedNetConn() net.Conn },*struct { key http.http2Flags; elem string },*func(context.Context, string, string) error,*func(context.Context, []string, bool) error,*func(context.Context, acme.Challenge) error,*map[string]*certmagic.RingBufferRateLimiter,*[8]struct { key string; elem acmez.Solver }DomainRecordsHrefjson:"domain_records_href" CAAIdentitiesjson:"caaIdentities,omitempty",github.com/hashicorp/golang-lru/v2/simplelru,*func(weak.Pointer[crypto/ecdsa.PrivateKey]),*func(*big.Int, *big.Int, *big.Int) *big.Int,*struct { key dnsmessage.Type; elem string },*func(*[]float32, string, []float32, string),*func(*[]float64, string, []float64, string),*func(*net.IPNet, string, net.IPNet, string),*func(*int16, string, string, int16, string),*func(*int32, string, string, int32, string),*func(*int64, string, string, int64, string),*func(*[]int, string, string, []int, string),*func(*uint8, string, string, uint8, string),github.com/spf13/viper/internal/encoding/hcl,github.com/spf13/viper/internal/encoding/ini,*struct { key uint16; elem *tun.TCPSession },*func(netip.AddrPort, netip.AddrPort) uint16,*func(*buf.Buffer, metadata.Socksaddr) error,*func() (handshake.ShortHeaderSealer, error),*quic.retransmissionQueueHandshakeAckHandler,*struct { F uintptr; R *quic.connIDManager } RequestorNameasn1:"explicit,tag:1,optional",*map.group[crypto.Hash]asn1.ObjectIdentifier,*[]struct { key uint16; elem func() dns.RR }LastPaymentAmountjson:"last_payment_amount" RedisACLKeysjson:"redis_acl_keys,omitempty" IPXEChainURLjson:"ipxe_chain_url,omitempty",**govultr.ContainerRegistryDockerCredentials,*func(*regexp.Regexp) *properties.Properties,*map.group[netlink.BondXmitHashPolicy]string,*[]struct { key int; elem *nl.SocketHandle },*map.group[string]netlink.BondXmitHashPolicy,*func() protoreflect.ExtensionTypeDescriptor,*map[protowire.Number]protoreflect.RawFields,github.com/apernet/quic-go/internal/protocol,github.com/apernet/quic-go/internal/monotime,*func(protocol.ByteCount) protocol.ByteCount,*func([]uint8) (*wire.ExtendedHeader, error),*func() (handshake.ShortHeaderOpener, error),*[]struct { key ipv4.ICMPType; elem string },*[]struct { key *syntax.Regexp; elem int64 },*func([]uint8) (*edwards25519.Scalar, error),*func(func(protoreflect.ExtensionType) bool),google.golang.org/protobuf/internal/filedesc,*map.group[protoreflect.Name]*filedesc.Field,*struct { key string; elem *filedesc.Field },*map.group[protoreflect.Name]*filedesc.Oneof,*[]struct { key filedesc.pathKey; elem int },*struct { key filedesc.pathKey; elem []int },google.golang.org/protobuf/internal/filetype,*map.group[protoreflect.Name]*impl.oneofInfo,*map.group[reflect.Type]*impl.coderFieldInfo,*func(*internal.VecK, *internal.VecK) uint32-*[8]struct { key string; elem zapcore.Level }-*struct { F uintptr; X0 *masq.MasqTCPServer }-*struct { key string; elem *tls.Certificate }-*func([][]uint8, [][]*x509.Certificate) error-*func(string) (*tls.ClientSessionState, bool)-*func(*sync.entry[interface {},interface {}])-*func() *sync.node[interface {},interface {}]-*[0]*sync.indirect[interface {},interface {}]-*func(tls.QUICEncryptionLevel, []uint8) error-*func([]uint8) (int, syscall.Sockaddr, error)-*func([]uint8, syscall.Sockaddr) (int, error)-*[]struct { key string; elem map[string]int }-*func(*unique.indirect[net/netip.addrDetail])-*func() go.shape.interface { Error() string }-*[]struct { key abi.TypeOff; elem *abi.Type }-*[8]struct { key int32; elem unsafe.Pointer }-*[8]struct { key unsafe.Pointer; elem int32 }-*struct { F uintptr; R runtime.metricReader }-*[8]struct { key string; elem reflect.Value }-*struct { F uintptr; X0 *bool; X1 io.Writer }-*struct { F uintptr; X0 io.Writer; X1 *bool }-*struct { key string; elem encoding.Decoder }-*struct { key string; elem encoding.Encoder }-*struct { F uintptr; X0 zapcore.WriteSyncer }-*[]struct { key string; elem *v2geo.GeoSite }-*map.group[protocol.StreamID]*quic.SendStream-*func(utils.ByteInterval) *utils.ByteInterval-*func(*zapcore.CheckedEntry, []zapcore.Field)-*[8]struct { key zapcore.Level; elem string }-*struct { F uintptr; R json.condAddrEncoder }-*struct { key *net.Listener; elem struct {} }-*[8]struct { key *http.conn; elem struct {} }-*[8]struct { key string; elem http.muxEntry }-*map[http.connectMethodKey]http.wantConnQueue-*struct { key [8]uint8; elem chan struct {} }-*[]struct { key http.ConnState; elem string }-*[]struct { key string; elem []*http.Cookie }-*func(context.Context, string, []uint8) error-*[]struct { key string; elem chan struct {} } LongDirectionjson:"long_direction,omitempty" PrecisionHorzjson:"precision_horz,omitempty" PrecisionVertjson:"precision_vert,omitempty"AutomaticSnapshotsjson:"automatic_snapshots"-*func(context.Context) ([]libdns.Zone, error)-*map.group[string]outbounds.PluggableOutbound-*struct { key *reflect.structType; elem int }-*struct { F uintptr; X0 *reflect.structType }-*func(fmtsort.KeyValue, fmtsort.KeyValue) int-*struct { key dnsmessage.Class; elem string }-*struct { key dnsmessage.RCode; elem string }-*func(string, string, []bool, string) *[]bool-*func(string, net.IPMask, string) *net.IPMask-*func(string, string, net.IP, string) *net.IP-*func(string, string, string, string) *string-*func(string, string, uint16, string) *uint16-*func(string, string, uint32, string) *uint32-*func(string, string, uint64, string) *uint64-*func(string, string, []uint, string) *[]uint-*map.group[jwalterweatherman.Threshold]string-*struct { key reflect.Value; elem struct {} }-*func([]uint8, map[string]interface {}) error-github.com/spf13/viper/internal/encoding/json-github.com/spf13/viper/internal/encoding/toml-github.com/spf13/viper/internal/encoding/yaml-*func(tun.PackageManager, exceptions.Handler)-*[]struct { key netip.AddrPort; elem uint16 }-*[]bbr.entry[go.shape.uint64,go.shape.uint64]-*func(*quic.ClientInfo) (*quic.Config, error)-*map[protocol.ConnectionID]quic.packetHandler-*map[protocol.ConnectionID]*quic.zeroRTTQueue-*map[protocol.ByteCount]quic.frameSorterEntry-*func() (protocol.ByteCount, []uint8, func())-*func(*wire.StreamFrame, monotime.Time) error-*map[quic.connRunner]quic.connRunnerCallbacks-*map[protocol.StreamID]quic.streamFrameGetter-*func(string, string, uint16, int64) *dns.Msg-*func(int, int, int, *x509.Certificate) error-*[8]struct { key uint16; elem func() dns.RR }-*func([]uint8, string, string, []int) []uint8-*func([]uint8, func([]uint8) []uint8) []uint8 PersistentPxejson:"persistent_pxe,omitempty"-*govultr.ContainerRegistrySubscriptionBilling AccessControljson:"access_control,omitempty" BGWRITERDelayjson:"bgwriter_delay,omitempty" CheckIntervaljson:"check_interval,omitempty" ProxyProtocoljson:"proxy_protocol,omitempty" FirewallRulesjson:"firewall_rules,omitempty"-*[]struct { key string; elem parse.itemType }-*struct { key string; elem template.element }-*[]struct { key string; elem []*ini.Section }-*func(string) (*properties.Properties, error)-*[]struct { key string; elem yaml.fieldInfo }-*struct { key reflect.Type; elem gob.typeId }-*struct { key netlink.BondMode; elem string }-*map.group[netlink.BondPrimaryReselect]string-*[8]struct { key int; elem *nl.SocketHandle }-*map.group[string]netlink.BondPrimaryReselect-*func(protoreflect.MapKey) protoreflect.Value-bytesLostMultiplierWhileDetectingOvershooting-github.com/apernet/quic-go/internal/handshake-*[8]struct { key ipv4.ICMPType; elem string }-*[8]struct { key *syntax.Regexp; elem int64 }-*struct { key string; elem syntax.charGroup }-*func(context.Context) *retryablehttp.Request-github.com/cloudflare/circl/sign/eddilithium3-*struct { key reflect.Type; elem *gob.encOp }-google.golang.org/protobuf/runtime/protoiface-google.golang.org/protobuf/encoding/protowire-*func(func(protoreflect.FileDescriptor) bool)-*map.group[protoreflect.FullName]interface {}-*[]struct { key protoreflect.Name; elem int }-*map.group[protoreflect.Name]*filedesc.Method-*[8]struct { key filedesc.pathKey; elem int }-google.golang.org/protobuf/encoding/prototext-github.com/cloudflare/circl/sign/eddilithium2hy|- *\ٿN|-~5*ЁK|-c0Z)[2|-} 1ZC|-L2ZdX0-(C cRr,.``uy,.Ȳ`= A,.Wyv2-FO @4%,.A%`@yvj,.5@(.5@ל& (.XO A|- 5`A |-aOAC")f-(5A:p -jO B4|-`B<|-H%B\ |-=kB>/0 C w/`C}r /GkCҦl/QkCH`O,.O% DFզ:|- `D05;,.9 GmLk|-8JmL;ݜ} |-# LmLw,.8LmLj) -$MmL@X |-uOmLK2|-OPmL><-qw QmLۂ (.wQmL3ˉ |-w RmL? -w`RmL^_[ |-T(RD |-)W(RQ,.A(e3=ê |-< f3dA.|-koEr`/-Y)`pEr?$-~ Ers|-`zErj|- {Er1-,|  -U`=~}v|-ڲ`4 8|-4 ,.sD&M |-L@ gy (.6XuK|-Ffq(,.FZ'|- vޘ|- VK),.qY`H4f-0 G~''`,. @|-`e/|-Y#UD|-Y_|-`ZZ,.H Xq,.`l-:,.XT_ -2 X G |- 3X6 (.3 X*|-<XΎ9-13X[,.NX-1 X#C|-DXYi (.W X|->X//XZX{* /mZ X(;-XTҝ,.`X|-j XVN -X'f|-LJXz|-aI ,TQ -%`,TVMf-T,Th9^|-.=|-/.nC |-0HÀ> |- 1H]i|->m2H[Q,.Zm 3H?:,.K`3H;,.3H;U|-3H׻,.?4H1 |-  5Hb|-`6HA/|-6H_|-Q@7Hzkm (.A@ ? (.j;?a0l (.7 <?C (.)k`<?3 (.>k<?m[|-y`=?X2|-/ ?I ^4 -Gx | -%lHx 4gx|-*`Ix k|-jIx _(S-J89 ',.J89 L0,.N K89 t-6m`K89 (Hd,. LqO -pLo - L -jp`Mϱ-gM$4-0 N M,.9P aw-  V[-`VkN-"V\-VgSZ-[ Wf7-`WQ4-OWSi -Ws - Xݕ-`X-X}z|-EZ |-[|] |-]93!P|- ^9Ǿ6,.%_3(h,.K`fQNK (.[`fQI|-o`aԩ<@|-O2 ԩG,.qYet2#|-Ͼ`i2ѣȇ:|- l ,.& pGP |-`w: Cv,.a zL" -~p l9,.   (.v_ (.9'|-r v: (._`՝|-Ͼ P0Q|-x`#|- [,.*`< KeepAlivePeriodmapstructure:"keepAlivePeriod".*map.group[server.HyStream]*server.StreamStats`v3TV73T#Қ36TT#s3XTT#a!q3#l\3q8#)~3PB Xk)3.UTTXr3ccX4i 3IIX3 @ @XV -H Ѓ-H g.*func(*big.Int, *big.Int) (*big.Int, *big.Int).*func() *sync.entry[interface {},interface {}]L3# j@<#2h3 j@<#9v3v j`#b`ql3/= `#hXm3 ;#'3^= T=XZ]3 j#Hc*3wY3t@V#:Wq3XO 3S;=3XI3èX W3+ DDXc3|MNNX34@@X?3X|3 Xp3X~ދ3X@XVVpm*30@X@XX3`#ҪH3> @#`,.Ǐgխ3#G31" S#u,3.*func(bool, func(int32) bool) ([]uint8, error) 53u@U@V#pT 3OTXXЄo3VT@V#m3 E@U#.*[]struct { key string; elem []net.nssSource }.*[8]struct { key string; elem map[string]int }.*func(context.Context, string) (string, error)C3@@V$#835U#i3 U#<36U# (843Ov`<`<@Vk3g<<@Vz9Dz3 HH@VV34@V@V#.*func() *unique.indirect[net/netip.addrDetail].*[]*sync.node[*internal/abi.Type,interface {}].*[]struct { key *abi.Type; elem interface {} } (D3  Xcܵ3:>++Xh563HOXDa3`O`OX-`39X%3XQ!63a8X3X D 31@V 8#l3 @V#3@V#q3@V`¹#x3HTm#9g35T#k3TT#3uT#Ed3vTT#i}34aa@V.*[8]struct { key abi.TypeOff; elem *abi.Type }9-6D0B n36VT@Vd`3YVUM3UUXi 3hL@XXf3"qYYX+Jc3g{@V@VX/63XVVX}3TVVX5/3VVU]sE35VVC |-g*3e9@U@V#xL3/ @X@[#Q9835@V@V3 @V@V@Vk^e 3T.*func(context.Context) (*cobra.Command, error).*[]struct { key string; elem map[string]bool } X3#@`¹#GH34P TfK3@##30 \@#P3s:TX#35X#=33T`¹#883x@V`¹#K 3TȾ#v&3:T@VT2Ys3TTT.*[]struct { key string; elem viper.FlagValue }<3&TTX.*func(zapcore.Level, string, ...zapcore.Field).*func(zapcore.Entry, zapcore.SamplingDecision) Thereafter#json:"thereafter" yaml:"thereafter".*struct { F uintptr; X0 zapcore.LevelEnabler }'723Q WTa3T r#p3UX*z3f\@VT#^3  @,Tt?3~1  #RF3@ %#\n3 NT- E3 #ݥ3h@V]#g~3T#3rr@V3T#j3,  @׹#!3R `r #\͞3T%#.*func(http.ResponseWriter, *http.Request) bool.*struct { key string; elem *certmagic.Config }.*map.group[string][]certmagic.dnsPresentMemory.*[8]struct { key string; elem chan struct {} }.*struct { key string; elem certmagic.KeyInfo }.*struct { key string; elem certmagic.Storage }33z\T##93\TX7ꂾ3'\`¹#}m*3а `r X'3d2 \@#.*struct { key string; elem gandi.gandiDomain }3D \@#TermsOfServicejson:"termsOfService,omitempty".*func(context.Context) (acme.Directory, error)ۤC3 \#.*func(net.Addr, string, uint64) (bool, string)W3 @#(!`3gT#13 XTXF31-@V#.*func([]uint8) (int, *outbounds.AddrEx, error).*func([]uint8, *outbounds.AddrEx) (int, error).*func(acl.HostInfo, acl.Protocol, uint16) bool43i#t3^ #f%3T@D# 3A -&\A3] -&XfC3` -&X߽38 -&Xaᒉ3Gl @Vͦ+ -L g]t3 UX1 3W3ק7UUj+3VQ493 `` XU3XXXܡ3?!@U@UXt8t3r`UUXx&13ٙ#L3s6`#83`#3#fC3s6#~3#\3# !3l3|@V 3UUB)3V)ԃ3@-p93T`¹#.*func() iter.Seq2[reflect.Value,reflect.Value].*struct { key *reflect.structType; elem bool }83T`X"3ڭ `XJ@3٭``X2n3k``#Xqw3ҳ@V@V`f!3T`X$IL3&B@VT@ 3Ų@V@V@Vg3CE @Vӕ3¹X#.*[]struct { key dnsmessage.Type; elem string }.*func() (int, syscall.Sockaddr, string, error)2G=3<@VT#ZQ3 U#9 ,."sgBh3 T~@;3$@VV@X gN3& `@X@X3  `@X@X.*func(*[]bool, string, string, []bool, string).*func(*net.IPMask, string, net.IPMask, string).*func(*net.IP, string, string, net.IP, string).*func(*string, string, string, string, string).*func(*uint16, string, string, uint16, string).*func(*uint32, string, string, uint32, string).*func(*uint64, string, string, uint64, string).*func(*[]uint, string, string, []uint, string)c3TV#փ3TU#|3ҜT@U#CYj3TW#Yf3TW#X{3T#Y3TX#3)T#Χ3naTT`Be323؀`BTT=43mT#}O37Tֹ#G 3KT#s-U3mT`#G\V3TU#aY3LT`#u 3 Ts#3TT#U35T`#3UT`#3T@T#@.3xT@ȿ#>+3!T@#PQ3ST@ƿ#t3TU#3TU#P3YY3ʴTV#yH*3JTT#5[Q3T#0Z 3P `¹`Ž#,3TT3TUjW|^3@VU3#wt3"`+#.3#T$3{To#mM35\@V@V.3@V@U@V2&3@V`3>@Vѹbs3[T@V`¹3eT@VѹԦ3T@V"#3d@V`Ah3#K 8t3T@ӻT.*func(string, ...oauth2.AuthCodeOption) string3%3 TBTZ ]3T \ _Dw3( \ CAttachedToInstancejson:"attached_to_instance" MySQLSQLModes json:"mysql_sql_modes,omitempty"RedisACLCategoriesjson:"redis_acl_categories" LogLinePrefix json:"log_line_prefix,omitempty" MaxStackDepth json:"max_stack_depth,omitempty" MaxWalSenders json:"max_wal_senders,omitempty" TempFileLimit json:"temp_file_limit,omitempty" TrackIOTiming json:"track_io_timing,omitempty"Recommendationjson:"recommendation,omitempty"StickySessionsjson:"sticky_session,omitempty"e3#  #o\3 # J3v  `#ӑ3  # C3^= TXf4@#3w @`G3  z53 #v3 ```m3`#]$35 3# 3t "3D#d3#  d d`M3 ͹X.*[8]struct { key string; elem parse.itemType }3V#.*[8]struct { key string; elem []*ini.Section }3(M T`#[33lT_o3UTWWJ ?3T@V@V` 3mTUU)0<&3 .TVVBW3~TVVP3n#.*[8]struct { key string; elem yaml.fieldInfo }.*struct { key netlink.IPoIBMode; elem string }.*struct { key string; elem netlink.IPoIBMode }.*struct { pragma.NoUnkeyedLiterals; Size int }.*struct { F uintptr; X0 protoreflect.Message }V3"/ `D#k`3 `K#hL3I[@2#h"!3; `K# 3sO@2#ad36`3`m#.*func(protoreflect.Name) protoreflect.FullName.*func(protoreflect.MapKey, protoreflect.Value)} 3 ``(3h X͎>3$ !X߅3H6wv>B3\ wvv.*struct { F uintptr; X0 *brutal.BrutalSender }#(3$ uEmX3 umu=%3Z% vv@VT139  #ہi3E#.github.com/apernet/quic-go/internal/ackhandler.*func(protocol.EncryptionLevel, monotime.Time)[ot3jz t`EX3J@lX3M t`XaV3}ttt_3N( t@lXy3 tuu.*func(protocol.ByteCount, monotime.Time) error@ٞ3(vuXXV3p u@l#b\3t@utX3> R3@#cj3c#v%E3 @V#S3 v#KP3@zX#k3\@X43\#F3`¹W3 \T¹sg,3Z6#3 T#YX3 #8R& 3( @Sa3( @# $*38#Y[3|@#.*func([]uint8) (kem.PublicKey, kem.PrivateKey).*func(kem.PublicKey) ([]uint8, []uint8, error).*func() (kem.PublicKey, kem.PrivateKey, error)٦3  p뚷3  p#iN3h| p#zQY3#feTc3 #5 3w#ک31 /7 3#63p 4s<3#>-s3 4f3#3C rB3z:  #.*struct { key reflect.Type; elem gob.gobType }: 3, n nX*v/3u@V 953 `@#l0m3< T#Z3| `C#Nl[3 `#ޔ3 T#.*[8]struct { key protoreflect.Name; elem int }.*[]struct { key string; elem *filedesc.Field }.*map.group[string]protoreflect.FieldDescriptor.*map.group[protoreflect.Name]*filedesc.Message.*map.group[protoreflect.Name]*filedesc.Service.*map[filedesc.Edition]filedesc.EditionFeatures.*[]struct { key filedesc.pathKey; elem []int }}e3R@U@U@U=X3N @I{#3- @I@I{.github.com/apernet/quic-go/internal/congestion.github.com/apernet/quic-go/qlogwriter/jsontextLY3 .github.com/cloudflare/circl/kem/kyber/kyber512.github.com/cloudflare/circl/kem/kyber/kyber768.github.com/cloudflare/circl/pke/kyber/kyber512.github.com/cloudflare/circl/pke/kyber/kyber768q-Ŗ3t< Uxa3 |||3^sT@V_K3t< ``U3 ```;I3j`TT/*[]struct { key string; elem *tls.Certificate }/*struct { key interface {}; elem interface {} }/*go.shape.struct { internal/sync.isEntry bool }/*[8]struct { key string; elem []net.nssSource }/*func(net.byRFC6724Info, net.byRFC6724Info) int/*sync.indirect[*internal/abi.Type,interface {}]/*[]*sync.entry[*internal/abi.Type,interface {}]/*[0]*sync.node[*internal/abi.Type,interface {}]/*[8]struct { key *abi.Type; elem interface {} }/*struct { key string; elem runtime.metricData }/*struct { key string; elem *template.Template }/*[8]struct { key string; elem map[string]bool }/*[8]struct { key string; elem viper.FlagValue }/*[]struct { key string; elem encoding.Decoder }/*[]struct { key string; elem encoding.Encoder }/*struct { F uintptr; X0 *proxymux.muxListener }/github.com/apernet/hysteria/app/v2/internal/tun/github.com/apernet/hysteria/app/v2/internal/url/*[8]struct { key uint32; elem *client.udpConn }/*struct { key zapcore.Level; elem color.Color }/*struct { F uintptr; X0 *context.afterFuncCtx }/*[8]struct { key interface {}; elem struct {} }/*func(uint32, http.http2ErrCode, []uint8) error/*[]struct { key *net.Listener; elem struct {} }/*map.group[http.routingIndexKey][]*http.pattern/*struct { key http.connectMethodKey; elem int }/*[]struct { key [8]uint8; elem chan struct {} }/*[8]struct { key http.http2Flags; elem string }/*struct { F uintptr; X0 *http.http2ClientConn }/*struct { F uintptr; X0 *http.http2serverConn }/*func(context.Context, string) ([]uint8, error)/*func(context.Context, string, int, bool) error/*struct { F uintptr; X0 *certmagic.ACMEIssuer }/*struct { F uintptr; X0 *certmagic.jobManager }/*struct { key string; elem *cloudflare.cfZone }OverrideDomain json:"override_domain,omitempty"/github.com/apernet/hysteria/extras/v2/outbounds/*[]struct { key *reflect.structType; elem int }/*[]struct { key dnsmessage.Class; elem string }/*[]struct { key dnsmessage.RCode; elem string }/*[8]struct { key dnsmessage.Type; elem string }/*struct { key dnsmessage.section; elem string }/*struct { key string; elem *singleflight.call }/*func(string, string, []uint8, string) *[]uint8/*func(string, string, float32, string) *float32/*func(string, string, float64, string) *float64/*func(string, string, []int32, string) *[]int32/*func(string, string, []int64, string) *[]int64/*[]struct { key reflect.Value; elem struct {} }/*func(map[string]interface {}) ([]uint8, error)/github.com/spf13/viper/internal/encoding/dotenv/*[8]struct { key uint16; elem *tun.TCPSession }/*func(*quic.packetBuffer, uint16, protocol.ECN)/*struct { F uintptr; R *quic.packetHandlerMap }/*func(qlogwriter.Recorder) (http3.frame, error)SingleExtensionsasn1:"explicit,tag:1,optional"/*func(crypto.Signer, *dns.Msg) ([]uint8, error)/*func([]uint8, []uint8, []uint8, []int) []uint8DatabaseEngine json:"database_engine,omitempty"MaintenanceDOW json:"maintenance_dow,omitempty"TrackFunctions json:"track_functions,omitempty"MaxConnections json:"max_connections,omitempty"DDOSProtection json:"ddos_protection,omitempty"EnableFirewall json:"enable_firewall,omitempty"UpgradeVersion json:"upgrade_version,omitempty"PrivateNetwork json:"private_network,omitempty"StickySessions json:"sticky_sessions,omitempty"/*func(*bigmod.Nat, *bigmod.Modulus) *bigmod.Nat/*[]struct { key string; elem template.element }/*[]struct { key reflect.Type; elem gob.typeId }/*[]struct { key netlink.BondMode; elem string }/*struct { key string; elem netlink.TuntapMode }/*func([]uint8, protoreflect.ProtoMessage) error/google.golang.org/protobuf/reflect/protoreflect/*struct { key int32; elem impl.ExtensionField }/*func(congestion.ByteCount, bbr.roundTripCount)/*func(protocol.PacketNumber) *ackhandler.packet/github.com/apernet/quic-go/internal/flowcontrol/*func([]uint8, []uint8) *handshake.xorNonceAEAD/*func(net.Addr, time.Duration) ([]uint8, error)/*func(*net.Interface, net.Addr, net.Addr) error/*func(context.Context, string, ...interface {})/*[]struct { key string; elem syntax.charGroup }/*struct { key string; elem internal.AuthStyle }/*struct { laddr unix.SockaddrInet6; value int }/*func(kem.PrivateKey, []uint8) ([]uint8, error)/*func() (map[string]int32, map[string][2]int32)/github.com/pelletier/go-toml/v2/internal/danger/*[]struct { key reflect.Type; elem *gob.encOp }/*map.group[string][]protoreflect.FileDescriptor/*func(string) (protoreflect.MessageType, error)/*struct { F uintptr; X0 *[]order.messageField }/*[8]struct { key string; elem *filedesc.Field }/*[8]struct { key filedesc.pathKey; elem []int }/*func(impl.pointer, *impl.coderFieldInfo) error/*map.group[protowire.Number]reflect.StructField/github.com/cloudflare/circl/kem/kyber/kyber1024/github.com/cloudflare/circl/pke/kyber/kyber10240*struct { F uintptr; R *sockopts.SocketOptions }0*[8]struct { key string; elem *tls.Certificate }0*func(*tls.ClientHelloInfo) (*tls.Config, error)0*func(*sync.indirect[interface {},interface {}])Version(asn1:"optional,explicit,default:0,tag:0"0*struct { key *x509.policyGraphNode; elem bool }0*struct { key net.hostLookupOrder; elem string }0*func(context.Context, string) ([]string, error)0*[0]*sync.entry[*internal/abi.Type,interface {}]0*func() func(func(*abi.Type, interface {}) bool)0*struct { key netip.addrDetail; elem struct {} }0*[8]struct { key string; elem encoding.Decoder }0*[8]struct { key string; elem encoding.Encoder }0github.com/apernet/hysteria/app/v2/internal/http0*func(client.Client, *client.HandshakeInfo, int)0*func(context.Context) (*quic.SendStream, error)0*func(quic.pathID) (protocol.ConnectionID, bool) EncodeTime%json:"timeEncoder" yaml:"timeEncoder" EncodeName%json:"nameEncoder" yaml:"nameEncoder"0*struct { key context.canceler; elem struct {} }0*func(context.Context, net.Conn) context.Context0*[8]struct { key *net.Listener; elem struct {} }0*[]struct { key uint32; elem *http.http2stream }0*[]struct { key string; elem *http.routingNode }0*map.group[*http.Request]context.CancelCauseFunc0*[8]struct { key [8]uint8; elem chan struct {} }0*struct { key string; elem *http.http2dialCall }0*[]struct { key http.http2ErrCode; elem string }0*[]struct { key http.http2SettingID; elem bool }0*struct { key http.http2SettingID; elem string }0*[]struct { key string; elem http.RoundTripper }0*struct { F uintptr; R *http.http2clientStream }0*func(http.ResponseWriter, *http.Request, error)0*[]struct { key string; elem *certmagic.Config }0*struct { key string; elem certmagic.Challenge }0*[]struct { key string; elem certmagic.KeyInfo }0*[]struct { key string; elem certmagic.Storage }OriginalNameServersjson:"original_name_servers"0*[]struct { key string; elem gandi.gandiDomain }0*func(server.HyStream, *string) ([]uint8, error)0*func(interface {}, *list.Element) *list.Element0*[]struct { key *reflect.structType; elem bool }0*[8]struct { key *reflect.structType; elem int }0*struct { key string; elem *unicode.RangeTable }0*[8]struct { key dnsmessage.Class; elem string }0*[8]struct { key dnsmessage.RCode; elem string }0*func(*[]uint8, string, string, []uint8, string)0*func(*float32, string, string, float32, string)0*func(*float64, string, string, float64, string)0*func(*[]int32, string, string, []int32, string)0*func(*[]int64, string, string, []int64, string)0*[8]struct { key reflect.Value; elem struct {} }0*func() (*buf.Buffer, metadata.Socksaddr, error)0*func([]uint8, protocol.ByteCount, func()) error0*struct { key quic.pathID; elem quic.newConnID }0*func(quic.connRunner, quic.connRunnerCallbacks)0*func(protocol.StreamID, quic.streamFrameGetter)0*func(*quic.remoteAddrInfo) *quic.remoteAddrInfo0*func(*protocol.UDPMessage) *protocol.UDPMessage0*[]struct { key string; elem map[string]string }0*struct { F uintptr; X0 *httptrace.ClientTrace }0*struct { key hpack.pairNameValue; elem uint64 }Version(asn1:"optional,default:0,explicit,tag:0"Version(asn1:"explicit,tag:0,default:0,optional"WALWriterDelay!json:"wal_writer_delay,omitempty"0*struct { F uintptr; X0 *os.File; X1 *exec.Cmd }0*struct { F uintptr; X0 io.Writer; X1 *os.File }0*func(string, string, []uint8) (net.Conn, error)ObfuscatedTicketAgejson:"obfuscated_ticket_age"0*[8]struct { key string; elem template.element }0*struct { key string; elem yaml.resolveMapItem }0*[8]struct { key reflect.Type; elem gob.typeId }0*[8]struct { key netlink.BondMode; elem string }0*[]struct { key netlink.IPoIBMode; elem string }0*[]struct { key string; elem netlink.IPoIBMode }0*func(protoreflect.EnumNumber) protoreflect.Enum0maxCongestionWindowWithNetworkParametersAdjusted0*func(protocol.PacketNumber, *ackhandler.packet)0*func(protocol.PacketNumber, monotime.Time) bool0*[8]struct { key string; elem syntax.charGroup }0*func([]uint8) (sign.PublicKey, sign.PrivateKey)0*func() (sign.PublicKey, sign.PrivateKey, error)0*func(*edwards25519.Scalar) *edwards25519.Scalar0github.com/pelletier/go-toml/v2/internal/tracker0*struct { key reflect.Kind; elem gob.encHelper }0*[8]struct { key reflect.Type; elem *gob.encOp }0*struct { key reflect.Type; elem *gob.typeInfo }0*[]struct { key reflect.Type; elem gob.gobType }0google.golang.org/protobuf/reflect/protoregistry0*map[protowire.Number]protoreflect.ExtensionType0*map.group[protoreflect.Name]*filedesc.EnumValue0*map[protoreflect.EnumNumber]*filedesc.EnumValue0*struct { key protowire.Number; elem struct {} }0*map.group[protoreflect.Name]*filedesc.Extension0*func(protoreflect.ExtensionTypeDescriptor) bool0*map.group[protowire.Number]*impl.coderFieldInfo0*map.group[protoreflect.Name]reflect.StructField0*map[reflect.Type]protoreflect.MessageDescriptor0*struct { F uintptr; R *congestion.cubicSender }0github.com/cloudflare/circl/sign/dilithium/mode30github.com/cloudflare/circl/sign/dilithium/mode21github.com/apernet/hysteria/app/v2/internal/utils1*struct { F uintptr; X0 *sockopts.SocketOptions }1*struct { F uintptr; X0 func(string); X1 string }1*struct { F uintptr; X0 string; X1 http.Handler }1*func([]uint8, []uint8, []uint8, []uint8) []uint81*func() *sync.indirect[interface {},interface {}]1*[]struct { key interface {}; elem interface {} }1*struct { key uint16; elem func() *hpke.hkdfKDF }1*func(context.Context, string) ([]*net.MX, error)1*func(context.Context, string) ([]*net.NS, error)1*struct { F uintptr; X0 func(int) error; X1 int }1*func(*abi.Type, interface {}, interface {}) bool1*func(string, int, fs.FileMode) (*os.File, error)1*struct { key runtime._typePair; elem struct {} }1*[]struct { key string; elem runtime.metricData }1*func() (unsafe.Pointer, syscall._Socklen, error)1*func([]string) (*cobra.Command, []string, error)1*[]struct { key string; elem *template.Template }1*struct { Level *zapcore.Level "json:\"level\"" } Development%json:"development" yaml:"development" OutputPaths%json:"outputPaths" yaml:"outputPaths"1*struct { F uintptr; X0 net.Conn; X1 chan error } FunctionKey%json:"functionKey" yaml:"functionKey"1*[]struct { key zapcore.Level; elem color.Color }1*struct { F uintptr; X0 func() json.encoderFunc }1*[8]struct { key uint32; elem *http.http2stream }1*[8]struct { key string; elem *http.routingNode }1*[]struct { key http.connectMethodKey; elem int }1*[8]struct { key http.http2ErrCode; elem string }1*[8]struct { key http.http2SettingID; elem bool }1*[8]struct { key string; elem http.RoundTripper }1*func(string, url.Values) (*http.Response, error)1*func(*http.Server, net.Conn, http.Handler, bool)1*func(string, string, net.Conn) http.RoundTripper1*struct { F uintptr; R *http.ResponseController }1*[8]struct { key string; elem *certmagic.Config }1*[8]struct { key string; elem certmagic.KeyInfo }1*[8]struct { key string; elem certmagic.Storage }1*struct { key string; elem certmagic.ocspUpdate }1*[]struct { key string; elem *cloudflare.cfZone }1*[8]struct { key string; elem gandi.gandiDomain }1*struct { key string; elem acme.cachedDirectory }1*struct { F uintptr; X0 *server.udpSessionEntry }1*[8]struct { key *reflect.structType; elem bool }1*[]struct { key dnsmessage.section; elem string }1*[]struct { key string; elem *singleflight.call }1*func(string, string, []net.IP, string) *[]net.IP1*func(string, string, []string, string) *[]string1*func(reflect.Value, reflect.Value) (bool, error)1*func([]uint8, protocol.Version) ([]uint8, error)1*map[protocol.StreamID]*http3.stateTrackingStream1github.com/apernet/hysteria/core/v2/internal/frag1*[8]struct { key string; elem map[string]string }1*func(context.Context, string) (*dns.Conn, error)ActivationEmail!json:"activation_email,omitempty"MaintenanceTime!json:"maintenance_time,omitempty"DeadlockTimeout!json:"deadlock_timeout,omitempty"DefaultPassword!json:"default_password,omitempty"HAControlPlanes!json:"ha_controlplanes,omitempty"ResponseTimeout!json:"response_timeout,omitempty"BackendProtocol!json:"backend_protocol,omitempty"ForwardingRules!json:"forwarding_rules,omitempty"1*struct { key token.Pos; elem *ast.CommentGroup }1*struct { key netlink.BondAdSelect; elem string }1*struct { key netlink.BondLacpRate; elem string }1*[8]struct { key netlink.IPoIBMode; elem string }1*struct { key netlink.VlanProtocol; elem string }1*struct { key string; elem netlink.BondAdSelect }1*struct { key string; elem netlink.BondLacpRate }1*[8]struct { key string; elem netlink.IPoIBMode }1*[]struct { key string; elem netlink.TuntapMode }1*struct { key string; elem netlink.VlanProtocol }1*struct { pragma.NoUnkeyedLiterals; Flags uint8 }1*struct { pragma.NoUnkeyedLiterals; Buf []uint8 }1*func(protoreflect.ProtoMessage) ([]uint8, error)1*[]struct { key int32; elem impl.ExtensionField }1*struct { key string; elem qpack.indexAndValues }1*[]struct { key string; elem internal.AuthStyle }1*[]struct { laddr unix.SockaddrInet6; value int }1*[8]struct { key reflect.Type; elem gob.gobType }1google.golang.org/protobuf/internal/encoding/text oَ T fX  pBiWPTmL uf>X~TRb 3RiQ HQ?@Er6|-g &aTF Fj`@h E3TX ts TX hPLQ V oC*# T Dz`/TB@6|-|=F6|-T|-6|-QE| ͼ:  ux/2u`IT=4ClientCertificate mapstructure:"clientCertificate"GeoUpdateInterval mapstructure:"geoUpdateInterval"2github.com/apernet/hysteria/core/v2/internal/utils2*func(server.StreamState, server.StreamState) bool2*map.group[string]*trafficlogger.trafficStatsEntry2*struct { key string; elem zapcore.EncoderConfig }4(c 3TT#:4 B3ATU#TT#3,0l6|-<Tg2*[]struct { key *x509.policyGraphNode; elem bool }2*struct { key string; elem *x509.policyGraphNode }["38 X#30 X #2*[]struct { key net.hostLookupOrder; elem string }!h3I> @V$#G3] R@V#q3  S@V#\3x> $@V#UL3v@V#=3 @V |#$3@V#O$38 |@V#73U@V #&({3m @Vy#H3 @V#VO3 y@V#TZ3@V|#l 3|@V#y3, TTi#s3p \T`¹#$8>j3 \TT#3( \T`# 3d. \T#R>v3. \Tૹ#2*atomic.Pointer[unique.node[net/netip.addrDetail]]2*sync.HashTrieMap[*internal/abi.Type,interface {}]2*func(*sync.node[*internal/abi.Type,interface {}])2*[]*sync.indirect[*internal/abi.Type,interface {}]2*[]struct { key netip.addrDetail; elem struct {} }3. X8h3 X._6|-ܒgH?No3 Tf #32VTT#y+3u  T#3  w#AH32 T`# Sr}@gK 3,3 `T@,X3_3 TT-2*struct { key string; elem certmagic.Certificate }2*map.group[string]*certmagic.RingBufferRateLimiter2*struct { key string; elem *certmagic.solverInfo }2*[]struct { key string; elem certmagic.Challenge } Y<3 \T#r31 \T_#1nŕ3mC \T#a38%\B`}#[Y3 \TԿ#3 \j@<#/38j#9=3A \T#53 \>`¹#|3v \`¹#}Y3`\TX#7932 \TT#C362 \`¹X#03ʺ \ #9J3) \@z@V#3x\>#2*[8]struct { key string; elem *cloudflare.cfZone }rLE3E \T#KeyAuthorization!json:"keyAuthorization,omitempty"-3 \L #=D3xP \ #83@VT#CC3T@V#I3TVVXr3 < @#2*struct { F uintptr; R *outbounds.fastOpenDialer }2*struct { F uintptr; X0 *outbounds.socks5UDPConn }3P @V#"3 @V#H3  UX3g -&cr3 -&XXr3л@V@V`#݀3#K83X2 `#~a3X2 #33 dI>/3!@VVT+3FT@VX2*struct { F uintptr; X0 func(reflect.Value) bool }P30@V@V@V`2*[]struct { key string; elem *unicode.RangeTable }2*[8]struct { key dnsmessage.section; elem string }'3@V@V#n,3 @V$T#+43x@V@V@V#Z3@V@VT#v34@V@V`X#c3T@V@VX#M53@V@VX#bw3+@V@V#0N36a@V@V@V#634@V@V Y#2*[8]struct { key string; elem *singleflight.call }3J! `@X@XX2*func(*[]net.IP, string, string, []net.IP, string)2*func(*[]string, string, string, []string, string)>3TXT D3QTT ¹37 ¹TTl3 DTXTX 3TT`sڠ3ծ`TT3TTT`BgM&3I`BTTTp33 TT@3F TֹTչc3& չTֹTZ3 @TTx(3ϚTWTCg3V TT E34  TT;5=3CTWT%3TWTCκ3 T`T¶304 T`TqRR>3)CTWT<<3T@DTql3E TsTspx3@ sTsTPW3 TUTv3^4 TUTg(3eT`T xX3 T`TO-37qT@DTJ6a3mT@VT`BtKC3nTTT@ݘ3ڼ@TTT#h3T@UT`APo\*3JT`TIxa3}T`TԯE3`AT@UT# 3TUTAI:3sT`TM7~3T`T勅3&ATUTu3CT@TT`@38`@T@TTT٦3ݩT`T R-YI3L T`Tyc3`BT@VTLB3TT`¹#/3TTT @̩c3T`¹T`xB3`T`¹Tb3ݻ T@ȿT`pBJ32 T@Tf=+3|S T@TI$3 `T@ȿT])53x T@ƿT 'n3  T@ƿT"c'3 8 @TTTPr<3fTVTBx23TUT A3H8 ATUTW 3;TUTA'63p8ATUT@(3bTVT B̀"38 BTVT#3TTT@Ja[3r@TTT\iN3TT࿹V:qh38࿹TT'I 3\BTVT=/3TTTT!43 `X#-}3= ``#g83\6 ``X# ]3%TmX#[3lBTAT&$H3@V#2*struct { key tun.flowKey; elem []tun.tcpGROItem },3! y>sXW3K yscXxq36@VU#GnP3d&6@V@V#30 8U#2*func(*wire.ResetStreamFrame, monotime.Time) error2*[]struct { key quic.pathID; elem quic.newConnID }2*struct { key uint64; elem protocol.ConnectionID }^3{ \XHmr3UE#34 \\# $3@X3D @lXXvDz3 um`XϯF3l# u`#j13' ` .2#T3| ` . 3#3' ` 1mc3PtX33 V@l#3``Eum FG$Ԋ3T  Ǹ#R3Q `E@lXӥF3@4@V@V#736 m#2*func(context.Context, *quic.Conn) context.Context)3ɱTT5#:y3@V@VT#2*[]struct { key hpack.pairNameValue; elem uint64 }`3$;TT@DX$Q{3 6T#_3 /#o3ب`+#[j3[7 \To#2*func(context.Context, *oauth2.Token) *http.Client\3@\B#ClusterTimeZone"json:"cluster_time_zone,omitempty"2*func(context.Context, string, *govultr.Soa) errorFirewallGroupID"json:"firewall_group_id,omitempty"䑹3. \ ݸ#NP~3< \T`߸#v]'35 \T#H`35 \T#i`3/6 \T#DŽ3 Z\#z3 \T #3# \T`#u3@\T@V#E<3* \T`#gY3 \T#k537 \`#6 3R# \T#Il3. \T #M>3@ \T#ВQ3Y* \T #g3# \T#~~q3 \T#T#3T \T #2*struct { F uintptr; X0 *error; X1 unix.Sockaddr }%23 r #ðh3 r #&~C3,  #%3Vv @V 3  @V ..A3j ``#ܬh3  ``@V`P3 #&vA3d @Vb3 #h3 @V13:  Vd 0V'3*  d &R3ܱ  #3  d XJn3 d #3]FT@VX2*func(io.Writer, properties.Encoding) (int, error)6dX3TTTX"&3 5n@V#2*[]struct { key string; elem yaml.resolveMapItem }2*[8]struct { key string; elem netlink.TuntapMode }P3@V@VT#C3t/`D#J"3$m `K#2*map.group[protowire.Number]protoreflect.RawFields2*[8]struct { key int32; elem impl.ExtensionField };30v@lv@v+S38wvv@l~3 umX2*func(protocol.PacketNumber) protocol.PacketNumberv38 tEX#k<3eu@lv@vb%i=39<tuu@lC3r uX@l#E3o #L3  v#l 3^{ \@T¹q3), \@T`{2*[8]struct { key string; elem internal.AuthStyle }2*struct { F uintptr; X0 retryablehttp.ReaderFunc }2*[2]struct { laddr unix.SockaddrInet6; value int }H3b f)3  p#><3 #. 3  p#q3 @V-W3H @VeQ3 @V3 @V3U 2*[]struct { key reflect.Kind; elem gob.encHelper }2*[]struct { key reflect.Type; elem *gob.typeInfo }2*func(string) (protoreflect.FileDescriptor, error)2*map[protowire.Number]protoreflect.FieldDescriptor2*[]struct { key protowire.Number; elem struct {} }zW3f @V@@VY[3<M럿3X @I{@@VU3 @I@I{Mb3R uXF5=3@ſV@U@U3*func() func(func(interface {}, interface {}) bool)3*[]struct { key uint16; elem func() *hpke.hkdfKDF }3*[0]*go.shape.struct { internal/sync.isEntry bool } Extensions(asn1:"omitempty,optional,explicit,tag:3"3*[8]struct { key *x509.policyGraphNode; elem bool }3*func([]uint8, *syscall.SockaddrInet4) (int, error)3*func([]uint8, *syscall.SockaddrInet6) (int, error)3*[8]struct { key net.hostLookupOrder; elem string }3*func(context.Context, string, string) (int, error)3*atomic.Pointer[unique.entry[net/netip.addrDetail]]3*func(*sync.entry[*internal/abi.Type,interface {}])3*func() *sync.node[*internal/abi.Type,interface {}]3*[0]*sync.indirect[*internal/abi.Type,interface {}]3*func(*abi.Type, interface {}) (interface {}, bool)3*[8]struct { key netip.addrDetail; elem struct {} }3*func(*runtime.statAggregate, *runtime.metricValue)3*[]struct { key runtime._typePair; elem struct {} }3*struct { F uintptr; X0 *http.Server; X1 net.Conn }3*func(context.Context) (*quic.ReceiveStream, error)3*struct { F uintptr; X0 *client.udpSessionManager } EncodeLevel'json:"levelEncoder" yaml:"levelEncoder"3*[8]struct { key context.canceler; elem struct {} }3*map.group[http.connectMethodKey]http.wantConnQueue3*[8]struct { key string; elem *http.http2dialCall }3*struct { key string; elem *http.http2addConnCall }3*map[http.http2FrameType]map[http.http2Flags]string3*[8]struct { key http.http2SettingID; elem string }3*struct { F uintptr; X0 chan struct {}; X1 func() }3*struct { F uintptr; R *httputil.maxLatencyWriter }3*[8]struct { key string; elem certmagic.Challenge }3*[]struct { key string; elem certmagic.ocspUpdate }3*struct { F uintptr; X0 chan struct {}; X1 string }3*[]struct { key string; elem acme.cachedDirectory }3*struct { F uintptr; X0 *server.udpSessionManager }3*func(*outbounds.AddrEx) (outbounds.UDPConn, error)3github.com/apernet/hysteria/extras/v2/outbounds/acl3*struct { F uintptr; X0 chan outbounds.dialResult }3github.com/apernet/hysteria/extras/v2/trafficlogger3*struct { key unsafe.Pointer; elem unsafe.Pointer }3*[8]struct { key string; elem *unicode.RangeTable }3*func(string, time.Duration, string) *time.Duration3*func(string, string, []float32, string) *[]float323*func(string, string, []float64, string) *[]float643*func(string, string, net.IPNet, string) *net.IPNet3*func(string, int, fs.FileMode) (afero.File, error)3*func(bbr.extraAckedEvent, bbr.extraAckedEvent) int3*map.group[protocol.ConnectionID]quic.packetHandler3*map.group[protocol.ConnectionID]*quic.zeroRTTQueue3*func(monotime.Time) (ackhandler.Frame, bool, bool)3*map.group[protocol.ByteCount]quic.frameSorterEntry3*[8]struct { key quic.pathID; elem quic.newConnID }3*map.group[quic.connRunner]quic.connRunnerCallbacks3*map.group[protocol.StreamID]quic.streamFrameGetter3*func(quic.clientHelloCut, quic.clientHelloCut) int3*[8]struct { key hpack.pairNameValue; elem uint64 }3*func(io.Reader, string) (crypto.PrivateKey, error)IgnoredDatabases"json:"ignored_databases,omitempty"HealthyThreshold"json:"healthy_threshold,omitempty"FrontendProtocol"json:"frontend_protocol,omitempty"3*[]struct { key token.Pos; elem *ast.CommentGroup }3*struct { key reflect.Type; elem *yaml.structInfo }3*[8]struct { key string; elem yaml.resolveMapItem }3*[]struct { key netlink.BondAdSelect; elem string }3*[]struct { key netlink.BondLacpRate; elem string }3*[]struct { key netlink.VlanProtocol; elem string }3*[]struct { key string; elem netlink.BondAdSelect }3*[]struct { key string; elem netlink.BondLacpRate }3*[]struct { key string; elem netlink.VlanProtocol }3*func(protoreflect.MapKey, protoreflect.Value) bool3*func() (protocol.PacketNumber, *ackhandler.packet)3*[]struct { key string; elem qpack.indexAndValues }3*func([]uint8, kem.PrivateKey, kem.PublicKey) error3*[8]struct { key reflect.Kind; elem gob.encHelper }3*[8]struct { key reflect.Type; elem *gob.typeInfo }3*map[protoreflect.Name]protoreflect.FieldDescriptor3*[8]struct { key protowire.Number; elem struct {} }3*struct { key protowire.Number; elem interface {} }3*struct { key reflect.Type; elem protowire.Number }3*struct { key protowire.Number; elem reflect.Type }3*interface { ProtoMessageInfo() *impl.MessageInfo }MaxIncomingStreams!mapstructure:"maxIncomingStreams"4*[]struct { key string; elem zapcore.EncoderConfig }4*func(interface {}, interface {}, interface {}) bool4*[8]struct { key uint16; elem func() *hpke.hkdfKDF }4*[]struct { key string; elem *x509.policyGraphNode }4*struct { key string; elem []*x509.policyGraphNode }4*func(context.Context, string) ([]net.IPAddr, error)4*[]atomic.Pointer[unique.node[net/netip.addrDetail]]4*func() *sync.entry[*internal/abi.Type,interface {}]4*[8]struct { key runtime._typePair; elem struct {} }4github.com/apernet/hysteria/app/v2/internal/proxymux4*[]struct { key string; elem *proxymux.muxListener }4github.com/apernet/hysteria/app/v2/internal/redirect4github.com/apernet/hysteria/app/v2/internal/sockopts4*struct { F uintptr; X0 *error; X1 func(int) error }4*struct { key protocol.StreamID; elem *quic.Stream }4github.com/apernet/quic-go/internal/utils/ringbuffer4*struct { key quic.pathID; elem *quic.pathOutgoing }4*[]struct { key uint32; elem *http.http2writeQueue }4*func(string, string, *tls.Config) (net.Conn, error)4*map.group[http.connectMethodKey][]*http.persistConn4*struct { key uint32; elem *http.http2clientStream }4*struct { key string; elem []*http.http2ClientConn }4*struct { key *http.http2ClientConn; elem []string }4*struct { key string; elem []*multipart.FileHeader }4*struct { F uintptr; R *http.socksUsernamePassword }4*[]struct { key string; elem certmagic.Certificate }4*[]struct { key string; elem *certmagic.solverInfo }4*[8]struct { key string; elem certmagic.ocspUpdate }4*func(context.Context, *acme.Client, acme.EAB) error4*[8]struct { key string; elem acme.cachedDirectory }4*struct { key uint32; elem *server.udpSessionEntry }4*struct { F uintptr; X0 *sync.WaitGroup; X1 func() }4*func(func(string) bool) (reflect.StructField, bool)4*func(*time.Duration, string, time.Duration, string)4*func(*[]float32, string, string, []float32, string)4*func(*[]float64, string, string, []float64, string)4*func(*net.IPNet, string, string, net.IPNet, string)4*func(reflect.Value, ...reflect.Value) (bool, error)4*func(reflect.Value, ...reflect.Value) reflect.Value4*[]struct { key tun.flowKey; elem []tun.tcpGROItem }4*bbr.WindowedFilter[go.shape.uint64,go.shape.uint64]4*map[protocol.StatelessResetToken]quic.packetHandler4*[]struct { key uint64; elem protocol.ConnectionID }4*map[protocol.StreamID]quic.streamControlFrameGetter4*struct { F uintptr; X0 *error; X1 *sync.WaitGroup }4*func(context.Context) (*http3.RequestStream, error)DatabaseEngineVersionjson:"database_engine_version"WALSenderTImeout#json:"wal_sender_timeout,omitempty"RedisACLChannels#json:"redis_acl_channels,omitempty"RedisACLCommands#json:"redis_acl_commands,omitempty"4*func(context.Context, string, string, string) error4*func(*bigmod.Nat, *bigmod.Nat) (*bigmod.Nat, error)4*func([]uint8, *bigmod.Modulus) (*bigmod.Nat, error)4*[8]struct { key token.Pos; elem *ast.CommentGroup }4*struct { key danger.TypeID; elem map[string][]int }4*[8]struct { key netlink.BondAdSelect; elem string }4*struct { key netlink.BondArpValidate; elem string }4*struct { key netlink.BondFailOverMac; elem string }4*[8]struct { key netlink.BondLacpRate; elem string }4*[8]struct { key netlink.VlanProtocol; elem string }4*[8]struct { key string; elem netlink.BondAdSelect }4*struct { key string; elem netlink.BondArpValidate }4*struct { key string; elem netlink.BondFailOverMac }4*[8]struct { key string; elem netlink.BondLacpRate }4*[8]struct { key string; elem netlink.VlanProtocol }4*func(protoreflect.Name) protoreflect.EnumDescriptor4*func(protowire.Number) protoreflect.FieldDescriptor4*struct { F uintptr; X0 protoreflect.Map; X1 *bool }4*func(protocol.ByteCount, bool, monotime.Time) error4*[8]struct { key string; elem qpack.indexAndValues }4*edwards25519.fiatScalarMontgomeryDomainFieldElement4*map.group[filedesc.Edition]filedesc.EditionFeatures4*struct { key protoreflect.Kind; elem reflect.Type }4*func(*impl.MessageInfo) *impl.messageReflectWrapper4*func(*internal.VecK, *internal.VecK) *internal.VecK5*[8]struct { key string; elem zapcore.EncoderConfig }5*func(*tls.ClientHelloInfo) (*tls.Certificate, error)5*struct { F uintptr; X0 *tls13.ExporterMasterSecret } TrailerField(asn1:"optional,explicit,tag:3,default:1"5*[8]struct { key string; elem *x509.policyGraphNode }5*func(<-chan singleflight.Result, context.CancelFunc)5*func(zapcore.EncoderConfig) (zapcore.Encoder, error)5*struct { key string; elem *forwarding.sessionEntry }5*[8]struct { key string; elem *proxymux.muxListener }5*struct { F uintptr; X0 *socks5.Server; X1 net.Conn }5*func(protocol.StreamID) (*quic.ReceiveStream, error)5*struct { F uintptr; X0 *context.timerCtx; X1 error }5*struct { key *http.http2serverConn; elem struct {} }5*[8]struct { key uint32; elem *http.http2writeQueue }5*struct { key *http.persistConn; elem *list.Element }5*map[string]func(string, *tls.Conn) http.RoundTripper5*[]struct { key string; elem *http.http2addConnCall }5*[8]struct { key string; elem certmagic.Certificate }5*func(context.Context, []uint8) (acme.Account, error)5*struct { key string; elem *certmagic.soaCacheEntry }5*[8]struct { key string; elem *certmagic.solverInfo }5*[]struct { key unsafe.Pointer; elem unsafe.Pointer }5*func(string, string, net.IPMask, string) *net.IPMask5*func(string, map[string]int, string) *map[string]int5*[8]struct { key tun.flowKey; elem []tun.tcpGROItem }5*func(netip.AddrPort) (*udpnat.conn, time.Time, bool)5github.com/apernet/hysteria/core/v2/internal/protocol5*func(protocol.ConnectionID, quic.packetHandler) bool5*[8]struct { key uint64; elem protocol.ConnectionID }5*func(protocol.EncryptionLevel) protocol.PacketNumber5*interface { SyscallConn() (syscall.RawConn, error) } NextUpdate*asn1:"generalized,explicit,tag:0,optional"AutovacuumNaptime#json:"autovacuum_naptime,omitempty"PGPartmanBGWRole$json:"pg_partman_bgw.role,omitempty"5*func(*bigmod.Nat, uint, *bigmod.Modulus) *bigmod.Nat5*[]struct { key reflect.Type; elem *yaml.structInfo }5*func(protoreflect.Name) protoreflect.FieldDescriptor5*func(protoreflect.Name) protoreflect.OneofDescriptor5*struct { key int32; elem protoreflect.ProtoMessage }5*func(protocol.PacketNumber, *ackhandler.packet) bool5*func(*retryablehttp.Request) (*http.Response, error)5*func(protoreflect.ExtensionType, protoreflect.Value)5*[]struct { key protowire.Number; elem interface {} }5*[]struct { key reflect.Type; elem protowire.Number }5*[]struct { key protowire.Number; elem reflect.Type }5*struct { F uintptr; X0 func() congestion.Bandwidth }5github.com/cloudflare/circl/pke/kyber/internal/commonhS3`iQ#w32-TFdControlUnixSocket"mapstructure:"fdControlUnixSocket"6*struct { F uintptr; R *utils.LocalCertificateLoader }6*func(interface {}, interface {}) (interface {}, bool)^!N3b+ T@V#B֢73- 3  B3! \TT#6*func(x509.SignatureAlgorithm, []uint8, []uint8) error6*[]struct { key string; elem []*x509.policyGraphNode }wj3 - -0ľ0`QS- pľ4r-ľp0Ĕ-)ľp06*func([]uint8, []uint8, *net.IPAddr) (int, int, error)^N~3 \TTi#3d \TTV#"D3@ \TT8#8h A3 \TT`#p3" \TT`#7'3 \TTହ# Dn3 \TT@V#6*[16]atomic.Pointer[unique.node[net/netip.addrDetail]]6*atomic.Pointer[unique.indirect[net/netip.addrDetail]]6*func(*sync.indirect[*internal/abi.Type,interface {}])u30/ T@V1#6*struct { key chan<- os.Signal; elem *signal.handler }3`-6*struct { key pflag.NormalizedName; elem *pflag.Flag }v3@`¹T`¹U=3 #/3  #6github.com/apernet/hysteria/app/v2/internal/forwardingS -$ɾe -8ʾL6*[]struct { key protocol.StreamID; elem *quic.Stream }6*atomic.Pointer[github.com/apernet/quic-go.closeError]6*[]struct { key quic.pathID; elem *quic.pathOutgoing }6github.com/apernet/hysteria/extras/v2/transport/udphopg-S0˾5 Uo|-cp˾d  EncodeCaller)json:"callerEncoder" yaml:"callerEncoder"6*[]struct { key uint32; elem *http.http2clientStream }6*[]struct { key string; elem []*http.http2ClientConn }6*[]struct { key *http.http2ClientConn; elem []string }6*[8]struct { key string; elem *http.http2addConnCall }6*[]struct { key string; elem []*multipart.FileHeader }6*struct { F uintptr; X0 chan bool; X1 chan struct {} }Aţ3 UX#f38 @U#;3 TT`#*l3 \% #h3 \%T #O\@-dpξ^\-ξ0:z-ξM`]6}-1 0Ͼ!*`3]% TT6#6*func(context.Context, string, bool) ([]string, error)6*func(context.Context, string, string, []string) error~ 3x \TX`¹#%W3d\ #,3% \`¹#*3 \TT`¹#g(=o3? \T@VX#1-;3Jr\T#OnlyReturnExisting#json:"onlyReturnExisting,omitempty"\43Ay\ / #ޑ3r\ T<#GP3r\ T`#S|53 \ YY# 3\ @@#|M3d\ ~<#'{>33?\ <<#6*func(string, []uint8) (server.UDPConn, string, error)6*[]struct { key uint32; elem *server.udpSessionEntry }tn30 TVXT̢3x TT#33X U.@DccC3 -&&XX_b}3 6@5#n3+ 6#30@@nn#KLS3@@ooc#:Y3& 6*ecdh.Curve[*crypto/internal/fips140/nistec.P256Point]6*ecdh.Curve[*crypto/internal/fips140/nistec.P384Point]6*ecdh.Curve[*crypto/internal/fips140/nistec.P521Point]6*func(*big.Int, *big.Int, *big.Int, *big.Int) *big.Int?3 6*[8]struct { key unsafe.Pointer; elem unsafe.Pointer }d%3)"-K3+-3 @V#Fm3lT~#X 3N3 `0V@XX&3 `0@X@XX6*func(*net.IPMask, string, string, net.IPMask, string)6*func([]string, func(*pflag.Flag, string) error) error6*func(*map[string]int, string, map[string]int, string)6*func(pflag.Value, string, string, string) *pflag.Flag0 3:TTXT Di3E TTT ¹ͺ3  ¹TTTc3x DTTXTBQ3 TTT`73" `TTT}$3w TTT@w3! TTֹTչ\N3 , չTTֹTKb3ȃ @TTTߔ3 TTWTC6J{3ў TTT V3F  TTT1$3@" CTTWT7U3 TTWTC{]3 TT`T 3| TT`T3r" CTTWTe3 TTsTsR 3 sTTsT3; TTUT983 TTUT+Z3.F TT@DTq535 TT`T ~ʯ3e  TT`T_?3p qTT@DT/3 TTTT@H34 @TTTTě-'3  TT@UT`AS3 TT`TY3" TT`T34 `ATT@UT037 TTUTA ?3O TT`TqUl3" TT`T934 ATTUT|́3TT@TT`@l_e3Ё`@TT@TT\w3TT@VT`B<3d TT`T f}+v35  TT`TA3ѯ`BTT@VTX3)6 TT`¹T`[3f `TT`¹Ti$3]F TTTT @3\33 TT@T@~3 TT@T93 TT@ȿT`h3 `TT@ȿTd 3 TT@ƿT X35  TT@ƿT/3  @TTTTɹ<3F TTUT AN53  ATTUT+53F TTUTA1s3 ATTUT~R3F TTVT BgQ30  BTTVTp3 TTTT@k>3D5 @TTTTaEL3TTVTBա}3G TTT࿹bw3` ࿹TTTYO3(BTTVTƌ3 TTTEH3 T``#43p T@V@#6*struct { F uintptr; X0 *tun.System; X1 net.Listener }ᇼ 3g`@V`@V#J3h yU>sX3\y F ,ӽf-,3X2\y F ,I)3P\y@ F ,z>`3Q# 6*func([]protocol.ConnectionID, []uint8, time.Duration)6*func(context.Context, []uint8) (int, net.Addr, error)6*func(*quic.remoteAddrInfo, *quic.remoteAddrInfo) bool6*struct { F uintptr; X0 quic.packetHandler; X1 error }r3umX~$3 \@V#!3$wum #3:xum #r3" tss-^  6*struct { F uintptr; X0 *http3.Conn; X1 *quic.Stream }6*struct { F uintptr; X0 *http3.Server; X1 *quic.Conn }}'3%jj#Xka3 TUTT=͠3gJ TTUU<3J @V@V@V`#-3( T#5U3vy o#Vv39 `(E3J TT`3l\B #3Y\TB #) 3 \TT #LogErrorVerbosity$json:"log_error_verbosity,omitempty"DisablePublicIPv4$json:"disable_public_ipv4,omitempty"6*func(context.Context, string) (*http.Response, error)6*func(context.Context, string, *govultr.UserReq) error<3m\T޸#Y3\߸߸#Jq3o`\T߸#\tH3, \T #h3N{\T#N03{\T#=pF3Fn\T #W8W3x \TH#b3{\TH# 3.u\T#oS3h\ `#oR3Q\T`#/]3#\`#U3)\T#P̗3\`J`޸#:3OW\#q3/|\T#D3`\T`# }3)\T#.a3pR\T#9a3. \T`¹#@3 \TT#DS3:;\#~||3!o\T#J_3M \T #3l3\TT#L3%\`#aМ3R\T#3 \TT#!23 X\ #h0\/3z|\T #N 3^Z\T#"413 \T#ȉ3 \T #tM3\TM#w3\T#72>3*\T #bP3>\ #]43 \T #ɣ3D\ #O3 \TTT#BbE3u\T#83A\T #z3\`#61IK3\T`# 3=5\TP#:3RE\`#®[3 v\T#t3S\T`#&53jo\T #3\ #.3R\` #;|3\T #3#3\ `#y3Q\`#3|\T`#13;\ `#+3o\T`#qu3\ #ڨ3`S\T #zE3Z\#Li%3 \T#L3\`#8.3 \T# I3[\` #+3 \T #33\ #83(& TT#H31% TTTX#Ñ)3k 5Tn@V#6*[]struct { key danger.TypeID; elem map[string][]int }6*[8]struct { key reflect.Type; elem *yaml.structInfo }6*struct { key netlink.BondArpAllTargets; elem string }6*[]struct { key netlink.BondArpValidate; elem string }6*[]struct { key netlink.BondFailOverMac; elem string }6*struct { key string; elem netlink.BondArpAllTargets }6*[]struct { key string; elem netlink.BondArpValidate }6*[]struct { key string; elem netlink.BondFailOverMac }6*struct { key protoreflect.Kind; elem protowire.Type }w0-Dr)}-#`6*func(protoreflect.Name) protoreflect.MethodDescriptor6*func(protoreflect.FieldDescriptor) protoreflect.Valueݓ3@lwvvXŴ)3i@lvwvXM3Y `E@@V#6*func(protocol.PacketNumber, protocol.ECN, bool) error7_3e wUUUX6R3h x-޼43 tE@lX#gBm3>`E@lX#)u3x-9!63 x- ݼH.83^y-3n8@lutuXC3S#J3z @V #Sk3!{  @V#;3{ TT#g)38 @fXb@l53 #YJ93  p#o3@  p#6*map.group[protowire.Number]protoreflect.ExtensionTypeY-- ]@}HO-0 6*map.group[protoreflect.EnumNumber]*filedesc.EnumValue6*struct { key protowire.Number; elem *filedesc.Field }6*struct { key protoreflect.Name; elem *filedesc.Enum }]n3A@U@U``3|3@U@U``H6*[]struct { key protoreflect.Kind; elem reflect.Type }6*struct { key protowire.Number; elem *impl.fieldInfo }6*[8]struct { key protowire.Number; elem interface {} }6*[8]struct { key reflect.Type; elem protowire.Number }6*[8]struct { key protowire.Number; elem reflect.Type }6*map.group[reflect.Type]protoreflect.MessageDescriptor6*struct { F uintptr; X0 protoreflect.FieldDescriptor }/ - @ -MP@Gx^,3@uu@lu6*struct { F uintptr; X0 *error; X1 prototext.encoder }7*struct { F uintptr; X0 *utils.LocalCertificateLoader }7*func(*big.Int, *big.Int, []uint8) (*big.Int, *big.Int)7*sync.node[go.shape.interface {},go.shape.interface {}]7*struct { F uintptr; X0 *tls.Conn; X1 context.Context }7*[8]struct { key string; elem []*x509.policyGraphNode }7*func([]uint8, []uint8, *net.UDPAddr) (int, int, error)7*func() *sync.indirect[*internal/abi.Type,interface {}]7*interface { Network() poll.String; PollFD() *poll.FD }7*struct { F uintptr; X0 []mapstructure.DecodeHookFunc } DisableCaller)json:"disableCaller" yaml:"disableCaller" EncoderConfig)json:"encoderConfig" yaml:"encoderConfig" InitialFields)json:"initialFields" yaml:"initialFields"7*[]struct { key string; elem *forwarding.sessionEntry }7*[8]struct { key protocol.StreamID; elem *quic.Stream }7*struct { key protocol.StreamID; elem go.shape.*uint8 }7*[8]struct { key quic.pathID; elem *quic.pathOutgoing } StacktraceKey)json:"stacktraceKey" yaml:"stacktraceKey"7*[]struct { key *http.http2serverConn; elem struct {} }7*map[string]func(*http.Server, *tls.Conn, http.Handler)7*func(string, func(http.ResponseWriter, *http.Request))7*[]struct { key *http.persistConn; elem *list.Element }7*[8]struct { key uint32; elem *http.http2clientStream }7*[8]struct { key string; elem []*http.http2ClientConn }7*[8]struct { key *http.http2ClientConn; elem []string }7*[8]struct { key string; elem []*multipart.FileHeader }7*struct { F uintptr; R *http.http2serverInternalState }7*struct { F uintptr; X0 func(io.Reader); X1 io.Reader }7*func(context.Context, tls.Certificate, []string) error7*[]struct { key string; elem *certmagic.soaCacheEntry }7*func(context.Context, string) ([]libdns.Record, error)7*[8]struct { key uint32; elem *server.udpSessionEntry }7*struct { F uintptr; X0 *server.h3sHandler; X1 string }7*ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point]7*ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point]7*ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point]7*ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point]7*func([]uint8, map[string]uint16, int) ([]uint8, error)7*func(*abi.SwissMapType, unsafe.Pointer) unsafe.Pointer7*func(string, []time.Duration, string) *[]time.Duration7github.com/spf13/viper/internal/encoding/javaproperties7*func(protocol.StatelessResetToken, quic.packetHandler)7*func(protocol.ConnectionID) (quic.packetHandler, bool)7*func(protocol.StreamID, quic.streamControlFrameGetter)7*func(protocol.EncryptionLevel) ackhandler.FrameHandler7*map.group[protocol.StreamID]*http3.stateTrackingStream7*struct { key crypto.Hash; elem asn1.ObjectIdentifier }MySQLSlowQueryLog%json:"mysql_slow_query_log,omitempty"UnhealthyThreshold$json:"unhealthy_threshold,omitempty"BalancingAlgorithm$json:"balancing_algorithm,omitempty"7github.com/apernet/hysteria/extras/v2/outbounds/tinydoh7*func(*bigmod.Nat, *bigmod.Modulus) (*bigmod.Nat, bool)7*[8]struct { key danger.TypeID; elem map[string][]int }7*struct { references int; anchor int; serialized bool }7*[8]struct { key netlink.BondArpValidate; elem string }7*[8]struct { key netlink.BondFailOverMac; elem string }7*struct { key netlink.BondXmitHashPolicy; elem string }7*[8]struct { key string; elem netlink.BondArpValidate }7*[8]struct { key string; elem netlink.BondFailOverMac }7*struct { key string; elem netlink.BondXmitHashPolicy }7*struct { F uintptr; X0 *int; X1 proto.MarshalOptions }7*func(protoreflect.Name) protoreflect.MessageDescriptor7*func(protoreflect.Name) protoreflect.ServiceDescriptor7*func(protoreflect.FieldDescriptor, protoreflect.Value)7*[]struct { key int32; elem protoreflect.ProtoMessage }7*struct { F uintptr; X0 *ackhandler.lostPacketTracker }7*struct { F uintptr; X0 *ackhandler.sentPacketHistory }7*func(kem.PublicKey, []uint8) ([]uint8, []uint8, error)7*struct { key protoreflect.Name; elem *filedesc.Field }7*struct { key protoreflect.Name; elem *filedesc.Oneof }7*[8]struct { key protoreflect.Kind; elem reflect.Type }7*func(protoreflect.Value, int, impl.marshalOptions) int7*struct { key protoreflect.Name; elem *impl.oneofInfo }7*struct { key reflect.Type; elem *impl.coderFieldInfo }7github.com/cloudflare/circl/pke/kyber/kyber512/internal7github.com/cloudflare/circl/pke/kyber/kyber768/internal8*struct { F uintptr; X0 *url.URL; X1 *cmd.serverConfig }8*func(context.Context, string, string) (net.Conn, error)8*sync.entry[go.shape.interface {},go.shape.interface {}]8*func(x509.VerifyOptions) ([][]*x509.Certificate, error)8*func([]uint8, []uint8, *net.UnixAddr) (int, int, error)8*func(context.Context, string, string) ([]net.IP, error)8*atomic.Pointer[go.shape.struct { unique.isEntry bool }]8*[]struct { key chan<- os.Signal; elem *signal.handler }8*func(func(*pflag.FlagSet, string) pflag.NormalizedName)8*[]struct { key pflag.NormalizedName; elem *pflag.Flag }8*[8]struct { key string; elem *forwarding.sessionEntry }8*struct { F uintptr; X0 **redirect.sockAddr; X1 *error }8*struct { F uintptr; X0 *tproxy.TCPTProxy; X1 net.Conn }8*struct { key protocol.StreamID; elem *quic.SendStream }8*func(zapcore.Entry, zapcore.Core) *zapcore.CheckedEntry8*[8]struct { key *http.http2serverConn; elem struct {} }8*[8]struct { key *http.persistConn; elem *list.Element }8*func(string, string, io.Reader) (*http.Response, error)8*struct { F uintptr; X0 *http.conn; X1 context.Context }8*func(context.Context, []uint8, []uint8, []string) error8*[8]struct { key string; elem *certmagic.soaCacheEntry }8*struct { key string; elem outbounds.PluggableOutbound }8*func(*big.Int, *big.Int, *big.Int) (*big.Int, *big.Int)8*func(*abi.SwissMapType, unsafe.Pointer, unsafe.Pointer)8*func(*[]time.Duration, string, []time.Duration, string)8*struct { key jwalterweatherman.Threshold; elem string }8*struct { F uintptr; X0 *error; X1 func(uintptr) error }8*func(*tls.Config, *quic.Config) (*quic.Listener, error)8*func(*quic.Transport, time.Duration, func()) *quic.Path8*func(*wire.CryptoFrame, protocol.EncryptionLevel) error8*struct { F uintptr; X0 quic.connRunner; X1 *quic.Conn }8*struct { F uintptr; X0 *quic.Transport; X1 *quic.Conn }8*func(*dns.Msg, string) (*dns.Msg, time.Duration, error)8*func(context.Context, *oauth2.Token) oauth2.TokenSourceBGWRITERFlushAFter%json:"bgwriter_flush_after,omitempty"MaxParallelWorkers%json:"max_parallel_workers,omitempty"MaxWorkerProcesses%json:"max_worker_processes,omitempty"RedisACLCategories%json:"redis_acl_categories,omitempty"8*func(context.Context, string, *govultr.ReverseIP) error8*func(context.Context, string, *govultr.SSHKeyReq) error8*func(*bigmod.Nat, []uint8, *bigmod.Modulus) *bigmod.Nat8*[]struct { key netlink.BondArpAllTargets; elem string }8*struct { key netlink.BondPrimaryReselect; elem string }8*[]struct { key string; elem netlink.BondArpAllTargets }8*struct { key string; elem netlink.BondPrimaryReselect }8*[]struct { key protoreflect.Kind; elem protowire.Type }8*[8]struct { key int32; elem protoreflect.ProtoMessage }8*func(context.Context, slog.Level, string, ...slog.Attr)8*struct { key protoreflect.FullName; elem interface {} }8*[]struct { key protowire.Number; elem *filedesc.Field }8*map.group[protowire.Number]protoreflect.FieldDescriptor8*[]struct { key protoreflect.Name; elem *filedesc.Enum }8*struct { key protoreflect.Name; elem *filedesc.Method }8*[]struct { key protowire.Number; elem *impl.fieldInfo }8*func(impl.pointer) (impl.pointer, *impl.coderFieldInfo)8*struct { F uintptr; X0 reflect.Type; X1 *impl.mapInfo }8github.com/cloudflare/circl/pke/kyber/kyber1024/internal9*struct { key server.HyStream; elem *server.StreamStats }9*func(*x509.Certificate, func([]*x509.Certificate) error)9*func([]uint8, []uint8, netip.AddrPort) (int, int, error)9*[8]struct { key chan<- os.Signal; elem *signal.handler }9*func() func(*pflag.FlagSet, string) pflag.NormalizedName9*[8]struct { key pflag.NormalizedName; elem *pflag.Flag }9*func(reflect.Value, reflect.Value) (interface {}, error)9*struct { F uintptr; X0 func(zapcore.Core) zapcore.Core }9*struct { F uintptr; X0 *proxymux.muxManager; X1 string }9*func(context.Context, net.Conn, metadata.Metadata) error9*func(*list.Element[func(int)], *list.Element[func(int)])9*[]struct { key protocol.StreamID; elem go.shape.*uint8 }9*func(json.reflectWithString, json.reflectWithString) int9*map.group[http.http2FrameType]map[http.http2Flags]string9*struct { F uintptr; X0 *http.http2stream; X1 time.Time }9*func(context.Context, string) (certmagic.KeyInfo, error)9*struct { key string; elem []certmagic.dnsPresentMemory }9*func(*ecdh.PrivateKey, *ecdh.PublicKey) ([]uint8, error)9*func(string, map[string]int64, string) *map[string]int649github.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo9*func(protocol.ConnectionID) protocol.StatelessResetToken9*func(protocol.StreamID) flowcontrol.StreamFlowController9*func(uint64, protocol.ConnectionID, monotime.Time) error9*struct { key string; elem *http3.roundTripperWithCount }9*struct { F uintptr; X0 reflect.Value; X1 reflect.Value }9*[]struct { key crypto.Hash; elem asn1.ObjectIdentifier }FerretDBCredentials%json:"ferretdb_credentials,omitempty"MySQLLongQueryTime&json:"mysql_long_query_time,omitempty"MaxFilesPerProcess&json:"max_files_per_process,omitempty"9github.com/apernet/hysteria/extras/v2/sniff/internal/quic9*[8]struct { key netlink.BondArpAllTargets; elem string }9*[]struct { key netlink.BondXmitHashPolicy; elem string }9*[8]struct { key string; elem netlink.BondArpAllTargets }9*[]struct { key string; elem netlink.BondXmitHashPolicy }9*struct { F uintptr; X0 *syscall.Errno; X1 []unix.Iovec }9*[8]struct { key protoreflect.Kind; elem protowire.Type }9*func(func(protoreflect.MapKey, protoreflect.Value) bool)9*func(protoreflect.Name) protoreflect.EnumValueDescriptor9*[]struct { key protoreflect.Name; elem *filedesc.Field }9*[8]struct { key protowire.Number; elem *filedesc.Field }9*map.group[protoreflect.Name]protoreflect.FieldDescriptor9*struct { key string; elem protoreflect.FieldDescriptor }9*[]struct { key protoreflect.Name; elem *filedesc.Oneof }9*[8]struct { key protoreflect.Name; elem *filedesc.Enum }9*struct { key protoreflect.Name; elem *filedesc.Message }9*struct { key protoreflect.Name; elem *filedesc.Service }9*[8]struct { key protowire.Number; elem *impl.fieldInfo }9*[]struct { key protoreflect.Name; elem *impl.oneofInfo }9*[]struct { key reflect.Type; elem *impl.coderFieldInfo }9github.com/cloudflare/circl/sign/dilithium/mode3/internal9github.com/cloudflare/circl/sign/dilithium/mode2/internal8:0 2TZ[74N`GV mLHd-^HUཹmLF2TRw%nj `G3`5AI3k 3Wp^3~ 3cޅ$3k 3N=3x@l 3`p`3~l 3TL_p`Er * s`Er7h50_u?\--T{=3uD5pJ `54ǀATz ǰ0 T ZtMb`w~Il3E  << x4@ `^<<x4 _<<:x4B _A3t .TT3`.TTe3i / @(0KT89  c{<0UT N b3\1#'Mb ]`ϵV3"-`_UཹD |n7;_A~D53"``3B`3 cZ`NP3 dZ #Ox3P`dZ6#oVZ3dZ# b*+0(~iVྐྵ 9y=0P~iVྐྵ082x~ jVྐྵHtUX9~`jVྐྵ  ˦Q0޵ jVྐྵ4frj`4_ p`E{)- q@.I TP P~0T U8,7rT8ٴt31|Uཹs iykJҋ@)@F9 xT I` F@9 3>@F9 f2H`I3.  -d7`@G3. 3H`I! jI2` G@! 5]>H`IJ! ⨔>`@HJ! ;1<X2ҋ@*@F9 @.8` H9 X2`@F9  W51``T༹ IgnoreClientBandwidth$mapstructure:"ignoreClientBandwidth":*struct { F uintptr; X0 client.Client; X1 chan struct {} }:*func([]uint8, []uint8, []uint8, []uint8) ([]uint8, error)ƭ34J #X3``{``o#\z!3`@<`{o#f3/4`@<`oU#S͔"3k``{`o#U)3 J3t $@V@V#{X30 R@V@V#~I361  S@V@V#i3k"  |@V@V#v9D3  @V@V#M3. y@V@V#p3 |@V@V# 3E\\TJ#:*[]atomic.Pointer[go.shape.struct { unique.isEntry bool }]" 9|-b0 pNQ':*[]struct { key protocol.StreamID; elem *quic.SendStream }:*func(*quic.pathManagerOutgoing) *quic.pathManagerOutgoing:*[8]struct { key protocol.StreamID; elem go.shape.*uint8 }SkipLineEnding+json:"skipLineEnding" yaml:"skipLineEnding"I>T-u OT:*struct { key http.routingIndexKey; elem []*http.pattern }Y1A3 \TT`#:*struct { F uintptr; X0 *certmagic.RingBufferRateLimiter }:*func(context.Context, acme.Account) (acme.Account, error)TermsOfServiceAgreed%json:"termsOfServiceAgreed,omitempty"F3\ YY#U/A83Ce\ `/@V#Nh;-@QroTCR- QOTq39kjt#X#:*[]struct { key string; elem outbounds.PluggableOutbound }ƍ|36 J3  -&o3 `J3 @ ' i7h 0Sxٶ4L3;:`0V@X@XX:*func(*map[string]int64, string, map[string]int64, string):*[]struct { key jwalterweatherman.Threshold; elem string }@3HC"ysZ38$+E:*map.group[protocol.StatelessResetToken]quic.packetHandler:*map.group[protocol.StreamID]quic.streamControlFrameGetter:*func(*wire.Header, []uint8) (*quic.unpackedPacket, error):*atomic.Pointer[github.com/apernet/quic-go.remoteAddrInfo]:*struct { F uintptr; X0 *quic.Transport; X1 quic.rawConn }:*struct { F uintptr; X0 func(wire.Frame); X1 *[3]uintptr }(qt3kY\` .`#h3мu@lm\#t](3@u@lm\#Ky3Xu@lm #|3um\#Sj3W.m\#^n3:5 Xm`H#Ȫ3\T` .`#:*[8]struct { key crypto.Hash; elem asn1.ObjectIdentifier }:*func([]uint8, int, dns.compressionMap, bool) (int, error)D38X @VhX@V#Ihv3{\T#p3\o#RedisEvictionPolicy&json:"redis_eviction_policy,omitempty"BGWRITERLRUMaxPages&json:"bgwriter_lru_maxpages,omitempty"MaxReplicationSlots&json:"max_replication_slots,omitempty"!U3)\ݸF`޸# 3\ݸ G`޸#-ʺ3\ݸG`޸#o3*\T`߸#Wb53\ݸ I`޸#m<3\ݸI`޸#hw37\ݸI`޸#I3n8\T#=]s3\TT #!v3\ݸ J`޸#][q3i^\T #J3\T#Z32\T `#}3\T#~ 3=\T #|3\T#r 3\TT`#3:\TT#83MD\TT#sŽT3d\ K`޸#3-\T``K#$r3R\TK`޸#=3\ L`޸#3\T `L#7"3W\TL`޸#w39\T#>3xZ\T# 83\T T#%3C3-\T`#3\ݸ`޸# 6E3\\T#d7I3D\TT#n&_3:\ݸL`޸#>p63\T `#b~3<*\T@V`#U3\T D`#"3.\ݸ`M`޸#ɿt3\T #\g3\T` #[lS30\ݸ N`޸#ǵP3\ݸ`N`޸#o3F\T`# 3f\TT`#"K3\ݸO`޸#+z3z\T #3q2\TT#B632\TT #s37\ݸP`޸#-3\ݸ Q`޸# 35@I{@#3/ :github.com/cloudflare/circl/sign/dilithium/internal/common;*[]struct { key server.HyStream; elem *server.StreamStats };*[]*sync.entry[go.shape.interface {},go.shape.interface {}];*sync.indirect[go.shape.interface {},go.shape.interface {}];*func([]uint8, []uint8, syscall.Sockaddr) (int, int, error);*func([]uint8, []uint8) (int, int, int, *net.IPAddr, error);*[8]struct { key protocol.StreamID; elem *quic.SendStream };*struct { Layout string "json:\"layout\" yaml:\"layout\"" };*func(*http.Request, string) (*http.http2ClientConn, error);*struct { key *http.Request; elem context.CancelCauseFunc };*map.group[string]func(string, *tls.Conn) http.RoundTripper;*func(context.Context, []string) ([]tls.Certificate, error);*[]struct { key string; elem []certmagic.dnsPresentMemory };*struct { F uintptr; X0 *server.serverImpl; X1 *quic.Conn };*[8]struct { key string; elem outbounds.PluggableOutbound };*go.shape.struct { Key reflect.Value; Value reflect.Value };*func(string, string, time.Duration, string) *time.Duration;*func(string, map[string]string, string) *map[string]string;*[8]struct { key jwalterweatherman.Threshold; elem string };github.com/apernet/hysteria/core/v2/internal/congestion/bbr;*func(monotime.Time) (ackhandler.Frame, protocol.ByteCount);*[]struct { key string; elem *http3.roundTripperWithCount };*struct { F uintptr; X0 *http3.Conn; X1 protocol.StreamID };*func(*dns.Msg, *dns.Conn) (*dns.Msg, time.Duration, error)MaintenanceScheduled&json:"maintenance_scheduled,omitempty";*[8]struct { key netlink.BondPrimaryReselect; elem string };*[8]struct { key string; elem netlink.BondPrimaryReselect };*func(protocol.PacketNumber, protocol.EncryptionLevel) bool;*struct { F uintptr; X0 *ackhandler.receivedPacketHistory };*func([]uint8) (int, *ipv4.ControlMessage, net.Addr, error);*func([]uint8, *ipv4.ControlMessage, net.Addr) (int, error);*func(context.Context, slog.Level, string, ...interface {});*func(string, string, interface {}) (*http.Response, error);*[8]struct { key protoreflect.FullName; elem interface {} };*func(protoreflect.FullName) (protoreflect.EnumType, error);*map[protoreflect.FullName]protoregistry.extensionsByNumber;*struct { key protoreflect.Name; elem *filedesc.EnumValue };*[]struct { key string; elem protoreflect.FieldDescriptor };*[]struct { key protoreflect.Name; elem *filedesc.Message };*[8]struct { key protoreflect.Name; elem *filedesc.Method };*[]struct { key protoreflect.Name; elem *filedesc.Service };*struct { key protoreflect.Name; elem *filedesc.Extension };*func(protoreflect.ProtoMessage, protoreflect.ProtoMessage);*struct { key protowire.Number; elem *impl.coderFieldInfo };*struct { key protoreflect.Name; elem reflect.StructField };*struct { F uintptr; X0 protowire.Number; X1 reflect.Type };*struct { F uintptr; X0 reflect.Type; X1 protowire.Number }MaxStreamReceiveWindow%mapstructure:"maxStreamReceiveWindow"<*[8]struct { key server.HyStream; elem *server.StreamStats }<*func(*tls.CertificateRequestInfo) (*tls.Certificate, error)<*[0]*sync.entry[go.shape.interface {},go.shape.interface {}]<*func([]uint8, []uint8) (int, int, int, *net.UDPAddr, error)<*func(context.Context, string, string) (net.Listener, error)<*func(context.Context, string, string) ([]net.IPAddr, error)<*func(context.Context, string, string) ([]netip.Addr, error)<*[16]atomic.Pointer[go.shape.struct { unique.isEntry bool }]<*struct { F uintptr; X0 *forwarding.TCPTunnel; X1 net.Conn }<*struct { F uintptr; X0 *proxymux.muxListener; X1 net.Conn }<*quic.incomingStreamsMap[*github.com/apernet/quic-go.Stream]<*quic.outgoingStreamsMap[*github.com/apernet/quic-go.Stream]EncodeDuration-json:"durationEncoder" yaml:"durationEncoder"<*func(string) (multipart.File, *multipart.FileHeader, error)<*[]struct { key http.routingIndexKey; elem []*http.pattern }<*struct { F uintptr; X0 *http.Transport; X1 *http.wantConn }<*[8]struct { key string; elem []certmagic.dnsPresentMemory }<*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }<*func(*time.Duration, string, string, time.Duration, string)<*func(*map[string]string, string, map[string]string, string)Ip9protobuf:"bytes,1,opt,name=ip,proto3" json:"ip,omitempty"<*func(monotime.Time, protocol.ByteCount, protocol.ByteCount)<*struct { F uintptr; X0 *quic.packetHandlerMap; X1 []uint8 }<*[8]struct { key string; elem *http3.roundTripperWithCount }<*func(context.Context, string, *govultr.AttachVPC2Req) errorAutovacuumMaxWorkers'json:"autovacuum_max_workers,omitempty"TrackCommitTimestamp'json:"track_commit_timestamp,omitempty"EnablePrivateNetwork'json:"enable_private_network,omitempty"AttachPrivateNetwork'json:"attach_private_network,omitempty"NextScheduleTimeUTC(json:"next_scheduled_time_utc,omitempty"DetachPrivateNetwork'json:"detach_private_network,omitempty"<*struct { F uintptr; X0 *tls.cacheEntry; X1 *tls.certCache }<*func(*nistec.P256Point, []uint8) (*nistec.P256Point, error)<*func(*nistec.P521Point, []uint8) (*nistec.P521Point, error)<*func(*nistec.P224Point, []uint8) (*nistec.P224Point, error)<*func(*nistec.P384Point, []uint8) (*nistec.P384Point, error)<*func(protoreflect.FieldDescriptor, protoreflect.Value) bool<*func(sign.PrivateKey, []uint8, *sign.SignatureOpts) []uint8<*struct { F uintptr; X0 *gob.userTypeInfo; X1 reflect.Type }<*[]struct { key string; elem []protoreflect.FileDescriptor }<*[8]struct { key string; elem protoreflect.FieldDescriptor }<*[8]struct { key protoreflect.Name; elem *filedesc.Message }<*[8]struct { key protoreflect.Name; elem *filedesc.Service }<*func(protoreflect.ExtensionType, func() protoreflect.Value)<*[]struct { key protowire.Number; elem reflect.StructField }<*func(time.Duration, time.Duration, protocol.ByteCount) bool=*struct { key string; elem *trafficlogger.trafficStatsEntry }=*struct { F uintptr; X0 *cmd.clientConfig; X1 client.Client }=*func(context.Context, string, string, syscall.RawConn) error=*func([]uint8, []uint8) (int, int, int, *net.UnixAddr, error)=*sync.node[go.shape.*internal/abi.Type,go.shape.interface {}]=*struct { key string; elem func(*url.URL) (zap.Sink, error) }=*struct { F uintptr; X0 *zap.SamplingConfig; X1 *zap.Config }=*quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream]=*func(zapcore.Entry, []zapcore.Field) (*buffer.Buffer, error)=*map.group[string]func(*http.Server, *tls.Conn, http.Handler)=*[8]struct { key http.routingIndexKey; elem []*http.pattern }=*[]struct { key *http.Request; elem context.CancelCauseFunc }=*func(context.Context, *url.URL, string) (http.Header, error)=*struct { F uintptr; X0 http.http2closeWaiter; X1 chan bool }=*func(context.Context, string, map[string]interface {}) error=*func(context.Context, string) (certmagic.Certificate, error)=*struct { key string; elem *certmagic.RingBufferRateLimiter }=*func(io.Reader, []uint8, crypto.SignerOpts) ([]uint8, error)=*func(string, string, map[string]int, string) *map[string]int=*func(reflect.Value, ...reflect.Value) (reflect.Value, error)=*func(*tls.Config, *quic.Config) (*quic.EarlyListener, error)=*func(context.Context, string, string) (*oauth2.Token, error)PGPartmanBGWInterval(json:"pg_partman_bgw.interval,omitempty"=*struct { F uintptr; X0 *exec.Cmd; X1 chan<- exec.ctxResult }=*struct { F uintptr; X0 func(func() error); X1 func() error }=*func(*nistec.P256Point, *nistec.P256Point) *nistec.P256Point=*func(*nistec.P521Point, *nistec.P521Point) *nistec.P521Point=*func(*nistec.P224Point, *nistec.P224Point) *nistec.P224Point=*func(*nistec.P384Point, *nistec.P384Point) *nistec.P384Point=*struct { key protowire.Number; elem protoreflect.RawFields }=*func(*fiat.P224Element, *fiat.P224Element) *fiat.P224Element=*func(*fiat.P256Element, *fiat.P256Element) *fiat.P256Element=*func(*fiat.P384Element, *fiat.P384Element) *fiat.P384Element=*func(*fiat.P521Element, *fiat.P521Element) *fiat.P521Element=*func(protoreflect.FullName) (protoreflect.Descriptor, error)=*[8]struct { key string; elem []protoreflect.FileDescriptor }=*[]struct { key protoreflect.Name; elem *filedesc.EnumValue }=*[]struct { key protoreflect.Name; elem *filedesc.Extension }=*[]struct { key protowire.Number; elem *impl.coderFieldInfo }=*[8]struct { key protowire.Number; elem reflect.StructField }=*[]struct { key protoreflect.Name; elem reflect.StructField }=*struct { F uintptr; X0 impl.offset; X1 reflect.StructField }B+-h@@%fv-`Zէ-@hw-Eth揅-[ti@Zߝ-``iS-`i3E-S +u-{@K|- ; 0@d32 (. ; 0@4b3S-h (.Mu< 0@a3P-Sk|-/J`= 0@b3DU-q/-pY-v@qKL-q` ,.a? w"@lc3x,w|-(@ Zw"@T[+*-<|- A Z0@4V+z* 6,.C w"@X  Z2/-@ l̇|-F 0@A'8/$8r]|-x`F 0@F-beH w"@W#-OS Ow"@DIZ|-T O0@tp/|-9U O0@ĮS|-9U Hp7@P:9UV3`[H@`¹#.-ۮV hw"@YX-K}` g}-l h w"@fyy{-h w"@gy(yES`3Q a, j@<#k-(@i 9_,.t<j 3UFlZXYDy6?3,j=``p7|-(p =;;P-$Rl=!_,./s Er0@MNFF,{,.. t ErONNhF} (.qt Er0@UN(Fn|-5@u Er0@TbN0Kv|-u Er0@x^NFm&6 |-\| Erw"@HN\EJж-՗` Er` LNLYEcJ- Erw"@NE6r-l Erw"@܍NlER:-? Erw"@NEε- Erw"@̎N E{d-l` Vw"@('{- Vw"@L('-3S~  Y#iD-}  G7|-V@ g0@ RA-.@gRz-\`4 {-Y->>DĀ-5/>>MB-U >@>1a -l I- c- g\|- w"@(H(}M|-` w"@6(P*(|- %w"@!xW-u`Ds|- (w"@e+a+V-@ ǤP-q R-  cC-V`@w,.F v0@o`n' |- VK0@d"1|-F` VK0@`ze-1@'c4-')% -G GZ(K,. 0@C,-Sx@CG^-q-  -Z w"@dޢ- @o-G# I-|-h D0@wU-`- Ow"@, O OF_U-4C w"@gL$ (.Mu@ 0@Nt (.  0@O |-/J 0@(PrϦ3B (3@XVVtL3`(3@X@XXT|-H Z^76V|-ܭ@ Z7_d76&$,. T0@~͊,.  H0@wXrX|-K` H0@pv|-  H0@iYPP3m7H 8#*HA,.@ ?0@DurD (.j ?0@D)ur ,. ` ?0@L+ur[ڐL,.\ ?0@<,urD|- ?0@urE38|-. ?0@ ur})p|-n@ ?0@@#urGq1|-P ?0@ "urM|-. ?0@t$ur.;)|-y` ?0@%urB|- ?0@&ur0‹8|-( ?0@(ur턫|-? ?0@pur,.‚ ?0@u7-{ 0@s`U`Vek|-` |0@1l4k+_- @ӿ- s2-@ S- [3|-1 1w"@ldl巤-14vx-2 2w"@BYBLm-` 2w"@BYBm,.: 3-nt~3L `3 @Vfy7--P :w"@x#c- fQ0@f=,.r fQ0@te>(>5,.P fQ0@i-gaԩ|^3bZ`N @V -}@O  |- 0@S R+|-p T)J ,.| H) 0@DGS8S^ 3@`md.m`ސ3bmd.`XI -  od.\b<|- GP MlyXyy:-Q`p@¿l-qv¿: B3x@V r |-/ M&^F|-^ 0@da5YS|-/ E B1Z-H ÿ ]߇-@Ŀ /٭-`@Ŀ@ )-_ĿsV-Ŀ?HV-ſQ -f` '@ſ'=*-u``'ſ'InitStreamReceiveWindow&mapstructure:"initStreamReceiveWindow"MaxConnectionReceiveWindow#mapstructure:"maxConnReceiveWindow"DisablePathMTUDiscovery&mapstructure:"disablePathMTUDiscovery"ޝm5 TTV-865W@:XW045E<X-h 5|* T @Y-h 5Q5T`Z-=5TZ-h Ph{5 T[-hl`w;d5c5TW@\-h =15`T@V]-h 5T]-h >*func([]uint8, tls.ConnectionState) (*tls.SessionState, error)>*func(tls.ConnectionState, *tls.SessionState) ([]uint8, error)>*elliptic.nistCurve[*crypto/internal/fips140/nistec.P256Point]>*elliptic.nistCurve[*crypto/internal/fips140/nistec.P384Point]>*elliptic.nistCurve[*crypto/internal/fips140/nistec.P521Point]>*atomic.Pointer[internal/sync.node[interface {},interface {}]]>*struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }>*sync.HashTrieMap[go.shape.interface {},go.shape.interface {}]e3{5T@<d-h \'5QTe0.h v|5U`f4.AT5*UX g8.(Y5Ug8.HE5wUh8.@d5NU`i8.YG-p`g̿g/5rVX j<.h >*elliptic.nistCurve[*crypto/internal/fips140/nistec.P224Point]#3P6ࣹcc#f:5F`7Xm.H۷5J T`7n-h X51T`o- *func([]uint8, []uint8) (int, int, int, netip.AddrPort, error)>*func(context.Context, string, string) (net.PacketConn, error)Oge3M @V@V@V |#q23& @V@V@V #s3 @V@V@Vy#@k3,u @V@V@V|#N52vTહr-6q5N@VTs.h 3.5-T@t.h ՃS5&WT@ȿu-h ǽ"5T Xu-3l\TTTT #>*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}]fX5vx.h *5NX`y mH-M@ӿg!-_ 0ӿiM3k|5z.HL75^W@a{.Hi58@U@X|.HZ]5 @V@V}.Hv5b@~<.h j^5T-o}5Tc-]W5U`ʹ.RCq59@X@U@.HQh#55%TV-]|#:5SȾ.He5qf`-h I2?5UT -h cq5$yTο-h 6P5:T`-cD05AyTZ`-5bT< -(O5T`<-t:5. T@-h u |5' T@-h >*struct { F uintptr; X0 net.Conn; X1 net.Conn; X2 chan error }h~5$T@`-h M'¿5WT-h , 5T-h 5RZT-h 0`5yU .H~3 @/@VXa5Om@"<._[57m"`<.5*m  <.h 5mt<.h ~N5( m#<.A 5mE`<.h  y 5j <.h U*5UW0.Nk5<WT0.h >*struct { F uintptr; X0 context.Context; X1 context.canceler }>*struct { F uintptr; X0 context.canceler; X1 context.Context },pi5 (-h 5z`4.h -5Tk -h CGO5 X-h y]5  @V-h g83]@g``p>*struct { key http.connectMethodKey; elem http.wantConnQueue }>*[8]struct { key *http.Request; elem context.CancelCauseFunc }>*struct { F uintptr; X0 *http.http2serverConn; X1 chan error }٤5@.H"+5 T`-h 05;.H)CX5$>@.HTv@-Ryh5U.H <5P H(5B 8#Y~f5``@.H^5M .HB/!5u@V $P5% T-h _<5_U@.H'7b5`=h &5T@-Y35T}-h Ӽ5`¹@.Fp5T}-h N5]T.h B,+5 (T.h `458}@T@0.h *func(*map[string]int, string, string, map[string]int, string)a,5 TU`-[ś5T 0.HO5T -h !k5śT.h Hr55`A  ]5T`-h [p5@ hB4([aF5NbyU 25U༸8.H'5y@` /5%5@V .H>*5@ +@% ] m5TT`0.75u@UT .h 5T@U-h >*struct { key protocol.ConnectionID; elem quic.packetHandler }>*struct { key protocol.ConnectionID; elem *quic.zeroRTTQueue }>*struct { key protocol.ByteCount; elem quic.frameSorterEntry }>*struct { key quic.connRunner; elem quic.connRunnerCallbacks }>*struct { key protocol.StreamID; elem quic.streamFrameGetter }(k3@lX.XQ,5I @@C 6K5 @@`HCC`3 UE@V#F5MI ĸ @CZG5|I u <.Bi!5j3<.85 J 4`-sO5V <. ϋB58J m?<.,J5, m><.R33@lt@u#cP+3a`EuX@lm #Ҁ956 mN<.h '58VV@<.5T@-h 5T@ƿ-h 5V  +D5R@@.|5VT C` -Fm5oT 8.h YQg5T@ -h c5S TT -h iQ5GUR 8.Hoa6c5:UT 8.h B58T@@0.H(05f TT0.h PGAvailableExtensions(json:"pg_available_extensions,omitempty"DatabaseEngineVersion(json:"database_engine_version,omitempty"BGWRITERLRUMultiplier(json:"bgwriter_lru_multiplier,omitempty">*func(context.Context, string) (string, *http.Response, error)>*func(context.Context, string, string) (*http.Response, error)>*func(context.Context, string, *govultr.LoadBalancerReq) errorg5T@-3@6\Tݸ H`޸#[36\Tݸ`H`޸#(36\@Vݸ`I`޸#rn3.\TݸJ`޸#",3\TT` #Y3\TK`޸#g--3A\T```K#sG*3ء\TT`#(C3"5\TT#3+\TT #=G33.\Tݸ`޸#Z53.\Tݸ M`޸#]Zx35\TݸM`޸#u3\TݸH`޸#?3 \TݸH`޸#[i3\Tݸ O`޸#U[H3=\TT`#Gf36\Tݸ`P`޸#h36\Tݸ P`޸#&J37\TݸQ`޸#^3\Tݸ`T`޸#P5T-h 5gT@-~X5\V n.h 3PTTT`#\,5^lTm -h C$5BT-h 4|5&U@U.H:5`o`(z5T -h 5VV5lT`-S5ٌ5}@ǿ.Hpp5 `@VA >*struct { F uintptr; X0 *yaml.decoder; X1 *yaml.Node; X2 int }&5 X.H5X`4.h *Yn5mT | -H(eu$5e `8-h o<5T -h 5cT` -aG`52 p !-h 5T!.h W5T".h .5ͰT`#.h  5@T $.h K53T$.h 7~5n@T%.h >5ѢT`&.h ;?u5aT '.h bI5rT'8.h V5U@T(.h Z5L@V@`).H5wT *-h +5T*-h BW5<T+-h 7V5aT@`,-h ܕ5T --h 5T--h k5`bT.-h ڟ5<Tr`/-h `55T 0-h v{w:5T@0-h  --p hk  DMU5Ni@}10.j5 9 4.X25@U`K@5.h iž5 u@U"6. n^36N@lv@vsst >github.com/apernet/hysteria/core/v2/internal/congestion/brutal>*func(protocol.ByteCount, protocol.Version) protocol.ByteCount)-p5mV7<.M3@`Em@V#5P IT9.h ,5`@V@`:.H`5A T ;-[5V;TA-5@V<.H5HPU`=.h  5T >-c5T|>-h NL5@JT@8.h 5JT@8.h U5*ITA8.h t5|T@B0.h ]}5T n`C->*func(kem.PrivateKey, []uint8, kem.PublicKey) ([]uint8, error)>*func(kem.PublicKey, kem.PrivateKey) ([]uint8, []uint8, error).f 5՜T$`D->*struct { F uintptr; X0 *gob.encOp; X1 int; X2 gob.encHelper }=-G5pX E.Hj5-`oXE.HUռN5 @F.Hot45Ī `m`G-h 5A `o H-h c5y H->*func(protoreflect.FullName) (protoreflect.MessageType, error)4F]5.`J-o5#TJ-q5t* DK.h 6N5R| `L@L-h 65FT@M-h >*[8]struct { key protoreflect.Name; elem *filedesc.EnumValue }>*[8]struct { key protoreflect.Name; elem *filedesc.Extension }aM5l O-h &95* s O.H5r@VP-h d15h@Q-h PA5TR-h O.5R.Hhߴ5 !S-*5T!@T-\E(5p !U.h 5U-h 5V.HBvo5c@W-h 1@\5@nX-h )5X-h F$H5׸`Y-h 7^~U5IR@VZ<z+5``[-h 0n5` }p \.h q/56`\<($l5 i ^0.h >*func(protoreflect.ExtensionTypeDescriptor) protoreflect.Value>*[8]struct { key protowire.Number; elem *impl.coderFieldInfo }>*[8]struct { key protoreflect.Name; elem reflect.StructField }>*struct { F uintptr; X0 func(); X1 *protoreflect.MessageType }H5.z^.Hs-58 {_-h >5D@`.h k3[_@I@}{ # 5X {a.HX65`a.8T35 `b-<;5h @c-h -5 d.h YG5 {d-h 5, He->github.com/apernet/hysteria/core/v2/internal/congestion/common 5sTWj-?*[]struct { key string; elem *trafficlogger.trafficStatsEntry }?*atomic.Pointer[internal/sync.entry[interface {},interface {}]]?*atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }]?*[]struct { key string; elem func(*url.URL) (zap.Sink, error) }?*atomic.Pointer[github.com/apernet/quic-go.pathManagerOutgoing]?*struct { key http.connectMethodKey; elem []*http.persistConn }?*[]struct { key string; elem *certmagic.RingBufferRateLimiter }?*struct { F uintptr; X0 *certmagic.tlsALPNSolver; X1 net.Conn }?*struct { F uintptr; X0 *server.h3sHandler; X1 *utils.QStream }?*[]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }?*func(*abi.SwissMapType, unsafe.Pointer) (unsafe.Pointer, bool)?*func(string, string, []time.Duration, string) *[]time.Duration?*func(netip.AddrPort, func() *udpnat.conn) (*udpnat.conn, bool)Key;protobuf:"bytes,1,opt,name=key,proto3" json:"key,omitempty"?*func(congestion.PacketNumber) *bbr.connectionStateOnSentPacket?*func([]uint8, []uint8, protocol.PacketNumber, []uint8) []uint8?*struct { F uintptr; X0 *quic.packetHandlerMap; X1 *quic.Conn }?*func(context.Context, string, *govultr.FirewallGroupReq) error?*func(context.Context, string, *govultr.ClusterReqUpdate) error?*func(context.Context, string, *govultr.StartupScriptReq) error?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point]?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point]?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point]?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point]?*func(protoreflect.EnumNumber) protoreflect.EnumValueDescriptor?*[]struct { key protowire.Number; elem protoreflect.RawFields }?*func(wire.transportParameterID, wire.transportParameterID) int?*struct { key filedesc.Edition; elem filedesc.EditionFeatures }?*func(protoreflect.ExtensionTypeDescriptor, protoreflect.Value)?*struct { F uintptr; X0 *error; X1 *socket.Option; X2 []uint8 }InitConnectionReceiveWindow$mapstructure:"initConnReceiveWindow"@*[8]struct { key string; elem *trafficlogger.trafficStatsEntry }@*[]atomic.Pointer[internal/sync.node[interface {},interface {}]]@*struct { f func(); once sync.Once; valid bool; p interface {} }@*[8]struct { key string; elem func(*url.URL) (zap.Sink, error) }@*map[string]func(zapcore.EncoderConfig) (zapcore.Encoder, error)ErrorOutputPaths/json:"errorOutputPaths" yaml:"errorOutputPaths"@*struct { F uintptr; X0 *redirect.TCPRedirect; X1 *net.TCPConn }@*quic.outgoingStreamsMap[*github.com/apernet/quic-go.SendStream]@*func(*quic.pathManagerOutgoing, *quic.pathManagerOutgoing) bool@*map[protocol.StreamID]quic.incomingStreamEntry[go.shape.*uint8]ConsoleSeparator/json:"consoleSeparator" yaml:"consoleSeparator"@*[]struct { key http.connectMethodKey; elem http.wantConnQueue }@*func(context.Context, certmagic.CertificateResource, int) error@*[8]struct { key string; elem *certmagic.RingBufferRateLimiter }@*struct { F uintptr; X0 *certmagic.ACMEIssuer; X1 http.Handler }@*struct { ID string "json:\"id\""; Name string "json:\"name\"" }ExternalAccountRequired(json:"externalAccountRequired,omitempty"@*func(io.Reader, []uint8, crypto.DecrypterOpts) ([]uint8, error)@*[0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }@*struct { F uintptr; X0 func() go.shape.*uint8; X1 *[3]uintptr }@*struct { F uintptr; X0 func() go.shape.*uint8; X1 *[4]uintptr }@*func(*[]time.Duration, string, string, []time.Duration, string)@*[]struct { key protocol.ConnectionID; elem quic.packetHandler }@*[]struct { key protocol.ConnectionID; elem *quic.zeroRTTQueue }@*[]struct { key protocol.ByteCount; elem quic.frameSorterEntry }@*func(protocol.ConnectionID, protocol.StatelessResetToken) error@*[]struct { key quic.connRunner; elem quic.connRunnerCallbacks }@*[]struct { key protocol.StreamID; elem quic.streamFrameGetter }@*struct { F uintptr; X0 *quic.baseServer; X1 *quic.wrappedConn }@*func(context.Context) (*govultr.Account, *http.Response, error)PGStateStatementsTrack)json:"pg_stat_statements.track,omitempty"@*func(context.Context, string) ([]string, *http.Response, error)@*func(context.Context, string, *govultr.ClusterUpgradeReq) error@*func(protoreflect.FullName) (protoreflect.ExtensionType, error)@*func(protoreflect.OneofDescriptor) protoreflect.FieldDescriptor@*[8]struct { key protowire.Number; elem protoreflect.RawFields }@*func(*big.Int, *big.Int, []uint8, []uint8) (*big.Int, *big.Int)A*struct { Code int "json:\"code\""; Type string "json:\"type\"" }A*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }A*[]atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }]A*func([]uint8, []uint8, *syscall.SockaddrInet4) (int, int, error)A*func([]uint8, []uint8, *syscall.SockaddrInet6) (int, int, error)A*[]*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}]A*sync.indirect[go.shape.*internal/abi.Type,go.shape.interface {}]A*ringbuffer.RingBuffer[github.com/apernet/quic-go.receivedPacket]A*func(zapcore.Entry, *zapcore.CheckedEntry) *zapcore.CheckedEntryA*[]struct { key http.connectMethodKey; elem []*http.persistConn }A*[8]struct { key http.connectMethodKey; elem http.wantConnQueue }A*struct { F uintptr; X0 func(reflect.Value, reflect.Value) bool }A*func(*abi.SwissMapType, *maps.Map, uintptr, unsafe.Pointer) boolA*func(string, string, map[string]int64, string) *map[string]int64A*func(network.PacketConn) (context.Context, network.PacketWriter)A*func(context.Context, *quic.ClientInfo) (context.Context, error)A*[8]struct { key protocol.ConnectionID; elem quic.packetHandler }A*[8]struct { key protocol.ConnectionID; elem *quic.zeroRTTQueue }A*[8]struct { key protocol.ByteCount; elem quic.frameSorterEntry }A*[8]struct { key quic.connRunner; elem quic.connRunnerCallbacks }A*[8]struct { key protocol.StreamID; elem quic.streamFrameGetter }A*func(context.Context, string, *govultr.BlockStorageAttach) errorA*func(context.Context, string, *govultr.BlockStorageDetach) errorA*func(context.Context, string, *govultr.BlockStorageUpdate) errorMySQLRequirePrimaryKey*json:"mysql_require_primary_key,omitempty"AutovacuumFreezeMaxAge*json:"autovacuum_freeze_max_age,omitempty"MaxLocksPerTransaction*json:"max_locks_per_transaction,omitempty"MaxStandbyArchiveDelay*json:"max_standby_archive_delay,omitempty"TrackActivityQuerySize*json:"track_activity_query_size,omitempty"A*func(context.Context) (*govultr.Versions, *http.Response, error)A*func(context.Context, string, string, []uint8) (net.Conn, error)A*struct { F uintptr; X0 *int; X1 protoreflect.Message; X2 *bool }A*func(sign.PublicKey, []uint8, []uint8, *sign.SignatureOpts) boolA*func() (go.shape.map[string]int32, go.shape.map[string][2]int32)A*struct { key protowire.Number; elem protoreflect.ExtensionType }A*map.group[protoreflect.FullName]protoregistry.extensionsByNumberA*struct { key protoreflect.EnumNumber; elem *filedesc.EnumValue }A*[]struct { key filedesc.Edition; elem filedesc.EditionFeatures }A*struct { key reflect.Type; elem protoreflect.MessageDescriptor }V4A 6|-SEPPP밎 6|- F  Zҭ 6|-@0@d3d3xW 6|- 0@4b34b3y 6|-"22d 6|->`8G-8G-sbm 6|-Mu0@a3a3q$ 6|-yuu@ --kY5 6|-/J0@b3b3w 6|-W` P 3P 3H5 6|- w"@hf3hf3bwLE 6|-`w"@}.}.gF 6|-Mw"@T'.T'.ޭ 6|-M --$ 6|-aw"@lc3lc38EGc 6|-(@Zw"@T[+T[+: 6|-uZw"@<\+<\+dK 6|-L Zw"@dX+dX+p 6|-Z0@4V+4V+펁 6|-gu Zw"@Y+Y+xe 6|-Zw"@W+W+DV 6|- Zw"@\+\+ 6|- ZBcH+H+( 6|-w"@X X 3 6|-L3w"@  U 6|-(S HHSõ 6|-2dM $f'$f'BC 0 6|-א@ gi hT'hT'5` 6|-!w"@~%~%H+ 6|-E0@X>'X>' "@E T0@X>'Y%I 6|-@0@A'A'1D 6|-x0@d-| 6|-d9 6|- x *34 6|-bw"@, 6|-K <w"@ȫ!ȫ! 6|-K<w"@p!p!AN 6|-bew"@WW}KM 6|-%J$` 6|-j@$ԧԧ(7, 6|-6!M @@(}J 6|-e`!gi L(L(aS 6|-" [mLH5. 6|-<[mL%`C2_ 6|-#@mL5; 6|-#mL= |-#`mLWĩE 6|-mL0@T T (Zi 6|-RmLnry 6|-^mL&0 6|-W|mLYQ`߳0! 6|-8`OmLYQ` 6|-pmmL7s. 6|-Q{ mL [M 6|-Ҧ$mLYQg( 6|- mLw"@b 6|-mLo` fUh 6|-ԓPmLw!00 6|-\:RD o¾ 6|-s Rmuz^ 6|-@nRWjjwi 6|-=n(R!i@ hchc! 6|-ZX(R!i@ bb  6|-@e(R!i@ aa} 6|-(R!i@ D`D`:O 6|-R(R!i@ `` 6|-gi(R8`,o,o 6|-O@Ow"@?] 6|-@pOw"@ 2 27 6|-O0@ttEF 6|-9O0@F 6|-C|jHw"@99W^ 6|-9Hp7@P:P:x 6|-uhw"@YY6 6|-9`:hw"@\ Y\ Yr 6|-ۮhw"@YYm 6|- 1[[ C 6|-'@&C( <[<[L 6|-;`X83[[ 9 2;X #83[$Z/: 6|-; Y83[[ ^;X V83[xZ 6|-2 Y83[[ C뇥2 Y U83[Zd 6|-@ Z83[[ I4@ @Z U83[@Zj/ 6|-N `[83[[ (SN [ V83[Z[C 6|- \83[[ CC[ V83[Zq 6|-\83[[  \ c83[Zr& 6|-]83[[ <@] T83[xZ\ 6|- `^83[[ -p ^ @T83[Zbrm 6|- _83[[ A^ T83[DZL 6|-_83[[ fL_ @U83[Z;B 6|-`83,[,[ }t@` U83,[Z/ 6|-4`a83D[D[ u4a @V83D[hZI] 6|-; b83\[\[ 2;a W83\[Z!f 6|-;b83l[l[ h);b W83l[(Z.X 6|-ric83|[|[  lri@c 83|[Zqtti 6|-I`d83[[  jId W83[Z 6|- e83[[  8d @W83[,Z[ 6|-e83[[ jaIe X83[Z#4 6|- }w"@h[h[ < 6|-Qg83[[ aDQf 83[[z^ 6|-Z@ w"@7p7pB 6|-z:` (xxڕj 6|-l w"@fyfy~r3 6|-@ w"@gygy 6|-2jR 9{<xjoxjo* 6|-( 9  @no@no5 6|-; w"@<<I 6|-t<3UFlZlZB@ 6|-V`o3\= hZhZhE 6|-n@;3;y 6|-Q(3C(0Z0Z 6|-;384 eYeYYp 6|-<384 8|Y8|Y8[ 6|-x@<384 YYs 6|-~<384 YY. 6|-`m383ZZ yשm #383ZY3` 6|-o=w"@x;x;D-J 6|-Fz p=w"@c;c;~` 6|-[=w"@c;c; 6|-s=w"@::`x 6|-cz =w"@:: :T=$=lH<` 6|-(=;Y 6|-G;=w"@==< 6|-9R@<=;J #f 6|-<=; 6|-(==;Q- 6|-(`==;D 6|- ==;{\j 6|-9=;2 6|- >ErW# 0wN0wNa8 6|-/ Er9YNYN#B 6|-/Er0@MNMN爐 6|-.@ErONNNNj9Ɯ 6|-Ery 6|-qEr0@UNUNot 6|-5Er0@TbNTbN?3 6|-Er0@x^Nx^N=( 6|-w@`vEr( 0|N0|N 3!M<w@v TEr( 0|NKWؓ 6|-YEr( tKtK> 6|-RmtEr( KKs 6|-*Er( }N}N: 6|-@`*Er( ~N~N[ 6|-J>Er $N$NB 6|-Erw"@pOLpOL{ 6|->ErW# (N(NA+ 6|-nuEr HLHLH 6|-@?Er NNPj 6|->?Er NN 6|-`Er$N$N7 6|-`uErhKhK{ 6|-\*ErNN3 6|- Erw"@NNm 6|-SErw"@-J-J,^ 6|-(Er0@-N-N 6|-\@Erw"@HNHNt6X 6|-` Erw"@`N`N 6|-x]ErTETEs~G 6|-T OErXEXENd 6|-Er HH&V E 6|-\ErW# EE]+ 6|- Er\E\EV 6|-՗Er` LNLN#:8 6|-Erw"@NNT 6|-lErw"@܍N܍NEp 6|-*]+Erw"@0N0N2D 6|-xErW# FF 6|-U@ErNNf 6|-F]`@ErW# NN 6|-@ErW# NNN 6|-G Erw"@NN 6|-?@Erw"@NN;i 6|-Erw"@̎N̎NS 6|-b]@ErW# `N`N^?w 6|-~] AErw"@NNCB 6|-+AErD @N@NĤ 6|-Er0@ԗIԗI 6|-U} yEr|LLU|z 6|-lVw"@((J( 6|-Vw"@L(L( 6|-A QaggP 6|-?@z zvvn 6|-5@z u@TT 6|-u u@$q$q$~ 6|- { 6|-f|2U_n 6|-@0w"@e 6|-@ =~83UU >ۢ8@ ;=~83U@K[e 6|-SV=~@ ] LL* 6|-C =~@ ] ||? 6|-Vg0@ . 6|-Vg}\ 6|-ogu- 6|-_ i| ""ȜJ 6|-Z~i| ** 6|-w~i| H-H-6 6|-4 0@k 6|-|@B4 w"@ 6|-B4 w"@= 6|-C4 w"@ $ 6|-3A 4 w"@K 6|-h@/4 w"@л[ 6|-A4 9E  6|-W lw"@x[x[1I 6|-`Clw"@ [ [G 6|-Clw"@[[;< 6|-' Dlw"@[[y 6|-l@"L_پ 6|-lhh # 6|-Rpur 6|-I/ Rp" x,x, &?I/ TRp" x,OXQ 6|-&  2 6|-D 1 S1 6|-L^g&`ghI 6|-w"@((sqL 6|-߱DE`HH"9 6|-@w"@6(6([h 6|-%w"@!!óc 6|-`%6E`x 6|-/%6E`Q 6|-(w"@e+e+XJ 6|-@W# pHpHڰ 6|-BsvAA`Q 6|-$@EFw"@44Sb 6|-_Fw"@(_(_J 6|-iEFw"@Ϛ 6|-F@v0@ood 6|-h0@2 2 Z ?h0@2  IQ^ 6|-ihH'1 1  6|-VK0@7X 6|-Q`VKT((汝7 6|-FVK0@~4 6|-`VKT$$Ds 6|-1VK?^0 6|-XVK`ڬ 6|-2Y@VKw"@LLTO 6|-Tw"@ ">v 6|-m`H4w"@0 "0 "`> 6|-0@Kb 6|- ?x<_o 6|-Zw"@ 6|-fO#3 6|-ow"@kk ŖP TX0@j6H4 4TX0@i6X4C 6|-`XY3447$ 6|-hD0@W3  ``#nl3C 6|-Ow"@, O, Ok 6|-4C@w"@^. 6|-z!i@ ??Y 6|-Hz!i@ ?? 6|-I4 z!i@ ? ?% 6|-%z!i@ 4?4?/ 6|-[ &z!i@ ??>h 6|-tz!i@ ?? 6|-\`uz!i@ t?t?# 6|-Xuz!i@ ?? 6|-j@z!i@ ?? 6|-&z!i@ ??ƹi 6|-@z!i@ ??TN" 6|-P\vz!i@ 0?0?6%| 6|-]4 (z!i@ ??bA; 6|-q4(z!i@ ??O 6|-z!i@ ??; 6|- wz!i@ ??5 6|-xz!i@ t?t?ٻJ 6|-#Yz2`@@g?y 6|-`z!i@ ??' 6|-#z8`@@pϷ 6|-b *M rqrq{? 6|-#M lqlqQ_o 6|-M xqxqdS 6|-9 M qq 6|-݁@ Ew Ew 6|- :w:wV 6|- w"@``; 6|-L 0@sC 6|- (`[9 6|-u5 (` O 6|- (`dd"# 6|-v@ (`wە 6|-L 0@9D 6|- w"@ֆֆH 6|-2 `/3 6|-P2 `>  6|-Z 0i 0i_* 6|-`Z hh 6|- \Z2x 6|-`?mmxq 6|-j`6 @`No`No` 6|- 5!@Hr 6|-k`Fz BBBB3 6|-`zAAd d 6|- zAAu 6|-ޟz  B B 6|-FzW# LDBLDB ^= 6|-S&@Ow"@xrAxrA?p 6|-Ow"@4bA4bA./ 6|-@O PA PAW 6|-  Gww"@DD&=A 6|-m&ww"@@ D@ D<\ 6|-b?Q( DDp0e 6|-eGQ( (D(DP 6|-9Q( ԏDԏDe 6|- Q( DD8 6|-e QaD 6|-\ n!`HV 6|-R&w"@߱ 6|-bG&w"@ώ 6|-@&0@PPL 6|-b{& "X 6|-!ӎ0@((4 6|-^ ӎ0@ 6|-k@kӎX BB 6|-ӎw"@Ԡ5 6|-@ lӎ~g* 6|-!`'~`( miY 6|-| 'K-tto 6|-hD(_ 6|-@Edw"@LL>f1 6|- (Ed$ P P 85`f 6|- SEd$ } 6|-X ,ݖ,ݖ] 6|- F Z ޖޖUC 6|-DF@ rr 6|-Ig TT|E 6|-y`vh 6|-Mu@0@NNy 6|- 0@OOf" 6|-yuru@  6|-~))ܿ 6|-/J0@(P(P%{ 6|-"a 6|-~ϤZ\R\RoF 6|-a ZPP܌2 6|- $`֙ 6|- h`5 #ff ^ 6|-j`7 ` -6{j T7 `GSZ 6|-i 7 ` >4Di 7 ` 6|-7"ooG3 6|-T`75}DqDq} 6|-@?0E!!3] 6|-?0E$S$S@ 6|-B?0Eۭۭk 6|-bB$(?`` 6|-pˉ`XXW 6|-q> w"@//q_ 6|-bj"^^\v 6|-HZ^77M 6|-ܭZ7_d7d7 6|-j@Z0@77jl 6|-T0@? 6|-nK@Hw"@QQ 6|-Hw"@|Q|Q 6|-IPRصQصQ4 6|-0PR@3Q@3Q/ 6|-YPR5Q5Q( 6|-0@p 6|-Hw"@HXHX+ 6|- @H0@wXwX/w 6|-KH0@l› 6|- H0@T3L4H `7@V#W 6|-h?0@ԭsԭs6 6|-@@?0@DuDuD- 6|-Ar?0@8r8rwl% 6|-j?0@D)uD)u{j 6|-?@ r r~ 6|- ?0@L+uL+u1w 6|-\?0@<,u<,u/ 6|-s@89 0@\\] 6|-!m89 cr` ("\("\ 6|-89 0@|\|\| 6|-!C89  s\\ M= 6|-t,^,^" 6|-w ԯ 6|-C e zN 6|-{ 0@@a@aZ֞ 6|-p N u@ ccҗ2 6|-N 0@cc޳c 6|-@N C/`PcPc<޷ 6|-@N Dbb/[ 6|-{0@s`s`ؖ 6|-J:@Z`Z`? 6|- [ ;@`u= 6|-;@8 6|-D;@ 6|- @K;@7ib_ 6|-v ;@e 6|-0;@+Q 6|-rT 6|-A 6|-|0@1l1lc 6|-;@xlxla& 6|-@;@QlQl# 6|-;@p\lp\l!8 6|-eE;@ Tl Tl: 6|-;@{l{l=챻 6|-;@DvlDvl 6|-.o`;@}l}l[N 6|-Co`;@_l_l < 6|-yE;@llEQ 6|-K;@ 6|-11w"@llT˵ 6|-E1|XlXlY 6|-  (A(ASm5 6|-`2'ZBZB# 6|-22w"@BBt4 6|-2w"@BBp3: 6|--2 6|-3MCMC@R 6|--P:w"@x#x#S 6|-fQ0@: 6|-[fQw"@4f=4f=l 6|-rfQ0@te>te>Www 6|-P@fQ0@ 6|-ԩw"@<ҕ<ҕi 6|-O2@|ԩ9 ̱̱,? 6|-o`ԩH@DDl 6|- ԩXz͠ 6|-mw"@``wT 6|-1 i@֚֚I 6|- 2 <-b<-bM 6|-"@ w"@̗O̗OD) 6|- w"@RR(% 6|-@0@SSօO 6|-pT)䊓 6|-|H) 0@DGSDGS6 6|-]@d.p7@\?q\?qv5 6|-0U^#` 6|-Q`w"@TuyTuy> 6|-GP MlylyD-? 6|-`: }}6p> 6|-! ; X DD ߊ! @U; X D  6|-/¿M&&EQ 6|- HM9.  XX 6|- "ln 6|-^ÿ0@dada(#8 6|-/@ÿE 3i 6|-/ / >P 6|-/@*: ? ? 6|-3`Np K``̄ 6|-@:_0@eq 6|-g_  2 6|-H 5 ,H@  5cS|S 6|-EPzfq 6|-`0@99Me 6|-`F9 J0' 6|-`I9 JEEk 6|-n Mx0"@hn!hn!B*func(*tls.ClientHelloInfo) ([]tls.EncryptedClientHelloKey, error)B*func(*big.Int, *big.Int, *big.Int, *big.Int) (*big.Int, *big.Int)B*atomic.Pointer[internal/sync.indirect[interface {},interface {}]]B*[16]atomic.Pointer[internal/sync.node[interface {},interface {}]] 0 6|-"`Dm3Dm33 @V@V@V@V$#N 23X @VR@V@V@V#e3 @V S@V@V@V#B*[0]*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}]U 6|-š"`o!o!B*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *poll.FD }B*struct { F uintptr; X0 *net.TCPConn; X1 net.Conn; X2 chan error }B*struct { F uintptr; X0 net.Conn; X1 *net.TCPConn; X2 chan error }B*tree.Node[github.com/apernet/quic-go/internal/utils.ByteInterval]B*func(zapcore.Entry, zapcore.CheckWriteHook) *zapcore.CheckedEntryB*func(http.http2FrameType, http.http2Flags, uint32, []uint8) errorB*[8]struct { key http.connectMethodKey; elem []*http.persistConn }B*go.shape.struct { net/http.key string; net/http.values []string } 6|->@@ (_ ƜƜI 6|- 6H K`)44}> 6|-)R& ( ŜŜx 6|-0,`"`,((j 6|-"-L2L2B*func(*map[string]int64, string, string, map[string]int64, string)Code=protobuf:"bytes,4,opt,name=code,proto3" json:"code,omitempty"Cidr=protobuf:"bytes,2,rep,name=cidr,proto3" json:"cidr,omitempty"Code=protobuf:"bytes,5,opt,name=code,proto3" json:"code,omitempty"+" 3f.1u@lm.1uB*struct { key protocol.StreamID; elem *http3.stateTrackingStream }VerificationURIComplete*json:"verification_uri_complete,omitempty"DefaultToastCompression*json:"default_toast_compression,omitempty"MaxPreparedTransactions*json:"max_prepared_transactions,omitempty"B*func(context.Context, string, *govultr.VPC2AttachDetachReq) errorB*struct { F uintptr; X0 chan exec.goroutineStatus; X1 chan error }B*func(*nistec.P256Point, *nistec.P256Point, int) *nistec.P256PointB*func(*nistec.P521Point, *nistec.P521Point, int) *nistec.P521PointB*func(*nistec.P224Point, *nistec.P224Point, int) *nistec.P224PointB*func(*nistec.P384Point, *nistec.P384Point, int) *nistec.P384Pointoks3@VB*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }B*func(func(protoreflect.FieldDescriptor, protoreflect.Value) bool)g3MsXtww@lvvB*func(protocol.StreamType, protocol.Perspective) protocol.StreamIDB*iter.Seq[github.com/apernet/quic-go/internal/ackhandler.interval]c;3k>@lt#B*func(*fiat.P224Element, *fiat.P224Element, int) *fiat.P224ElementB*func(*fiat.P256Element, *fiat.P256Element, int) *fiat.P256ElementB*func(*fiat.P384Element, *fiat.P384Element, int) *fiat.P384ElementB*func(*fiat.P521Element, *fiat.P521Element, int) *fiat.P521ElementB*[8]struct { key filedesc.Edition; elem filedesc.EditionFeatures }B*func(impl.pointer, *impl.coderFieldInfo, impl.marshalOptions) int3@} #C*struct { F uintptr; X0 *masq.MasqTCPServer; X1 string; X2 string }C*[16]atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }]C*struct { F uintptr; X0 func(dnsmessage.Type); X1 dnsmessage.Type }DisableStacktrace1json:"disableStacktrace" yaml:"disableStacktrace"C*func(context.Context, network.PacketConn, metadata.Metadata) errorC*func(func(int), *list.Element[func(int)]) *list.Element[func(int)]C*quic.incomingStreamsMap[*github.com/apernet/quic-go.ReceiveStream]C*tree.Btree[github.com/apernet/quic-go/internal/utils.ByteInterval]C*func(string, string, map[string]string, string) *map[string]stringC*func(protocol.EncryptionLevel, monotime.Time, bool) *wire.AckFrameLogMinDurationStatement+json:"log_min_duration_statement,omitempty"C*struct { F uintptr; X0 *gob.encOp; X1 *gob.encOp; X2 int; X3 int }C*func(protoreflect.FullName, func(protoreflect.ExtensionType) bool)C*[]struct { key protowire.Number; elem protoreflect.ExtensionType }C*[]struct { key protoreflect.EnumNumber; elem *filedesc.EnumValue }C*struct { key protowire.Number; elem protoreflect.FieldDescriptor }C*[]struct { key reflect.Type; elem protoreflect.MessageDescriptor }D*atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]]D*[]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }D*sync.HashTrieMap[go.shape.*internal/abi.Type,go.shape.interface {}]D*struct { F uintptr; X0 *forwarding.UDPTunnel; X1 <-chan struct {} }D*quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream]D*func(zapcore.Entry, zapcore.CheckWriteAction) *zapcore.CheckedEntryD*func(*http.Request, http.http2RoundTripOpt) (*http.Response, error)D*struct { key http.http2FrameType; elem map[http.http2Flags]string }D*struct { F uintptr; X0 *http.http2clientStream; X1 chan struct {} }D*func(context.Context, acme.Account, acme.Order) (acme.Order, error)D*func(*map[string]string, string, string, map[string]string, string)D*func(context.Context, bool, protocol.ConnectionID) qlogwriter.TraceD*func([]uint8, net.Addr, []uint8, uint16, protocol.ECN) (int, error)D*[]struct { key protocol.StreamID; elem *http3.stateTrackingStream }D*func(context.Context, string) (*govultr.Soa, *http.Response, error)D*func(context.Context, string) (*govultr.Iso, *http.Response, error)D*func(context.Context, string) (*govultr.ISO, *http.Response, error)D*func(context.Context, string) (*govultr.VPC, *http.Response, error)D*func([]ackhandler.packetWithPacketNumber, int64, int64, int64) boolD*iter.Seq[github.com/apernet/quic-go/internal/protocol.PacketNumber]D*func(protocol.PacketNumber, protocol.ByteCount, protocol.ByteCount)D*func(protoreflect.FullName, func(protoreflect.FileDescriptor) bool)D*[8]struct { key protowire.Number; elem protoreflect.ExtensionType }D*[8]struct { key protoreflect.EnumNumber; elem *filedesc.EnumValue }D*struct { key protoreflect.Name; elem protoreflect.FieldDescriptor }D*[8]struct { key reflect.Type; elem protoreflect.MessageDescriptor }E*utils.Atomic[github.com/apernet/hysteria/core/v2/server.StreamState]E*func([]uint8, []uint8, int) (int, int, int, syscall.Sockaddr, error)E*atomic.Pointer[internal/sync.entry[*internal/abi.Type,interface {}]]E*[0]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }E*func(reflect.Kind, reflect.Kind, interface {}) (interface {}, error)E*func(reflect.Type, reflect.Type, interface {}) (interface {}, error)E*struct { F uintptr; X0 *udphop.udpHopPacketConn; X1 net.PacketConn }E*func(context.Context, string, string, *tls.Config) (net.Conn, error)E*func(context.Context, *url.URL, *http.Request, *http.Response) errorE*fips140cache.Cache[uint8,crypto/internal/fips140/ed25519.PrivateKey]E*go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer }E*func(string, reflect.Value, ...reflect.Value) (reflect.Value, error)Value?protobuf:"bytes,2,opt,name=value,proto3" json:"value,omitempty"Entry?protobuf:"bytes,1,rep,name=entry,proto3" json:"entry,omitempty"E*func(congestion.PacketNumber, *bbr.connectionStateOnSentPacket) boolE*struct { key protocol.StatelessResetToken; elem quic.packetHandler }E*func(protocol.ByteCount, protocol.Version) (*wire.StreamFrame, bool)E*struct { key protocol.StreamID; elem quic.streamControlFrameGetter }E*[8]struct { key protocol.StreamID; elem *http3.stateTrackingStream }E*struct { F uintptr; X0 *http3.stateTrackingStream; X1 *quic.Stream }LogAutovacuumMinDuration,json:"log_autovacuum_min_duration,omitempty"MaxStandbyStreamingDelay,json:"max_standby_streaming_delay,omitempty"E*func(context.Context, string) (*govultr.User, *http.Response, error)E*func(context.Context, string) (*govultr.VPC2, *http.Response, error)E*struct { value []uint8; length int; style yaml.yaml_scalar_style_t }E*struct { F uintptr; X0 proto.mergeOptions; X1 protoreflect.Message }E*func(protoreflect.FullName, protoreflect.Name) protoreflect.FullNameE*func(protocol.ByteCount, protocol.Version) (*wire.CryptoFrame, bool)E*func([]uint8, protocol.EncryptionLevel) (wire.FrameType, int, error)E*func(protocol.PacketNumber, protocol.ECN, monotime.Time, bool) errorE*[]struct { key protowire.Number; elem protoreflect.FieldDescriptor }E*struct { F uintptr; X0 *int; X1 *error; X2 *socket.Message; X3 int }&I-K-W# 3`.$T@V`-6Zܴ Z" 3,1-c 9 `39]-`9@!i@{-t9! 93u-49"0@=:R{-=" <`"` ?-d=" qa- > #L1.-Y`?#L5-5?#w"@yA3ҦO mLVYQY-3`QmL$mL0@B-T(R%(R!i@ [$Y-9Z(R`%(R Mm-`\hѶ%h R@g- ] &C( A 3'W GC( Hh[Hh[ #-(Qa 9& 9  Hq-+e3@'31s-e e3'383-Ld3(3UFx.-H`f3`(3C(7Y3Q k 3C(|kZ|kZ>-<f3 )3: B-ƪg3)3S3(ѧ-[ h3)3z H/-Q`h3@*3;@-~iQ*QDIao- jQ+Q0@5@-%`j=`+=--j=+=9 DZ-Rkk= ,=9-U->nEr,Er-BmrEr,Er( q i-]* tEr@-Er jDp-JuEr-Er`tF-|vEr.Er` ]Jό-HBwEr`.Er[)`2\D-rnwEr.Er(< fC-V xEr /ErҶy-U`xEr/Er n-nxEr/Er A #MT-xEr@0Er`M- yEr0ErHg-`yEr1Er/-gyEr`1Er(A-| zEr1Er/K-zEr 2Er` -zEr2Erp0`&AY3--U{Er2Er`!Q_l-!| @3 Qa6m-),} 3 aY % - ~ 4 Y 5-` `4 3u`[  b-- 4 H=[ TW-g 5g| iE'-!/ >5>uǵm-5W# %-@6 -p`6gi [-7D y7-`7M }`g- 7^#-` 84N -^-p8n-p 8f`$$%-p`@9h` -2q E9E`7-/ E:Epa-/`E`:Ep-ɞE:EP>p)-ڞE ;EX>@` Y3$#P3$ #{7-aO@<O;` uaL-tO<O: >A-buz=z!i@ E-i`=i 6U-OC`i=i] it- > (`vV-0 2>2 `{-Z>Z¥{ $1- Z@?Zw` έD-k`Z?Z`~ C-Z@ZN ⬧- Z`@Z~ +M-@c8-(F1| A1|3K-V 1|A1|r u-`1|A1|g? \-CF1|@B1|84 --9`QBQ( -PC @-" ӎ`Cӎ~[A-`EdCEd~ VP-ZdEd DEd$ >-PDX }-τ`DZ V-@E@ G߿- =Eg [-ʤ&7F7 `L- `'$`F$(?4>-h(F'T`sb-b ) GW# ?-`-GPRT-2`0HGH9Qi- 0H@HHr~" -`1HHHk=x-K1HIHk=G'9-aL8lü`Ilp0{$r-( 9lüIlp0-j`9lü Jlp7^ -@`;?J?@%-=J@+G?-2 >(c@K(c0@q-n AIKI B ja-dIxLx KDB=- [|`L|ӄw-[[|L|"`w]x -`^2 M2r'h-) _2M2# +-҇ bzMzh- -`bz@Nz9s)x-0bZۺNZ:,e3~P`cZ$\#X#._3cZ$@VB3kcZ$#@V#W-2 eZۺ PZ` mj_-  fP{o-`fP.\3d-`nd.@Qd.! P-nd.Qd.,$;-pR}X@f-YGrNλ`RN#@oX-mG sNλRN#e_-/| Swaӯ-|SL-%I }S9.K-`}@T J-h}TPO-y}U@@K+- p`Up Kbh-Z`U]@  8=VTT epVT TgawVV"һ bx,*0 0W$@V6T W@: X`sWV"@ջ m. PX< hhCa XV"ջ  YT  hh-#B pYV"ջ ,ΑlYT `sE 0ZV"ֻ 0ZT hhÇZV"@ֻlh;B P[T hd>U[V"ֻ i +\T Wh`jZ_p\V"ֻ '_\T @Vh`厇n0]V"׻ /X]T h`Mx t]V"@׻OP^ V9ɵ;+ ^ V@ 3=_T `¹#*fUp_V"ܻuF/ W_ V?s 0` VO ` V@X` V Y!W,4+ Pa V0 a V@Dq, b Vϖ pb V@L< b V@$! 0c VA 8c Vm uc8c V w3Pd VT H(= dT @<hhz4eV"߻ ?Gpe ThdPBĭueV" (u 0f t&6fV"`px fU X("@PgV"1. gU HHgEЭhV" kT84NphU  nUhV" at40iU aiV"` kD iV XhPjV"rd00j V,k V@5Z pk V<k V*@ 0l V` 1l V ; l V>\Pm V@^  m`7 XHDr@KTOnV"` p HF pnT `7hhBMnnV" k 0oT oV"  ^`a oT  FV:PpV"` )HKm pT Xh`6qV"TuVpq7@ t,tZܴq{` ,Se0r V? Y, rT હr rV"` ?zPs@V ThdĭsV" U > t ThdZ tĭptV"  XK tT @ȿhhF0uV"`e4uT  X20uV"c\XPv V [Pp v V@tzR Nw V`h pw V (sw VF*[]atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]] lz6.- px hhJ/ xV" : 0yX  ԭ`yV" 7-gzgw"@ FDĭPz V@V = z HH˱  {V"C p{@a HH=Э{V" 7- mL0|@VD 8' |@U @XHH. Э|V" V!P}@V @VH$}V" Zc/ ~b hd 'Lp~V" +-~T :P0V"`bȬ  T c]qXV"$Z=PU `ʹ ԭ@V"d@X @UHD3\T khh BӯPV"L xFG| Xhdi0)ĭV"@L Qp @Vhd@ĭzСV"L #~d=05@V5s\  V@< W80 V $JP V`= .+A  V..PJ V# p V<?x5Ф V=E|J0 V= X1  V`F*struct { key string; elem func(string, *tls.Conn) http.RoundTripper }F*[]struct { key http.http2FrameType; elem map[http.http2Flags]string }Uv p@ HD:^-TMЦV"@RF<-0e # )o lqT `hh[nj V"@THz$B P; HD.MTV"UyDM HDgT pV"@Uč ЩU @HHNߞЭ0V"U ) T hhV"VEO Pu @ T'l V"Wg,MT v΃rȶnpV"WNgS ЬU HH.gЭ 0V"X( *<4  H@!q4 V"@X804İ@ P g V"XYZ ` `HH-h MpV"X v Я  HHi  0V"Y +#  @V`J.V"@Y D&J PT hh%]v V"YR U HHuЭ pV"Z j8B в` hh/0V"@Z HҎw T @(34V"Z AE81& PT }hh>9$EV"Z  `¹HK_pV"[ ́L еT }hh0V"@[ p  Thd˻ĭV"\ y[ P( ThdyĭV"\ m1 @ Thdߘ6ĭpV"]3c и HHs+Эl1 0V"@]Л@  X(3V"] ]H P Thd'RĭV"] " T f?pV"^ Ӹ лT @ƶ40V"@^*j T -́pPbV"^ 8P V@,zY  V-lЩ  V`p Vpо VWl0 V@WE\ V _H Vc nw P V@ӏj  Vf2   Vk0 p V@IgKa  VLN0 V@XxN V`}G*  VSP V `N VFN V@֚Q p VRWf  V 0 V@  V`׍tD V`¹뛝LTP V  S8v V# i8r V@2d3 p V}JP  V F*func(context.Context, *tls.ClientHelloInfo) (*tls.Certificate, error)tpvjtW pT %TV"b Ri 0T  YhhRnѥV"b   T hh WW PV"b  T hh 8aV"c 1Ԍ5W pT  hhzV"@c c5@2 0T  0 V"c 娊 T hh=\]PV"cTTl7  T @RY#mԼVV"d0$Mi pT _|LV"@dĔX) 0T }÷PV"dj^4 T {?'PV"d26T `?BжPV"e_p p V Da VyfP V r@ , XHDJTV" {-D p, @VHDTTV"`{&Y0 X!8'pV"{3 Q2 @X @XHH -PV"{\cڨ VǟW VJf E p V,IZ q V༹z.0 V`#I V`+  V`7wvP V¹[(a  VK| 3  V x! pT सhhMBV" | }0T Uh`="V"| wrE 6 Thdtĭ(PV"`} M kE  7 ThdJĭLV"} Ҍh) p@` ThdoPĭBV"}F*func(string, func() (interface {}, error)) <-chan singleflight.Result DZ pT `hh\ OhV"`~炿0T U|15V"z?}T HHJ ЭPV"F*struct { F uintptr; X0 *parse.RangeNode; X1 *template.state; X2 int } =2%T hh+PV"` -'  Thd3̡ĭHG V"`NkwG p`  2V"` ϟY10T hhV";^h: V@7HP V@F*func(netip.AddrPort, int64, func() *udpnat.conn) (*udpnat.conn, bool)4,HMRx @  (PV"1$ y UQ[V"5 pU ༸HHu6ЭV" 4̬0y @CV"`A@V H$PV" 2̬V+ @%}xLV"`/n%p V )gdL V͹. 0T T!SbV" ̍1mD'@U Thd%ĭBPV" ?h'T @Uh`m`[V"  H p @ gڟ V"Q"H 0@ @T||T V"BfMd@  ĸ(}a PV". u  ŨEH y V"8## pj 3YGV" e<p 0 4x( V"` x0tz V  U6PV"[pt m ?58/ V"`}/tL pm > QT V"n0 V`:X/6  V>&u  V` 7;8!P V:@ V` n< V`&*Kp VE V`6pG0 Vt VUb3 V  (h08D Pm NhhĊ V"ϛ-V VP&pV"@ U c3 T @hh20 0V"߅ VM V`VvS! P Vk>W] V60̠ Vl1qszp V Bp T @ƿhhsR0V"h$  V` vx]$  VFHPV"{0EE  V@4Lt`<=0Ԟ p@ @z /ԭ7 V"]0 T  C#nP. V" e" -<> k pGP  Thd~ĭM V" 6oq T h`{wwlp V"଼ שׂ = T Th`0 V" ! U RHH'?CЭC V"`  P U Thdvĭ' V"nIT @H,lA pV"୼ ai0=T ThdUĭ0V"  * 08 CӺUn-ܸAutovacuumVacuumThreshold,json:"autovacuum_vacuum_threshold,omitempty"F*func(context.Context, string, string, *govultr.DomainRecordReq) errorO -pU@Vz@V'T @|F40V"@3#U V5 0 G`|TqT -= PT hhOnV" i2T DTk}JpV" 3v8pYV  nhhM0V"@ TV8[ V .$ T mh`k:gPV"  L T h`:}daV"UapU @UHj V"3&9 0`o _V" a)/dT hhnlPV" Z|_P% T `|>V"@$^% p V x.~ } @ǿHHWA 0V"U-` @V oV".>kaHPѴ hc.@p s7QHaHFq.X syaH4D ֹRp XHDPGNnTmV" d|,0 Xhd8JĭV"¼( AЌ8% T  |H@QܺPV"@¼   `8hh$ bV"¼ swpT  hh{V"¼2/,& 0 T C7ȶ V"ü ]M  phd+jĭDkP!V"@ü jY9 ! Thdĭpa"V"`ż qD p" Thd'qĭ% "V"ż ֩b 0# Thd,*ĭq#V"ż bH #@ Thd@HĭP$V" Ƽ 5A9 $ Thdflĭa%V"`Ƽ 4&M p%@ Thd+@ĭk%V"Ƽ fKy+ 0& Thdm ĭM &V"Ƽ   & ThdĭR8 P'V" Ǽ ` 'r ThdQuĭ(V"`Ǽ  `Z9 p(@ Thdw ĭa(V"Ǽb50)@V @HHQЭ)V"Ǽ \m%: )T h`:bP*V" ȼ O *T h`/f% +V"`ȼ U[ p+T h`wF+V"ȼ 7?/. 0,T @h`N{,V"ȼ UbFX: ,T h`Vܭ8bP-V" ɼ kl{+ -T h`6BN .V"`ɼ "]0 p.T h`J8 .V"ɼ ` 0/T rh`'/V"ɼ  /T h``6P0V" ʼ  : 0T @h`fb1V"`ʼF*struct { F uintptr; X0 *[]uint8; X1 *error; X2 proto.MarshalOptions }+Ҩ8 1i @}fP& 2V"˼rr ,.$; p2¿$T %GW; 2¿e |- 03¿@V|D 3¿Rt ф~8 3 Vtn`ҙ P4 'ԭ 4V"ؼ ,8 5@U `Khhp5V" ټ lj(Tz 5@U "06V"`ټF*func(congestion.PacketNumber, congestion.ByteCount) bbr.sendTimeState6 V+#0 07 V`1 8*7V ,O7V"`ݼ" P8 V az 8 VI 9 V` G Vxlp9 I ThdUePĭ9V"`w10:@V @HHgYЭz:V"; :T GWPyP;V"` >$ ; VuH<V"v߶p< @VHDTQT<V"@ tP0= Uh`{=V"'N\O =T o/~P>V" &3 >T |h`9F?V"O( p? VC "rE ?@J Thdĭ(0@V" E @J Thd(^jĭL@V" s3 PAI Thd\aĭAV"@ V̦) B| ThdNdĭBpBV"8ܸ 7d Bv$`u"@V4I/30CT  n :_PCV" F*func(*edwards25519.Scalar, *edwards25519.Scalar) *edwards25519.ScalarSg0DT $|~g*rDV"fHnDp XHObrPEV""kb۷E`o XHDTZFV"b z) pF @HHHEЭFV" $O 0G `mhhfGV"  h) G `ohhH`DPHV"`T6 H  nޯ+ֳIV"@ܥpI V`oL c, I` PP 0JV"` q JT 4:Y JV" o89 PK Dhh'Sx KV" 6L` LhhGS9 pLV" Qh/LT @h`8Z-0MV"@KI( M V` M VF*[]struct { key protoreflect.Name; elem protoreflect.FieldDescriptor }F*[8]struct { key protowire.Number; elem protoreflect.FieldDescriptor } | N  hh΂`* 0OV"`9 Os  HHMgЭ8 OV"@ q.( PP @Vh`Y" PV" n Q hhrX:; pQV" c2; QT hhA0RV"Лp R HHЭ[( RV"@v7  PS !#:D!P7 SV"wG7 TT !zP pTV" :8 T !hhi>, 0UV" v+c U hhIm`; UV"@ + PV H᮵VV"  W chhL(( pWV" ]~8 W @nhh@ 0XV"@ %K- X hhԿQ XV"|3-,PYC@  .  ڿs8 Y `hhŔ0 ZV"c$pZ @V:ZV" "} 0[ `hh C<+ [V"@ T% [} phȝX P\V"$YZ̬; \ `( ^]V"N(=-xp]. H` 8J ]i  hhy0^V"|  ~-M> z#T-jK `b`W]- ``Bm@   yw>2Z hetz`r33 ù-L`C 3@3;TEN-c :b#;9|-jXi{9|- 5I`9|-8J{"-!D  ;Tw9|-~@|^9|-! `d~-8M@;T}q9|-Xc9|-n@M`DA-N`>`cT`ErErIF-x Er@ErbTn*3z Er`r [K[K,A(n-S| Er)Uf- Er`Er-Xa-+ErErbT$"-T Er*T @?9`ErEr`¹E - ErEruT?-Er@Er|`rꨋ- ` T-@T$@-_` `i2Tg-Z~ iqTܤO9w~ i iP*@ƿ&-~4 w.5-iA 4 w.~W-A @4 W r-4 .ox9|-A 4 4 =[ry|-``tD@V ӯ`|X@   Q@@@oo#q@@y "q8@-q7Bq´@XqTq!{p> %%EEp> %%*` /,0 ` ۻ'-rEڴ)l|-Ew w@=UFA- `#ܵ>`uu;sD-_` @F7 Ovv2` ( rr`4VKVK\0(phY,`VKô$$L9ԱVKZ$$ĘԱe1@ VK:@C2ܲ H4=0" H4ػ0 9|-GG@G@|-s@GGĴV bx0x0QH usC`Cc,.F`B΢9|-Y O O@XJ,.X6 XX|-IIƴg<- @I# ࢭT[;`¹*O;9|-L1d@- :`:IVmFG\ q9|-  + pv  P@D-@ 2  U3l,.P @2 dXv-BB E-t9|-bwB =t9|-x2Z`Zɴ ܞ9|-_ 3ZZɴ 0(!ђ-7Z ZصY-ZU -% 8ZZb#e-`Z@Zb# <9|-`9f-  b#dW-@`#q -  uT--z h1VCN-!9 crmK\ bjj@'T-@]9cTFA$-s`]9#K-*R % 5LLLHP`&i`y"\ܬ `&p˴ Dʮ |` ӎ nOD ̮+} ӎ @ b ̮!`ӎD ` ̮?}@ӎ @,$l( ӎ= ` Kjp; ̮{}ӎD( ̈́(} &`ӎC J84x }nӎ- _ڤ-` ӎ ӎbTHN`A-r`ӎu~T LC  ӎO ` M:@ӎ u ӎO `'(.P`ӎU mo Q`ӎU `¹ -{+ma:ӎ`> y,u:@ ӎ/`/-N"`'%T W:V:hDhD+-c@hD@hDT֢9=; vf p-J͵T.n-# `jT09|-Hf D) pV  `@46:ܹ d ;V-`̷T;-ܡ@̵T !jy-e̵T+M/HW-#?-5 `_TB0-lE Tp-U (Tc-DH`̷T T&}<h`¹/-@DTrU-jT3V-f T dnA``3+`¹1a-H);Tr-i  TIc-+ T 4.7I պ`¹]?*9|-@); @ m$  <`¹Z9|-` 159|- F `15ϗ(9|-L@15\]z9|-V 15&Y9|-15kU9|-15lI9|-q@15l9|- 15JBs9|-k615@9|-( `15W9|-N 159|-  15Uq9|-158ß9|-i` 15"vo9|-i.@15%9|-@ 15Z@>9|-DF 15kֺ9|- `15}9|-t`159|-I 15ϊ9|-15a\9|-15M]e19|-u`7@15$I9|- 15$o9|-@ 15SS9|- `15s9|- 15NC9|-j  15D9|-5 815 ̒FhF` P$`¹ւ9|- @(ض ݸ K.j` }$`¹AR9|-f ޸&?9|-o `ֺ!9|-` ߸K7D9|-I`  Y=` W`L] ]9|- _)]9|-ʯ`@Sֺ`{ }9|- ?-,`XضT59|-u`fj  mȻ`¹,9|-j` m==9|-I, ^f``¹Lo\9|-f@ eT9|-Iַ&u9|-FkﯺO89|-I ``x9|-1, x9|-5  ַs)9|- T޵`Z9|-f`R~ 9|-p@ w9|-U `B[09|-_`W,.9|-f`ֺ "E-+ 볻P 2k9|-a <9|-k`9`bL9|-> `%  *J@$M `KT vuQ0 -Y 30 ;i%.B;d $W H;`¹'A-@ 2H@Hb# 6lC@lül3 ù 5s.?D` *t@`?D`E~|- ?'U@ ?秴@M4j)?秴@AA`?秴@ehx @?秴@)={- o'غ'5 MpX₵ r 70x`x è@ڼ?s`-Ͽ V>@ |-q  89 ^d@VO2̻D-ICun4- `@uEILU-K@yV vu`m$Q(0a0``E0 `-&   mtо^-9  `6_-u @hhAPp @  9DI 0ONN A 10g0O NN `bf-n Y`h1U<|-J Ut(2|-8 Aö xմ-,2||V`o=<"- crm jeE @,8EM-.o 7Vp>ל-yE 7VG6- ԩ`ԩ^2ܲ2   C2AB>+ ^H2 P@@`¹6E0" ػ s6 R$7#-of` KTЖ-l}}#`eg|-}} }Y@V 0 Dƺۻ_H!- h5# cx0@JC `#0JC0n82JDH댨NX9`J@DU;z 00 4ƺ 4;D-UFkb# ! ) bPpH)@H) `¹ i_p@ d.4״ 0Xa^r nd.d./@4Î-<]nd.`d.b#b(M Z] U`]۟-i] U@-U.y ц0@U/ F-p@;T C  rB*B* , dž]YYDᮕ,E`: cv9|-@ >@XJ&Y-  I 2U3. @GG33 !p Gn>ןJ!@ @H85pQ7` T80@9@H[2 3.3. @G8Ή3!`! Gl 8> J!J! @HƧ- B B  -BB K - BB 5y|-*@ U ,.@337LXN,.B 337LX5,. `3`g7LXJ*func(context.Context, string, string, string) (string, []*net.SRV, error)kG,. x0x07LX,.N 3`37LXYY,. 337LXߡD1,.Px0 x07LXRߑ,.x0g7LXJ*tree.NodeIterator[github.com/apernet/quic-go/internal/utils.ByteInterval]J*func() *tree.Node[github.com/apernet/quic-go/internal/utils.ByteInterval]J*[]struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) }J*struct { F uintptr; X0 func(*http.Server, net.Conn, http.Handler, bool) }J*struct { F uintptr; X0 func(string, string, net.Conn) http.RoundTripper }J*go.shape.957378fe0bb00c3d391e5bb75bbf944ec5c239e07918068cb08c7a047ff2913cEKB`ԚԚ#1 ԚԚ9 Ԛ`Ԛx ԚԚJ*struct { F uintptr; X0 reflect.Type; X1 go.shape.uint64; X2 *[5]uintptr }J*func(*abi.SwissMapType, *maps.Map, unsafe.Pointer) (unsafe.Pointer, bool)J*go.shape.8b7904c80154b83ecf596893bf0803eca9f198932213ffb2fa1e3e98ed863b60IntValueAprotobuf:"varint,3,opt,name=int_value,json=intValue,proto3,oneof"J*func(congestion.PacketNumber, func(bbr.connectionStateOnSentPacket)) boolJ*go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899J*struct { F uintptr; X0 *error; X1 *error; X2 bool; X3 *error; X4 *error }J*struct { ExpiresIn int64 "json:\"expires_in,omitempty\""; *oauth2.Alias }J*func(context.Context, string) (*govultr.Bandwidth, *http.Response, error)J*func(context.Context, string) ([]govultr.VPC2Info, *http.Response, error)MaxPredLocksPerTransaction/json:"max_pred_locks_per_transaction,omitempty"J*func(context.Context, string) (*govultr.Neighbors, *http.Response, error)J*func(congestion.PacketNumber, congestion.ByteCount, congestion.ByteCount)W3>p @ltt1.`EEuXXJ*func(impl.pointer, impl.pointer, *impl.coderFieldInfo, impl.mergeOptions)K*func([]uint8, []uint8, int, *syscall.SockaddrInet4) (int, int, int, error)K*func([]uint8, []uint8, int, *syscall.SockaddrInet6) (int, int, int, error)K*func() *tree.Btree[github.com/apernet/quic-go/internal/utils.ByteInterval]K*go.shape.struct { encoding/json.v reflect.Value; encoding/json.ks string }K*interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool }K*func(context.Context, time.Duration) (context.Context, context.CancelFunc)K*[8]struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) }K*func(go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer })K*struct { F uintptr; X0 *tun.TCPNat; X1 context.Context; X2 time.Duration }K*struct { F uintptr; X0 func(*quic.ReceiveStream); X1 *quic.ReceiveStream }AutovacuumVacuumScaleFactor/json:"autovacuum_vacuum_scale_factor,omitempty"K*func(context.Context, string) ([]govultr.ReverseIP, *http.Response, error)K*func(context.Context, string, *govultr.RestoreReq) (*http.Response, error)K*func(context.Context, string) (*govultr.KubeConfig, *http.Response, error)K*func(context.Context, string) (*govultr.ReservedIP, *http.Response, error)K*func(context.Context, *http.Request, interface {}) (*http.Response, error)K*func(context.Context, string, string, interface {}) (*http.Request, error)K*func() iter.Seq[github.com/apernet/quic-go/internal/protocol.PacketNumber]L*func(*unique.node[net/netip.addrDetail]) *unique.node[net/netip.addrDetail]L*func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)L*func(int32) (http.http2FrameWriteRequest, http.http2FrameWriteRequest, int)L*struct { F uintptr; X0 *http.http2clientConnPool; X1 *http.http2Transport }L*struct { F uintptr; X0 *http.http2ClientConn; X1 chan struct {}; X2 *bool }L*struct { F uintptr; X0 *http.http2dialCall; X1 context.Context; X2 string }L*struct { F uintptr; X0 chan bool; X1 chan struct {}; X2 *http.persistConn }L*struct { F uintptr; X0 *http.Request; X1 chan bool; X2 io.ReadWriteCloser }L*struct { F uintptr; X0 *certmagic.solverInfo; X1 *certmagic.tlsALPNSolver }L*func(context.Context, acme.Account, acme.Challenge) (acme.Challenge, error)L*struct { F uintptr; X0 *server.udpSessionManager; X1 *protocol.UDPMessage }L*func(protocol.ConnectionID, protocol.ConnectionID, quic.packetHandler) boolL*struct { F uintptr; X0 *quic.packetHandlerMap; X1 []protocol.ConnectionID }L*struct { F uintptr; X0 *http3.frameParser; X1 *http3.ClientConn; X2 error }L*func(context.Context, *dns.Msg, *dns.Conn) (*dns.Msg, time.Duration, error)MaxParallelWorkersPerGather0json:"max_parallel_workers_per_gather,omitempty"L*func(context.Context, string, *bool) (*govultr.IPv4, *http.Response, error)L*func() ([]uint8, int, []uint8, []uint8, []uint8, []uint8, []uint8, []uint8)L*func(*wire.AckFrame, protocol.EncryptionLevel, monotime.Time) (bool, error)L*func(protocol.PacketNumber, protocol.PacketNumberLen) protocol.PacketNumberL*struct { key protoreflect.FullName; elem protoregistry.extensionsByNumber }M*struct { F uintptr; X0 client.HyUDPConn; X1 *net.UDPConn; X2 **net.UDPAddr }M*ringbuffer.RingBuffer[github.com/apernet/quic-go/internal/protocol.StreamID]M*func(context.Context, acme.Account, acme.Order, []uint8) (acme.Order, error)M*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn] BoolValueCprotobuf:"varint,2,opt,name=bool_value,json=boolValue,proto3,oneof"M*struct { F uintptr; X0 context.CancelCauseFunc; X1 context.CancelCauseFunc }M*func(context.Context, string, *tls.Config, *quic.Config) (*quic.Conn, error)M*func(context.Context, string) (*govultr.BlockStorage, *http.Response, error)AutovacuumAnalyzeScaleFactor0json:"autovacuum_analyze_scale_factor,omitempty"MaxLogicalReplicationWorkers0json:"max_logical_replication_workers,omitempty"M*func(context.Context, *govultr.ISOReq) (*govultr.ISO, *http.Response, error)M*func(context.Context, string) (*govultr.LoadBalancer, *http.Response, error)M*func(context.Context, *govultr.VPCReq) (*govultr.VPC, *http.Response, error)-|Z->* X ]`,.ԯlw"@``3,0@`3ض,W8-T .@ LIK-v / 3r  -u`@ Zw"@<\+<*3|-@B `Zw"@\+|*92C-T`: iM@0@_p+3-2d D M $f'x%J-אD gi hT'h%-5uiM@Q'$0@ R' $Qp-6I @!M @hwB-e J !gi L(o-.- ?" 4`0@-ywmLw"@ z `t {w-MxmLw"@ z `x f},.-#@zmL5ǍBl-gSmL#mL w"@z `- TR#R R@D@O IӋ|-@(R4`r0@r4:^-Y`^Xɾ$X Kw"P-Y^Xɾ%X Kw"_-'`_l`%l Kw" \-_Q%Q Kw" u??- `Q &Q Kw" b;R-< c 9& 9 Rj9# ^-`c,A&,A d FK-'~c3@'3 W# AG-2kg3'3 .H@4 -h3(3 S3"`d?- iQ`(Q #1` P-mEr(Er 8X`_ |-(Er0@8PNXE@xd-`mEr)Er # Qoen -Er&``y-w @*Er( }NxKXH-@w *Er( ~NK-zpP-\@{ +ErNlKڵi-2?`tEr`+Er @V s#x-*] +Erw"@0NEl-a`wEr ,Er NRL-T`{Er,Er U^Ŀ__-s{A,A X]-T } @-  * Y @v-^^ -  8C@ GC@ XSP- g.g   7-`g`.g ^# h `hy-og.g ^#(WjA->4 /4   Cz-h` /4 w"@l-2p`>/> >+ f->@0> XX@ >+TQ- .0. K U-p 1 ^# X9-D `1 If-p`1  W# D-0 2 ^#W# -p 2  @N Z-A2 ne-R@3 h` $=.-g3g `01`< -E4E ``&^-qF`F`4F :`)-M0 F:z`y|{-XF:8q`@q_a,.| F: pp``pj,.̚v00ñ-0VKX@8? ld (..`H4i@0@* (.:H4i@0@zo  (.M H4i@0@5( T-IVpN |-j0@} V- 181 ~0@:-u z8z z;6y-`@9 ^##ߧ-v 9 X *] e-1$`@:@ a} w} e-v`: 88E- Z:Z `]a-4Z ;Z `q`x$C-`Z;Z X   -*Z;Z  J@*N6-By`Z@<Z  ~   5  ?{2-  j>j ,yL+|-% Vw"@`CmC[@PY-b @?Q( DĉD0- P? \W eW  ׅi- ӎ@ӎ 5} 2 ]-`@ X @Z 4- @  R@g [SH-P A t#g g IH5 T-J>->`#׺A X ]\-b` @B$(?`\-{(B 3r /5-,TTV-zlltp-W`:?`C? y,b7@o-->X<CX< p7P`R sS- GI DI @A @L-W` Dx K \\/P}-B`JٺD  nRu,.^Y89 0@L\\*6\\.yƿ,.}N`89 0@\h[] r@\8[X||-89 ك`rP\\0@\\ - M㵻`F ?~ h1;;-0 PF ^ L8C LB n- Q G tr-1QG t@G-pSNGN N N 3O-2Yں@H : %@"t-ŚYںH ^#Ava$-E ZںI Nvõl|-b@n`&d d0@'d d/-[^2I2  n No (..i@Q0@pOָ (.:i@0@l (.M`i@ dU0@S c (.x / M(̢I:}̢Ig - kQ KQ  :`UYF-oUڷLU `p5~r`q`J-B* _>g5qDK.h B* A<5q`L@L-h B* *]H-R`x:M: 6 G  +- H M9.  XjŤ5H!@U"6. S>-3 Np K`̇`08-"  O  ؋@ Z˔-E `O   q7-V  O  h :J-_i) Pi) `}X@fN*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *net.netFD; X4 int64 }N*func(*unique.entry[net/netip.addrDetail]) *unique.entry[net/netip.addrDetail]N*unique.node[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]N*struct { F uintptr; X0 *int; X1 *go.shape.[]go.shape.string; X2 *[4]uintptr }`-K`gQg   N*cache.Option[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]N*struct { F uintptr; X0 *int; X1 string; X2 bool; X3 control.InterfaceFinder }N*func(context.Context, string) (*govultr.DatabaseUsage, *http.Response, error)N*func(context.Context, string) (*govultr.FirewallGroup, *http.Response, error)N*func(context.Context, string) (*govultr.ObjectStorage, *http.Response, error)N*func(context.Context, string) (*govultr.StartupScript, *http.Response, error)N*func(net.Addr, protocol.ConnectionID, protocol.ConnectionID) ([]uint8, error)C,5;T$`D-g޵5FrT@U-h gN*struct { F uintptr; X0 *int; X1 *unix.Sockaddr; X2 *error; X3 *[65536]uint8 }N*[]struct { key protoreflect.FullName; elem protoregistry.extensionsByNumber }N*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 reflect.Type }lj-=Uhk   B@ O*map.group[uint16]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 }O*struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }O*struct { Type asn1.ObjectIdentifier; Value [][]pkix.Extension "asn1:\"set\"" }O*unique.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]O*weak.Pointer[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]O*ringbuffer.RingBuffer[*github.com/apernet/quic-go/internal/wire.DatagramFrame]O*struct { F uintptr; X0 net.PacketConn; X1 *client.clientImpl; X2 **quic.Conn }O*struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2startPushRequest }O*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest }O*func(acl.HostInfo, acl.Protocol, uint16) (outbounds.PluggableOutbound, net.IP)O*struct { F uintptr; X0 *int; X1 *bool; X2 func(reflect.Value, reflect.Value) }O*func(context.Context, net.Addr, *tls.Config, *quic.Config) (*quic.Conn, error)O*func(context.Context, string, ...oauth2.AuthCodeOption) (*oauth2.Token, error)O*func(context.Context) (*govultr.ContainerRegistryPlans, *http.Response, error)O*func(context.Context, string) (*govultr.BackupSchedule, *http.Response, error)O*func(context.Context, *govultr.UserReq) (*govultr.User, *http.Response, error)O*func(context.Context, *govultr.VPC2Req) (*govultr.VPC2, *http.Response, error)O*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }O*[8]struct { key protoreflect.FullName; elem protoregistry.extensionsByNumber }P*struct { F uintptr; X0 func(string, func() error); X1 string; X2 func() error }P*func(context.Context, string, *net.TCPAddr, *net.TCPAddr) (*net.TCPConn, error)P*struct { F uintptr; X0 client.HyUDPConn; X1 chan error; X2 network.PacketConn }P*struct { F uintptr; X0 network.PacketConn; X1 chan error; X2 client.HyUDPConn }P*func(tree.NodeIterator[github.com/apernet/quic-go/internal/utils.ByteInterval])P*go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts)P*struct { F uintptr; X0 chan struct {}; X1 http.RoundTripper; X2 *http.Request }P*struct { F uintptr; X0 <-chan bool; X1 context.CancelFunc; X2 context.Context }P*struct { F uintptr; X0 *server.udpSessionManager; X1 **server.udpSessionEntry }P*struct { F uintptr; X0 func(string, string, syscall.RawConn) error; X1 string }P*cache.LruCache[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*[]*cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*[]cache.Option[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]P*func(protocol.EncryptionLevel, protocol.ByteCount, protocol.Version) wire.FrameP*func(context.Context, string) (*govultr.BareMetalServer, *http.Response, error)P*func(context.Context, string) (*govultr.DatabaseBackups, *http.Response, error)P*struct { items_data []yaml.yaml_node_item_t; style yaml.yaml_sequence_style_t }P*func(wire.FrameType, []uint8, protocol.Version) (*wire.StreamFrame, int, error)P*func([]uint8, protoreflect.Value, uint64, impl.marshalOptions) ([]uint8, error)P*struct { F uintptr; X0 impl.Converter; X1 impl.offset; X2 reflect.StructField }P*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.Converter }P*struct { F uintptr; X0 reflect.Type; X1 map[reflect.Type]*impl.coderFieldInfo }P*struct { F uintptr; X0 reflect.Type; X1 reflect.Type; X2 *impl.coderFieldInfo }Q*atomic.Pointer[internal/sync.entry[go.shape.interface {},go.shape.interface {}]]Q*struct { F uintptr; X0 *struct { sync.Once; v *x509.Certificate }; X1 *[]uint8 }Q*struct { key string; elem func(zapcore.EncoderConfig) (zapcore.Encoder, error) }Q*struct { key protocol.StreamID; elem quic.incomingStreamEntry[go.shape.*uint8] }Q*func(context.Context, *certmagic.ACMEIssuer, acme.Account) (acme.Account, error)Q*func(context.Context, acme.Account, acme.Identifier) (acme.Authorization, error)Q*func(context.Context, acme.Account, *x509.Certificate, crypto.Signer, int) error AttributeGprotobuf:"bytes,3,rep,name=attribute,proto3" json:"attribute,omitempty"Q*func(protocol.EncryptionLevel) (protocol.PacketNumber, protocol.PacketNumberLen)Q*struct { F uintptr; X0 *http3.Conn; X1 *quic.Stream; X2 int; X3 *http.Response }Q*func(context.Context, string, string) (*govultr.NodePool, *http.Response, error)Q*struct { F uintptr; X0 *bool; X1 *int; X2 *error; X3 unix.Sockaddr; X4 []uint8 }Q*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.structInfo }Q*struct { F uintptr; X0 func(impl.pointer) (impl.pointer, *impl.coderFieldInfo) }! 6|-7w"@p0ryJ 6|- K˦˦w" ͦͦ׿ 6|-Et KĦĦw" ƦƦr 6|-[t Kw" b 6|-`@ Kw"LL 6|-` KDDw"EP- 6|-!&`` 6|-cu`yK --J1-1-ᶓ 6|-bt`AK --J?-?-! 6|-|Lh0h000n2} 6|-1@fLX0X0p0p0 6|-ԯw"@``3``30@`3`3-{p 6|-5LN1N1V1V1d 6|- LP>1P>1B1B1xw 6|-@gL 0 0 1 1i 6|-{ L|1|1$)1$)1W 6|-tgL00`0`0 6|-LW1W1X1X1JLV 6|-UKL11$1$17 6|-5@L21219191:] 6|-6LT<1T<1T=1T=1Vo 6|- 6L$11$11$21$21"hz 6|-UALC1C1H1H1Vk` 6|-@L;1;1<<1<<1 6|-2 @Mw"@(M-(M-p0M-M-͡ 6|-vL,Z1,Z1Z1Z1UiK 6|-L00P0P0 6|-Zw"@Y+Y+p0Z+Z+" 6|-3w"@  p0h h h( 6|-cTw"@%%p0%%$ 6|-``Tw"@%%p0&&B"&- 6|-^s:':'0@P<'P<'  FP^sT:' $0@P<' $f& 6|-a L%L%%%]n 6|-s5ZiM@w'w'0@px'px' 6|-!`Zw"@H'H'4H'H'1 6|-`@S""_ 6|-5 iM@Q'Q'0@ R' R'^ 6|-rdj$0$0$dt2$t2$i6 6|-dXi##? 6|-WyS""\kL 6|-c6`Jw"@|i|ip0jjq. 6|-y "mLw"@ z `t t [(9 6|-M"mLw"@ z `x x  |-eZmLkohh\ 6|-hmLw"@z `J| 6|-ymLw"@ z `h h ] 6|-mL5EI |-@\mLs%! 6|--#"mL5Ǎ9s 6|-mLMK 6|-fmL}lfPj>0 |-0 mL`7`p9 6|-mLY&#WI 6|-mLP`DD'  B B) 6|-mL58 6|-Tw mLYQ`&`" 6|-}mLԖԖt 6|-w`PmLw"@ммz `sr 6|-.`QmLmXX(&`qVF 6|-Qw"@ \ \ p0`^ `^ KH4 6|->X=RW# wwD xx86 6|-~`cR R@D@O ȅȅe@ 6|-;R R@D@O DD  6|-xcR R@D@O & 6|-$(R4`0@Nf 6|-> (R8`?] 6|-= g(R(P(P %|O|Ozk 6|-Pg(RPP %OOu 6|-  jO# \\o`6w 6|-jO# )o:" 6|->:w"@@[@[1ZZ# 6|-X X@~ 6|- X  ooFoo)N 6|-( X (50o0o4oo| 6|-| w"@T"pT"pp0#p#pe' 6|-}l moo5} oo< 6|-`ll ih&ph&p4(p(psm> 6|-lQ iDEr! 6|-H]Er^#NN NN ߻ 6|-Er^#ĜNĜN `N`NxZ 6|-^`]Er^#T;IT;I 9I9I  6|-˰@ Er 8N8N(ȟNȟN˝R 6|-u Er^#EE E E 6|-TErw"@8I8I4TITI 6|-:Er# NNQNN! 6|-I Er# ȫNȫNQTNTN& 6|-]@ Er# NNQ8N8N" 6|-`Er^#GG GGUq 6|- Er# `N`NQNN/.͓ 6|-`xEr# HIHIQ0HI0HIH9' 6|-| ^Er# NNQ$N$Ndl 6|-|^Er# 0N0NQNNL 6|-@ Er# NNQpNpN_l 6|-3Er# TNTNQNN N3@9Er# TNxGIQNGI͠) 6|- Er (N(NسNسN1{ 6|-Er NNNNGt 6|- Ergi NNW# `N`Ngd 6|-?@ Erw"@\N\Np0NN2@ 6|-  Erw"@NNp0NN% 6|-`^Er^#MM 0M0MV@ 6|-@^Erw"@`xN`xNM`xNxNz 6|-@_Er^#lyNlyN yNyN Z 6|-_Er`TNTN01`ЄNЄNa>5 6|-C:Er6 Z 6|-yA= 'X@X@B`@@e 6|-;AB{1 6|-[@ w"@oop0ppw 6|-@{ =8:8:=`>>KU.' 6|-a0||eC@`@@gk 6|->;=~w"@OO1PPx}V 6|-C=~w"@ 6|-_g^# hTԙTԙ `hәә 6|-.g $$ ԔԔkQ 6|-Gi| ))@%@%~^ 6|-:W~i.OW11.Pq 6|-~@4  pp qqhُ 6|-y@4 w"@ddp0TT2%g 6|-\@4  00 XX2 6|-`4  dd 9f` 6|-: :HH L 6|- 0@ƥƥg켥켥#/ 6|-lw"@[[p0[[ . 6|-W@lw"@[[p0[[ ~Z. 6|-۝`tu 4 4`]>1 6|-pt" ff` f f+l; 6|-W# l l D )6 6|-D^#     6|-g`x- x- 01`- -  = 6|-D@g`N N 01``O `O } 6|-g`,4 ,4 H>`4 4 ) 6|-`gE`5`f/ 6|-7v`i%`||Rq ?K 6|- (#`c+c+`Xd+Xd+ 6|-TE`kbqw`. , ,}`. , ,fo 6|-*D   `g\ 6|-q`  01`  ' 6|-EwE=,=,qX:,X:,qN 6|-Ewq`[,[,Y,Y,BP 6|- ^#W# = 6|-90F:` "g90TF:p`p J 6|-X F:xx`ww 6|-=F:`,,8? 6|-M04F:`j 6|-a0F:`xx ҎWa0 4F:4s`xrIw"@88p0X8X8?  6|-`r\w"@>4>4p0A4A4A5B 6|-j70@A< 6|-+>0@a 6|-T[`w"@,N@,N@J Q@ Q@w; 6|-BO;T OT OM0O0O 6|-C O:^ O Opl+ 6|-Jb ;` l*Ol*O: +O +Od1 6|-cr5 ;` *Q*Q: +Q+Q{0 6|-`cG ;` |zR|zR: {R{R] 6|-cH ;` TT: TTĖ" 6|- d3H ;` l~Xl~X: xXxXT: 6|-F1~330@x3x35cV 6|-@0X`;4/Y4/YjW 6|-`Z^#HHW# v+ 6|- 'z z;??6??c$ 6|-ִ'z z;??6??Nm 6|-ψz z;??6??YFt 6|-^LR@\q\q"AR 6|-0K`_LR@$q$qM |q|q' 6|-X *1u1u] 08u08uc 6|-O, (`88] c֬ 6|- ]` (`N||6V 6|-`B X@jj~DjDjϖ 6|- cZ"Gdd HddBg 6|-l 0Zw"@mfmf4lflfgE 6|-@ZJзfзf2xffSB 6|-7Z"Gjj Hjj;w 9 6|-5eZxvgxvgvgvg$ 6|-@Zw"@PofPof4nfnfЍs 6|-Zw"@BgBgp0BgBgJ 6|-Y8eZ^ Lԗjԗj8C LPjPj$ 6|-<8Z^ Lgg8C Lgg9 6|-6 9Z^ L@g@g8C LPgPg 6|-h9Z^ Lgg8C Lgg# 6|-`Z^ Llglg8C L|g|g 6< 6|-fZw"@jjp04j4jK 6|-Z^ LPlgPlg8C L`lg`lg 6|- .RZ^ Lhh8C Lhh 6|-d`SZ^ Lhh8C LhhrX 6|- @8w"@mmp0mm 6|-  <^#mm HmHm7 6|-z=0@5o5op7@L6oL6oN 6|-V 8 =w"@@m@m4mm( 6|-@8 w"@FmFmp0xFmxFm 6|-@zW# 8B8B$b?, 6|-]9^BBgYV 6|- @Vw"@pCpC[@sV 6|-%>Vw"@`C`C[@TE 6|-*R ^#xdDxdDW# ,bD,bDƪ 6|-bw"@4މ4މp0މމI 6|- A#w"@6m6m[@Ed..9 DܕDܕui 6|-# @0@))9 ((`E 6|-LX @Z r5 6|-@ R@g 7? 6|-t#g ܕܕg DD, 6|-`w"@uup0uu57 6|-=C`w"@@v@vp04v4vO 6|-cucK HHJ|٣|٣Q 6|-bt`K ddJg 6|-6`L,ߤ,ߤ֓ 6|- 6Lܤܤ0ޤ0ޤW 6|-7"oo\ooAxJ 6|-  E ,,;G 6|-fˉE ]@@Zh 6|-K@hw"@hhp0x 6|-ET f `i//`i11㇃ 6|-`j"]]`^^^ 6|-%.@Bw"@SS0@,S,S 6|-`lw"@grgrp0jrjrf! 6|-`lw"@ererp0frfrք 6|-?y,brr7@rr> 6|-(?y,bDrDr7@XrXr 1` 6|-`?y,btrtr7@rr'x. 6|-. i?y,b\r\r7@prprJ@)A 6|-@?y,brr7@rrS! 6|-(@?y,brr7@rr3 6|-??y,brr7@rrs[Ez 6|-(?y,brr7@rr>= 6|-)~?y,brr7@rr 6|-P?y,brr7@rr~ 6|-aG?y,brr7@rr#0 6|-"?y,bPrPr7@drdrzh 6|-r?y,brr7@rr%= 6|-?y,blrlr7@rr`2 6|-`?y,b]/@UI "z8y0@zy" 6|-xJ [[n[[2 6|-^YE89 0@L\L\*6\\D 6|-}N`E89 0@\\] r@\@\]s$@ 6|-E89 ك`rP\P\0@\\8ڲ 6|-q89 `T[T[q`8[8[% 6|-@,]]XC !]]-D 6|-  w"@;];]p0<]<]sz 6|-?~ <(^<(^h1 *^ *^Af 6|-IC?~ ^^h1 ^ ^{8 6|-G0?~ ^^h1^^Y, 6|- ?~ ]]h1]]W4 6|-0@?~ $?^$?^h1T@^T@^^ 6|-9?~ d ^d ^h1 ^ ^ae5 6|-N?~ Y^Y^h1([^([^y}G 6|-2p`?~ `^`^h14^4^໭ 6|-K`?~ /^/^h10^0^I 6|-`m?~ 8^8^h1^^nJ 6|-ֳ?~ @!^@!^h1"^"^$ 6|-8`?~ ;^;^h1@9^@9^e 6|-a0 ?~ p^p^h1^^ Z 6|-?~ ^^h1,!^,!^h 6|-Np?~ p{]p{]h1|x]|x]  6|-{0@?~ ]]h1X]X] 6|- `?~ m] m]h1n]n]!v 6|-&?~ ]]h1D]D]aE 6|-& t``@``F? 6|-F: V` V`%@ W` W`M0 6|-1`: W`W`%@X`X`VX 6|-I: PY`PY`%@`Z``Z`3 6|-?: [`[`%@\`\`"o 6|-m: @]`@]`%@T^`T^`Ų 6|-F: ^`^`%@_`_`(%hi 6|->G: ````%@a`a`܇- 6|-G: $b`$b`%@8c`8c` 6|-n: c`c`%@d`d`2 6|-H: le`le`%@@f`@f`Ԥ 6|-`@: f`f`%@g`g`sl 6|-: ph`ph`%@ 6|-U`XrXrphrhrP 6|-pw"@qyqyp0,ry,ry2x 6|-@A'' @P%P%4Q 6|-Ҋ@A @<<i# 6|-  ` ^^`[Nv 6|-@ +``¶ 6|-`  c cbZccnLF 6|- s`]@ LcLccc 6|-F@]@ cc0@HcHcT(C 6|-]@ 0c0c0@ccB] 6|-N0&]@ cc0@cc; 6|-aIL]@ cc0@ccKL 6|-uI]@ $c$c0@cc 6|-\r]@ TcTc0@ccOhk 6|-l@]@ cc0@.Od5 V   n p V` +  V`- R*struct { f func() bool; once sync.Once; valid bool; p interface {}; result bool } ; V ^1  V )V h2P VJJ g'  V?R*struct { F uintptr; X0 quic.streamSender; X1 protocol.StreamID; X2 *quic.Stream } 8\b p  V? \g"  V`` 3 0! V`OV\O( ! V` &  ! V?? 9uP" V?@V Z7( " V`}L6lU # V| 贊- p# V ` ׎hj# V`/ EN>0$ V`B? vq$ V  Y!A"z$ V`O@ s.U P% V LQB % V@# R*func(http3.StreamType, quic.ConnectionTracingID, *quic.ReceiveStream, error) bool }Ud7p& VkR ʌ & Vt ڢ̨0' V`*^9y ' Vm Gj ' V@v` Z P( VNt =] ( V`J XȮ3 ) V``t( }0`Cp)UUTn-`ܸR*func(context.Context, string) (*govultr.ContainerRegistry, *http.Response, error)R*func(context.Context, string) (*govultr.DatabaseMigration, *http.Response, error)R*func(context.Context, string, int) (*govultr.FirewallRule, *http.Response, error)R*func(context.Context, string, *govultr.BackupScheduleReq) (*http.Response, error) k - % 0+ V1@Z 兟 + V`X r\% + V51 M9 P, V@ZW x , VXݐF4 - V?< G p- V% \%7- V@^  No0. V`BT{?Z= H."<@V c.p }%o<d `iH.Ҵ@VF@V$ҴX YiC6 P/ V `R*func(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) |:tQ[0¿Rt$T-Jxp0¿3tt Ư 0 V`B! u,8 01 V@t=\< 1 V~ D R*func(wire.FrameType, []uint8, protocol.Version) (*wire.DatagramFrame, int, error) Ӝ؎ 0!}9P2{X{G{ 2 V  (i53 V`ұ? p3 V m <0~T 3 V¿`땅\b04 V  r@ 4 V`F 4 V@ W|t~ P5 V .}X\- 5 V  ~  0J8~ 6 V  $$(Oſ p6 V?@S*struct { F uintptr; X0 chan cmd.clientModeRunnerResult; X1 *cmd.clientModeRunner }S*[0]*unique.entry[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]S*unique.uniqueMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]S*[]struct { key string; elem func(zapcore.EncoderConfig) (zapcore.Encoder, error) }S*map[protocol.StreamID]quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream]S*func(*tree.Node[github.com/apernet/quic-go/internal/utils.ByteInterval], int) boolS*[]struct { key protocol.StreamID; elem quic.incomingStreamEntry[go.shape.*uint8] }S*func(*tls.ClientHelloInfo, []certmagic.Certificate) (certmagic.Certificate, error)S*struct { Certificate string "json:\"certificate\""; Reason int "json:\"reason\"" }S*func(http3.FrameType, quic.ConnectionTracingID, *quic.Stream, error) (bool, error)S*acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]S*func(*abi.SwissMapType, *maps.Map, uintptr, unsafe.Pointer) (unsafe.Pointer, bool)S*func(io.Writer, *http.Request, bool, protocol.StreamID, qlogwriter.Recorder) errorS*func(context.Context, string, string) (*govultr.DatabaseDB, *http.Response, error)S*func(context.Context, *govultr.DomainReq) (*govultr.Domain, *http.Response, error)S*func(context.Context, int, string) (*govultr.ObjectStorage, *http.Response, error)S*func(context.Context, *govultr.SSHKeyReq) (*govultr.SSHKey, *http.Response, error)S*func(protocol.PacketNumber, protocol.ByteCount, protocol.ByteCount, monotime.Time)S*go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool }S*func(protoreflect.Value, protoreflect.Value, impl.mergeOptions) protoreflect.ValueT*struct { IPv4 string "mapstructure:\"ipv4\""; IPv6 string "mapstructure:\"ipv6\"" }T*func(*sync.entry[interface {},interface {}]) *sync.entry[interface {},interface {}]T*func(*unique.indirect[net/netip.addrDetail]) *unique.indirect[net/netip.addrDetail]T*func(*unique.entry[net/netip.addrDetail], *unique.entry[net/netip.addrDetail]) boolT*struct { f func() error; once sync.Once; valid bool; p interface {}; result error }T*[8]struct { key string; elem func(zapcore.EncoderConfig) (zapcore.Encoder, error) }T*[8]struct { key protocol.StreamID; elem quic.incomingStreamEntry[go.shape.*uint8] }T*struct { F uintptr; X0 *http.Client; X1 map[string][]*http.Cookie; X2 http.Header }T*func(context.Context, acme.Account, acme.Authorization) (acme.Authorization, error)T*acl.compiledRule[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]TypeOprotobuf:"varint,1,opt,name=type,proto3,enum=Domain_Type" json:"type,omitempty"T*func(context.Context, ...oauth2.AuthCodeOption) (*oauth2.DeviceAuthResponse, error)IdleInTransactionSessionTimeout4json:"idle_in_transaction_session_timeout,omitempty"T*func(int32, int32, []filedesc.Enum, []filedesc.Message) protoreflect.EnumDescriptorU*struct { F uintptr; X0 <-chan struct {}; X1 context.CancelFunc; X2 context.Context }U*[]acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]U*fips140cache.Cache[crypto/ecdsa.PrivateKey,crypto/internal/fips140/ecdsa.PrivateKey]U*func() *cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]U*cache.EvictCallback[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]U*bbr.RingBuffer[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.ackPoint]U*struct { F uintptr; X0 *sync.WaitGroup; X1 *quic.SendStream; X2 *protocol.StreamID }U*func(context.Context, string, string) (*govultr.DatabaseUser, *http.Response, error)U*func(context.Context, string, string) (*govultr.DomainRecord, *http.Response, error)U*func(context.Context, *govultr.ClusterReq) (*govultr.Cluster, *http.Response, error)U*func(context.Context, *govultr.NetworkReq) (*govultr.Network, *http.Response, error) @k?S`: F(@,X M: `F()K 0& |t`F(ȶTWX j؃ G(TЏTkS G(%Tɶ~ m G(%T`~ 3T!@H(tTsTLt"H(T5÷ &,.#I(%T 6$]$`I( T*@ƿ .>wT%I(tTsT lJ4 & J(ȶTWX"7i H&J(T5÷05f&J(T5÷ 3_   (@K(TސT6Dra)K(%T#o2+L(#*P ,`L(#JU @2rb,L(;#U`1Uqh, M(7UȬ2 pM(˶# P*D @? M(6U,s6$`@N(` 48H$vN(#` i-`/O(``#+*-/`O(L*3kps/O(%LU|#o0 P(hX"`n+q 4`P(X0`X($`¹5T ٌ9><X<(=X0ThX4 Y(NT#y%0\2Y(4VTG-j?ʌYʌ( 8xM-|EmL@ZmL(okUOUFdo-" FmLZmL(ua%@a M-FmL[mL(#UUq-"J mL`[mL(5@Uk@@@+<J mL[mL(¹k  *-eGmL \mL(VV(f|ymL\mL( JTQWB|-f ImL\mL(fV-ImL@]mL(@YVW%-bf mL]mL(]Y@UN-f mL^mL($ Jm JY Y0mL`^mL(0 `l R-`JmL^mL(ILV 0*`KmL _mL(mVPV~%$-N KmL_mL(^@V \UI6 |HmL_mL(#`Ml e0 $LmL@`mL(mԵU 5 )7`NmL`mL(P`%@Vw-`OmLamL(mmV}|-f`amL(6@"UsD5bOmLamL(1$ Ć\ mL bmL(Sq`d/`PmLbmL(7ྐྵPQ` &-$`SmLbmL( .)r80OSmL@cmL(i9YQ D^X~ RcR(`8P"T  ̛<xRdR( $[`¹ {-~9`TR`dR(%@VH@VWk,@RdR(G@Dnrw@9WU e(R(x8U$x.'l`R (Re(R(%T{d>$`Ve(R(8o2 W@f(R(U7UN9Vf(R(f"Rt`Wg(R(8  w5-=`g(R(@U@Ul-P`g(R(@U@UA|-: X h(R($V)V)80K`Xh(R(o0PXh(R(ػU@ X-gS @i(R(@UѮ-\ Yi(R(c'@U8@UlI-t`Z(Rj(R(M `W#` O`jO(e 츴X) OjO(e XX }C|`U Hж kH(TMoT "42( [kH(T'TCI-?`]k(^#W# 0}`@l (ؿ@ĸll (pmS %ϡ mQ (pmS% /&"` `m` (TΒGOo-a 9m 9(^#_T  7x)-"j`a 9 n 9(^# 9b-bn 9((V(V ܢ%bn 9(غXV"=0tN[ 3@o3("@,'eBV`j 3o3(.UQ@O(Pm =p=(T9U^TFz n `p=("`0T fEp2= k=p=(;X໴X ū}}(`k q=(; `¹Ä 5` l=q=(`LT 9<8ErqEr(@߿ yF.`oEr@rEr(T ;`¹n- oErrEr(8` W# R`L-hqErsEr(x@5@V?>- Er`sEr()@U8<@U , rsEr(2T8 J/-drEr tEr(` W# W2|- Er^#`FF`FFRfRm w ErtEr(T ~p2n`y Er@uEr(VTSX $iz EruEr(T[@V (T׬sErvEr(@V;TAI*Er`vEr(r<@ \4(msErvEr(@,RT^t3@Er wEr( ˚'uErwEr(+A##Cp2' vErwEr(mX\XYI-B wEr@xEr( * `u`\-ErxEr(7U[(\;}-ΤyEryEr(@V s#` ʈB@U} `yEr(#qTqTo-yA(t  ;əȬ^`} z (ڴt T/? z (B`¹p`~z (X=,@ƿ -|:|  @{ (1 YSNT((HԞ028U { (qcc'ί | (euh= pp@g}&^ `| (W( Yl 䋚6V|@(͵T2o@V @0 }0(1@"@ tC`}(I*5"@A/M a}(1@}T  v;.P@~=~(6T-TL_`=~~=~(%`¹W@  =~(jT  J6pǘ`=~(hVTAT@<\<SV =~(W xѾX<   =~((ضTAoHH `X=~=~(蘴c4 ]-`gg(^#gi] M] S-Vg@g(( `^ ` LU-`g((V(V v%\-.gg(1[u2 J$0``i(<X@T ˣ0(Gi(:_T-?B`-. 4 4 (^#gi_ M@_ ˬ@ 4 4 (WW 5n\P` 4 (Wj^w.ѴXń@4 (=XFX.f4\ 4 (%Tu.w` 4 (#ەnȬ`4 `4 (@Db# D@Ȭ4 4 (@Db# [-   (.VtVY/f2^` (#UUR-->>>( >+ L T` @Rp(1@KTk-۝t(h@V1@-pt(#@V4& `(6Ue̜-W(^# W# ntD ("@b#Or gg(#O- gg(%@X@X _DU8_@g@g(-v!) gg(]bX(gg(X8>`CXt`g`g(rF gg(  3-'E`E E(`XX`X`g&x> %%(Vػ?fx>%%(Vػ#>D@D(PimV 4bqbq(`k@V znrq(KT28܁$F ڴ`(Uk"(E`ڴ(@U.0qڴ (UQR> uu(\sG@sB (0@ UG @(0@ `X(0@ 'Tb0 (0@ W-Q;`;(`q +ݵvvv( Xj-Br (ô q { Ȭ h(7@" 0(V)~4Ah(@` +5@h(7@` LD-8``VKVK(`* 1 VKVK(5U )1VK`VK(%,$` LN-=1VKVK(`t@(,b..VK VK(Ĵ @0 ^d2Y VK(2T DT@ (2TބEh28`@(`"` Jm H4H4(;Tb#G2h2GG(ѵwN t${8Y ` (@Ώ-(%a+@a$$Ա ( $$5X+Աrs( tT|-E(6@"@U{É,.H @(6@"T x@|-q(6@"US/|- (6@"Vk|-8`(6@"@X  0f OO(@XĴV$SM`-VX۶ X(~0@7@r}X۶X("࿹ZX0Ra X۶X(" ZXlBX۶@X("ZXPN X۶X("`ZX1qgX۶X("`ZXX۶`X("`ZXK&CZX۶X(" ZX=%@X۶ X(" ZX~&p`X۶X("ZX =  X۶X("ZX A X۶@X(P#@8xT77"X۶X("ZX#X۶X(" ZX"B`X۶`X("չZX_& X۶X(" ¹ZXj>-}`X۶ X((~0@eTS 03`II(uT"`8ei-/ DD(q`&`&-mJ \@\(@V6@V@<+i[`(z#``4 BOO(y@׿VC`O`O(y׿?c-"u`11((~0@J.=Ed54 54(>U@9]qe5454(>VqEf5454(>@U2u'0ܶ@0( k@ aKK(DǴ 3 ùn/I]/@9z(x8U$x=c4 I4@ z`z(%T{z-ψz(cUwU6|-# z(@U($0Ez(x8U%pq 8z(@%Yh | `@z(U8 /P2<z(U7UḖp2#` (T2T[p29 `(T9TB0O(~]!yܚ- (?< R p7P`R ˃0v(~\ػ\V;O-f(^#&# p @ @ (=T\@VXl ]` (]&y,`¹ XA  u5`  (UTT   ` (\@VRT|35ZZ({@V KO'h2$ Z Z(GOh]U~u-7]ZZ(GP` 3 Z(쯴Xb`Z@Z( M t` ZZ(@Ŀ6ZZ(]ܹ<ɴ@l  ?@ `Z(B`  ZZ(b#X@@#p7@Z Z(x cG< 3,@3 Q#S-ZZ(N Kg`` =TL ZZ(> @V v%0 Z`Z(صt/m DbÌZZ(G 64b0fa  (h1V3@V;u-a`(x1  ^# t1D F<(x<Dd^@V ~+L ( @(86 \ݳX 859 jj((@;?Mz-rz`jj(,(? `z("ο`| ޟ zz(86b#  ;K  O(@VT}V-` OO(8@ #@V 5k # ww(uT"Tah2$  @&("cҺ@_#b`&(!@r K CNܬ9 &(9@_`  ;;C``ӎ(F@D Q ӎ(ϩ@D$*kܬ{ ӎ( }XiMU } ӎ(:`= /[}ӎ(P`¹G[W @ӎ(FTU ӎ(IcT ` ӎ( 'TEJ I} `ӎ(%:TEۚ ӎ(V;8  ӎ(LRVJ S}`ӎ(BU4 W_ ӎ(QTNW8 `_@ӎ(hT9`< i_ӎ(T@ r_`ӎ(T7H {_`ӎ(TgX D ӎ(\ T RT! ӎ(۵`¹N\ _`"ӎ(ۺT={` ! #ӎ(Th `%@ӎ({TVBl &ӎ(xT K!}Wӎ(*۵=a?Ep }'`ӎ(T }9~,ӎ(P`¹ ėj]M~`1 ӎ(P`¹1d W~ 2ӎ(=Uߤ 2ӎ(6-T=] k~`4@ӎ(Tn=z|ӎ(&`Uj !`ӎ(FT 8 "|`ӎ(UT Ɲ1M 2|ӎ(~U-T ? ӎ(UpB|ӎ(U8` RR|`ӎ(U8`K0b|@ӎ(U8` X  ӎ(U89T  W ӎ(U[ T-ų9Qӎ`ӎ(D$P hc`hD(a `wཹGw}hD hD(y `[!-Q`hDhD(U\ڸm,uQ hDhD(DཹY-A 0(Uvh hD@hD(DP~`$ !9Y d (?)#Ttu REd(3C- < b} `(8ܵTJܵTTn-R`(;@V; ޸ *4D ` (ET1Ժ @ SOGh (Tf D t e(@V(T0,/ X@(ݵ@p@޸e K `(W ԺWthmQ `(D`(ŏ@bilq-`(VR`B% D - (uԷ D>f @ j34  (ӷT(T :P3`(̵TD`¹  c  (ܵTݵT ֒ )`@(o##Du\- (@VH@V lfY # (jTT b$ i<``( #TT A, .# (.TeT 4 e (TT ȃTt (1ԺT(T mc - (TmT ~\ @(jTmT  = (^TST^p׋7, (FB޵`޸ ^IPǒ `( GB޵`޸ " (Q, RB޵`޸ 1V\`   (ȼGB޵`޸ bZƈ (5ַ IB޵`޸ ~Jj (ݒIB޵`޸  7]ڣ @(,ֺ JB޵`޸ F9 (`JB޵`޸ L`(JB޵`޸ V?Q`($`BȻ`K'k, (KB޵`޸ w8Vj (j LB޵`޸ (kj(jLB޵`޸ ( (k KB޵`޸ g*k @( _`޸ L`(@B޵`޸ m(zֺLB޵`޸ bk``([ MB޵`޸ ]žX(~k`MB޵`޸ f3J` (`IB޵`޸ M-H(IB޵`޸ Sl6(x޵ NB޵`޸ fr}@([`PB޵`޸ H0K ( PB޵`޸  SM`(PB޵`޸ m `(, QB޵`޸ F(,QB޵`޸ : (ֺ`QB޵`޸ 5f (#GB޵`޸ L=`(;QB޵`޸ p@(MB޵`޸ % (`NB޵`޸  Kg (`R `޸ ɦA-`(:RB޵`޸ _(kRB޵`޸ ~` (W SB޵`޸ ppW(ֺ`SB޵`޸ ZG=(=SB޵`޸ o-`@(|OB޵`޸ * J( OB޵`޸ fPҽ (޵HB޵`޸ ޝ `(<`TB޵`޸ <`!(޵HB޵`޸ k=! (޵ TB޵`޸ JM*^!(޵SB޵`޸ xX^ ``(%T# /  "`@`(b#$  ۸  8`"``(9P@Ve#  q^ (T_2c #`(-UEU"W׺(1K V0T> $ (EZ&U E S`$(5>HZh2$׺(#$׺@(#JU ?&6׺({  6@׺({  $`׺`(`  $v׺(#`  | 82%׺ ( 3` ~U8 &5 (9U t&9@ 77(#k .D7@7(F_ ˅Lt '7(k @w0 ַ(J`M` -$`$(VVϣM-p ˉ(d#@V4&-@3 3(#@U{U.76T e( `iSV~`6$$(_z2 ~b j@j(#l ijj(F_Ju#-`*(@X@V@<ĝD --`-(z#``4 ![u? 0B(; ~"`rMp2 4H H(U.@T\.@Tvm`4HH(4h8 #g-6HH(@V"@V ,aE@ 8H@H("TsDlül(bT?)#mWn( ?(Ҵ@V@Do@``?(@Vہ` :P :??(0G@VT4,HV? ?(.ļ@V00{D?(秴@K!U/[(?(秴@'UC;;Pc@?(秴@˂Tݠ#2 ?(#UUW-V ?(#UU8Qo12 =`?(xU|U$ \(҂`>X<X<( F*.G`. X<(3@@ 5Ld8<>'غ'(@B@k ˬ-TM BII (X`}X@f'}-MFI@I (l BBtb-A`GII (@A2A7BB+-XGxx (V]@lmv:bT `(!@.H@.  UF8(9un|-G0 (crmu%j-0(crmu 8%x9 (7u+ `w1N@(7u}-8`(crmޟ@vm y(҄X >-pN`(wAv ^O (./`UFC:Q`P  (./ FUFk-O`Q (#ttw (5@x~+t Ÿ-(`R@ (t @lGHb  (@Vy~K>NN ( h`%w2\p `N (K{Xdg-I TNN (MD N  o =d-f`TN N (N Kg`` 5-ƨTNN (MD N  e[$NN (` 8P-- X@(9Uh1U 7ڌ`Z(x8Ud /H;r (U+`-M[@ö`(@H %@V uq0P,@#ö(nNPH@zC | |(``0A ēX@`\(%T"TE\11(T ; rP#]@(uT"T5y$pE^22(eU!@U:2- 22([UU ԗ@3ۺ`3(T& EJx[@ fQ(!TM,< afQ fQ(!@V*` x852ԩԩ(@qN@ZۺZ(:`CkDm @(;Tb#r;-"`e(i@ w {6?( (AU 1@ `(UI (7I (8` }@G-f  (" 3:@|9-2g("`3:|x-F }@}(1xinp }}(1 *p } }(1lX2O` O (1_`g  <O O ( _ ( 8h`/ / (1F ̮" (:`o#A iF (qKXlN/-8k@ (9Uh1U13` (mZe@V @%H) H) (P`״@V Uik` d.(%Tp9 ,"` d.(4״ p  a2l d.(%TpsV#  d.(4״ ~" LBd. d.(0Y -0@ @U(UI@&olJ-Q (״@Vc@VX(' (;Tb#fWw-oP`P (`#`0@ -B ܱY`rNλN(j7|X&qrNλ N(X!`t: (Rf2s OoPq : (;" @ s'h3t:@: (XpF: (;" `LDDй: (;" 0,bpgl`: (;"  69(qv: (RfMK S#8$w: : (IػT -@x;; (C@  . lT*y(5@V'X 㿆 {@(`j/`,"X-S(>@ID 8_kl( (`A" Ip "`(I RŇ4tr"(I ~3!Xr`# (I Xr$(I E<=TX$(I DYX@%@(I X%(I ;}?X&(I X '`(I `_X'(I №X`( (I YX')(I X-@ID +DҊ`@(w^ /(Vc@V j-~(e (:`  &[}:r`:_(>ȶTYTk-g_  (@U /0#  (`-UHHQx6`  ((C;$kK@0H  (JNT i$L8.@ ( ۻ$138s@/ ( ۻ$i[83s/@@ ( ۻ NXJ1`2`(#l#q4QQ (3_h 44s8`Q Q ( _@ KHm0 `<g(=X0Tj@ @+..(g1@" @,.@ .(g`1@ @-. .(g1@4G @..!.(g1@wʆ 4W`!(`@XA%>7x0!x0(jjV*struct { F uintptr; X0 *func(go.shape.*uint8); X1 *go.shape.*uint8; X2 *[11]uintptr }8t Z"Z(;JXM# I Z"Z(;tJXl!d9Z@#Z(;EJX{s,f-#g(#uuJдh?=$g(`LT UEr`$Er(T"K Er$Er(;@  Ph Er %g(T ;`¹V*func(context.Context, *x509.CertificateRequest) (*certmagic.IssuedCertificate, error)V*[]acl.compiledRule[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound] I9@& (u.7D@DLDgc!` @2H&H ( 6@VH)R ' (l*`"  |>`'g(uQ7D@DLD;$#w"@@[[ r)9|-`;` :g( y ya>Z-i ; TTw"@<XP-G`p = <=$#w"@=$=WE,9Rp =<=;;h;(9 q =<=RU@;̩;̩;O$9(q =@==1r@;,;,;s9(q ===RU@;;;]9 @r =>=RU@;p;p;q,9|-s Er`>ErW# GGr9|-J@x Er>ErV xvLxvL`-y Er ?Er25W# (NL-y Er?Erb# N,LoI9|-> z Er?Er` xzLxzL`)[9|-U@ Er@@Er`TTMTMy9|-F] Er@Er W# dKdKy쉳- AErP;5W# NLN-~] Er`AEr$#w"@N0N Н-+@ ErAEr25D @NI{- B W]Qag8ugA],.| B4 7Tw"@Jg9,.@ B4 2Tw"@J>b|- @C4 9@Vw"@ 1B|- Clм@Vw"@ [ [Y٣`- DlRTw"@[[{MH-'@ `DlRTw"@[[nN9|-߱ EDE `-* EcEF `a-$ EFTw"@48$-i EFTw"@HPD31T#~330@p3p3h԰9|-k zFz> BBY-@ GzP;5W# LDBCB ^-  `Gw#w"@D`CVO9|-e QGQ+ ( ԉDԉD0}|-b H&9@w"@ y;^-nK` H=Tw"@Q9Qa9- H=Tw"@|Qh:QrW- @IuTPRصQ2Qj Y@I?c m7@,*u@rA=J?pGm7@*ur.1e-n ?`J?$#w"@d-u,u%-xJx<6 [<[- K./:@Z`_ "^  K;@4`- K./;@Ll 2@LQ @`$T42خrLQ $ ` TTMQ .b`bh?9|-n x0`Mx0">"@@n!@n!Z*func(*sync.entry[interface {},interface {}], *sync.entry[interface {},interface {}]) boolZ*func(*sync.indirect[interface {},interface {}]) *sync.indirect[interface {},interface {}]Z*struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } }Z*map[uint16]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) }Z*struct { F uintptr; X0 *struct { f func(); once sync.Once; valid bool; p interface {} } }Z*func(*unique.indirect[net/netip.addrDetail], *unique.indirect[net/netip.addrDetail]) boolZ*map[protocol.StreamID]quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream]Z*struct { F uintptr; X0 chan struct {}; X1 func(time.Duration, uint32, bool); X2 *uint32 }Z*struct { F uintptr; X0 *unsafeheader.Slice; X1 uintptr; X2 *abi.Type; X3 unsafe.Pointer }Z*func(context.Context, netip.AddrPort, network.PacketConn, *buf.Buffer, metadata.Metadata)Z*func(context.Context, *govultr.SnapshotURLReq) (*govultr.Snapshot, *http.Response, error)Z*func() go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool }[*struct { F uintptr; X0 *http.http2ClientConn; X1 *error; X2 *[8]uint8; X3 chan struct {} }[*acl.compiledRuleSetImpl[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound][*func(context.Context, string) ([]govultr.DatabaseDB, *govultr.Meta, *http.Response, error)[*func(context.Context, *govultr.ReservedIPReq) (*govultr.ReservedIP, *http.Response, error)\*[]struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } }\*struct { F uintptr; X0 *func(go.shape.struct {}); X1 *go.shape.struct {}; X2 *[11]uintptr }\*map[*pflag.Flag]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)\*func() []acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]\*struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }\*func(*edwards25519.Scalar, *edwards25519.Scalar, *edwards25519.Scalar) *edwards25519.Scalar]*[8]struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } }]*struct { F uintptr; X0 *socks5.Server; X1 *net.UDPConn; X2 client.HyUDPConn; X3 chan error }]*func(utils.ByteInterval) *tree.Btree[github.com/apernet/quic-go/internal/utils.ByteInterval]]*struct { F uintptr; X0 *certmagic.httpSolver; X1 context.Context; X2 *certmagic.solverInfo }]*struct { F uintptr; X0 *tun.System; X1 net.Conn; X2 *tun.TCPSession; X3 metadata.Socksaddr }]*func(context.Context, *govultr.DatabaseCreateReq) (*govultr.Database, *http.Response, error)]*func(context.Context, string) ([]govultr.DatabaseUser, *govultr.Meta, *http.Response, error)]*func(context.Context, *govultr.InstanceCreateReq) (*govultr.Instance, *http.Response, error)zL--:.X0;6J V6K @K K Ix|-eZ0@W+y*1h;h"j-T8Y0 ` $`W# 1 Tj-iw"@R'D}%hS'}%LS'}%JQWg-H^Er^#N8I N8I-V7-| `^Er# NTNIQ$NMIV-8-|^Er# 0NhGIQNGI-@@ _Erw"@`xNxHM`xNhH;[-_Er^#lyNt8I yN8IL,-_Er`TNXM01`ЄNhM\-C g@`g0` Rj9#  =U-og`g0oB ^ |gC )[+-EaE0`J Kg` \-jw`aw0Q SF`  K` ,V(-B *a*0 %%@7#- `* b*0^# N  &]-O X۶bX0(~0@7@b-Jb ;` l*O%O: +O( O- @cr5 ;` *Q)Q: +Q'QXc-cG ;` |zRyR: {RyR"-dH ;` TT: T,T݀-@`d3H ;` l~X}X: xX }XZ?|&-Gz d0^# W# ] g!y-6Z eZ0^` `ŭ-UZeZ0iNxN E8Z@-Y8eZ^ LԗjBg8C LPjBg@5-@fZw"@jhp04j h9- 9f90"P #`W# -Шzgz0^# 4N @N V)-`g0@ [ @ "@[ ?-g04@b 1 Xb  jN-:`%׺ h0;6j V6j k @k T-Khw"@hרp0بo,.M qI i@|:|)"|-I d.leu@lqHqp7@mq qO5,@U`K@5.h Xӽ|- ` _`$0@`#`aA |-^9]!0@$r{-\ @r]@ Tc@c0@cdc(U-qr]@ pcLc0@cpc?-{s]@ $cc0@cԦc"p-\0@`s]@ `cԕc0@cc=-(s(0" #`W# -Pϻ tP0" #`W# k-1`;t;0" #`W# ^*struct { F uintptr; X0 *udphop.UDPHopAddr; X1 *cmd.clientConfig; X2 *sockopts.SocketOptions } (جT0u0ʶXUW)TUķTf Hju Vm Vw 4wu Vm 8x,T Pv V@TTԟaXtv V  RCT[w V׻T lw;pw VݻTD:G`jw VT @O]iw0x V@ B1>x V@ '.vXhx V` X Py V`BͿο [" c̮$' `gyA`$X>rcJTAz V>\ U6X;pz V@> ^*func(*sync.node[*internal/abi.Type,interface {}]) *sync.node[*internal/abi.Type,interface {}] FXS0{ V@ 'JX!{ V@ yĮ@ { V ע`( P| VJdl | VJ X(} Vm@ @ع* \p} Vm @~  \} V@ mG9W0~ V8 ޹7t`]~ V- _X0~ V @r 9X QP V`B@ ${X? V_ pX V D -$Xp V % >`HЀ V}\T6D0 V@` E X V` TK[0 V\  TP V  l,Tk V  D`r $ T1^ V !>\ jX7p V Yhj mZ``VЃ V\ O;+` 0 V \\>$86T̵TT2o@V%!Įrs V11 {e*XP V * FeX5 V + XP V A ,zXp V   HG8XxІ V@  iAt 10 V@VV 9y V  `XE V ෽ `(XKNP V@ XY V`B Dz  h  V@V Q֧p V\ƉMЉ Vdm tX90 VkRt ?0=X. V@vN X<yX=#u 6|-eXZ0@W+W+1h;hAY,2c1Zܴ`Z4 vL`߻L@qF<L`4Z4> =<l`3`Z4rc {I ,c=\LD T@ 5Z4gRF=ݷ( =04H =`4$SԲT$T \W=4$cb#MпS{ 6|- 6$ m 6 $$r `4/1"$XV 6|-4Xw"@IILIIp0II'A 6|-LM `W#`tt6Rq 6|-2@YNf`O`TNTN 8IT08F``49@V3t4`Y: 6|-ʌ:%``  y0~EmL`mL4k%VHVykV@c N`FmLmL4`T Tߴ @ |-M@mLkk OեFmLmL4a OV UV=#mL`mL4 $m0#mLmL4IV&VV > 6|-f]mLTP ]P' 6|-1mLL؎؎%tt$0`{mL`mL4 @_ 617f`mLmL4mVHVDe=,mL`mL4 gMI`5 6|-f amLBa@ rr\r\r"@|r|rq_ 6|-mL5( 6|-wCmL w"@t t z `0 0 a07w PmL`mL4^ mM 6|-WmLYQ`m]-tQ{N mL`mL4yZ 7VtQ@X D<%&4$mLmL4 @X'X&\ "0r SmL`mL4%VVV.>T`~Q47TT# kXsP R`R4RT1#g`(Tl  RR4@nP@V$R#(|/^ 6|- R R@zzD@O {{1,r,r$ \@RR4;TYUn@V UBU R`R48# p8`¹E<h2R (R(R4@V{`R ,0>`(R4U"@U7@U ^0W(R4K@V8@V@V KF:0bX`(R4LR1R@UxB|ZOO4uT5@V'X Jr 6|-XH`::q p:p:+$:$: rX @H`:9q p:p9+$:9WP 6|-)'p^#[[[[W# [[y,Z 4a h7 P T oґ 6|-Z$`|[|[`L|[L|[w!}[}[ ?v8P ^4ʺ@V@VѶ4\\d `4@U׿pǾ  6s`_ @X 4:mLX kIxY(`X 4pm:TS`$%C 6|-VT x1pp pp^#hphp320y' _l`l 4x3U` 6|-k i6L8pL8pil9pl9p ? *]0k` 4!< @ AP @7[\ Q 4pmLS%! ` 4LTT# Af]<   4qTqTX 6|-]< q0@h(yh(y#q@,,_W,04ڔ`,, 4_ڴ@<lڴclc5> 6|-Y` 9^# ~o ~o_T ,zo,zo ({o({om2[ ,A,A4T@- (@ 6|-2[,Ad  $肐(  4P@D) TT" 6|-( iM@  0@(($Ws 6|-=~`3q@ZZ0@̂ẐZ@ZZ< 6|-~;39 xYxY84 nYnYk=GrYrY;Y 6|-ݪ`3`\Y\Y83PYPY1̜Y̜YDD4DQ`Q49;$ ,Cjc0Zn 6|-u`XQw"@!!p!p!L!!OX` =`=47 #ԻTb 6|-8]=7UJ==F)KL=L=0@==@7S̮?`=`=4; rV@Uݿ,(`l==4N@ݿ T@ݿj 6|-L>@H=: BD<D<[>XH<XH<ȔG<G<E 6|-qErFFë`8F8Fk$F$F е? pEr`Er4;T%Xi)X  6|-} JErQ V3Uk- 6|-?>uErO`\F\F[)TFTFW# FF`\ qErEr4A(b#qs`eS.{`qEr`Er4<t`b#) ErEr4<5@U - 6|- sErW'  H ErEr4{sU>Xp 6|-Er0@IIII# JIJIQJIJIq 6|-.\TEr# PIPIQPIPIhTIhTIP? 6|-@tEr^#`vNvN`,F,F`vNvNO 6|-S@MEr^#MM MM< K 6|-`ZEr^#zNzN {N {NM {N{N  `ErEr4D00>R`X6X6 yH`4 4@D@D #8 4 4cTU mVZ 6|-iA4  ߛߛ DDXݛݛ%HL~4 4T:@w. ̝; 6|-`4  lślś ƛƛXI6 6|-ń4   4pp,} 6|-A4 ^#ddgi] M] (e:  4=<ADB 6|-p {i| | +L L )  V:p @ {i|  +L )  iD`V&`&4D@V v^b|D@&&4;YU n@V o*C_0D`t4# P8 t41@sX@$h% 6|- M    ̶^| 6|-ȱ@^#  M p 6|-s`fgi   W# D X X ] 6|-"q^#| | bj  W#  6|-@g`2 2 K<3 <3 01`3 3 qh</gg4yڴmsaP 6|-`gXF F X@G @G #v(D (D mgg46#{U^{ 6|-fg`, , 4`+ + `* * gg4S @PW E`E4@1ȉ@VX@V %P. 6|-3gE`xx`#@@ V 6|-I`hE`hh`||#r`>_ ´4XXX| 6|-_`\/(\/(XX`3(3(X`l/(l/(Xp>/ %%4h>@V@qU@q8 M 6|-@%``#ڒ 6|-%`PP```#0 0 {(´`(4;qYT}TgH 4uTX ,E ڴ`4U`&}, 6|-b@w` \\,\\,q`2 6|-/w` p],p],q`u~U 6|-`Vu"] ((~" 6|-.@@@@L 6|-b`lw"XX*/" XXLLM<@`4@V@q5D80p 47T'Y@ƿ" DX`F`F40Y` 4[ 4׽>`vv4ij*@V BY@V H!0ٟ`4),/{Ȭ h4@!X "$!`h4jRcc``;i@ h4ܴ@XI c=;TF`*4LTT# M 6|-F *w"@Lp0d`{̱Y VK` VK4\/XHo\VK VK4n`t x ca_lVK` VK4n<@V`spr VK VK4@X@X% eԙ(2`` Z4xU|U?U ː0  Z4xU|U?U)GY` Z4  @Vp( 6|-ܲ@H4i@ w&y 6|-"H4i@ wBm 6|-YoGw"@< <   LL!L!f^- 6|-GGw"@iiiiLii Z 0@GG4@V@V@Vk8-G@G`G4#VL+US+U +V 4#@@X$J| `H`t`4kZU +xU"0(?624DK` MK`$ 0` `4%`+9V0(y2q@4DK` x;`$[E`46@"Uq 46@"VU 6|-YO+ 7 6|-bX~N6N60@O6O67@|O6|O6؀ 6|-2bX~ I6 I60@I6I67@I6I6r 6|- 3cX~C6C60@ D6 D67@D6D6& 6|-3@cX~=6=60@>6>67@h>6h>6>O 6|-<cX~P86P860@86867@8686ya# 6|-RaX~`#6`#60@)6)67@)6)6m 6|-BX~P6P60@667@66Y 6|-N`X~660@ 6 67@ 6 6^9-a 6|-13cX~@5@50@557@55 6|- X~550@Tk6Tk67@55 6|-E3@?X~550@557@55F 6|-s?X~Į5Į50@P5P57@Ȱ5Ȱ5  6|-NdX~550@557@l5l5;.s 6|-1@dX~Ђ5Ђ50@t5t57@X5X5ɡ 6|-DdX~l5l50@|m5|m57@`m5`m5d 6|-WdX~@g5@g50@g5g57@g5g5pyO 6|->eX~a5a50@pb5pb57@Tb5Tb511 6|-X~[5[50@[5[57@h\5h\5D 6|-XZ@eX~PB5PB50@B5B57@B5B56b 6|-mZeX~P+5P+50@,5,57@+5+5Xrn 6|-eX~440@H4H47@,4,4t~x 6|-X~Ğ4Ğ40@j6j67@44$; 6|-@X~440@i6i67@44q$ 6|-j@fX~440@447@44$U4`¹A`¹ (`¹m 6|-Y5 ;` lQlQ: pQpQ@_M 6|- ;` oRoR: iRiR@wlK 6|-@1X@33~@3@30@(3(3}N 6|-[@g1X@t3t3~330@33N 6|-!4g1X@33~В3В30@33љ 6|-g1X@D3D3~330@33 6|-h1X@Ԑ3Ԑ3~330@D3D3qh& 6|-@h1X@(3(3~p3p30@33# 6|-"h1X@33~330@33 6|-uh1X@܈3܈3~$3$30@D3D3,] 6|-[1(33~330@,3,3jyM8  z%z4AU{@*,h2[ z`&z4@V{`tqL  z&z4VTT{`v :0`'z47U:,UA,U S:0ִ 'z47UzU;U @߶X 8]4 z`(z4$@V8{`w 0 4\ q4` z(z4AT%T{\,d `)z4x8U1R@Uػ 50K`)z4LR1R@U) b `*4T=zTMK'J2 6|-tM~`xx' ,1x,1xu<|/x|/xDD*#d< `+43yyȴc0 cOvEy+y4@K@XHD @M5`,y4nT3**(TO, 4 \X $`- 4cTb)U e 6|-b `jjph8j8j`jj+X 6|- Z"`Hdd,eR 04.Z4 XXXc_ 6|-ZP@ ZgZgHhghg^,jg,jg,((]|`Z/Z4q]G ‘ l`0Z4crmޟ@v:Xu,a@Z0Z4+']u] % 6|-lZ^#ugug,qgqgBsgsg [(Ɋ Z1Z4G `E{w`( Z`2Z41Bx@1Rx _ 6|-x Zx1 4 h4 h (!h(!h^# h h@y 6|-_Zx1 !h!h "h"h^#8"h8"h0&j3 3Z4yV>_@ 6|-GZIjj7Ijj3 DjDj qz D 4Z4I7I3ٽ fZ0DZ`5Z4M8L \5E Z5Z4]ȸ鉴ȸ^b8 Z`6Z4D$\UE^.{ 6|-@ZGP`ddܕdܕdB\W7Z`7Z4Q0:E8ʴ gш 6|-W 7ZGP`̕d̕dddލ6 6|-%Zw"@8i8i4d9id9ip07i7i f< Z8Z4]ȸ鉴ȸ^ &=4[`~I^ $ld 6|-T=^#EmEm DDmDDm`EmEm @T 7>4, `ϸ@VzXpCY?j`?j4@V@V" 6|-Y ?j,ܦܦ(?x T z`@z425;|TE|t z@z4h 2XP#  @ O`AO4`DȬ A]94$`# Xn 6|-q9w|DDDD0@`D`D X 6|-wb`wW&CC*`hChC@6j 6|-C hR  DZDDZD@`\VD\VDOYDYD, 6|-^FyF,x=ܬd`D&4`%@V6 < 6|- chӎ!2C$ xmv ̮`Eӎ4!_U&eT$ { ( Eӎ4T T$ xC (`Fӎ4LRT$̴T JÅ$ ̮<_`Fӎ40̴U烷T$^̮} `Gӎ40̴UI @D 4( }Gӎ40̴UV R=0 ̮N_``Hӎ40̴UT$ 7D (< Hӎ4='TW'T L ̮_`Iӎ40̴UĺT jT } Iӎ40̴UDV( (#`Jӎ4T: $ 0| (_)Jӎ4T T &l ̮_*`Kӎ40̴UT 6|-P Lӎ0@}}@ ||X << x PK`Lӎ4T(-U0DU $ o׸ (/Lӎ4ӷT^eT7(2'`Mӎ4ULUh1U o   Mӎ4U?U(X /K Q@`Nӎ4U=-U~U 6|-| Oӎ`ddq 蚐蚐+ xy|Nӎ`dq 蚐+2cOhD4g A#@V xD@V dhD`PhD489`-X@V ${{Y=}hDPhD4&p7 3 P -K UhD`QhD4UX@Vz5c 6|- mhD(&j>j>b=z/K 6|-0d w"@NN`3NNPUpwpw 6|- Ed A #x%x% 8 8 IUb X Ed`SEd4N\ "T $ٍ7S4xFG F`¹T ]`T4@TTT X  T4@TTT:GK U`U4TLD@V@V Ͼ(  U4y)TETVT W g `V4نWe@VW ; 6`V4W,e@VWF `W4ܵ VIV }Z 0 W4섷TiTT !S90r`X4ݵ@Vg@V}@VV* g X4\T@VT )L0)H`Y4; D# D; DAA A<Y4uշT(TT$eV g`Z4uշTǻTTr0 `Z4TTTˠP f#``[4堻TCTDTQU>`\ [4̵T̷T+ D*sl  `\4TTWTyTbr RI\4^T^TշTA+(`]4Uַ`KB޵`޸rD]44 HR`H B޵`޸~ 6|- `"vvW# luluu 6|-q a` X` 1h`r[`_Y4 4dδXdoXeܢdt 6|-HLgS 6|-J:~$LǤǤ['X h 5`5 4`bߵ ` P9 ַ`a4J`M` D`@ 0 `ַa4JMD U(70/ַ`b4JMD /0Uַb4JMD8AES$`c$4#T`,Fa@V4p4 6|-W#"ذذٰٰdٰdٰ @'ˉ`dˉ42dGVQU 6|-`P4`@]`{ 6|-6T@5} **@`))(4l&l&@u5 %`)e4V'V4X  rET `f41@̿ ̥0h *f4@X@V@V@N04`+Z`gZ4wXaXTϴX++n 6|-pi h`4#Q4#Qq #Q#Q+%Q%Q 7Xpig`4#QعPq #QP+%QP' 6|-@IBghThT0@tTtT84 SS )p4a?/B`iB4XɦX_T uB*0>/iB4T"`R iܬH'`B`jB4SXbet | 6|-CV kH`xXxXq DyXDyX+yXyX ^XrCVj`H`xX|Xq DyXX+yXX 60 2HkH4$@V@VC@Vphr 6|-?HaV'B'ߧK 5HlH4F$@V SkY@`m?4秴@r{`lS#9`m?4秴@rsMW`n?4秴@G@V\)@k/ 6|-?" uuJ|s|s0@ss91* 6|-`'@.v.v] +v+v< /v /v"hȰ p'غo'4di[@XH. 6|-o'@/v/v] H/vH/v<8/v8/vTTPLm₵p4a@ػ @b#Lȧ, 6|-MhI i@f>q Tg>Tg>+h>h>fD/>- `fQ4g #@V xD@V 6|-ܲi@՚՚ w {1N 6|-i@ w {< 6|-AB@i@DD w {FMb 6|-i@`` w {Y 6|-i@88 w {U 6|-(i@ll w {+#| 6|-i@ĚĚ w { 6|-"`i@T֚T֚ w {!I 6|-i@ʚʚ w {;j 6|-i@TٚTٚ w {(y 6|- i@ w { r3g04Pe` 4XXGŶX =~ 0AF }}41JM,,bu/ `/ 41!F`(((P_/ / 41.J M$00aΩ^@/ `/ 41.! F,Y 6|-/ "`cc3EE:|PaPa<DP / `/ 41 / p/ plz 6|-r`LQ i@4eO4eO:aOaO`u 6|-\ Q !_|bO|bO:,bO,bO` o2'`k4Y@V2.@V"X ` `4ūRT `¹P 6|-iF hI>@@?BB ʱJ3s J! 4ۻ@H H % 6|-3s ʭ ?ppq|0 6|-s@9 "?_0=IIl`l 4F0`M0`8`p- 6|-I l e"~~k"`}} `||߫ܬI<`< 4@bql 6|-s 3. ʭ ?HנHנ (z5bJs3.`3. 4ۻ@G G >: 6|-s ! ʭ ''? Js!`! 4ۻG H ʪ> 6|-s J! ʭ nn?XcXc BrJsJ!`J! 4ۻ@H H 2, 6|-s9 "?hhCÑ03ڴ`4ӻ@Xv4s ڴ4Ի@Xr[̿8ڴ`4Ի@X-<H ڴ4ջ@Xb*struct { F uintptr; X0 *tls.weakCertCache; X1 []uint8; X2 weak.Pointer[crypto/x509.Certificate] }b*struct { F uintptr; X0 *func(go.shape.interface {}); X1 *go.shape.interface {}; X2 *[11]uintptr }$ ڴ 4@XsA !ڴ4`@XL y 6|-@3## gKL !ڴ4 @Xф0 "ڴ 4`@XjH~"ڴ4@X Qc`ڴ 4@X}B ڴ4@X|Aڴ 4 @X(\P4L #ڴ4 @X$[ 6|-x0## g`jH1 #ڴ4 @Xo P0 $ڴ 4 @X pz $x0x04@V`wA# %ڴ 4 @X0<y %ڴ4 @Xg 6|-E @3##`g1:p &ڴ4` @X =P/ڴ 4 @X@ڴ4 @X.(," ڴ 4@X2HV0ڴ4 @X Kux0 x04`@Vѹ[<ڴ4@Xb*map.group[*pflag.Flag]func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective)pɈ 6|-u@( xxwTxTx}xx.  4@/ ;@ڹ@Vq6P 'ڴ4`>@XU2 'ڴ4>@XU)\N$d (ڴ4@@XmS 6|-K $ErWs!"#d`g4cTb)U  j08 `jj4#lg M0p jj4#lg` 0 jj4#lg xt0]7Gg4@V@V@V$jfK ̬"к4y"sWUcx 6|-(=xxxxw=@x@x}=xx$\{w ̬,%к4+"EWUSh@xx 4tZ`*ȴս{txx 4tZ*ȴս$NxW@3xx 4P`Pݶ@Vuw9<(,xx 4෽Z`,ȴֽ `-xx 4෽Z -ȴֽ$e8<-xx 4P`Pݶ@Vuwb*func(*qerr.ApplicationError, protocol.ByteCount, protocol.Version) (*quic.coalescedPacket, error)P$ 0U `+ڴ4`@Xb*func(context.Context, *govultr.BareMetalCreate) (*govultr.BareMetalServer, *http.Response, error)b*func(context.Context, *govultr.BlockStorageCreate) (*govultr.BlockStorage, *http.Response, error)b*func(context.Context, string, *govultr.DatabaseVersionUpgradeReq) (string, *http.Response, error)b*func(context.Context, *govultr.ListOptions) ([]govultr.ISO, *govultr.Meta, *http.Response, error)b*func(context.Context, *govultr.ReservedIPConvertReq) (*govultr.ReservedIP, *http.Response, error)b*func(context.Context, *govultr.ListOptions) ([]govultr.VPC, *govultr.Meta, *http.Response, error)b*struct { F uintptr; X0 protoreflect.FieldDescriptor; X1 protoreflect.Map; X2 proto.mergeOptions }04<g4XXGŶXR_`,ڴ4 @Xb*struct { F uintptr; X0 func(impl.pointer) (impl.pointer, *impl.coderFieldInfo); X1 reflect.Type }b*struct { F uintptr; X0 prototext.encoder; X1 string; X2 *error; X3 protoreflect.FieldDescriptor }c*func(context.Context, *oauth2.DeviceAuthResponse, ...oauth2.AuthCodeOption) (*oauth2.Token, error)c*func(context.Context, string, *govultr.DatabaseForkReq) (*govultr.Database, *http.Response, error)c*func(context.Context, *govultr.ListOptions) ([]govultr.User, *govultr.Meta, *http.Response, error)c*func(context.Context, *govultr.ListOptions) ([]govultr.VPC2, *govultr.Meta, *http.Response, error)c*struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }c*func(protocol.ByteCount, monotime.Time, []congestion.AckedPacketInfo, []congestion.LostPacketInfo)c*struct { F uintptr; X0 net.Addr; X1 net.Addr; X2 func(*tls.ClientHelloInfo) (*tls.Config, error) }c*struct { F uintptr; X0 *sync.Once; X1 protoreflect.FieldDescriptor; X2 *protoreflect.MessageType }d*func(*sync.node[*internal/abi.Type,interface {}], *sync.node[*internal/abi.Type,interface {}]) boold*struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream] }d*struct { f func() go.shape.bool; once sync.Once; valid bool; p interface {}; result go.shape.bool }d*struct { F uintptr; X0 *int; X1 *bool; X2 *parse.RangeNode; X3 func(reflect.Value, reflect.Value) }d*cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]d*struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }e*struct { F uintptr; X0 *http.http2clientStream; X1 *http.Request; X2 func(*http.http2clientStream) }e*struct { AutoAdded bool "json:\"auto_added,omitempty\""; Source string "json:\"source,omitempty\"" }e*func(context.Context, *govultr.ListOptions) ([]govultr.Backup, *govultr.Meta, *http.Response, error)e*func(context.Context, string, *govultr.DatabaseUpdateReq) (*govultr.Database, *http.Response, error)e*func(context.Context, *govultr.ListOptions) ([]govultr.Domain, *govultr.Meta, *http.Response, error)e*func(context.Context, string, *govultr.InstanceUpdateReq) (*govultr.Instance, *http.Response, error)e*func(context.Context, *govultr.ListOptions) ([]govultr.Region, *govultr.Meta, *http.Response, error)e*func(context.Context, *govultr.ListOptions) ([]govultr.SSHKey, *govultr.Meta, *http.Response, error)e*func(congestion.ByteCount, monotime.Time, []congestion.AckedPacketInfo, []congestion.LostPacketInfo)֜-+8`J Kg` ` 0)L@ `Z(ڴ`cTw"@dX+) 9dF (3Ti $KG <`<(|TTw"@ȫ! ! 0#K mLmL($U ,7@;8`O mL`mL((7Tx6w"@ 30O mLmL(xV5Vo` cf0-:\hѶ`h8'(,w",,.(,q, G/u V hѶh(uTTw"@Y\XG-< d3`38( S3} GW# s9r ==((@[U@;;Սe-=lEr`Er8O@@OR`.-nErEr8D` 1)@U `rR@ ? { Er`Er([@VKTw"@N'Ka&-vErEr8^# N @N   k 4G` `Er((2Tw"@NE k@` 0(TTw"@cup23A `4 (XXw"@Sg- 8oB ^ |gC ) <tW `l(~"T2Tw"@x[t[|S\-8`8`#``W#  `X(P@D+s 0@Tk685    (T Ǵ`@nt-``8^# X W# ] #-t ZZ8! L4IbI3 -U`Z`Z8 H ^ # Z # M⋎9@ QQ(@DT ( ԏDDD4"-`ӎ`ӎ8HA@0@G T5 :0-WQhDhD8"}Q`$  Z 0d R`(Tg- PUpwlvs-̢`84a 1 [ Xa @ B@ .>g-{ `84 1 X b B@ R`-e84@ 1 X c d Fh-  `84 1 X f B [ V-,84@ R 1 X h ]7-`84 1 X@ h B@ #2p-л84 1 X i B p -Y``84 1 X@ @i B 1w-f 84 1 X i B [ fZ54- %׺`8`J Kg` `=-!9??8; :"x8`0@5-9?`?8; :" 0@7`6θ-CII 8*@GX`}X@fDjBE-sDI`I 8G@aX`}X@fs- (ttpdtt,^s] =08w ` (t H`-P 8M`~ +K rn N- [` `(h1@VW@V;@_0,Ë_X (yy;@_j Vv `(C tPߵ t ;@J` 6LE 1(%T"T|Xll2@ `( }h1T0@D臚e[-`g  8"m3 >+:@| KM`.`Q (#`o)T` t~@Q (w`K邴c`SN-V.ld.`d.8x u@(/`p7@f*func(*tls.Config, *tls.clientHelloMsg, *x509.Certificate) ([]uint8, *tls.clientKeyExchangeMsg, error)=9 @(@X"`Dm3_3+- gg8`#``W# f*func(*sync.entry[*internal/abi.Type,interface {}], *sync.entry[*internal/abi.Type,interface {}]) boolf*func(*sync.indirect[*internal/abi.Type,interface {}]) *sync.indirect[*internal/abi.Type,interface {}]?<š (@X"`o!g!f*[]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream] }f*struct { F uintptr; X0 chan struct {}; X1 *error; X2 *http.Request; X3 net.Conn; X4 **http.Response }f*struct { F uintptr; X0 *outbounds.dohResolver; X1 *outbounds.AddrEx; X2 chan outbounds.lookupResult }z@μ0,@ (n@X"`,(ȲڄDT  (o@X"-L2*f*struct { F uintptr; X0 chan struct {}; X1 *http.Request; X2 *http3.RequestStream; X3 chan struct {} }f*func(context.Context, *govultr.ListOptions) ([]govultr.History, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Invoice, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Cluster, *govultr.Meta, *http.Response, error)f*func(context.Context, *govultr.ListOptions) ([]govultr.Network, *govultr.Meta, *http.Response, error)f*func(string, string, string, map[string]*parse.Tree, ...map[string]interface {}) (*parse.Tree, error)g*[8]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.Stream] }g*func(time.Duration, func()) interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool }g*struct { F uintptr; X0 *outbounds.directOutbound; X1 net.IP; X2 uint16; X3 chan outbounds.dialResult }g*cache.LruCache[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]g*func(context.Context, string, *govultr.DomainRecordReq) (*govultr.DomainRecord, *http.Response, error)g*func(context.Context, string, *govultr.FirewallRuleReq) (*govultr.FirewallRule, *http.Response, error)g*func(context.Context, *govultr.ListOptions) ([]govultr.Instance, *govultr.Meta, *http.Response, error)g*func(context.Context, *govultr.ListOptions) ([]govultr.Snapshot, *govultr.Meta, *http.Response, error)g*func(wire.FrameType, []uint8, protocol.EncryptionLevel, protocol.Version) (*wire.AckFrame, int, error)g*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 bool; X3 protoreflect.FieldDescriptor }h*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest; X2 *http.http2writeData }h*bbr.packetNumberIndexedQueue[go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899]h*func(protocol.ByteCount, protocol.Version) (ackhandler.StreamFrame, *wire.StreamDataBlockedFrame, bool)h*func(context.Context, *govultr.ListOptions) ([]govultr.PublicISO, *govultr.Meta, *http.Response, error)h*func(context.Context, string, *govultr.ForwardingRule) (*govultr.ForwardingRule, *http.Response, error)h*struct { f func() go.shape.*uint8; once sync.Once; valid bool; p interface {}; result go.shape.*uint8 }h*struct { F uintptr; X0 net.Addr; X1 net.Addr; X2 func(*tls.ClientHelloInfo) (*tls.Certificate, error) }i*struct { F uintptr; X0 <-chan struct {}; X1 func(); X2 *time.Timer; X3 *atomic.Bool; X4 chan struct {} }i*func(context.Context, *govultr.ContainerRegistryReq) (*govultr.ContainerRegistry, *http.Response, error)i*func(context.Context, string, *govultr.DatabaseAddReplicaReq) (*govultr.Database, *http.Response, error)i*func(context.Context, string, *govultr.DatabaseDBCreateReq) (*govultr.DatabaseDB, *http.Response, error)i*func(context.Context, *govultr.DBListOptions) ([]govultr.Database, *govultr.Meta, *http.Response, error)i*func(context.Context, *govultr.ListOptions) ([]govultr.ReservedIP, *govultr.Meta, *http.Response, error)i*func(context.Context, string, *govultr.ReservedIPUpdateReq) (*govultr.ReservedIP, *http.Response, error)Ɇ-rZ#w"@Y+<)p0Z+)-3P;5ZtZW# Z ZI9|-Er Er^#II tHtHF-˰Er Erb# 8N8I(ȟN8I(|-I@Er Er{sU# ȫN[IQTNxZI($|-] ErcrU# NtKIQ8NJI!Gt9|-`Er Er# MIMIQLILI `N0Er Er`# NLIQpN,LIXS(9|-Er Er`gi AMAMW# @M@M5ɥ -? Er Er$#w"@\NNp0NvMrI- Er Erb#w"@NLp0NL-b!-[  #w"@o8Op0p O Þ4,8[ii`<8` d?>W# @?6-y4 #w"@dp0TL3-l#w"@[\[p0[[x-W@l#w"@[[p0[[-Dx<6^# T   h װ9|-bww Yq`ju9|-/ ww Yq`ITq9|-wBOO%w"@z `!93[ %1T#(33~330@33]9|-0ܶ0>X`;d.Yd.Y_-b$#w"@4މ݉p0މl͉xA0T@Zϴ;^T7D77_X7H7}0Zϴ;^87(77_<7,7b0Ç0d Zϴ;^7|77_77R|-U: ph`c_%@-lմT: w`X_%@w`<_`o)-qs t: ANt~#AOd~0@O~IklA-  `t: m\P|~#mPl~0@xQ~|-F@?U]@ cpc0@Hccy|-uI]@ $cc0@cco|-lU]@ cܥc0@gA$X>4#$$Y29g0A@$X>4yOp  VA? D @uxI7ȮU0 V@m W v Vm @ j*struct { f func() json.encoderFunc; once sync.Once; valid bool; p interface {}; result json.encoderFunc } TgA`$X>4@ "T`Mg A$X>4޿WpQ  V?` lX›! V}T {p! V@` л%~4" V\ ͢&" V @DU*`\P# V *V @X W̮g#A$X>4X s""̮`g$A5$X>4B]K$ V`T ~-p% V`B D z40U_,V% V )༸*i R& V`BTX9 CountryCode^protobuf:"bytes,1,opt,name=country_code,json=countryCode,proto3" json:"country_code,omitempty"j*bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]4Btph*p' V` O n1pmz' V D` D LT4  mT ng+A\$X>4  f8TngP,A@\$X>4  EBTog,A\$X>4@  -T@^gP-A`-$X>4E|lH-Ѵ`h6 6 6c.oZ\`P. V`B@V! ! (̮g.A`{$X>4  [Si9̮UgP/A{$X>4 6A$ / V`m`m@V @VLQpTP0 V`B? H8aL80 V¿ `XDLL6NKPNP1 V¿ ` DHHÇXi1 V¿`X<!@LLIAd!P2 V¿`<!DLL"d2 V¿` <DĉTuX. P3 V`B? @VHfpv3 V`B?. 44":P4 V@T ?(!,k*struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } }k*struct { F uintptr; X0 *tproxy.UDPTProxy; X1 *net.UDPConn; X2 client.HyUDPConn; X3 string; X4 chan error }k*struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream] }k*struct { F uintptr; X0 *outbounds.standardResolver; X1 *outbounds.AddrEx; X2 chan outbounds.lookupResult }k*func(context.Context, string, *govultr.ListOptions) ([]govultr.IPv4, *govultr.Meta, *http.Response, error)k*func(context.Context, string, *govultr.ListOptions) ([]govultr.IPv6, *govultr.Meta, *http.Response, error)k*func(context.Context, *govultr.ListOptions) ([]govultr.BlockStorage, *govultr.Meta, *http.Response, error)k*func(context.Context, *govultr.ListOptions) ([]govultr.LoadBalancer, *govultr.Meta, *http.Response, error)k*func(context.Context, string, *govultr.ListOptions) ([]govultr.Plan, *govultr.Meta, *http.Response, error)l*func(*sync.indirect[*internal/abi.Type,interface {}], *sync.indirect[*internal/abi.Type,interface {}]) booll*cache.EvictCallback[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]l*[]bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]l*func(context.Context, string, *govultr.DatabaseBackupRestoreReq) (*govultr.Database, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.FirewallGroup, *govultr.Meta, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.ObjectStorage, *govultr.Meta, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.BareMetalPlan, *govultr.Meta, *http.Response, error)l*func(context.Context, *govultr.ListOptions) ([]govultr.StartupScript, *govultr.Meta, *http.Response, error)m*[]struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } }m*struct { F uintptr; X0 *net.Resolver; X1 context.Context; X2 *net.dnsConfig; X3 string; X4 chan net.result }m*struct { key *pflag.Flag; elem func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective) }m*[]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream] }m*func(context.Context, string, *govultr.DatabaseUserCreateReq) (*govultr.DatabaseUser, *http.Response, error)m*func(context.Context, string, string, *govultr.NodePoolReqUpdate) (*govultr.NodePool, *http.Response, error)m*func([]uint8, []uint8, monotime.Time, protocol.PacketNumber, protocol.KeyPhaseBit, []uint8) ([]uint8, error)O` " ?@TT5TX fd`"?@TT5T2TT Ft $ @@)TɶTTTFȬ '@@T5÷(ɶTWXTȬ`' A@T5÷(ɶTWX$$DbtjA@I2` KUN\( sZ"U p B@ޢXΑ˶`VIN-.B@`#``W# o 0 C@U%T gXo7("c@ZܴCZ@2@ǿx LƿX\a-4 DZ@>2@h I c=, ^ 5DZ@K@Vv,@k= P`7Zܴ EZ@ܴ LͿgͿhXm)\L7EZ@~V70!@V`@VdxxI-c 8 F@ h` `$F $ $`Xn-4:F@iM@0@x3`!i rMlqapx: G@3Xqi $@V(+t G@MJ,F .޴@S$ W H@X5T3X r7i<H@3TUiU 3U 0,Q"< I@G Ui OM ,Gܬ5 I@iXX9þ|޴ xxsL eE J@ 4JNTdSNTlpMt 7TH4c6@wJ@LT T T# V'P8%I K@@D`[@V a@VpLTe@K@1TuT%muI*0`HmL LmL@%[ߴVV lVnh2^NHmLLmL@UUUU 5!ImL MmL@ mI5VyT b$vKmLMmL@ 6^P 5U=50`MmL NmL@WEmY@V 6@V -NmLNmL@YmVU@U&V VnQ,.NmL0@ { <08M mLOmL@]nV׏V{V⏴V 0OQmL PmL@dVp5V07V Vђu@w}mLPmL@0{nn9T t\)\idԓ P mL QmL@Q `7V h7͹!&Ӧ |-g (Rw"@@o4Dp8rL`r %X0x U R(R@x8UU4U8U,?09UR(R@x8UU`4t2 S (R S(R@@V8Uػ{@o MA8oO ZS(R@=UBU8ཹXX 9$ [O TO@U$T'X 'X rk2 \TH@XXOXĵX<V U @0k?i qiUQ @pmp`X S[a7ɩ` V, @X;TjT }X va7V 9@HƵ XdR' 9 W 9@1hqT8` ( #U(HcW @@V #)E,.j3<@lZ#ZS3Z3ZgZ%Z0@PZ!ZJo-uXQw"@!P!p!|!L!l! {X~oEr YEr@ 87 XrX r(:Xh{qErYEr@{sU|` Vл $ wEv Er ZEr@ p<XT (- ZEr^#zNI {NhIM {NI hwK8`sEr [Er@=5@Vb#VT  D\ Er[Er@g 02 < ,  Er \Er@)X(xl jrmEr\Er@mv$ v<<[L( e7:Er ]Er@EVT]㖴@>aT^`Er]Er@<[0@# *x} Er ^Er@<>`Sb#,`Er^Er@=[@#7&ږ- _Erw"@xNV  c=~@T+T3`¹*X-Vgcg@ K fC ` f@C $C +_<A  d4 @=T#qT qT$\hpd @LdDXu u%q- e@`"m#``W# ^-ʝ`.e.@!K 1D 1 b  44Q4 ft@ę&0>ॹ f-s fgi  | W# L D X d T g gg@6w`3P7@X^$"pl@EgE@VPqX@V $v Ȱ3E hE@V@V v$gLD]ȰI EhE@V@V v$ krȰ E iE@V@V v*<>7v%i%@V'V-V5VAvD jD@@1ȉ@VX@V$ DjD@Pi'XVmV`NP9b k@`!Jx@VTVXPQwTE`bqkbq@m`s`" WJ̮6 l@"`q@´`o\bwlw@# aS> \X >d´ md@;`Jx@VPVT4Lu0FmF@*@V@V<@V´X 9Q"-&* n*@%N@%@@ -`VKnVK@y'V  ;]h`VK oVK@V% @7VZ= z7F7 o'@w#Zѻ- ͫ-Y  pGw"@< pi iLL!i,(lBs`p@ +$V(F#VL-  q@%a@aaa J-@q@@ݻp@=Y-ɛ r@"71U   $r\@@V=@VpA@V# w , s1@%T(T"@8xT QzJ@,,s,,@b#D5@Vt5 ?}0#  tz@x8UU4U8U)h0 tz@x8UU`8v,A7` z uz@ػ8UAU{[42\ zuz@@V8Uػ{W1@ X z vz@OUU$T{[ UP z`zvz@x8UAVTT 80ܬP\ z wz@^U:3T{@>z{B/0`wz@x8UzT$@T$|?h  z xz@1R@V}UU{ ) ep  xz@U[UhǴU U -Pl  z yz@&U1U U{`x @3!- yz@U`TdTbUѲ-4` zz@3zUT)UAUAU -e\`z@^#W X d k #G`a5 { @7i"Tr,\ y,ο ֌52{2 @#`9@U>L0' 42 |2 @#`9@U>L0`(Yd3c-4 Z|Z@O^#`&@ S.-L`Z }Z@^#9 X`@` &H\(rEZ}Z@ص}{X0Hu4 <H\8`  ~@86{sm@ڽa4 p~@ UX 2ٵX O8  @ `~R^\H Omt @aU |XHX , 8` @-j j@@>^U]@TF&j 66 @,U,9$TY@V*s  ]9@CX^X In Ltww@>g@:^TTz! w w@ @˴V 2տ(5wbBww@N'YUQ\U {U$ e  Q@TL˴T^TXLL4U|!&@P|0P<jHf)`b  &@@I T+=!,[ ӎӎ@/TbT˴#`i($ !}  ӎ@T_T T ( 8 ӎ@?U$U: ,(Zg r  ӎ@}T]}Tg}T$,$)4`ӎ@iU 'T6 = ($~t _`( ӎ@0̴Uq'TFT A_ ̮`.ӎ@T7T7T |b) ̮a~3 ӎ@iU3U9:TY;.\5=TTV-ӎ5} TT2 UU^Aq ܬ ( Ed Ed@C@\  d Ed@`TQT~Tң@kH D` @@@V̵TܵT ۏT.OP GR@(T%Tƻ@V^T7l   @ŏTػ@V(T XԺTH<x `@̵TXŏT ̵T@4 Q~ dĭ` @ U+) U U U00(A)`@0`¹б`¹ `¹$E`¹$L  @y)T(TVTK`HHzNV lrg@OTԷT䙷Tշ@   @(T^T:gTVgTA @DTDTgTz^@VZ$J-M  @)`:`p`7` ޡ*8 0h @6Tnh`B*`B *@V @ <` @@T̵T̷TշT qD R@@TT);TOT^K T ]  @jiT^@VT ˷T,` =f`@ŏT̷TITE@VZp Ds @@@VŏT*T T 5n `@@T̵TTT6^K ` @ŏT̷TITE@V$$gbt׺@I2`Z KUN\@8г` ׺ @Ĥ@T$(S4PHS̳~"׺@KUh1U{Dg{-%׺ @`#``W#  jT 77@=a@ SV!47Wc# #@ۻFۻ ;@h8ۻ`g\A dַ@d X-V \Ss-C*Z Z@@:^0@7_m:M3^82 5HH@XX'@VSk V~`8 H@7`ҴiB@V@ѹ ?@秴@W!UrPGU{HW ?@秴@T EW>- I ?$zyMzy%dzy9dzyp{r @G@V ?@V /@V A0kHxx @ȴvȴve*t {0@ @crmޟ@v&u*u8hg2p@yVYV>_@%LfHNp @]CXޟVV +T ?Ra50 @@yVP¶VqCumtX,ȲXPM @yy>0_@E|xw|   @9DI{smhпp\nXx \O jԪ-]md.d.@tz#@V$`/@V,,MشK]`od. d.@xp~e@IU@ /"@(+@&UڷU@X@U/1"@ $̬ : : @eXTT( q` :: @X5"@&W0 t : @9`Ӵ9@ $@V LT :: @ 2/d\=xt : @Rf8;`X $@$$ MO8.R`:: @ A@ CG-F`| @` K¬ eͬ egAH @¿)Eج@E ^-=  w"@d* t*<p0x+L]9I`~@¿)Eج@E 赍-^e Heh0(Df/:` f00@gT.Ƿ - e b*(c):` c+0@Xd):F^-e |h4(`i3:` ix40@j@34d _@%@@ @vv/@l0@qghd*p p @uu/@lBI_:_@TrSTȶTSHݘX9U   @ ۻDۻ(Ht5X9 @  ۻDۻ(Hֺ:X9ן@ @ @ ۻDۻ(f|-.OOO8OXOhO0@O(O( I@,9``< < @1 FTJ$X&n-"''@1)z8?  f@4(9C<2' '@`;`V`$ @V0n*[8]struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } }0JDN33@`g"N@D! 33@g̿"̿0,kcP g@G Ui OM , /x+x0x0@g`V ET- `O33@ g" H T 33@gM"̿  KJ%Vx0x0@g` !V 4:u@((@m@s@;"` n*[8]struct { key protocol.StreamID; elem quic.incomingStreamEntry[*github.com/apernet/quic-go.ReceiveStream] }) @/` @"]@/'@/;@TUYW PDD @@ܹT@V T@VXsG 1 PD`D @ܹT@V T@VX wQDD @ܹT@V T@VX(  C` @"`#]޹'޹;@Tn*struct { F uintptr; X0 bool; X1 *certmagic.Config; X2 context.Context; X3 string; X4 *certmagic.Certificate }<X<J3@J3 @Y@Va@2^*4XR 0Hj`+x g@ȴvȴve*tK)g ,xx @+T@V T@VXn*func(*quic.packetBuffer, protocol.ByteCount, monotime.Time, protocol.Version) (quic.shortHeaderPacket, error)n*func(protocol.ByteCount, monotime.Time, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)n*func(context.Context, *govultr.ListOptions) ([]govultr.BareMetalServer, *govultr.Meta, *http.Response, error)n*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPCInfo, *govultr.Meta, *http.Response, error)o*go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }o*struct { F uintptr; X0 <-chan struct {}; X1 *net.netFD; X2 chan error; X3 context.Context; X4 chan struct {} }o*[]struct { key *pflag.Flag; elem func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective) }o*func(*uint8, func() (*ed25519.PrivateKey, error), func(*ed25519.PrivateKey) bool) (*ed25519.PrivateKey, error) InverseMatchbprotobuf:"varint,3,opt,name=inverse_match,json=inverseMatch,proto3" json:"inverse_match,omitempty"o*map[string]struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }o*func(context.Context, int, *govultr.ListOptions) ([]govultr.InvoiceItem, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.DatabaseListAlertsReq) ([]govultr.DatabaseAlert, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPC2Info, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.NodePool, *govultr.Meta, *http.Response, error)o*func(context.Context, string, *govultr.ListOptions) ([]govultr.VPC2Node, *govultr.Meta, *http.Response, error)p*func(*tls.Config, *tls.clientHelloMsg, *tls.serverHelloMsg, *x509.Certificate, *tls.serverKeyExchangeMsg) errorp*struct { F uintptr; X0 *sync.HashTrieMap[go.shape.*internal/abi.Type,go.shape.interface {}]; X1 *[144]uintptr }p*[8]struct { key *pflag.Flag; elem func(*cobra.Command, []string, string) ([]string, cobra.ShellCompDirective) }p*struct { F uintptr; X0 *singleflight.Group; X1 *singleflight.call; X2 string; X3 func() (interface {}, error) }p*func(bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket])p*func(net.Addr, monotime.Time, *wire.PathChallengeFrame, bool) (protocol.ConnectionID, []ackhandler.Frame, bool)p*func(context.Context, *govultr.ListOptions) ([]govultr.ContainerRegistry, *govultr.Meta, *http.Response, error)q*func(*tls.Config, *tls.Certificate, *tls.clientHelloMsg, *tls.serverHelloMsg) (*tls.serverKeyExchangeMsg, error)q*go.shape.struct { net.addr net.IPAddr; net.addrAttr net.ipAttr; net.src net/netip.Addr; net.srcAttr net.ipAttr }q*struct { F uintptr; X0 *httptrace.ClientTrace; X1 *tls.Conn; X2 context.Context; X3 *time.Timer; X4 chan error }q*go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }q*func() bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]q*func(ackhandler.Frame, protocol.ByteCount, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)q*struct { F uintptr; X0 *http.Request; X1 *http3.ClientConn; X2 *http3.RequestStream; X3 *httptrace.ClientTrace }q*func(context.Context, *govultr.DBPlanListOptions) ([]govultr.DatabasePlan, *govultr.Meta, *http.Response, error)q*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 impl.Converter; X3 protoreflect.FieldDescriptor }0ud 6|-`@f PԦPԦ|Ҧ|Ҧf@٦٦$ئئφ 6|-S `& XMq 6|-{f țțf$``.Cł > `4T w"@hf3y-dT 6|-;6J 0202V6K $f2$f2@K q2q2K Ts2Ts2[?s 6|-jK w"@$Y-$Y-Z-Z-LpZ-pZ-p0Y-Y-/ 6|-v@;6J 0h30h3V6K h3h3@K i3i3K Pj3Pj3wb0guA Zܴ`Z4i`L#Yh` w"@Y+,) : A Z4i`2R2Tw"@W+()3 6|-=l#ŊЊ  6|-@jw"@t%t%x%x%Lv%v%p0t%t%ݨ 6|-! @iD'D'#tF'tF'G'G'" %%c 6|-5w"@%%<%<%L(%(%p0́%́%$ 6|-t`G3 h5#h5# ;#;#F4#4#45#45#' 6|-w"@}%}%4 ~% ~%~%~%L~%~% G `43X3T3T x @@PHbG 4>`1T0$#8w"@. 6|-r $`%%%%j%%_,%,%$K@H <<4|TTTw"@p!؀ }[n 6|-M[mLINdd%  Cr 6|-#mL%0/0/600#e#44"T 6|-bf`]mL#uP鹜s |-H_mL#]P 6|-qmLg`` h hp8 tgtgj 6|-NNmL0@ {.i 6|-amLg``p8 ?Sc 6|-N9mL#& |-FmLQ@`S 6|- R R@iiD@O U'cc`Ɨ 6|-g`Q(Rw"@4DDL``" 6|-h p@@p@:@6@W `4n@V" 1[d[ ކ 6|-9z(  J= 6|-d  hi[hi[Pt[t[e' @q[@q[Tm[m[u 6|-? EX (6LoLowNooook4o4oE~ 6|-Q iHrHrlPrPr TJrJr'UrUru#F 6|- ;` ?< R xxp7 y yP`R XxXx(dydy 6|- w"@yyyyLyyp0|y|y\ 6|- , 88,,jXX2!DD 3`34@)`q'S3ZZ*' 6|-@Qix!x!#,!,!!!" 0!0!X 6|-;Qi|!|!#8"8"L"L"" x"x"<<"H`QQ49;,A`8i 6|->Er^#NNuMuM $tM$tMW# N Ne 6|-ErLLjILjI#`) 6|-m`Er1LL@ +..P0P0 P1P1 8= WTRp"m- >+.xP04 P1\k 6|-g!`O O #`|S |S `U U `S S P 6|-W E`xxJ Kg`  6|-Bq`*(*(XX`L,(L,(X`*(*(x%(x%(a- 6|-%`DDXX`X`TT6E`tp 6|-D`8Y8YJ [[Kg`HYHY XYXYTA 6|-$`jD`]]J d`d`Kg`]] ]]eh: 6|-rEBa@ x x @  "H H    lR' 6|-F Ba     "     v 6|-`X`@ 6|-0Y!A@>>uX\k 6|-`v`rrdss9Y`(s(sQ`l; 6|- chX`08 8 0@`3 `3 F0D4 D4 T 6|-`VK 2}}wHH#" 2c 6|-2@WH4$87 " "5b ""?3 6|-Y ` z"z"H@ }"}"2sL"L"P@""] 6|-HZtGtG6( 6|-bj,ܔܔ@@(? 5)  Q`Q4+TT㡴X( D4DBkH 6|-x Q'`}D}DuDuD|yDyDB$1 \` `4|T@V &@V n!` h.޹  `ىPȉq Dډtɉ+X܉`ȉBHˉ 6|- u@؉؉uΘ 6|-{ӎGC`@1= 6|-d`)(X(Xw"@xWxW`3`X`Xp0DXDX@ 6|-@@ TT[ @ $$"@[ j 6|-4@b 1 ܷܷXb ൗൗ hh44f#I?2~ 4Eػ+aػ4ac ϤZ\R\>44M2a ׺`4 1ػKػKc ZP=.W 6|-v;6j V6j k @k ; 6|-;6j V6j k @k cx08 ZZ4+ ^77 >08Z`Z4+ ^77 v,8@ 4%n@VT0@LQ+J 6|-Bw"@DSDS`SSSS0@ȄSȄSj 6|-@ BF (PTPTgTT0@TT84 SSPP 6|-i{BF (TTTTgTT0@TT84 pSpS, 6|-k@%)%Ś 6|-`I ?$z$zMzz%dzz9dzz8 6|- x #`A\A\`DDA\DA\`D,A\,A\B?\?\X=A 6|-Ջ@w"@;];];];]L;];]p0;];]) 6|-w"@D;]D;]4;]4;]L$;]$;]p0`;]`;]Vv 6|-Nw"@<]<]H=]H=]L8=]8=]p0=]=]pݝ 6|-?~ ]]h1p]p]D]D]5C ]]ݎ 6|-b` !@h`h`v``1t``+ MD`D`dѺ 6|-{N N bbN - fQ3$>$>@z>>0@|>|>$e 6|-@ i@TT0@DD 5b rn 6|-2$87aa5b ddqN 6|-p`}" 3@@ >|:| 6|--F}"`3:| nHH1 6|-*p}"x١x١3ءء >|PڡPڡ:|lءlء4Ob 6|-AF}"`PۡPۡ3HܡHܡ:|ءءn  4D/ / 41 " "3Ela?c 6|-P / ",_,_3t]t] >|(`(`:|X]X],,?FQ 4$ $(`4,q4\ `Q 40I`o8I`o@b(`,,8g-4`Q 4@I`oHI`o(`r 6|-d.0MO0MOMOMOxNOxNO0@OOOO 6|-`od'OOOO9POPOM 6|-]Y‰ {{ i,{,{`m`l 6|-: (}(}eep}}< 6|-@A: `3d~d~XМ~М~`~~}X@f؝~؝~# 6|-S@lggI1hh BiiBiin 6|-^e HeHe(DfDf:` ff0@ggjB 6|-`e bb(cc:` cc0@XdXd( 6|-e |h|h(`i`i:` ii0@jjx 6|-_("TT ԠԠ#`W# ,,q8 6|-_("̚̚ LL#`xxW# Jd 6|- ("DD ėė#`W# Ab 6|-`.OOOOXOXO0@OO%1 6|-s'@ OO9@ OOM4O4O0@OO= 6|-SaQ `3L PX` L` h 6|-1`;" <<#`W# ЄЄmA 6|-U@ `" tt?&| 6|-p `??"@ HCHCxAxA?BBk+ 6|-ן `" ЇЇ?2 6|-3. `ޠޠ"?H֠H֠m;D 6|- ! `$$"? 6|-J! `jj"?XbXb9m 6|-2'b0BBx@x@0@nCCE% 6|- B Ba`  "  tti=R 6|-@B Ba @"@XX/ 6|-B Ba @"̀ 6|-3 Ba" 6|-sBa &&,(,("''@$'$'/g 6|- Ba` P:P:@::"h:h:::r 6|-HBa"o@ 6|- Ba   "`    6|- `Ba@ D D ܘ ܘ " \ \  ԗ ԗ c 6|-L `Ba $ $ "`   @} 6|-0Ba 838344" P4P433 6|-`Ba HH`JJ"JJ xIxIs 6|-4L `Ba` e!e!pg!pg!"f!f!hf!hf! 6|-1 `Ba h! h! i!i!"8i!8i!h!h!` 6|-`x0` c!c!` b!b!wN1gu 6|-0 Ba d! d!`e!e!"8e!8e!d!d!A6: 6|-# Ba pt pt `v v "u u  u u WE 6|-y `Ba r r  Pt Pt "`s s ` Hs Hs \R$ 6|-p`Ba q q r r "r r  q q q 6|-@Ax0` Hp!Hp!` q!q!wN1L 6|-P @Ba@ jjh jh j"@ j j>` j` j]Lf^ 6|- Ba ijijxkjxkj"jjjj ?pjjpjjh 6|-d@Ba@ @M@M@MM"XMXMAMMr*func(acl.matchResultCacheKey, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound])r*go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer } 6|-L*X<T (x(x xx xx\`xxr*func() *bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]r*struct { F uintptr; X0 *quic.wrappedConn; X1 chan quic.errCloseForRecreating; X2 *quic.Transport; X3 chan error }g3\ @u:` .` XHEm`K? 6|-0U Ba iiNjj"Njj iir*func(context.Context, string, string, *govultr.DatabaseUserACLReq) (*govultr.DatabaseUser, *http.Response, error)jW 6|-@Ba @kq@kqlqlq"XlqXlq`kqkqs*struct { F uintptr; X0 *tproxy.UDPTProxy; X1 *net.UDPConn; X2 client.HyUDPConn; X3 *net.UDPAddr; X4 *net.UDPAddr }s*[]go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }s*func(context.Context, string) (*govultr.DatabaseAdvancedOptions, []govultr.AvailableOption, *http.Response, error)s*func(context.Context, string, *govultr.ListOptions) ([]govultr.DomainRecord, *govultr.Meta, *http.Response, error)s*func(context.Context, string, *govultr.ListOptions) ([]govultr.FirewallRule, *govultr.Meta, *http.Response, error)s*func(context.Context, *govultr.ListOptions) ([]govultr.ObjectStorageCluster, *govultr.Meta, *http.Response, error)s*struct { F uintptr; X0 impl.offset; X1 reflect.StructField; X2 bool; X3 reflect.Type; X4 impl.Converter; X5 bool }t*func(*ecdsa.PrivateKey, func() (*ecdsa.PrivateKey, error), func(*ecdsa.PrivateKey) bool) (*ecdsa.PrivateKey, error)t*struct { ExpiresIn int64 "json:\"expires_in\""; VerificationURL string "json:\"verification_url\""; *oauth2.Alias }u*struct { F uintptr; X0 net.addrList; X1 net.addrList; X2 *net.sysDialer; X3 chan net.dialResult; X4 chan struct {} }u*struct { Protected string "json:\"protected\""; Payload string "json:\"payload\""; Sig string "json:\"signature\"" }u*go.shape.struct { Outbound github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound; HijackAddress net.IP }u*func(context.Context, netip.AddrPort, *buf.Buffer, metadata.Metadata, func(network.PacketConn) network.PacketWriter)u*struct { F uintptr; X0 func(string, string, syscall.RawConn) error; X1 func(string, string, syscall.RawConn) error }u*func(int) *bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]u*func(monotime.Time, []uint8) (protocol.PacketNumber, protocol.PacketNumberLen, protocol.KeyPhaseBit, []uint8, error)u**struct { ExpiresIn int64 "json:\"expires_in\""; VerificationURL string "json:\"verification_url\""; *oauth2.Alias }u*map.group[string]struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" }u*func(context.Context, string, string, *govultr.DatabaseUserUpdateReq) (*govultr.DatabaseUser, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.PrivateNetwork, *govultr.Meta, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.LBFirewallRule, *govultr.Meta, *http.Response, error)u*func(context.Context, string, *govultr.ListOptions) ([]govultr.ForwardingRule, *govultr.Meta, *http.Response, error)u*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error)w޷g7(~"T#w"@ݦp0ݦ I3 @8(gV1` k3 k3^#l3(l39v-`;8H^#9 gi@H c`@`d`MH m <+3@93(x;ԿԿZP;ZUDZ\DZ>0 )@9Er(U0@VNFT)XNF-Er@:Er({sU5U# N\IQN,\Iz*8-C`Er:Er(%U<U6ıEJT A@;A(91V1BHD1\L>;=~(W(~8w"@OO1P$J{-g@<gH^# c`@`d`crW# Yc08<i(@Vo`r8` <x<W# 0>=+@=F("^@V :ȅ`,=F("^@V @KT | fZ @>I(%T#w"@87p0X87 v +@>(%TL70@-`@?H0@A@A(?"-u<?<H'(@ w"@ J(@ @ f(@ .(@ q@ -\ i@@iH^#9 X c`@`d`   V@V(#T,Tw"@pC{>@G(8 @.: ``J_%@a`J_PHUSG(8 H: $b`XM_%@8c`!-M(LU@V]@ cc0@ıc`c_~@N(@@V]@ cyc0@ܮczc5 N(@@V]@ |c c0@@ccv*func() go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }0(uk5O VU`0 $ L/Ю@<0P V \vT((FԮ0P VE@ $pp0P0Q VA? D U)rܮQ V \$$iЯ,0R V@8m f/p,R V @m    c 40S V @m T;(S((@@V)TxDx`xxε @T(x<6s 7 NNM NHNe[<T(x<6<7^#NN N,N3o0U V`\  005tU V`  ܮ0V V?  xP<V VX Y\ T!0Da=(@W((@V)T x0x`xxv*bbr.packetNumberIndexedQueue[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]v*func(protocol.ConnectionID, []ackhandler.Frame, protocol.Version) (quic.shortHeaderPacket, *quic.packetBuffer, error)}HȮ X V??X ??Pt0Y V`    @ܮ2Y V@>l \T5ty90Z V@v NYv*func(context.Context, string, *govultr.DatabaseMigrationStartReq) (*govultr.DatabaseMigration, *http.Response, error)$Xs ܮf0[ V D`B? <$  $$v5v`TT ټZt=0] V A A  v*struct { F uintptr; X0 *int; X1 *int; X2 *int; X3 *net.Addr; X4 *error; X5 *socket.Message; X6 int; X7 *socket.Conn }w*func(acl.matchResultCacheKey, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]) boolw*func(context.Context, string, *govultr.ContainerRegistryUpdateReq) (*govultr.ContainerRegistry, *http.Response, error)w*iter.Seq2[github.com/apernet/quic-go/internal/protocol.PacketNumber,github.com/apernet/quic-go/internal/monotime.Time]w*func([]uint8, impl.pointer, protowire.Type, *impl.coderFieldInfo, impl.unmarshalOptions) (impl.unmarshalOutput, error)x*func(go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer })y*struct { F uintptr; X0 *certmagic.Certificate; X1 *error; X2 *certmagic.Config; X3 context.Context; X4 bool; X5 string }y*func(acl.matchResultCacheKey) (acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound], bool)y*list.List[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]y*func(protocol.EncryptionLevel, protocol.ByteCount, bool, monotime.Time, protocol.Version) (*quic.coalescedPacket, error)$pWbLTTTHTX XPMcL T%Tv@b 4?FL((L~a`#cL TXɶU5÷ U÷UNT$($(l%dL%T5T@ƿ?I÷T `XisĬ5`&dL%Tɶ@JɶJpɶ`@(T@D f̬'eLX5÷ϻX T#T, HЬt'eLT`¹TT÷TA$,8xa)fLQ"@"U6;$t1kfLigU0U##U AȬ=-gL/۴ gTV۴Lȯ P#X( * mgLXyXΑ˶`(=1tmhL(Tp XَW3X$)Dp?u4hZL>K@V dL4bVk<e4 iL36DL@V Lwh@U, K$LiL83D=$@V"$X)$?\Hh@pjLD h`@V@VX3`((c}5hjLLTT3# >Xrd vkL$@V@V%TE$@( k[DP kLuTYUNc@(0$** `@lL4@V#,%4 wN$ [M L(Hz MmLlmLLPDW U48XH^0  OmLmmLL @Uz;VcmU  b6GmLmmLLA 厴U U 7p@N mLnmLLbQ9폴 gn|qn kQ`Ox$Nŀ|@Q RnRL"Tn@Vh8T m@QN'ιCh2=Q (Ro(RLx8UU4U8U{Q  l09 Vo(RLx8UUnUػnUnZ-*Vp(RLU7U$UU4U ($Z MEx`@T pOLp9T"TT TRT Σ-)' q,'^#[Xi[[T[W# [p[ ejxԯ q Lpmp`T S [$_ x8!4W@,r, LUqTMTT_q@& 8 br 9L̮TX@ K@u,$; 9s 9L@&"ٿ ;U$2X(ldjn0<3s3L)G'L)XT#)'X*)`($r&\Ln t=L"T7 9U;T~"T $%==t=L@;X`b#&U Ӫ8z`nuErLcrUWUy>XLT,(mx? EruErLT<T+Tr?T$(c`?> ErvErL<#p@/v${`rErvErL1@<T% 87 S$$ErwErLR V@,g$ ȾԾ ((*ErwErL2`r80YU5Ub# ǴT@ErxErL=9t%,T(T <X GErxErL5`8@V 2@VY@VtUEb)` EryErL<#p@/_9|-1 yEr* e HH# )PNPNoNN4{̮:~z L ̵@Q, t@V:G40c5 z L ^`¹ P׶ė$,T,cW-{ X=`?\W hdAeW di= @j @ ` { L@%@V)C@V +' ;*ȿ,,ZD@ |LU̷o0ʶX u̷¹^`((p 9}-|LͺTͺTκT û`¹@V$$ 2BH-}L͵TXDXT (T2T( qH- }L$@VXضTӃT -T郶$$P lh ~gL`=T D`` u-44x@g~gL` .""0)4\:W@iLu@V @VU@, `XpO|Bp`ͷL`%J x@V`Vd*XlRttLϙ@ `X7>-ȱx<6^# d  H M t (=<$9`L87IUU$U5U |QDggL2@ڙU噴U : E`ggL2@ڙU噴U h0\ggLUP7UV]@X @X }|M0`wwL# aX´S> %8pswwLuT}vຽbF `Ta$eh"r FL*@V_@V´X" i$^4`VKVKL"+ ô` ôV)+@V0+@V 0(3$}2`  Lb#@V }+$LDKa`@Uh@U UU ,d@2`ooLD `YU 5U$ U($W|ŢIILMt5 Y #@V [is \`&L,@q5h8 1 G- !11>BX@33~@330@(3ܜ3Mh2 zzLx8UU4U8U{s 5h< azzLx8UAU[U x&-0zLx8UUnUػnU 8 D j zzLYUOUyT {@\ Y-zLx8U$U1RUzUuU W$T @ zzL$U1RU[UU {, P`  zzL1R@V%VhU T{ )s-; zLx8TT$T$T$U a&k\ LTTH,TB(t@02L[ػ\ػ \U \U"O,U$<<WhLU(ȴ4ȴ?\4H\@84,2:(݁ LdK@V87 3yX04,33( LdK@V87 3yX0$B?i L` LuTLRT.T7DT\@V $$+t[22 L#`9@U>L "T@>$ch22 L#`9@U>LDyU $$N0aX /ZZL8j).0:E(#%ZZL87 h7.1<u 0(WǮ`ZZL+'0Mus{Xuq$J} ZZL+'`N",ʴ @$$OjXZZL8j).0:E4,z?Բ(! OLg[T"Nc%T( T0<4aIx QQLCX˴%% d˴`;$2{`;0TLT9`&L>.%@V R{ѷc40;H,(pٕ4PӎLԲTTc@DҷT$ w ̮*_ӎLCUT˴TڵT 1D ̮*ӎL$UnTTxT$ Y`c g` ӎL7UCUT&T |x ̮ʢ )ӎL$UnTTxT R{y ̮ӎL(T%~T!T T$ I C~-ӎLiU3UU 'T bm ̮` /ӎLCUT˴TڵT Ν ̮ӎL(T%~T!T T$ ֨ 5ӎL?U:T1TڵT ;8- ӎLUx8U*QTTLR@D($(al@ EdLrޟTܵT~T $ <@ 4L@TT̷T\ܵ@VOT($T\L `8R`L(TTT^TT \ L@@VܵT̷T WW/ $HVL;WdWdWdW ӷT$ks Ų L^TDTDTgTz^@V $+D  *`L̵T_)Ty)TݵT\ܵ@V q 4/*L̵T^T^T @Vh`B xL D  LjiTVT#$@V8Tǻ@V,$n%V`ޫ`L@T ޵TTTh`¹ ($Ϧ| ``LӷTT1ԺT(TT ($'LT^T7 DmI`¹ET $=У 0` LŏT̷TT TR@V (ܬ  ^``L@Vh8D@V`U $="׺LyT-UT$ D[&ZX ׺L_KUs#X`ꎵ N4R 5׷5L`J @x@VVY@V5Jܬ˭8LaX-XEX`-(+702L VhVlV V V $ E\ BBLbT@VC@V @@@.T-ōT:?L@@VXҴU$U 8GU^q?L秴@UUӴUӴXB(?L秴@b@Vg@V]!@V@Vz?@?L秴@ D8ӴAA`W DOT5 $Sk<?L)@V@V@VtӴ@V ӴE$$8xL:XVޟ@n d T0$#,5L17< !V!V'/V$W-㵻LTX]XX| sB`  LWF z z t|$J[8uz LX6ttmtԴt@ tl 22L/@~Ӫ~ U \hД\ 3ۺ3L#X&UX@@B 9|-bfQfQ>`T>T>q 0>0>+l>l>($:l` ԩLrޟTܵT~T 44s^@aԩLT+TZ-THc, 8ݝa L% 7I*@J-Uh1Up'ip4ƺ4LDJ@M@(D@P\@x GtL@  m@V*@V1Y 4B*B* L LqL@V@V ]@VTdG`v: LRf.HxAH `XsX80b]s: L.`C`خ M ,d\F=s:: Lce`4`@^ L  XTv ҉:: Le`dU@ w U-J@8 x: L2Hh i p<8,.5#T_XR$\nXQ3T`yLYL@s숴 I & W&XKyLD %}e}e}&V4(;jm3`zLeVe@VqX 8)״@$-9|-H DC@ ,X,X WW. XX16-r`K`(#` )0@),D< t :_LTT20`0@,Bs8j(J<09h, LۻG @  `pT/(J<s99 LۻG @  `c<`9ll LJ`M`8D`p``((|vKD59, Lۻ@I     `$(({ڼKs99 Lۻ@I     `$TTF!33L` 1gTTeO,)%u) @*$`+$$0@+nN |-4*%T<Xך<tt=0@=7>[h-rwZZP>^#9  zLW# { M &Hd5G 44`-ZIdd7Iԝdԝd3 ddda-0_@E;@_عD|-A|| lrk"`w("lyk"l8qkg`#lsk0@$lmko-˼-ƺP!K 0s 1D 0 1 b  (|-.`(}Բ`0@--TZggP^#9  c`@`d`W# ~*func() iter.Seq2[github.com/apernet/quic-go/internal/protocol.PacketNumber,github.com/apernet/quic-go/internal/monotime.Time]*struct { F uintptr; X0 context.Context; X1 func(context.Context, string, string) ([]net.IPAddr, error); X2 string; X3 string }*struct { F uintptr; X0 *http.http2Framer; X1 *error; X2 *bool; X3 *hpack.Decoder; X4 *uint32; X5 *http.http2MetaHeadersFrame }*func(acl.matchResultCacheKey, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]) (bool, bool)*func(*list.List[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]])*struct { key string; elem struct { IncomingBytes int "json:\"incoming_bytes\""; OutgoingBytes int "json:\"outgoing_bytes\"" } }Gʌ 6|- `,,#`,,`,,--W# @-@-| 6|-`N`,,J ,,Kg`,, ,,`,,*S0 6|-v`N`,,J d,d,Kg`,, T,T,`D,D,|T 6|-e`K %̰̰%@0@7$3- |-oWmL8_l8;`H5D`0T 6|-mLq7L L ` `L L   }lNJ 6|-zBmL7xP" @@i* 6|- ^mL7xP" @@H 6|-fmLP`#(&`ԚԚ8=2 6|-@h'(, Y Yw", Y Y,X YX Y.(, Y Yq, Y Yg 6|- @q (5oopoo;,o,o<,o,oi`2e`( 6|-Wq, a 쇇쇇.葇葇00l 6|-fE 9^#,xo,xo uouo9vovosqqoqooooo1. 6|-'V 9^#coco ]o]o9 co coMRoRo<\o<\olR 6|-N[o3`ZZsZsZKtZtZ01`ZZW# prZprZ N 6|-<@s3%U YY' YYp;` YYW#(Y(Y(&`I' 6|-3( xZxZS3ZZ|Z|Z} GZZW# ZZ[ϠC 6|-@Qi " "# " " " "0@!!" \!\!`ʾ 6|-=DQi""#""L"L"0@""" ""Tи 6|-EQi!!#4!4!X!X!0@p!p!" !!. 6|- FQiP!P!#!!!!0@!!" !!Y. 6|-=@t=` ; ;0$>`bkx;x;(&`A 6|-Er8NNNN0@xONxON`X`FFd47( 6|-u>`KEr8`jN`jN0@kNkN`X`0lN0lNd̥l! 6|-LEr88hN8hN0@\iN\iN`X`jNjNd @8> Er@Er4=͚^#NXNW# NtNC' 6|-:\ErOrIrI@4pI4pI@OmImIRwIwI`rIrIm < 6|-TwErG@BMBM%@8L8L1@rV@|EM|EMB 6|-G@xEr`EE (E(EW# EETjEEf]3(خ ErEr4gVq#x18NN dNNV,`Er`Er4N\ @ (NJKسNJK#`0X`ErEr4N\ @  NKN0Ko 6|-@Er[ХFХF`FFq F FD FF+,F,Fj 6|-Er<[)dJdJ(< fJfJ@`d`jx 6|-8 (@d@d Wdd =eeafft`l 6|- \W kkeW mm $n$n-@r@ ҝ 6|-@8C@ ((GC@ < <\ @ 99@q 6|-@@~g$`44&wNDDk 6|-NAS4   %%8NX Mk% 6|-@>O,),)u)) @**`++0@++ 6|-9*`      4N @N ܶ ܶ LX 6|-D ` "`  K@ @ 01` wg 6|-/gXX#v`5۳j 6|-_gXTA TA XB B #v`@ @ 5 6|-TgX@7 7 ]6 6 X9 9 K4; 4; X< < o 6|-AviD`DDJ |H|HKg`$D$D 8D8D/ EET 6|-C;`,,q ,,>,,E`ȩ,ȩ,+,, C T;`,@n,q ,Pn,>,Hj,E`ȩ,o,+,o,[s 6|-VwQ SF`  0@ppK` "R 6|-s@wQ SF`  0@K` z 6|-4*%T<T<ך<<t=t=0@==7>>_bJ 6|-G G4nn4kkrll@ oow qqΛC 6|-E! !EEBa` E EDD" EE !`E`E' 6|-E ! FFBa DFDFEE"FF FFa 6|-q!`(K(KBa JJJJ" @J@JJJS 6|-8 Ba `M`M M MLL"LLLL"b7 6|-2o@7dd@7ggw)LdLd@`gg@`hh} 6|-L ^LR@qq KM qqC, 6|-K$i~uu@uu@TuTu?uu#t 6|-0Zff@ ff`| qf qf@~f~f`| 0rf0rf_'7 6|-  9`4ۇ4ۇ"Pڇڇ ܇܇#`LۇLۇW# ههs9 6|-]O!mAmAnAnAX@hoAhoA~pApA8;qAqA"w 6|-޹`ىىq DډDډ+X܉X܉BGݲk 6|-ӎg[@͌͌w4Ҍ4Ҍ`RόόhΌΌ][ 6|- Fӎ`ȜȜ#`LL`ܝܝppW# ؟؟_L.s 6|-"| ӎHA@ӋӋ0@ԋԋG T$ԋ$ԋԋԋ5 DՋDՋ_ 6|-2|ӎHA@XϋXϋ0@ЋЋG Thϋhϋыы5 ҋҋu 6|-u:ӎHA@ʋʋ0@(͋(͋G T͋͋ʋʋ5 ˋˋ2 6|-' MӎHA@TNjTNj0@ ɋ ɋG TXʋXʋdNjdNj5 ,ȋ,ȋt 6|-ӎHA@PP0@ddG TËËŋŋ5 (Ƌ(ƋW 6|- MӎHA@0@G TDD5  ZW 6|-B|@ӎHA@0@ddG T((5 88G< 6|-R|ӎHA@0@̷̷G Tpp5 P 6|-b|ӎHA@谋谋0@44G Tشش5  4Z 6|-r|kӎHA@쫋쫋0@PPG TDD5 00A2 6|-Q NӎHA@000@@@G T 5 ̪̪  6|- `ӎHA@0@ttG Tऋऋ5 T > 6|-- ӎHA@LL0@ԡԡG T \\5 X 6|-WӎHA@0@G T5 ە 6|-9Q ӎ<2"~(Au|- 6|-chDy` f?f?N f?f?\" g?g?0@g?g?pD. 6|-}PhD:%`'~oz 6|-:hD"}>>Qt>t>`,>,>$ >> >>] 6|-chD"}>>Q>>`>>$ h>h> >>} 6|-d PhD"}|>|>Q>>`>>$ >> >>~Z 6|- B)QQw"@yy`30R0RPUzzp0RR񋭒 6|-( 4a 1 [ Xa @ B@ ,,

6|-v??css"uuJ0s0sccss0@uug!~T 6|-@^^m^^<^<^m "c48 6|-*+l@H]H]Y ]]R H]] ]]d·lz 6|-@ Mx`x``~ ``+K`` 4`4`rn ``\. 6|-N `@b@bJ BbBbKg`@b@b AbAb` Ab Ab'142@.B@. /[m: W`<_%@X` _XTRn`@48 Hd@yP: c`Q_%@d`pQ_ Kz&4dxWxU{: m`o_%@ n`o_gDH`4crmJ./K: l=l%@ l=lGxHHE 4crmJ./K: lAl%@lAl'Y 6|-"1^#llll{ll llǟ 6|-0-`fQy` #>#>N >>\" 8 >8 >0@T&>T&>t 6|-PJZ'(,(ז(זw",tؖtؖ,ٖٖ:,hږhږq,ۖۖ*%b 6|- / "`3TT:|໢໢0@ 1wŗ} 6|-/ "`3XX:|䡢䡢0@1wkB 6|- d.x qqu@qq(qq/`qqp7@qqIel 6|-p`d.x PoqPoqu@doqdoq(qq/`oqoqp7@ q qG 6|-@ d.x nqnqu@nqnq( q q/`nqnqp7@#q#qHF 6|-( : `3~~XL~L~@ļ~ļ~`8~8~}X@f~~" 6|-R@ ; C@ ТТ6  ,,G  . xx$NLX G#4%D"!z5(4' 7n'' 6|-p KG@bba|c|cXee`0f0f}X@fDgDgڻ 6|- @A''2A4(4(H(H(7B((@@d(d(e 6|-Il4w4wwwR|x|x B8y8yByy 6|- _`@ I .\.\-\-\Bq3\3\YK1\1\/@qD3 6|- '`5cc%dcdc?cc0cc7o2N0&4S"~gTQT]@ cc0@cXcc5 c 6|-JOu @`0@ خ.`(47`:s)ThOO0@OOg-_ 6|-.@}Բ`0@Mm 6|-x`LOu @`0@,ӎ9 6|- h9 "xߟxߟ@ >(ޟ(ޟ?@̷̷@ tŸtŸж[ 6|-i9 "CCll >TBTB?  p)p)Ww 6|-Ba D~ D~  ~ ~   "@ @   xE 6|-@x0# 2eg`1# *struct { F uintptr; X0 *forwarding.sessionEntry; X1 net.PacketConn; X2 net.Addr; X3 client.HyUDPConn; X4 *forwarding.UDPTunnel }b 1 6|- ZX TOjTOjbj`|Mj|Mjf: Nj Njj NjNjt:̚" 6|-؁ `ZX@ QjQjbj`OjOjf:PjPjj ,Qj,Qjt::A. V? D  VA00pP. VTU$@2($ ; ,N`P/ V? Y \XT%28L/ VGp Yt\xT,({(<0 V11``T$*func() *list.List[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]tt\+0ؼ1 V%hs  ,+Xp*struct { F uintptr; X0 *http3.roundTripperWithCount; X1 context.CancelFunc; X2 *http3.Transport; X3 context.Context; X4 string }*func(context.Context, string, *govultr.DatabaseConnectionPoolCreateReq) (*govultr.DatabaseConnectionPool, *http.Response, error) &=P3 VE \$$$P3 V\ [wH4"X e@X jXXVXc.pX(ɶTWXT tTAT(T$<<d@< ?Xڴ` t Et`,`8ґD0`8?XۊXLX抴Xh@V$@V 3@V )! `@(M\p\iD'C'#tF'E'G'F'84' Lj`I AX uT(N0jX42ߴX5ܳX6?h2te HmLAmLXVVPg@X pVxV0l z mL@BmLX ^hUlX$PX%K&V(KV,( yS8v@mLBmLX1m % 6U൴UX$;mX%Ubh2xMmLCmLXV5VVV VbV _W4wmL DmL(TGV w"@t xz `0 h  ; DRmLDmLXWU#VuT/T@Ud@U<$̯?Xɾ`EX Xpm:TLS$ؿ "$ דf 9F 9X亴@һ<@1m$@V@2X8(B ~`,AF,AX8&T@q$D@0LH\*4,j`d@G3X"WcPTRT X;`($'TDxkJ@į~@3G3Xz=`gD';Xk@V 'Ȼ(0,^ȯL> =H=X25b#໴XӔ~T uT(8tE Er IEr(@ȵ 8SNSN0@TNhTNdZ0 nIErXcrUy>AXXLTi (^}`JErXK\x`TU@, l ]s`ɵX$(yErKEr(@ȵ` 8fNeN0@4gNfNdu߈u>ErKEr(@ȵ!V( 8`jNjN0@kNjNdyt@Er@LEr(@ȵ> 8lNDlN0@mNmNdj`ErLEr(@ȵU 88hNgN0@\iNhNd$$ SErMErX[0@2Xa#  ǥM8?tEr NErX=s `#X $ <?`ErNErX\@*@ V T} Er`OErX<>`N\S b#.ftrErPEr(@ȵ> 8NN0@NNdCg|ErPErX{sU<T%  +[U68Mt"Er@QEr(@ȵ> 8NԒN0@T(_gUgX6#@XV@>@XV @_-E wUw(VV`4>`&`, b>`u@VuX_ۻDۻ 8ۻ@ۻ`5F@DFZ?h2VKVVKXy`5VYV?V @V@V X#02 H4WH4XxU'UEU5ZUGUTU +dt KO XOXUgUĴUĴT$@Vx@ \Us`XX%TZTZ@V T:X꛴X@@_o`I`YIXM@ֿPAXAL[ ƴ78)ֿ<LD Z5 (Tn;` lQȾQ: pQlQ@̓( T`棵ZXb#@25 D`[@Vq  K0#`@[zXx8UAUnUػnU[U'}-&\[zXx8UUUJU$T ` +H ;\ z\zXx8UTUAJU T  Y0 ]zXx8UUUA&[&%&<9 *z]zXx8TT7U$@U$U09U &,ܬL`^XT2TmTT[[4,i_XmT T [[(Fhtܬ0K@_XT7TmTT[[e-v@` X^# ` =` 47#4`$x-K ` X~ `@ ^#NK` W# ]   3H FaX%@V H@Vg@VWX,$H/L`2 b2 X#`9@U>L@Te ' E7-b X{UzUBTTT<8B Z`cZX1 T@l E $$z#ρ t$ZdZXxjGw@lL`X wX!8 ltZdZX`ɴ] "x@Bdp޶X]^Xp`iPa`@eZXXd-XeK{XfKmhXl Vh\5ZeZXx/  Xɴ`Dҡt-vZf ZX@V V  `V +` }7W 7@ @`@W {(0D@  gX1>Vm^#`ʴ={ H@:nzwgwXC`^U(`!U,X0254D< K ȬC CR `hR X85Vb# D|XCU?> cDӎiӎ(:@ȿ!2C$Ы) |ӎiӎX7$TbX"T 1 U @V C@V$ /d $@jӎX1T$Tl̴UhTҷTH@+}jӎX8D Xw >?$ 0"< 0k kӎXUeU_U_U_U_U 0r| lӎXUKU(DUw"UV8U,2V@  lӎXA``¹>`¹ TD-@V L@V$~@V(XP8QhD`mhDXH@V`~` Be`ཹ(DP4<4*rF @Q EdnEdXTӺT"Tuӷc{,4HH"<DB}EdnEdXT"T p`T,D`¹4R} @<4Nh, H R`@oEdXɸTQGT,TTBc BU4<4 0 H RoEdXɸTQGT,TTBc BU4$Y` D pX@@VܵT6T ̷TWW ($w; \  qX@@V(T(T "ݵXTӷT ,(p^  qXjݵT|ݵ@VݵT (TGTԺT$0,~:< l)`rX(TӷT>fT^T:gT VgT(( ysXضT^T^T^Th@V  @V$ Z( sX D^TrT nh@V*@V*@V( &۩4e @tX);TŏTTZ8X_XNL\htX#@Vu( @Ǯ@V쮺@V Dշ@ƿ$ h]~X  uXTǻ D =L DT+T,(Cfd x vXRfTŏT̷TITE@V T$0,$p l vX@TTT̵T6T CT(0(N5* S`wX@T̵T:Tﻷ DtTmI`¹$,(Xk x#xX@TŏT̷TITE@V T$,(G" xS xX@TŏT̷T TR@V T$,(bT  @yX@TT@V̷T6T-T$<<o yXڴ` tZ Et`,`84,¶ܳ$`&z5 X7TKUCPߵh1U $( %0$ {$XG 5@V @VET'@V#@l p0i {B(@ @I F (TTSgTĬS0@T,S sH/1`|HXT@VꦴX !X @VF`TKD(@H}HXG2'X? b@XǁXe_ W@H}HX#c2'0qUXF@VX  )@~?X秴@c!Ui!UU'@D:@D j-M?I~ I X#@eX@M`d/e#e~Pg-)/`AI I X9d$`X%dRf9@ii}X@fGg$ ( B`Hx x XLX<*Xƒvmv ҃vXvLiKǀ Hxx Xz@lYvvt@lݶ@l kL(H6o Ix`x X1BsEBXΨ v:lȴv@62u8989 (V hT"\L[`\<[0@\[0py`LX6+LA 8(0ųt̻@XXH   Y (GD]-Kmv(#uu!L(]$]()]%]0@*]|&] Hm$`㵻Xcrm9uX҄X탴Xd@A'˘ 㵻 X?lTPU{Q(@uRtT]u\w-l Oٺ X+LB|Y  40 $d z` X!V!V5/VYyd,sX08C` X]y*w …@y҅@V$Nt(nt0`@el$ R Xd@G8=@l@p@lH+tP~tXV`-Pv S @  X++@k11 @# H80V`UN XB,X쯴UUUe1 W,XC@ NN XB,Xc$e1,WAB |(T" "2l k0@3l kO 02 XxU'UEU5ZUGUTU 4,fp 2`2XÅY@V QTsD(XV`22XG 5@V @VET'@V#|84}RдF`^Xce` C] b#,$X4 8`lH)@H) X*@Vm@VuyvXX ׈t(ld.d.X`VEX1@V DOm``Wwܴ[`s: XRf״TX$FX`(PRHX((rn: : X 2@II /$(($`:: X 2I@I@ /$`TFLq v`: X.C خ 8ӴXT)XUpV00#v 3zXشU@H`z "V e,gx{XD Y`Ls숴@ I&$8@ǎp@p XλttqKX+_U$0X (/` Xy@~TU VWVX$, ~  X_f` @V @V$$@V($$ro|%  X5@V*0# #@VBR IOGh2'XVVzV#V &VwVAq+ @3`3X11` @Lg@V# 33X11 @Lg@VhL 33X11` @Lg@Vt6 3@3X11` @Lg@V<8Ih@ZgX1 T@l E $$QkoȰ>@   Xu.=n@U+XU7D@D$|׫Ȱ~   XuQ=n@U+XU7D@DLb| H *xgXz@lYvvt@lݶ@l kL(*func(context.Context, string) (*govultr.DatabaseConnections, []govultr.DatabaseConnectionPool, *govultr.Meta, *http.Response, error)*func(context.Context, string, string, *govultr.ContainerRegistryRepoUpdateReq) (*govultr.ContainerRegistryRepo, *http.Response, error)*func(context.Context, netip.AddrPort, *buf.Buffer, metadata.Metadata, func(network.PacketConn) (context.Context, network.PacketWriter))j,.W ErEr'Tp)JNtIw)TKNДI0@KNI|LN,I( e6\ȱ VKL%TDKT7 7`$@V$T$4L% r{@@ӎLTCU*U U |UX (Z00Q LbH8`o `K (,`|Uۧ-S \ lgI1h BiBij-_  (@t"T Ԡ(#`W# ,-_(`f"̚  L#`xW# - `(gs"Dt ė#`tW# p+4`9ll LJ`M`8D`p``0@*struct { F uintptr; X0 certmagic.Certificate; X1 *zap.Logger; X2 *certmagic.Config; X3 context.Context; X4 string; X5 *certmagic.Cache }*func(context.Context, string, string, *govultr.DatabaseConnectionPoolUpdateReq) (*govultr.DatabaseConnectionPool, *http.Response, error)*struct { F uintptr; X0 bool; X1 protoreflect.FieldDescriptor; X2 impl.offset; X3 reflect.StructField; X4 reflect.Type; X5 impl.Converter }*struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2responseWriter; X2 *http.Request; X3 func(http.ResponseWriter, *http.Request) } [y ymLmL@JUM@V5X [X w"@ @z `h 0--h'(, YXw", YX,X Y X.(, Y8Xq, YX "%&0|  @nTLT#w"@T"ppp0#p p8-`3( xZZYS3ZtZY|ZZY} GZZYW# ZZYHgA0$ F@棵`@;#@[@U@AXDA;@ؙ|-52 @Aφ䮆A`Іحwц2Aц识0@h҆<7Bӆld-kE Z Z`7I^#/M7`$N N`j``Ry!AJ |-Q`3s]ghtd/@[`\u@u0]dW\9ZZ@+ - ^777_7 7<١\h`ZZ@+ -`¹ ^м777_77!\> Z Z@+ S ^777_<7,7  8 ZZ@+  X ^Ⱦ777_7ܾ7E-@Z`Z@ +=@V ^777_77\>ZZ@+ )T ^7x77_77>ӗ-iZZ@ +=@V ^777_77@\Z@Z@+ -`¹ ^87(77_\7L7\S` ZZ@+ ) ^@7077_d7T7) \<ZZ@+ -T ^(777_L7<7[\XD@ @`EtV R: pk`i_%@l`xi_((E (tH@7yz`Ec: r`h_%@ s`L_$bIخ.`d@7:`o)T!X 0@RO`@O"@hSOAO-p p `:d= B`@ yl@ X *@ ^B@Y&y- s@LU`TdTbU]@ Lc@jccpjc gx@@S"~UgTQT ]@ 0cDc0@cc*go.shape.struct { Start github.com/apernet/quic-go/internal/protocol.ByteCount; End github.com/apernet/quic-go/internal/protocol.ByteCount }*struct { F uintptr; X0 func(context.Context, context.CancelFunc) (certmagic.Certificate, error); X1 context.Context; X2 context.CancelFunc }MS0v VG YT `X f0(vqN@T̵TU-@V! T"_T[@T$6X,YX-*func([]uint8, protoreflect.Value, protowire.Number, protowire.Type, impl.unmarshalOptions) (protoreflect.Value, impl.unmarshalOutput, error)*struct { F uintptr; X0 *struct { f func() go.shape.bool; once sync.Once; valid bool; p interface {}; result go.shape.bool }; X1 *[4]uintptr }*map[netip.AddrPort]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*list.List[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]]$a~* 6|-h K 00 ̊̊fC ll` ЍЍf@C ||$C DD4`% dſV.V^&VſV) 䦾U(ƿX0@8Ԭs`(d%TT ,T,ߺT4RX<ǽ 6|-'Hg3Hg3W# D2D2p`{2ԙ:Xd_KUs#X``oꎵ hKLLuld x3@V(3@V,ݴX0T4v$<}$D$25@d‹#T%T3T͋X ݴX!\X"o 6|-`M 4%4%iMD%D%3%%`%%W#`d%d%TEU/ 6|-nM y'y'iMy'y'38y'8y'`d%d%W#`%%Tz 6|-P @k%N@hhTT%@88@j+DmLmLdQXAXVV` WD]*qNdT 6|-XVmL%#koO$4 6|-6@mL%  k@ %@PPk{dZ4 6|-"`:mLOh"Yk 61S |-# mL'`2O5O0[Ē#mLmLd\Q`ƹ`P'PV]  Ւ (% 6|-vBmL `jjH8h8h hh%gg%`w`(m(m |- mL 6 Om %8`5\ 6|-%{@mL7xP" @(&`@݊L7Tw|mL`mLdbgVVrgVĶV:VжV$Q(O<$RmLmLdLOVU QV3ULN : X!sT0`U(Rdx8UnU1R@U8U:RT \'T ` ( HFhZXR (R@(RdnU1R@V8U:RT \'T ` {`<<mqh@OOduT)@йpй9T U(9oU0Z8pv1 6|-hO0@91”`P#P#ȸFF[= 6|-i`UQ (5qqp q qqqqqqqÒqqD 6|- !:@X@~((B,`, dl<T▵Ti ѻ`Kqٿ @ٿ$4_'`b 9dnZVҶVȷVZVBj (X0$ KԯY  9dU&hT }q&`:X ) 6|-;r 9$`oo;9xoxo$<``o`ohohooot 6|-D`X3( oZoZS3ZZ"`@mZ@mZ܉Z܉Z} G0nZ0nZW# 8Z8ZᱠHDQQ4M\i ""# " " " "dǘ 6|-`ErmUT 0_N0_NYr`$`N$`Ncr`N`N0@aNaNj>`iIiI ?r>"HF`ErEr4@ȵi >8ZNpZN0@[ND[Nd$; 6|-?@uEr0@IIlDIDI8lIlI-?l* 6|-Er3UFF>` 8F8Fr`gsRxFxFz@FFIFF}(`GG8 GG`GG((rW 0\`vErd:XVXA@V@V"n@V UtcwLc$m|Er`Er4@ȵWU >8@NN0@dNЕNd 6|-rOEr8NNVs* U@.d)t jX@V%T!1 6|-vu h h   q  l# c @@vd@ Sa =0(v 6|-H39`X6X6%@0@8"@88s` 7 7T<Ewwd`TY ',q8>`UDOt5 6|-w"*/`` "m >+/||| 6|-gX?t5t5qx8686 R,66~550@557@55hTi 6|- X?55qx$5$5 R,55~550@T5T57@8585ry 6|-X?55qx 5 5 R,Ф5Ф5~550@,5,57@55J 6|-a`Kw"@YY;XYXY`3 Y Yp0"Y"YBuYYգYY,$S%8J,,,,dD6 8@V2@Vb#y@V$@V(^0a``zdx8UnU1R@U8U:RT \'T ` (P0 H zzdnU1R@V8U:RT \'T ` { p]t $@ zzd&U1U UuT <T T{Y+eT 6|-Qz2PwPw"vww[z(&`ez̿ 6|-52 @AφφA`І`Іwцц2Aцц0@h҆h҆7Bӆӆ<8x,HDw22 d#`9@U>LL&Ts'((T4U 6|-5`{2 ņņzCƆƆ`ĆĆBĆĆ#``Æ`Æ0@HĆHĆ8X 6|-{2 ppzD`LLB\\#`0@༆༆L]`Z`ZdwQ Y GP`$$ hl 1ZZdxj  xɴɴ` ] ` 6|-Z?CfCfMAfAfZ@?f@?fZ Ef Ef2y$Ef$EfW# CfCf߃ 6|-E`}Z?xjxjMhjhjZjjZKfKf2yOfOfW# ,Lf,LfY 6|--7Z?ȌjȌjMjjZjjZjj2y0j0jW# XjXjU˜ 6|-`]Z!|^f|^fbj`dlfdlf`efef(af(af`pcfpcf_T \if\if 6|-Z ~ XCgXCg GgGg~TgTghhIghIgQ tPgtPgLgLg 6|-@ZOgg^#`DgDg&gg@ gg gg@g@gr5`o 6|-59`j,00||(?ܞܞXXll^pp\5LC{`99d` @Y@VP' T5@V (1@VX4$hsVT zzdtT8]U ^^T CU(X0 U 6|-z^#@B@B|@BB|@BB TBTB`BB B B?i 6|-`^z^#B>B4N ?B?B@N 0AB0ABBBBBZ 6|-!^O^#BB@BB DBDB#0BBBB BB D\ q9 B w4%T"T¡X|DCD4C0@`DC-s 6|-zgwbb`C`C@CC@tCtC@CCdCdC 6|-w|&`DD͡TDTD'``DD3DDXDio{ VwwdC`&(X,ء@V0D4^ @4˴XTQh&dC` e_LtP_hclc`4,j.Dq}@ӎdT] TUtT!T `¹(40PӎdԲTTTc@DʃT$xT,84 1dP H`ӎd-U0̴U$T_T DT(T0q 6|-``hDWt>t>%:%'`(x>x>>>n 6|-Q`3ssghtht/@`u@uu_ 6|-QmEd".Q #\\7@T)00ǣ```0(,QL& dW ԺWTl7W̵T:T`¹$40M4 d@V踷TӷT 섷TiTT$~T,40!8 @d@@V̵T T &T6TT$T,0$+ `5 d̵T;T̷TTӷT @V(@V,00  pdjݵT|ݵ@Vy)T (TDT졾T$} D,84xe) d̵T6T`¹`B3`B Ժ`$TT04,aA l``dhTlT̷TPTyT #T(A@V000ht_y pHE`djݵT|ݵ@Vy)T (TDT졾T$} D,, d@T̷TTTX@V j@V$E@V(40ۛK |c* dT}*T͐T@V^T˷T$T,40$9< |J# @d@TT*Tz^@VշTT$OT,$MOtH dT^@VNiT L@V8@VG@V!@V 40хVx gf d@TŏTT͐T@V );T$T, 6|-S c$ hh30k0k 0c0c@7bb(?bbr ee[9V 6|- $ uu3HxHx`uu(?0|0|r xxm\z\z0( `d -P# X(|aX)(1@V,կ 6|- `<Ө<Ө"m4ب4ب#`ӨӨ`ҨҨΨΨW# LҨLҨ5Q 6|-h@Z@:x6x6^м7м70@667_77m:d6d6MH6H6^ 6|-`GZ@:66^770@667_̽7̽7m:66MD6D6on7 6|- Z@:77^Ⱦ7Ⱦ70@x6x67_77m:x7x7M66t 6|- Z@:'7'7^770@'7'77_77m:'7'7M (7 (7Ⱦ 6|->Z@:66^770@|6|67_77m:66M$6$6? 6|-i`Z@:)7)7^770@`*7`*77_77m:|*7|*7M*7*7ad 6|-Z@:66^770@667_66m:66M4646M 6|-1Z@:77^770@777_77m:77M0707< 6|-Z@:H7H7^770@777_Ŀ7Ŀ7m:4747M77;X 6|-Z@:h6h6^87870@667_\7\7m:T6T6M\6\6|jd 6|-;Z@: "7 "7^ 7 70@777_0707m: "7 "7ML7L7g 6|-T@Z@:%7%7^T7T70@h7h77_X7X7m:l7l7M777 6|- Z@:66^770@h6h67_X6X6m:66M66 6|-Z@:,7,7^87870@L7L77_<7<7m:P7P7Md7d7h5A 6|-HZ@:`7`7^X7X70@777_|7|7m:L7L7M77~r 6|-iZ@:5757^770@.7.77_77m:5757M/7/7i| 6|-SZ@:66^@7@70@667_d7d7m:66M66~1 6|-d@Z@:-7-7^770@777_77m:77M770,rU,` d3TbTX@ƿ ο`¹ҀT( H0 B4;@V'@V`@VF (PTtSgTS0@T|S<<tV@B Bd>`^eX"X' A jp 08TLI `2H HdkѴk Ѵkmk$]0<!!HhLH[$,0 6H`Hd%@q 7`. $R-4ѴkPmk\dX>H)sX<X<dN\1 ? * *03 =PX0 6|-@?~ I^I^c HO^O^h1L^L^ O^O^5C | S^S^gd`V^V^f 6|-Y ]]C n ]]`n ܷ]ܷ]vn d]d]h ]]m]]_1 6|- u``#t ` `CL`L` ``r ``0  ` `4(J!8I ad,@V@V@D@Dd@V d@D$@V0!$ 6|-,|!@ kk݄x$k$ky,x5l5l" y7l7l`,8l,8l3`y8l8l 6|-@1;lledldl~ll ' lllltlUv,B3ۺ`3d$D Tm@B\pF@B`>@Vdh\| 6|-efQ_@Q>@Q>"|K>|K>H`lP>lP>ihT>hT>0@s R>R>40u||o ԩdT1T&T@|TLͻT$cPT,? @d  ?U,ZUE+U?U ?UBG 6|-u / "3 >|:|880@xx1w{ 6|- / "3`` >|:|즢즢0@,,1wdYL. 6|-/ aRRׅRRRRw alRlRT)̈R̈R" aRRB 6|-pH) @S@SxSxS<(&`_if: 6|-d.x 0nq0nq'qqu@DnqDnq(qq/``nq`nqp7@qqp⢋ 6|-r. d.x oqoq'(q(qu@oqoq(qq/`8oq8oqp7@\q\qV ~ 6|-" d.x xnqxnq'qqu@nqnq(qq/`nqnqp7@H qH q 6|-B d."HpHp`4p4p#`lplpW# ppD p pŊ aY md.d.d9 I /@VV@Vc@V@T'@TR^0L] d.dI I`ue )" p@ @ R@ ttu\Դ.`d. d.d"@2@p״;U b#lh 6|- : Gpp`3((X@`}X@fpW;S 6|-: G~~`3L~L~X@~~`~~}X@f~~p~~gv 6|-G : G~~`3~~XH~H~`4~4~}X@f~~p~~ 6|- : G<<`3X@`}X@fhhpxx+ 6|-G: G`3Xtt```}X@f$$p44K 6|-o : G  `3l l X@0 0 `  }X@f  p   aR "; ; 4e¹e /@C@ Т$ ,. xܤ zsP8X  !4#TMj@ #@V B4 ( RÐ 6|-HN#\/\/X // ,,d 55#@o))~  11($< 6|- ` ̃̃K΃΃¬̓̓ eσσͬ |ʃ|ʃepЃpЃݜu 6|-r` ÃÃKǃǃ¬ŃŃ eǃǃͬ eɃɃ7X 6|-r` 88K¬|| eةةͬ ``eq 6|-r@` ooKpqpq¬pp eLrLrͬ \m\mexrxr%6 6|-` |u|uKTwTw¬vv e0x0xͬ rre\x\x'0 6|-` p{p{KP}P}¬|| e,~,~ͬ xxeX~X~V 6|-`` ttKLL¬̂̂ e((ͬ ~~eTTw 6|-` Khh¬舃舃 eDDͬ epp]9 6|- ` LLK<<¬ eͬ eDDܩ 6|-` Kؔؔ¬XX eͬ ppeѨR 6|-` xxK¬,, eͬ e2M 6|-'@` Kll¬젃젃 eHHͬ ett:^ 6|-H` ߃߃K¬ eͬ ,݃,݃e88$W5Z d/ *dK@q"ÿ+@ÿ㬴@V ش@V8@V0> 6|-p I````B@``YK``/ Hr$`$`m 6|-H ,  *LX_d w( dH+T  *LX_d 7cw(P9c8cic 6|-2`- `#`uhchcJ}u02,- d%@URU.8U M@DU$@U㾎 6|-b  Xd1cd1c8:2c2c~4c4c0?,6c,6cpcpcHcHc 6|- _ "`3  :|? >u 6|-s` _ GG"`XX3XZXZRR:|UU?SS. 6|-3s@ _ "`잡잡3HH:|44?((* 6|-h, ""  3ddr ?TTa 6|-n1"m3 >+:@|<< jbn 1T"mÞ3 tƞ >+hĞ:@|<4ƞpŞ Ǟx 6|-1 ! vk( 6|-W3"m؝؝30ڝ0ڝ >+ڝڝ:@|LܝLܝܝܝ ݝݝ —W3T"m؝s30ڝv >+ڝt:@|LܝLvܝu ݝ`xJ;4;d`%  Y@V(',5@Vlp(1@V 1q 6|-ul 1)ztt8?  ddf``@iA 6|-D@, "؅؅" ܌܌344ԄԄr ?$$HDn H`6H dms@2 - "&Vc0JTDHD! H7H dm s @ " 'Vc0JTDHD}H7H dms@ "(Vc0JTD*struct { F uintptr; X0 *struct { f func() go.shape.*uint8; once sync.Once; valid bool; p interface {}; result go.shape.*uint8 }; X1 *[4]uintptr }*list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]]*struct { F uintptr; X0 *http3.ClientConn; X1 func(http3.FrameType, quic.ConnectionTracingID, *quic.Stream, error) (bool, error); X2 *quic.Stream }*struct { f func() go.shape.interface { Error() string }; once sync.Once; valid bool; p interface {}; result go.shape.interface { Error() string } }w-"`mL:mL(Iq$qOh"Yk,,ָ@i(Q@;QXM\@Sgܿb?)#$i!! qg Q;Q(M\i|!H!#8""L""" x""ǒȐEr<Er(@ȵ) 8lsN(sN9\tNsN0@TuNtNdD@Q!\)V ==~X~OTMc ,tX8T<u@T}- = h`|x 4`|%@DK@0@x?n@-c`Z`> Zh^#9 gi@H h c`5 @`d` M MH <4T$ H"f?EdXɸTQGT,TTBc BU4.ؕvR-&`? h4 Ցe 1  [ X @e Te e g (f@ B -kBI@@ I h9d$`XMK@g%dRf9@ii}X@fgGg-DI@ I h9d$`X%d2ARf9@ii}X@f@jGgЇt&x0Ax0(j $j` Hp!o!` q!p!wN1*func(context.Context, string, *govultr.DatabaseAdvancedOptions) (*govultr.DatabaseAdvancedOptions, []govultr.AvailableOption, *http.Response, error)*struct { f func() (map[string]int32, map[string][2]int32); once sync.Once; valid bool; p interface {}; r1 map[string]int32; r2 map[string][2]int32 }*map.group[netip.AddrPort]*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]]*tree.Node[go.shape.struct { Start github.com/apernet/quic-go/internal/protocol.ByteCount; End github.com/apernet/quic-go/internal/protocol.ByteCount }]$$><(j`D3LT7[UU 0T)`ZYh;FlZY1_-=Q EQ \i"8!#"`!L"p!0@"!" "![}-@QEQq@i!!#4!$!X!H!0@p!!" !!|-Q`FQq@iP!(!#!!!!0@!!" !t!"_9|- `ӎGӎV`V`֋֋#`֋֋``֋`֋֋֋W# ՋՋn0ZGZL+ =@V ;^777_̽77 m/-ĮZ@HZL+ w ~"`¹^7p77_77t  ZHZL+ ;T )T^X7H77_|7l7u0hIBL5@V9@V9@VԸ@V @VghTS0@tTdS    JL@x xL 2Tdw: PY`#_%@`Z`#_-\-PJZ\o'(,(ז֖w",tؖז,ٖٖ:,hږ`q,ۖ$ۖ]~y-p`#`KϞ G@b@ba|cܙXed`0fe}X@fDgf@@V{"xK VYY[T (,  Y8<$$-x]L V`B`B`B `:?  @VH *func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }*func(bbr.Bandwidth, bool, bbr.roundTripCount, congestion.PacketNumber, congestion.PacketNumber, monotime.Time, congestion.ByteCount) congestion.ByteCount*func(monotime.Time, []congestion.AckedPacketInfo, []congestion.LostPacketInfo, bbr.Bandwidth, bbr.Bandwidth, bbr.roundTripCount) bbr.congestionEventSample*bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error)@@po`!`PpſV.V^&VſV) p(ƿX0y 4, 1{Te EmLQmLpdV7kTT=@Vd@V%V kV$4ܴUH.~mLQmLpWWWpWfW W(X09X1,,<9Eܯm@R p@IVv#0k< $<`(x0 2jh 9R 9p &T @r̺0&@ndiqXt:XuHDNrXR@s=S=p@V ;@V@tp`k8#<XD"XE 9[H`Er TEr@@ȵZU !V(j8QNlQN0@RN@RNd401tc.\ErTErp{sU@V s`¹ X#TT$x?T,LL=gx@Er`UErp@ fVs(`<@V0b#4s#<)Dh<`H,,HuVApV&t #-=?s`&迴,n@`$`(@8$$ V p`--̵--`¹ "oT,4$@84(ذN @W0pض@U((T>_T Z_T^T̷T$ U,hU0,,qR XκWpb#42X*5@VE@V EX$q D(yT !`Xhp> @V +1@cLFVc` ࣹtԻ`\Xd%б VK YVKp@@$VHVL7+VP T$=Xô=XXtS x # YzpU[UhǴU U TT.|ԵUT8  n `Zp@\U(GU,RU.$\U0BT2-\T3BX4@<dL2[2 p#`9@U>LL&Tl (TX(`,T800J|qZ[Zp:ɴV׵@'2u$ `( L,@@| ѧ Z@\ZpN@l{t{u puQصX4DʴT5]`H8 P[VȱH k\pX8@V M+X0:2O;@^D<a в z]zp^T @Vl z ٵ, 8{o{5T`¹@_-O!.A.A 2A 2AX@0A0A~d/Ad/A8;h1Ah1AXTי!@O^Op?@8I46!0<CUDYUHD`Lb#LMXT$,, }`_ӎpKTT}TE_T]}U}Ug}U 8 05v (/~ ,`ӎpۺT$T?U$,ZU(E+U,?U0`DU4xp&pN4hD`hDpL\>   kA8\`XD~`HDPT4(td x`@ap̷TXTTTy;@V GT$ԅW,;W0<8y^ ܰap@@V̵TGT ŏTTfT$̷T,T4lh  `Gbp@@V̵T}T TXT ӷT(๷a0| f cp@T̵T}TTHXPGpT)|Xk- c p4 1 [ 1 4 [ X@ eR\ @\ * 2 F B\ X ,,eg`dp@V);T̵T }TǮ@V쮺@V D$շ@ƿ(LH$ԚIh `ep@TTV@VŏT+T);T$OT,D \40$ `ep@TT̷T\ܵ@Vպ@VOT $@V(od@V,40}!`ˉ@fˉpF_ >d d  ,$X040rPh&fpA@6g[TuT xb`¹@ƿ$&X(bT,,,0ƌp  gp #T#@@V %@V2.@Vb@V +`^*``(<,Q4}  h?p$`ļ G@Vہ` '@V(G@D,c@D(D@V4I@V8Rmq0 h?pPcX.XXX!X.X+X(XT0+. `i?p秴@$@r,ӴXXG@V]@.U+U rZ8-A j?p'UEcU)UMTXU7-4EIj I px;@k9d$`X%dRf9@ii}X@fkGg0c /@x@kx pB,N@lv wEV1W$qX,ӲX-s{ خG`1 k p{vv /@%*ۼLdW+.XU;r-„ f9 !@x(\$\' )\ %\9 )\T%\" l*\%\9 +\%\e+\$\H@@,\%\P@*+㵻 mpT7@KmCPߵh1u4$<]uHDD̡o`|m|p!X!T x@`¹(@V4 825<CtB-- g `n p Q %@"`=\`` L\`P 2` 2 ,,clN) X 5ڷo5pb#42X* 5@VE@V EX$q D(gyod@tT9@V=@V pA@V'OO>O9PO>O0@QO=OnK0R u@p: p{XX״XuXXGXXXzqup: pRfx;G ,X HdƲ $$ Gzqp!`:%@ f<شBUe 4  rpw^ Hsv¿^¹1@ U(H ,@`XX?@^ ~rpI شVشV ,;f@DfiPA")T-v`p`s p p:ddl H= @SB`@ X *@ ^B@Y4i t@tT9@V=@V pA@V'@ OO9@ OO0@OLO*z\t tp@VT0QD5@V&V@[0TB-4@ul 1)ztT8?  df`X@44F`$'_ кup(BUQ\@V@ &<W2vX,X-4XT044i($$кvp(BUQ\@V@ &<,2vX,X-4X@T0*struct { F uintptr; X0 *zap.Logger; X1 *certmagic.Config; X2 string; X3 certmagic.Certificate; X4 func(); X5 bool; X6 func() (certmagic.Certificate, error) }*[]bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*struct { F uintptr; X0 []*net.TCPAddr; X1 []*net.TCPAddr; X2 *tfo.Dialer; X3 string; X4 *net.TCPAddr; X5 []uint8; X6 chan tfo.dialResult; X7 chan struct {} }*interface { RegisterEnum(protoreflect.EnumType) error; RegisterExtension(protoreflect.ExtensionType) error; RegisterMessage(protoreflect.MessageType) error }*struct { F uintptr; X0 func() go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }; X1 *[3]uintptr }*struct { F uintptr; X0 func() go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) }; X1 *[4]uintptr }*struct { F uintptr; X0 func(context.Context, string, string, syscall.RawConn) error; X1 func(string, string, syscall.RawConn) error; X2 *tfo.Dialer; X3 *bool }\u 6|-J&#=0=0L00T/T/<0<0*3<0<0`0`093V 6|-4TiM@&&0@&&x3`&&@&@&3 !i & &rM 6|- UiM@$$0@$$x3`$$($($3 !i $$rMk&C 6|-qmLWGC%k\U, 6|-w9mL`l7l7'`H.H. `x0x0'`77& 2 2`@1@1h** 6|-S3к[к["`[[g[[ȼ[ȼ[yp`l[l[0@[[84 8J[8J[< 6|-mR Hpp` p pT`oopppppppp`\o\ot 6|- m` '(@ xxw"@ xxJ(@ xx@ xxf(@ (x(x.(@ xxq@ TxTxߪ} 6|-~`F,A^#9 gi@H c`@`d`MH PP۵ 6|- 3( ]Y]YS3ZZ"`ZYZY,aY,aY} G8[Y8[YW# _Y_Y&#I' 6|-i(;Qi!!#!!!!0@8!8!" !!1` !!!!(:[ 6|- Qi\!\!#""""0@!!" ""1` H!H!ԘV 6|-Qi>0@>>GS@@`d?d?x?x?,5 ??9 6|- ӎS330@99GS<<`3344,5 8686 6|-M:ӎS//0@//GSL1L1`(0(0<0<0,5 22ӟ 6|- `ӎS|%|%0@**GSX-X-`%%%%,5 ''@m 6|-PӎS$#$#0@D#D#GS##`4#4#$$,5 ($($`h 6|- ӎS""0@d"d"GS " "`t"t"@"@",5 ""n 6|- Q ӎS0@  GS `L L ,5 M%u 6|-a:ӎS 0@ GS`pp| | ,5 dd,(;Qi ,! 'd_Tb)T%TiV3VV 3T$~`( 00\ | `'dT7T%T"T- iV(3V,K-t8/. 6|-B}`nEd hh:`  ` 44\ ߕߕ~ A( S# 6|-D &&4 1 x"x"D@ ''X <<[ ##B ! !捲 6|-t4@f }}1 @@X LLf Yf 䇘䇘2~@ B [ V 6|->Z@:0606^770@667_<7<7?m:66M66`iC 6|-HZ!66@:66^770@667_77m:66MH6H6^Uf 6|-TZ@:77^770@ 7 77_4747B`m:77M77!U 6|-H' jBV|w" p2Tp2TV'd'L0TL0Tr'(.T(.TR 6|-H; B@/X@/X: B>X>X9IXIXb@TJXTJXPXPXc@KXKX% 6|-V?; dtdt:$t$t" 3t3t5c tt tt0@,t,t7`TtTt00 _@n?d@V@V @D$@VHB* (" us.: 6|-I zzzz@zzMzz0@HzHzzz"ezz2 6|-„@lf9 !@x(\x(\' )\)\9 )\)\" l*\l*\9 +\ +\e+\+\H@@,\@,\-T 6|-  ``t``t``@P`P`Y`x`x` HHkD dԴyt KmCPߵ-$D;@8`^b 6|-om|d@&#Q4҆`'k`'kZHkHke 6|-aaGpGi@w?5b ́́f 6|- O "--" h6h6300}d+d+:@|$5$5r 22?}((OBG 6|-LQ ! VOVOׅ`D\OD\O`]O]O8WOWOi@eOeO:4_O4_O`~. 6|-3` "/pI,.#` V 6|-`: G@~~a~~`3<~<~XT~T~`@~@~}X@f~~p~~! 6|-j : ~~`3 ~ ~X@~~|~|~`~~}X@f~~p~~Ub 6|-ǝ: <~<~`3~~X\~\~~~`H~H~}X@f~~p~~ 6|-.R`: *@~~G~~X,~,~`~~}X@f~~/ph~h~k- 6|-` xxKhh¬ eDDͬ 00e/> 6|-/`^ h9h9?%%e`,%,%"@%@%`77#`%%W# ,',' 8 6|-ǎp 0 Щ`Щ`Xtx`x`*t\`\`Mf`Ь`Ь`r ``wt``Vf``$ 6|-r("ܣܣ ̥̥#`ئئW# ``"%޵ 6|-U _`"3(( >|:|?@ @ K 6|-` _`KK"VV3UUOO >|YY:|UU?QQ. 6|-ן@ _`"蜡蜡3TTܕܕ >|쟡쟡:|?lltr 6|-Q "LL" 3HH :@|xxr HH? $$P 6|-t`t"`II tdtd#`HHW# KKJRRf ^ ^fSS: 6|-l 1`ww0@uuk"@vv 1\z\zhJyy.1*struct { key netip.AddrPort; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]] }P> 6|-h@x #`\\;]E\\\LE\\E\\#\\\ FT\T\B\\ 6|-x #`t\t\;]`F\\\L`F\\`F\\# 4\4\\ F\\B \\*bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*[]struct { key netip.AddrPort; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]] }*[8]struct { key netip.AddrPort; elem *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]] }*[]bbr.entry[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]hk-m`۶ x^#%@ 4N N ^  @N  j`W# NN D +-Ν ۶@ x% %N 4ON 4 3% k %@ k 44` ` I?- x `+%`+^#K P [  c`@`d`crW# > جi ZZX+ =@V %T ;^777_77.l#-Nٺ x:ddl@q= @SB` X@ * ^BqlqYpl:ϼm@X8 HC0Pw\'XddTh: @]`?_%@T^`?_]e#I$(Hel4wwR|x B8yBy*bbr.WindowedFilter[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.Bandwidth,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]4,U&`-` |1 -/۴ `{I#U p1U"<۴X$($$c`0 |xU(1@V1@V#@V  #@V@1`Eg`@ h`ʳӸح6 | N\۴ #`{#`0@LK;X1\ GKh348 |X*ݴXZ$XXa$Xh$XXo$XP3X@ =~8@mL` mL|`&`{g&`{n&6`ǹV > UX7Xu& 88'G |w X)X S' uT'ep@)$蹴@V,'`'049|- hfS3TI[TI["`I[I[gPK[PK[A[A[yp`I[I[0@I[I[Xo 8=~3LTXdVT=@VkTq@Z܃Y0@̂Z\Y@ZYF7.>=` =|86D_@SM)@V\dUU`@thb#@@VL` nMg* Er ErL$X7$@h1UcrU8NNF0@xONFdF(H9@Er Er|@UXU 7 <XUX <U XX鐹m Er Er|w4`40`8@<N\D整>LSXP4`%ThhN1TL=~` =~|T_ەT :G$@(>0=`dPP,5pV g|'=T=UocW@(C@08@oHDDg7C?H`4 4 |=[JNTSNT u*4Cj|8b|<d5|@0v-2H4 H4|87@W >Z@`@V$@V rX$ؠ@V(G`6,頵U.(Hw@uG` G| Z+@VGZ`a+UPĴU wX$GX%@X&@0*p` | $+(X@@,V05xV4}ZV8$U< /0tԛ0O O|VV@@X @@VXTeTZTX]xV44MJ@71 1|(`uTh=X A(A`¹I@i$0A5(%,@ƿ0 00` z|x8TRTRTVT'TnT$T7T$U88CZ Z|{`@ ,j߹)ۿ(8j,j4TP!@hZ Z|"@M %$m@(M@30N4<A7EHcXP88H@Z Z|{`@ ,j߹)ۿ(8j,j44usd 9` 9|_<U\uV`(h'5@V(ʴU,'|X0880̲z z|8]p 3T @ƿ865@V &U b#(V#0ːX  L+P<JW Dڵ@:P`?b u@؉׉u<4cK) ` ӎ|1T$Tl̴UhTҷTx̴T$ڝT(: 0$$@ ׺` |xU(1@V1@V#@V #@V@1`Eg` 80;-8) |;g[TuT "TRX5UXÀXKb  v&`¹,ִz@6 |WncDXPT`¹l`x1@Ѵ@@@D,̿ 7H H|)h 4 Wj`f@V@@V b@V$'@V(Ѵk,mk8<4w  C` I |@@V @Vd@V@V `¹T(T0w@V8ll{Ah  > |~¶ @l4<t<JtDLXTk@VX@l\0:Ed0-2  |87 >Z|@V$@V rX$ؠ@V(GI,頵U.SgM w : |G je}TZ`.C 4خ PMlp44Jw93 y` |;IHشM Tش¹`ش $lش`(6/`,xش0@mGp p |' U@V0@l uu<u$u,>U4ru8H@Pϻ P|G` @VY"@V_"@VETTE'@V#80X,wv_1 ; ;|_@4<UuV(ۻۻ'ۻ5@V ʴU$'|X(*struct { F uintptr; X0 *[]uint8; X1 protoreflect.FieldDescriptor; X2 *error; X3 proto.MarshalOptions; X4 protoreflect.FieldDescriptor; X5 protoreflect.FieldDescriptor }*bbr.WindowedFilter[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAckedEvent,github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount]*func([]ackhandler.Frame, []ackhandler.StreamFrame, protocol.ByteCount, monotime.Time, protocol.Version) ([]ackhandler.Frame, []ackhandler.StreamFrame, protocol.ByteCount)*struct { value []uint8; multiline bool; flow_plain_allowed bool; block_plain_allowed bool; single_quoted_allowed bool; block_allowed bool; style yaml.yaml_scalar_style_t } ! hѶ h@oTpT5T:T p@@p@:@ֱl5T`¹@_- !:@]y]yX@~i5T`¹@_-V!H'H''':@''X@''''~@'@'JU( |-GVKy1@?`}`Rbr`0`PQ` X6Gd-`CI I 9d$`.lX`s%dRfxAl9@ii}X@ffGgC:-@II 9d$`kX%dRf9@ii}X@fiXijGg8;j*<-1`Oٺ:ddl@q= @SB` yl X@ * ^BqlqYx-g`B`] [\ P . u`(` %@"`=\``j\`P 2 44?P  : p]T]@U@U]@U@U .@ $. Y,(=j}*struct { F uintptr; X0 *http3.Conn; X1 func(http3.StreamType, quic.ConnectionTracingID, *quic.ReceiveStream, error) bool; X2 *atomic.Bool; X3 *atomic.Bool; X4 *atomic.Bool }$ 6|- 4@P^#x2x2/22( L2L2 22`22Xp2p2#\2\2\` 2 2f 6|- 5ix_&x_&iM@a&a&0@a&a&x3`@&@&d&d&3 !i & &rMd 6|-5i|&|&iM@&&0@&&x3`E&E&!&!&3 !i F&F&rM 6|-9E t #t # ##F@ #@ # # #Cj""F'6MjQr 6|-6 ^#\o\o9 xoxo oo ooc`oo@`DoDod`ooW# oo%*` 6|-f; ^#pp9 pp pp $p$pc`hphp@`ppd`@ p@ pW# !p!pVeM 6|-7`V 9^#eoeo9 `fo`fo DdoDdo |fo|foc`fofo@`PgoPgod` ho hoW# xeoxeo)! 6|-jW3<@lZlZS3ZZX@2Z2ZgZZ~@2Z@2Z0@PZPZ84 d&Zd&Z<wXErEr4l#@);@S mUT 0_N`bIYr`$`N(bIcr`NaI0@aN`fI_^ 6|-WErp)JNJNw)TKNTKNrIIrIIRDIDI0@KNKN|LN|LN<-饻 6|-P YEr^#mLmL xaLxaL3sLsL@|qL|qLh cLcL@gLgL\`tLtLрۻAp@  4T׶TP=`?\W k02eW mp. $n0-@4r@@ 6|- 8C@ GC@ \   @ 88x88XX\\YP@ 6|-`b08C@ xxGC@ \ @ <<x{{Ro\ ||88nPC =~d6TTͷ@V5ͷTT$0w"@ 6|-ӎ8Rdd0@GR,, @ HHX OO, 5b @@ 6|-S}@ӎ8Rxx0@GR   @ ȼȼX PP, 5b U 6|-rӎ8R0@GR @ HHX QQ, 5b LLBŤ- 6|- Eӎ8R0@XXGRPP @ 住住X SS, 5b &N 6|-q}ӎ8R0@XXGR @ xxX UU, 5b  6|-`ӎ8R0@EEGR<< @ ڏڏX жж, 5b ́́P 6 6|-`ӎ8RȬȬ0@8 8 GR @ ؏؏X YY, 5b $$YY 6|-Pӎ8Rܬܬ0@ύύGR   @ ̿̿X 4[4[, 5b $ 6|- Fӎ8R0@GRh h  @ X ^^, 5b @@7 6|-<_Fӎ8R0@hȍhȍGR  @ X cc, 5b U{ 6|-} Gӎ8R,,0@((GR  @ TTX dd, 5b # 6|-}Gӎ8R@@0@GR @ X pfpf, 5b !!H 6|-} _ӎ8RTT0@XXGR @ hÏhÏX hh, 5b `#`#[MG 6|-N_ Hӎ8Rhh0@GR @ ÏÏX nn, 5b **p 6|-W_ӎ8R||0@88GR @ ďďX oo, 5b x,x,{ 6|-`_ӎ8R0@44GR @ |ŏ|ŏX pp, 5b T-T-?9 6|-i_`ӎ8R0@xxGR @ HƏHƏX lqlq, 5b 0.0..KG[ 6|-r_ӎ8R0@GR @ ǏǏX >& 6|-jӎ8R0@ڍڍGR%% @ ΏΏX , 5b GG] 6|-ӎ8R0@~~GR ' ' @ XϏXϏX , 5b KKA 6|-} ӎ8RЮЮ0@,,GR(( @ DDX ̋̋, 5b MM1q 6|-`ӎ8R䮏䮏0@GR** @ ϏϏX , 5b NNuY 6|-} ӎ8R 0@LLGR,, @ ЏЏX , 5b PPaT 6|-_ӎ8R 0@GR-- @ яяX PP, 5b \Q\Q\ 6|-ʢӎ8RHH0@0ԍ0ԍGR@0@0 @ (ӏ(ӏX @@, 5b TTI% 6|-_Jӎ8R\\0@GR\1\1 @ ԏԏX PP, 5b XX 6|-_ Kӎ8R0@||GR44 @ 0֏0֏X , 5b cca 6|-_ӎ8Rtt0@VVGR4D4D @ ޏޏX \ǎ\ǎ, 5b hh e 6|-/~_ӎ8R0@GR77 @ ׏׏X , 5b rrXr¡ 6|-9~ӎ8Rԯԯ0@GR88 @ ؏؏X DD, 5b zzY 6|-C~ӎ8R诏诏0@XXGR:: @ TُTُX , 5b {{< 6|-`ӎ8R0@h̍h̍GR;; @ ڏڏX , 5b $$e% 6|-`@ӎ8R$$0@|ɍ|ɍGR(?(? @ ۏۏX , 5b ||6  6|-Lӎ8R880@\ˍ\ˍGRD@D@ @ d܏d܏X , 5b LL4K 6|- `ӎ8RLL0@܍܍GR|A|A @ tݏtݏX TT, 5b ܉܉6 6|-M~ӎ8R0@GREE @ ߏߏX ώ ώ, 5b r\ 6|-W~@ӎ8R0@GRGG @ X ώώ, 5b ؠؠf 6|-ӎ8R0@PPGRHH @ X DюDю, 5b ,, 6|-a~ӎ8Rİİ0@GRII @ X ҎҎ, 5b Ve 6|-k~ӎ8Rذذ0@GRJJ @ X ԎԎ, 5b  u 6|-@ӎ8R찏찏0@GRKK @ X ՎՎ, 5b 즏즏> 6|-@EUS ЗЗj <˗<˗E= Wٗٗחח# ؗؗdS`$ڗ$ڗ# ٗ ٗ<ڗ<ڗE 6|-k4 ll1 XXX 蝗蝗@ D @a أأB [ ؟؟K Ha 6|-uD [ Y PP4 $$1 D TTX h B@h  6|-5@D 4 ӘӘ1 ٘٘D X@ X՘X՘i ۘ ۘw PݘPݘB [ HטHט`w, 6|-˭k $ $ $`i((`i( ( $'n  `i%\\|8 6|-Z@:66@_66^770@,6,67_77?m:66M 6 6,$շ^l ;Z:Zd+ =@V X  a ^`7P77_7t7}g 6|-`:Z@:0606#_66^`7`70@667_77?m:t6t6Mx6x6߽Ad0Z <Zd+ =@V ;9-9^ 777_07 7^ 6|-@Z@:66^(7(7@FL6L6b@d6d60@667_L7L7m:66M66 6|- v'(]]P:, ] ]`:,]]Q(,]]z`s ] ]@ ] ]@]],$]$]c 6|-  @ aa+KTaTa=tP aP a aar aae a a~  a a` a` a*oe 6|-N ^#$b$b9 PbPb bb 4b4bc`bb@`lblbd`|b|bW# bb|tb?d8 HC0Pw\'XddTh@.p: [`8_%@\`d8_,7r0 @dB+4@V >[@V$@V(: f`DY_%@g`(Y_u 6|-8x1 w d dJ/ w d d8H d d 0 d0 d(3 w' w5_` 6|-@|| l l"`w("l("l"l"lg`#l`#l0@$l$l9 qkqk84 tktk,DukDuk Zf_ 6|-, 3#8w:`@N ` Bb`m9 6|-`Z` TTX  @ rV (L 0:@DQ 6|-@`bbJ 0b0bKg`(b(b 8b8b3J J T'bT'b9  "b"bN 6|--B* C@ {{ -{-{m`1{1{6{6{3{3{p9{9{. {{0{0{HS 6|- : 9dL}L}$`ܘ}ܘ}X}}%dh}h}9@i}}ih}h}}X@f}}Gg}}z? 6|-: . |~|~~~`3~~X8~8~@~~`$~$~}X@fd~d~pt~t~gj 6|-"5(4'4'~` xxe HH7n''"e,,Xe p`PPG@ 6|-p 3` ؊`؊```S```#`T`T`+```0 ;G" ; ;{ 6|-@0 d c>chf (c(cI~ !c!cqf -c-cS~ T%cT%c 6|-2uA=4`kk`kk#`4k4k8`kk0@xkxkW# HkHkf`$kkD lklk 6|-[`gh, ""m3DD@ >+ r ?@ǃ6 ' K4!@KT: Ou @`0@}C^ 6|-*!K 4A4A0s AA1D dCdC0 DD EE1 8F8Fb xGxG HHTx)L4!@KT: Ou @`0@ w 6|-h, ""mPP3 >+싟싟 r ?||f@ 6|-V`'q":0@i0P$/ 6|-3b# g31  Ij#m 6|-- 3b#`g31`  " 6|-WD #`jj(|j|j`jj`jjhjjpjjpjj`V8 6|-1 D #` j j(jj`jj`TjTjh@ j jp@H jH jppjpj` 6|-wD #`ljlj(jj``j`j`jjh8j8jpjjp<j<j`*bbr.RingBuffer[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entryWrapper[github.com/apernet/hysteria/core/v2/internal/congestion/bbr.connectionStateOnSentPacket]]H@ lbb -`S {KU h1UgTB#Uu H3T,0خ`<D8=1$fL1Zܴ T ZLTG4@#@ ܴc$.7@V0{L 4wX@|XAXB0(CUD 6T ZK@V#@V& ),!%!w ह$i(B>B4N ?B>B@N 0AB?BBBtBB84(N m`_ ӎQUTDT_U̴UբU CU$T(T0@<UmhQ `+ ` ӎT V/-U$_U&BeT(@DU0w"U2}U4ET8@<?D  0` ӎTբU̴U U$w"U&ZU(zeT,}U4ET8HDC p T`a @TܵWOT ػ@VŏTT T();T0T8+T@@8:Q5t4``b @TD@V6T 0@Vr}@Vܵ@VK@V ƻ Y$0g`¹4HDd ` c @@V㐶T6T T}*T|ݵT$͐T,@V4T8U<T@ddv0=ijcu ׺c D ̮T R@[c Z,t`¹8 DP1`XN\\H<|N/(@`5Hd H%Ѵkmk1|p" D,h88c.pDU.@TE\.@TF8 C` `e @l1C.+t h1u(`E0ߊX1X2T+X3(X4<8f;C f fQL@${e`!!`/$ r@V()@V,@V0%T4L(Fr({f 8)`D L ״@$w45¿8eV<e@VDXHشXI` J[ J9g h, ۻۻ F@G@G@, ۻ@DF`DF`G`G``6\ J)9`h 9 ۻۻ F@G@G@, ۻ@DF`DF`G`G``qJ M9 i , ۻۻ H@@I@@I@ ۻ@0I`0H`p@I`@I``J@*9i 9 ۻۻ H@@I@@I@ ۻ@0I`0H`p@I`@I`PPn( @0Zj Z"uTڿR۹ m,<m40X<G;@}Dq#HPP徚 @1Z`k Z"uTڿR۹ m,<m40X<G`;@}Dq#HPP>^[Z l Z"uT@ۿR۹ m,<m40X<G?@}Dq#H*struct { pairs_data []yaml.yaml_node_pair_t; pairs_start *yaml.yaml_node_pair_t; pairs_end *yaml.yaml_node_pair_t; pairs_top *yaml.yaml_node_pair_t; style yaml.yaml_mapping_style_t }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point] }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point] }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point] }*struct { f func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point]; once sync.Once; valid bool; p interface {}; result *ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point] }*func(monotime.Time, protocol.PacketNumber, protocol.PacketNumber, []ackhandler.StreamFrame, []ackhandler.Frame, protocol.EncryptionLevel, protocol.ECN, protocol.ByteCount, bool, bool))I|-}mL@qmLGVWGC%k\qE9|- ErrErT`@V EEs#X]NX]N2A`]N]N Bu+/9|-`r(10 "<< ((#`W# *struct { f func() (go.shape.map[string]int32, go.shape.map[string][2]int32); once sync.Once; valid bool; p interface {}; r1 go.shape.map[string]int32; r2 go.shape.map[string][2]int32 }w |-ZO~(R H^o`^ `X^4]4^o(],_CRt,^`P_Ds-?IuI #nlX@nfMd B *o#@o~o7o(@8S-Qu dK+ l@ ` d@ ZZ M)@ KB@YK*struct { Code int "json:\"code\""; Message string "json:\"message\""; ErrorChain []struct { Code int "json:\"code\""; Message string "json:\"message\"" } "json:\"error_chain,omitempty\"" }*struct { F uintptr; X0 *struct { f func() go.shape.interface { Error() string }; once sync.Once; valid bool; p interface {}; result go.shape.interface { Error() string } }; X1 *[4]uintptr }*[]struct { Code int "json:\"code\""; Message string "json:\"message\""; ErrorChain []struct { Code int "json:\"code\""; Message string "json:\"message\"" } "json:\"error_chain,omitempty\"" }*struct { F uintptr; X0 *func(go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer }); X1 *go.shape.struct { weak._ [0]*go.shape.uint8; weak.u unsafe.Pointer }; X2 *[11]uintptr }pp+cujy D ̮T R`c ,t`¹8 Dخ P\1`dN\h\TXq2@ z "@b#_KU@1gl`$8,D<KD#@L2P,$2Xw3`{ Z>@V jI 1Dmh RhdLŷ=(Ⱥ=`  6|-= ^#w"@9  c`@`d`W# XT8WM mL } mLV+nVܶVVGV TV(V05nV8?nV@V VHgVPX Β8@}~ mLd UUUaUnU Y$U(gU0 U8InU@jUH̏UPl 6|-ZOt(R o `XX44o((,CRtt`HD2ushp :T:T cTTDTT$-qX,X-7qT0AqT8T@%X 6|-FEr (CF(CF8ZNZNNRdBFdBFBFBF CF CF0@[N[N`X`\N\Nd88)|\p Er@V=@V=@Vȵ@V @V >@VF+ ȵ(BX0ļ4H 6|-?Er ^#LNLN9 hNhN NN NNc`$N$N@`NNd`NN!*`NNW# NNG~Bc 6|-rm`\Er <@W\K\KWHKHKU DlKDlKKKZmKmKuKuKl{Kl{Ks@WgdKdKr9 6|-UA SSܿ||HzHzBU` 0Q0QByyѮ쎈쎈O,@@nQQHD."\hp% V:T:TcTTDTT$-qX,X-7qT0AqT8T@O_ 6|-{  8C@ <<GC@ ,,\ HH@ Nww\44VCllj||@4E"|g gUTT &`u@Ծ$u`(,u@42X<ߔ` 6|-4 ^#tt9  c`hh@`d`W# dW/K 6|- T oB ^ 44|g88C )p@̥@̥,եե,s 6|- !K "WW1D mTT" UU DD1 ``b  ȉX @4*`enq !K 1D t D1 `b  4b*8 6|-et XX@ kk"mgg`h}h} >+`g`g X&9[h 6|-{9 `3,,#`ԾԾ`‡‡r ``W# |,ć,ć$lu 6|-r{ӎ 8R||0@GR @ X $$X , 5b <<kXX ^ ` ӎUrX(D@VGX_X RѵX 2X X X dѵX!-@VD@aD@@ ӎT_U ` =L$,ʹ@ƿ4$"?8|X@PPc$P(` &@VО D(Td@VT0Tu( @$nܵ`¹(`¹4"`¹@K DL@8TR` @T0@Vr}@V ܵ@Vއ@Vvf@VKW6T @V(/T,g`¹4@8 8 @TlG@VIT @Vr}@Vܵ@Vއ@V vf@V$KW(6T,g`¹488j)c0V`H H? lS@c`¹V  (X$xҴX%5@V(Ҵ@V,Ҵ@V0`(4 hp@@ ?秴@U:@DTVT.UcT2TBTUXy Ы 6|-/kx `?\?\X@qH4\H4\,?\?\#=\=\d?\d?\ F=\=\p?\?\?\?\B 4\4\A} 6|-˘ ?~ ]]G]]@t0]0]@^^Y ^^R H]],]] dWE1i3ۺ@ 3!` -T, -@VA !@V qxF DD\fQ fQ#{%`H@VyT` @V,@V0-eU4;<Y@eҩD 6|-2 O "//"mD5D5322@},, >+88:@|55 77r 33?@} * *O 6|-  HH`,,"m||3@@#``,,r W# f 6|-: ~~G~~a8~8~~~`3~~X@~~`x~x~}X@f\~\~pl~l~a[ 6|-: <~<~G~~ad~d~~~`3~~X@(~(~`~~}X@fd~d~pt~t~L8i~0$`{  f5H(Z4¿8h^¿<bX@¿DrXHD/XITJd 6|- ?pԃԃXe@փ@փX҃҃M؃؃`уу4e,؃,؃~ӃӃj`(׃(׃@@ككdT/I9ƺ@ D`V@J`of`o$Q@V8^@V<@V@HJ@VDw"HDٴ@VLPJ`oPdTM|ݺ |D`V@Jsfs$Q@V8^@V<@V@HJ@VDw"HDٴ@VLPJsPe 6|-q4Q "ԛԛ"m3؞؞ >+88:@|XX r PP?``SR 6|-@4; `(s(s38k8k#`LsLs`8s8s$w$wr ooW# ss|hxhxTT$} ,Z Z"<uTڿ 'm$Ƶm,<m4<V<G:DƵHq#LTT2p ؁ @-Z Z"<uT@ڿ 'm$Ƶm,<m4<V<G`;DƵHq#LTT;x 0Z Z"<uTۿ 'm$Ƶm,<m4<V<G?DƵHq#L*interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) } K6`  (M: ^#\oo9 xoo ooc`o$o@`Dood`ooW# oho-,A,A(j`T@^#`9 gi@H c`@`d`dMH H @̈c4 (M: ^#l 9  c`4@`Td` W# $x . `ZZ(ʴ8 ʴX^#|jj9 j jgi@H j(jc`Xjj@`ĩjjd`0j|jMH jj Y P<hZZXM|y0:EIXصX^#Xj̘jX`(jj@` jlj j؝j-hR ~@d R 2i ~ [  @ R ?d L@ X#d R   R "~ ` 3$+-9`h`J [@ `o B`] [\ P . u`(` %@"`=\``j\`P 2 VLb@Zܴ@Z N+ (| ,P+(" Q+$(`LR+ (3S+(g8T+(0@U+d(ml(>- vE q,qnrNh` s4s`tpt$F vluvO$x|w $`$yx9|-\@MHd d >dd |?d|?d~ @d@dh ^,~ u l,~ +r9|-`MHd 7d7d~ 9d9dd l:dl:d~ ;d;dh ^,~ u l,~ B)' -*K*`e!K 4A@0s A?1D dCB0 D > E E1 8F=b xGF H HDLh2VM''>q":p:0@i0P*interface { FindDescriptorByName(protoreflect.FullName) (protoreflect.Descriptor, error); FindFileByPath(string) (protoreflect.FileDescriptor, error); RegisterFile(protoreflect.FileDescriptor) error }$#ȹa`*@ 1`~@V 7g ߻qKXzKAgK1>0XKAJX d` ,  Lic9QX$66(0,F8Wj P4TMJXd@ž\.޴S`hTݏZ0mL mL\6xV8zU@LH6LLLP0PXTSXU &@VX9P@V\6@V`b\7^ M mL mLUnU7U!nUU 2gV(V0V8@V`BgVhRgp|-5 g33\ 2 `==` h @@  =@LLPP4k= =uTpTATX$$`(% 4{X<rX=H4K@;XDIU@HD@.@d =~p6TjTOT^T䙷 lT$\T,(~4@xQ߈,@\R8߈,@Er $`4#K4#K`#K#KH`D"KD"K!s ĝJĝJ+s(J(J[KKKKJJ~) )K)K5s$K$KG9{ 6|-vEr s*`¹<`¹HTTXWX` Td(@dx| Wd} =eaf|Q 6|-@  4*d``o o`=L``TT=`H 6|-Bp@  0 0` > >"m;;3t/t/#`<<`==pApAr 88W# 0>0>uCC 6|-@. !K 1D  ̕̕1 88b  YĜĜq/ rp\pHH( 6|-g #`. . п@ 1 1 BaD (1 (1 1 0 0  - - 3 / / E / / # H2 H2 " . .  E 0 0  6|-ld  49(49(`\B(\B("mA(A(38(8(#`@8(@8(`LB(LB($E($E(r X>(X>(W# lB(lB(upF(pF(7!h 6|-q` ! IIZ@tItIBa HH! IITHTH pHpH @II"@HH@HHrDIDIo; 6|-Z2 @@)]C ]@ĻĻ"w@躆躆:\\`B,,#`ȷȷ0@ 6|-bwB  `+jj%`+jj^#jjK jj djdjc``k`k@`TjTjd`jjcr@j@jW# j j 6|-hZ Iܝfܝfc ff? ff_`PfPfZ,f,f LffcȝfȝfU7$f$f`ffi7(f(f<.d 6|-Z ^#|j|j9 jjgi@H jjX`DhDhc`XjXj@`ĩjĩjd`0j0j hhhhMH jj&H`h`h] 6|-EZ  Hjj ^ 0j0j^ Lff8C LDfDf# 4j4jZ ljlj# MjjS'f HT 6|-+}@ӎ 8R0@ĊĊ, S܊܊GR @ X 88, 3_5b DDd 6|-*_@ӎ 8R((0@ƍƍ, SGR,, @ X +aab  pp lhlhC 6|-s`G $`*`',u,uxbZvvv8x8x`!xzs 6|-J`s,, O`44644;r`@4@4[)44gi 44#X4X4`D4D4W# T4T4f`$44q 44D 44 6|-F  ` ȳȳ hh;x xx <<PK:`Ru i\K<<A;@K 6|-wR ` P+P+ X+X+ l+l+i@++l+l+++++0@++A@\+\+A + +(?++Y| 6|-S ` ++ ++ ++i@l+l+++++h+h+0@\+\+A@++A++(?d+d+լ 6|-R  O`PhDPhD6 iD iD;r`iDiD[)jDjDgi DkDDkD#lDlD`0nD0nDW# nDnDf`$oDoDq TpDTpDD qDqD@[ 6|-` 4 |Z|ZՑe cc1 __ [ kkX L\L\@e llTe eee HaHag nn(f@ hhB <^<^Ԟ 6|-  ` ԕ|ԕ|2 ̖|̖|AX)h}k.і`'U 6|-O Lx^x^?^^0@(^(^` x\^x\^p Ġ^Ġ^8+\^\^2<^<^C̛^̛^jz^z^ r^r^]^]^Xm? 6|-P, `'d'd$`(d(d\N(d(deN`(d(dK|)d|)duj)d)d01`*d*d:%Q/ W˜ 6|-\/  OϢϢuТТ%@ТТ @ѢѢj\`lҢlҢ`ԢԢ0@pբpբy\ \Rr 6|- H) |D SD SBSBS.S.S,DS,DS]<:S<:S"S"S:%`PSPSxI!(&``SSr` 6|-`U ^#`LrLr/`I[`r`r`_T8r8rrrԬrԬrK01`C7 6|-: 9dcc$`|d|dXdd%dee2AffRfgg9@iggi4h4h}X@fhh@j4i4iGgiiNʁ 6|-ar  F@$$`* en1dellŠ`(E(E|/`X=X=p/`$$r 6|-ҋF9 !  \\f  ``l`hh188   1 O 6|-ҋH9 ! mm HpHpf nn`xnxn`lll`TmTm1$s$s4q4q oott1,r,rx 6|-@ . !K 1D  441 b  ,, K 44?P3 6|- . !K 1D 44 1 b  || ,,K ?P34 6|- ` . !K $$1D  1 llb $$  ||K ?P3SN 6|- . !K 441D  1 ||b 44  K ?P3 6|- '(`gjgj@Er%T"T;XT;TUc$T8;@V@<XDrXEr@\H_XLTPr`¹XX<t`Er?Er1`T整> T s==#8@$C(I@,<T00<@8s@@HXPU: Er@Er (M^#LNN9 hNܵN NN NTNc`$NpN@`NܺNd`NHN!*`NKKW# N@N JKu AV,@V6\1h=@WMǴ`ǴXsǴ`?K@@ XHD6st`ZBZN\E޶V CVBd L$`("@,D_@146@08Y_@-<6,@(&XD]XEhd?18`4ZCZ۠N`ME@e M(8,7$0栴`<<@<<D `?LZN@T] X`\@Vdhda7x6h`DӷT>fT(Tu(TE @ T$7T,ԁT4`¹<`¹Hr6 DT DX4@V\PZGZ%TSTk9lKT8)` ,7$0^@VlY`¹pa|lϴ@Vxϴ@Vϴ@V 0aH?秴@U'@D:@DTVT$Ub)TqUDӴTѧUPӴU\ӴUhӴU6h-)`@III .jkخfx;@k9d$`XCg%dGkRf9@ii}X@flƲ@lXikGghhW}Hs J  ሴu0մu?Zu"@u 洵u(NZu0u8u@GnH@lLNuT{t\0:E`*func() *internal.LruList[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }*map.group[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]*list.Element[*github.com/sagernet/sing/common/cache.entry[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 },go.shape.*uint8]]*struct { f func() go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts); once sync.Once; valid bool; p interface {}; result go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts) }*struct { F uintptr; X0 *func(go.shape.struct { internal/poll.rfd int; internal/poll.wfd int; internal/poll.data int }); X1 *go.shape.struct { internal/poll.rfd int; internal/poll.wfd int; internal/poll.data int }; X2 *[11]uintptr }*struct { Strict bool "mapstructure:\"strict\""; IPv4 []string "mapstructure:\"ipv4\""; IPv6 []string "mapstructure:\"ipv6\""; IPv4Exclude []string "mapstructure:\"ipv4Exclude\""; IPv6Exclude []string "mapstructure:\"ipv6Exclude\"" }*go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899 }*[]go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.present bool; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.entry go.shape.d6b653b8e6ea330ac32890bf64ce8a6c819e94a07fb7d477bbba1fedf55a6899 }9)-w@@R ` P+Ph+ X+0j+ l+l+i@+m+l+g++i++k+0@+m+A@\+`g+A +i+(?+k+)r-@@S ` +n+ +p+ +Y>YBa 4?Y4?Y@H>YH>YE=Y=Y|$g$g^#XjXj9 xgxgX`(j(j HgHg@` j jzLggW# { gg jjM gg&HggV\g\gTTv} j`N\{X 0:2X@^{@T$m(7m0{ θ8ص<"@T H]`HLHH eIJ&+ k 87 sȿ D3@VDٵ \ʴU,hʴU4yX<B9X=<X>yX?+sX@0:2D$ 6|-H \ bj 0bm0bmPLqmLqmK bmbm5  DMmDMmbmbm WmWm]sObmbmimimdQmQm fT(T u(T(ET0T87T@`¹H`¹Tr6 D` Dd4@Vht>1 224 [ <<X@ ))eR\ 77@\ 8,8,* `F`F2 (D(DF 44B\ 00X ::tlQzȳyu ׺ sKUXXڴUTUX ̮T (a4Et`@RLXS@¾dݬ[h@T 6|-)X< ^#Er `!,G,G<4G4G[)`DGDG0GG8` GG GG@`@G@Gd`GGW# GGR`GGD GG`TGTGl# G G]Y0 6|-{]Er nNnN88oN8oNNR|pN|pNLqNLqN>"jFjF@gFgF@"hFhFqNqN0@TrNTrNLDkFDkF`X`sNsNd 6|-@?Er ԭ`HH`HH`THTHHHpT`HHa+`HH`HH@SPHPHKPHPH"@SHHR 6|-  l@bzztto` S SxSxSkttWU@bqq\x\xn`ll0eee,nn7TT  : 6|-W @t8t888 \$\$ >Y88S8888~@:@:::Y;;,99 Z<<"a99a`Z88@\8\84/: 6|-~ #`п@ BaD 1 3 E # " E 6dd*.LP 6|-9@ :d``dl H``= ``@``S``B```@ ``yl@ ``X x`x`*@ ``^L`L`B@``Y``ޙ 6|-\ d =d=d~ >d>dd @d@d~ TAdTAdG ddXH ddldd-ddTh ^,~ u l,~  6|-2  ~~`uu"~<<3|| yy#`uu`uuzzr DDW# ,w,w&#TT``v`va`[ 6|- ! tt"PpPp"@mmEةة9`oo tutu&~mm0E PvPv~ppw` qqEuue uu&ppW- 6|-` ! ""\ީ\ީECC9`ߩߩ & ީީ0E ~w ,,Exxe &HHy 6|- ! 0O0O"JJ"@`H`HE<6<69`II PP&`HH0E PP~JJw` 0L0LEPPe OO&LKLKg 6|-  ! CC"??",=,=E''9`d>d> DD&<<0E` EE~l?l?w AAE4E4Ee LDLD& @ @ߨ[ 6|-ip@4 !TETE"" ESSb~wP;P;&0808@@IAA,> 6|-Pq: `3z}z}9dD?D?$``?`?Xt?t?%d??2Ay}y}Rf\y}\y}9@i@@i@@}X@fAA@jxz}xz}GgAA](~(~D 6|-P `XX"xx #``ll$$W# D&#TT44a`촞촞^b 6|-9`< "P`)})}#Q0`*}*}\`H8;}8;}L?}L?}1D-}-}  @} @}@}@}*func(*list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]], *list.Element[*github.com/sagernet/sing/common/cache.entry[net/netip.AddrPort,*github.com/sagernet/sing/common/udpnat.conn]])*struct { F uintptr; X0 *fips140cache.Cache[go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int },go.shape.struct { crypto/internal/fips140/ecdsa.pub crypto/internal/fips140/ecdsa.PublicKey; crypto/internal/fips140/ecdsa.d []uint8 }]; X1 *[16]uintptr }<1-d33q `BTB/=`B>=B C`CC`;Cq Dqq`DTD`  UD U E `EE#Eq F`FM=~GZ TTp@GG pɶ@>0 P\HXX "?`"ϻ`ϻ"܇"޺ #ɶ`#,##<@THpɶ $ % ITIXdXeXf *hcp@dTdʶ@e$DKPx`tNn|; "`hX _KU-gXڴUsV0X(꽵,8y`DaP(T\"Vd0Ul1phK|d` #yu= @KUXXڴUKTUX̮T a(Et`4R@LڴXXS@¾\ X` b KOB `Z Q@$K@V0+4I X@] DHdLcPİ خ`؏`h`¹b`¹۴`E g^08~Y(R3U &8VU'U=U BU$U( &,U8 g@ gH gPpR@UX@U\8U` `&hPA-@T̵T㘻@VL `¹T T( ~c0 cD]cX(ضl5̷`¹|̵`~`OTeX6T`¹phgCa@DD+`&,`&_`&e`& ,`&y`&,`&1`&y ^[$`5@k5H2P碵Th8TX#@V`@@dTPs.ȲlD`̺ .9W~X 9ն@V*X"zRn ` :2$"@(kj0z]#<XADv^H뗴L2XPܻpb{ &9@V j|˴cc(аc<;cPvڵ@Vdڴ`hl+xI X˴@ڵڵخ`؏`*struct { key acl.matchResultCacheKey; elem *internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]] }*struct { F uintptr; X0 *udpnat.Service[go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }]; X1 *context.Context; X2 *udpnat.conn; X3 metadata.Metadata; X4 go.shape.struct { net/netip.ip net/netip.Addr; net/netip.port uint16 }; X5 *[11]uintptr }*[]struct { key acl.matchResultCacheKey; elem *internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]] }*[8]struct { key acl.matchResultCacheKey; elem *internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]] }.M-R: 9d[1$`\0k]42X]1%d^0Rf _19@i_p0i8``0}X@f`T2i8aD2Xia1jHb2Ggb08;j\c1r 6|-0nnPPI@N@Ng2a-5X[X[-::a77:2  WWAyQ 6|-jZ8*8*BcF ** **@ ++"`X*X*2 X*X*b<6*<6* * *w)) -L))q 6|-$mL!&`l`7` `6l(& &h606` P* 6|-.> =;r; B:<:<P`h$`L<L<=<=<5A<A<4gJ<J<e=>`5DY 6|-\*y5iuu@uu*`uuB@@duduBU>UVRURU&eUeU'!KUUbZUU 7UU7U7UG\T\T U UJa 6|-}}B`] dd[\ P . XXu`(` hh%@"`=\``j\`P 2 R 6|-}O  ??Q ;;%@::{H;H;"`::=\`::`;; <<L\`;;8;8;.\(;(;P AA2` @@2 ==`\@$/ /  4xKuT!@ OϢ4ϢuТТ%@ТHm @Ѣ`Ѣj\`lҢ`m`ԢPӢ0@pբԢy\ n\(sRo)! 6|-й:  x;@kD}D}`3h}h}9dHH$`IIXII } }%d(I(IRf}}9@i0J0JiLJLJ}X@fJJk܋}܋}GgJJ]l~l~: 6|-R : 9d[[$`\\k]]X]]%d^^Rf _ _9@i__i8`8`}X@f``i8a8aXiaajHbHbGgbb8;j\c\c~6v 6|-Hÿ B`] [\ P tt. u`(` %@ll"`=\``j\`P 2 } 6|-ÿ B`UU] T_T_[\ [[P H\H\. ]]u`UU(` ZZ%@@U@U"`lUlU=\`\U\U`|U|Uj\`UUP |a|a2 ``T 6|-Ŀ@ B`] [\ ܡܡP . u`(` DD%@"`ěě=\``ԛԛj\`䛡䛡P ԧԧ2 J 6|-_@Ŀ llQ LݞLݞ%@HܞHܞ{ܞܞ"`tܞtܞ=\`dܞdܞ`ܞܞ TޞTޞL\`ܞܞܞܞ.\ܞܞP 2` 2 6 6|-|OOb(P(Pmxx1?xxd, xx PxPxy xx4@ xxBv@y xx#@?8x8x" x x@ HxHx]K>`*struct { F uintptr; X0 *struct { f func() go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts); once sync.Once; valid bool; p interface {}; result go.shape.func(*encoding/json.encodeState, reflect.Value, encoding/json.encOpts) }; X1 *[4]uintptr }y-hf33q `BTB/=`B>=B C`CC`;Cq Dqq`DTD`  UD U E `EE#Eq F`F"@S M=*fips140cache.Cache[go.shape.uint8,go.shape.struct { crypto/internal/fips140/ed25519.seed [32]uint8; crypto/internal/fips140/ed25519.pub [32]uint8; crypto/internal/fips140/ed25519.s crypto/internal/fips140/edwards25519.Scalar; crypto/internal/fips140/ed25519.prefix [32]uint8 }]*go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }*struct { F uintptr; X0 *struct { f func() go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool }; once sync.Once; valid bool; p interface {}; result go.shape.struct { IPv4Enabled bool; IPv6Enabled bool; IPv4MappedIPv6Enabled bool } }; X1 *[4]uintptr }*[]go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }*struct { F uintptr; X0 *func(go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer }); X1 *go.shape.struct { weak._ [0]*go.shape.struct { crypto/ecdsa.PublicKey; D *math/big.Int }; weak.u unsafe.Pointer }; X2 *[11]uintptr }3 5@T`¹@_-Er !~I~I"` 4I4IDIDIX@$I$I~II8;IIW#@,II8 @I@I@Ϙ$I$Il#EII40JN py` DV]`H$: ݽ,OX0 `++o*o%`+0,o+o^#L-o,oK h.o-oP|/o.oc`0o0o@`$2op1od`3o2o:D 6|-F  j`d_d_4 W W4`0\0\0@D\D\O,W,W@hWhWj@WWTVTVjUU4O@j@ ks$ 6|-f\mL!&'`l`L# L# 7`  E E `6d d l(&   &h606` 6 6 Pl l (HF mL mL W XV& ` \}QX-X3X9U ?V$\(UdEVl\pUK ddo#hx@Er`Er@xU[@l@t N\整`UY@U$U,H< s4#<X@8ʵXAXBbDd5Lq#T3V \ `x sX۶X(`ƜX@uTh=X AֿI6$(Aֿ0I4D@ƴL`¹PI@V\If`0A5dRXlp@tI 6|-]PZ `+ g g gg@`İgİgcrggx`gg`$g$g¥{ ggX (g(gb gg ggt g gA{$g$gT`?qr 6|-s `+nn%`+\n\n^#|n|nK nn HnHn lnln[ nn nn @S$n$nc`lnln@`\>1LLb bb@ TUTU0E RR~00w X1X1$T.T.&@;@;vAA8E>>(b(b1k 6|-Ub ! ̭̭"0í0íeɭɭ(Eƭƭ1tԭtԭb ll ݭݭ0E lڭlڭ~츭츭w xx$`44&íívʭʭ8ETǭTǭtcsٰ ;`?@V|EQ!@VN@V@G@V5XU U$U(MV,XV4>cV<GcVDyVLVTcV\nVd?Ul.Up`% 8xx ƒvmv҃vmBvv t@l(ݶ@l0w8w@<*XH×wLB@3T, X*xvOl@SvSXuX; 6|-`  d`aa+ aa+@ a a,a,aaa Haa aaaa+@OĴմ MR M:Pu 6|-p   +aa+@ a akaaaa11 ,a,a@@a@a#aa Haa\a\a+@OĴմ MR Mu2 6|-4 ! [["\h\h"@ii ]] ZZ E\\~x]x]` gg` ``` ]] (\(\&hhҷjj\__\ppFi 6|-:  `3L}L}9dLL$`LLXLLMK@g}}%dLLRf}}9@iNNiNN}X@fЕ}Е}g}}GgxNxNp]~~]}}e c'@pp ߻{t$`L(#0G, /*0' U4M"X<@t@ 4tH#4tP sXXu\MIudVlut&su|u]`H*struct { ID string "json:\"id\""; Name string "json:\"name\""; Price int "json:\"price\""; Currency string "json:\"currency\""; Frequency string "json:\"frequency\""; LegacyID string "json:\"legacy_id\""; IsSubscribed bool "json:\"is_subscribed\""; CanSubscribe bool "json:\"can_subscribe\"" }``/v{Y@(R9T\ Z9X 9X yRXRX(9X@VhX@V$ tV$ V(eϹ,rϹ8vXXD HXT/o@VX'`B\llErErmPV;D`kt + *XQXUȵU=U =U$\X(f,4+<ȵDļL@rPT:A +`uhll$@~ ErErmPV;D`kt + *XQXUȵU=U =U$\X(f,4+<ȵDļL@rPT:A +`uhwhO@"uUٷuXuBu T(hX)u, 4<BjDMLP:Oequ|_KVEu=QX@ /Xov2@28I!eU VU\V``d`0'}D-}H!LDdzh@Vl{/Xpb#tH|hl e@V7@V#K 6|-kLTLT"ORR4,U,UTT" \S\S DPDP8`QQpdpd+OX`X`4dcdc__/*; 6|-p і@ Jy Jy@\Ey\Eyp@(p3(@(PeyPeyp@@~0@pKypKyr xHyxHy;TCyCyU1 6|-z% dNdN%N NN4ON NN4 N N<x NN3% |N|N k (N(N%@NN dOdOk OO 4 OO4OOPOPO4` OO` OON` dOdOa 6|-n_gZ !dd (d(d_Idd^#`$d$dX`Mdd ddQ dd_dd`dd`ddxI\d\dWĹdĹddd`67`ddƛ 6|-  AO OAOA  FAFA  P7AP7AX8A8A 8UA8UA UAUAy 2A2AO@3A@3AzXAXA  GAGA|` !BABApX9AX9AO4A4A`AAAAI9`YAYA? 6|-w9` w"@uuj` v v4|v|v4`vv0@TvTvOvv@| v| vj@8!v8!v"v"vj#v#v`@$@r~$`R 6|- a !@ HH@ "{{e(E``1`ȌȌ Eb LL dd0E LL~`qqw `r`r$nn&H|H|v8E( 2 83xö@  4ʴ8MHhH ^#*d*d9 +d4+dd .d-d~ /d/dd 1dt0d~ L2d1dc`3d2d@`5dh4dd`6d5dh ^,~ u l,~ \l 6|-3T06Tb6`s6'bHFPF%Fi66X 6|-l}B`סס] [\ ݡݡP . ttu`ءء(` ܡܡ%@`ա`ա"`X֡X֡=\`աա`֡֡j\`ססP 002 H`H`xԡxԡ(, 6|- : `3Ԗ}Ԗ}9dJJ$`JJ.lt}t}XKK`}}s}}%dKKRf}}xAl}}9@i L Li @]T{@4\ .@^#jdj9  jjgi@H Xjjh jjc`jԲj5 Դj@j@` jljd`jضj jDjM TjjMH j,j Kp8 @! X¿9.X)XBXWj@ R@V ` ԕ|l{2 ̖|8{{AX{){h}k.і`{`t{'P{*func(*internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]) acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]|pxT  .@Z ׽{@./Bj ɴ: nZV(ҶV0ȷV8ZV@׽Hm.ULUT\UdXfXg~XhXiBzlEUp5Xxȳz[( ӷT>fT&@VLTTО D$(T(ҿ`¹0d@V<T@0TH7 DPDTTu(T\"TdRK Dlnܵ`¹p`¹|"`¹K D"@ƿб`h` >fT(Tu( @nܵ`¹&@V d@V$T(О D0 D44`¹8`¹Dպ DPBպ`¹Tiպ`¹`K Dl`¹p"`¹|Tպ D0T<TSUQf-z % dN8N%N NN4ON N$N4 N4N<x NN3% |NN k (NN%@NN dONk ON 4 ON4OxNPON4` OHN` ONN` dO\NUh`- @I@! I elײlFXem@A9dA,$`9G/uXG@@mGmmRl%d2mRf9@ii}X@fnGg@D< 6|-E6 8<!! !!| !!i!!e`!!{i` !!!!MD!D!3!!g!!@4!!j !!0@!!r E!E!84 >!>!NH4D 6|-ĒmLBP  60+ 0+ &`0 `0 *`h& h& 5`l l l`dD dD `4 4 l`A A (6`> > |) |) &06`<`< < < < 86`ld/ d/ 9_ 6|-pV `(`(і@$'$'@t't'p@''(''p`|(|(3`(`(( ''@t't'(`'''p@X'X'@t't'~`''0@''r p(p('';T((TG 6|-J(@ ::p:,::S@ D:D:$`ؿ:ؿ:xA ::f(@ p:p::,8:8:S@ ::3@ : : (@ (:(::,D:D:6S@ ::y`::h:h:vh:h:A@ $:$:0A|:|: 6|-2u0\X'YX'Y8#Y#Y`H(Y(Y%Y%Y#Y#Yt H%Y%Y &Y&Y")Y)Y`)Y)Y`.Y.Y`)Y)Y#`*Y*Y0@*Y*Y`-Y-YW# *Y*Yf`$+Y+YD ,Y,Y 6|- l^#DvDv&vv#vvT(v(vvvvväl1wl1wRvwwbvww,v,vԤ6w6wrv w wv&w&wKvv%PvPvu\vvdvv Vn ̬\*y4OUT5iutuu@u(pu*`uwuB@@duquBn>n@PdKndKn8` 'n'n@`KnKnd`tLntLnW# X/nX/nR`(n(nBlHAnHAn[^ `2n`2n;O`4?n4?naV`-n`-n  p6np6nJOCnCn$ 6|-j`vvxY ;7U`ԉԉ`44,ЃЃXC !,`C  KHH`zz DD^All(?hC !Q 6|-iR 88~@d HCHCR H@H@2i AA~ [ M M NN@ 99R RR?d \H\H VVL@ TTX#d $<$<R DEDE  PPR >>"~ JJ` XX$[ 6|-%z$  ll`" ^PP3TT#``r <<W# TT`؀؀a` ) !0HHl# &% ((( 6|-Gk :dT\T\dl@q\\= \\@` ]` ]SP ]P ]B`p ]p ] \\yl \\X@ \\* l\l\^ ] ]Bq]]lq\\YX\X\ X, ] ]OYt]t]` 6|-,@|'(,pkpkf kkS }k}kw",kk` xkxkUy<{k<{k,kk= ,k,k P~kP~k ~k~kq,kkJ PkPk}X{kX{kD |k|k&# kk lklk* 6|-Y@B*  R{R{hk c{c{ @H^#D]uLzuT-{\7{`Cj@ldwl\2 .`Z@RZ$"@U]@0N\韴 ${sm(Bd0zu8u@#H#{Pݶ@T]XXӥXY]XZ]X[X\w``lp tCj@lxw(dZSZ$"@U]@0N\韴 ${sm(Bd0zu8u@#H#{Pݶ@T]XXӥXY]XZ]X[X\w``lp tCj@lxwzL@hO@vU$T@V ` ̺ .U@,~XRl@V 9$"zR(n `,0`޽8:2<"@@9X2Xd{\h>p{\t>|_ hٵr T 6|-{w ^#CC( hChC@C@CU@CC"{,C,CQCC@TCTC9`CCW# CC|@ C CxDDO`CC, CC? CC9CCDD2 6|-}ӎ 00P`8R-`TLL<ААI ԑԑ0@ЀЀ_@K6``@GR++ @ ttX , 5b OOh ȸ@Z` Y`$TS`¹/`¹*T |-6(D50D58(δ@@YL`@P$`TN\X#`4hl*$չtSչ`Y8$`WW~#ϓ8 6|-X` ~uu` v vxAuu&@u@u#uu4R0u0uuu@Ruu0@ u uuu HuHu|u|uLuuavv[dudululu]\ 6|- _Y9 @j  F̄̄PPCjjjTF$@j g OOYYTTaqq<<K)bD qq/ }G :@]?$MVXV>cVGcVV V(cV0nV8yV@ҴVHVP|(VXBV`$WVh(VpҁVxVȰV(V|V⁵V(V(VMu(r^?$秴@c@VN)@Vc@D+@D-@Vl@V!X)XqXGXGXcXXX.XvXX{@V)@V@Vc@V@V.GL =`?$MVXV>cVGcVV V(cV0nV8yV@ҴVHVP|(VXBV`$WVh(VpҁVxVȰV(V|V⁵V(V(VQ]B 6|-C/I .j\z\zخfxzxz9dzz(dhzz$`zzXzzCgzz%dzzRfzzZd8z8z9@iTzTzipzpz@zz}X@fzzhzzM@hzzhzzGgzzE;xNbN $]``1 z_Km֩@"ʴ@"@" ᩴX${t(]`H,0:E4E<döc@ZTZ\ZdZlLt]|y zZXZXT z 6|- : `3x}x}9d4A4A$`PAPAkDy}Dy}XdAdA%dxAxARfv}v}9@iBBiBB}X@fBBi4y}4y}Xiw}w}j0x}0x}GgCC8;jv}v}p]~~]L}L} 6|-dR@@: .j(R(RخfRR9dPSPS(dhSS$`hThTXTTCglUlU%dVVRfVVZdWW9@iWWi X X@XX}X@fTYTYhYYM@hLZLZhZZGgt[t[*go.shape.struct { unique.node = unique.node[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.dead sync/atomic.Bool; unique.parent *unique.indirect[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.mu sync.Mutex; unique.children [16]sync/atomic.Pointer[go.shape.struct { unique.isEntry bool }] }*func(acl.matchResultCacheKey, acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound], time.Time) *internal.Entry[github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResultCacheKey,github.com/apernet/hysteria/extras/v2/outbounds/acl.matchResult[github.com/apernet/hysteria/extras/v2/outbounds.PluggableOutbound]]*[]*go.shape.struct { unique.node = unique.node[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.dead sync/atomic.Bool; unique.parent *unique.indirect[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.mu sync.Mutex; unique.children [16]sync/atomic.Pointer[go.shape.struct { unique.isEntry bool }] }*[0]*go.shape.struct { unique.node = unique.node[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.dead sync/atomic.Bool; unique.parent *unique.indirect[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; unique.mu sync.Mutex; unique.children [16]sync/atomic.Pointer[go.shape.struct { unique.isEntry bool }] } )`l0N\dc\T@VV0:?$lK,{K84ODOX5OlOKOLȴUVVl\UzU0B8B)KX9K@VX(m0@T"Tr}TܵTT lG@V(ŏT,tT4T<OTDCTL`TT̵T\}TdZfTl@Vt@Vx);T|}T$@Vod@VT(`¹nܵ`¹D<*^- o0.XGXiXAX>XiX XL&XpXZ&X LX lX -X KX 艷Xi`¹?T-T$pT, X4$`8@V<X@lXAo_1 6|-hi``l00>$@@E$ 4I4IhXKXKx55FFL$  J J??H3LALAS$ 00'((T,T,hD>D>c@f`(&(&v 6|-{M@D| X.'X.'k4/'4/'" /'/'0'0'7H1'H1'x2'2'!2'2'P3'P3'x3'3'_4'4'4<5'<5'g5'5'+` 7' 7'0@7'7'@8'8'@9'9'84  $ $+i [  6|-R@S=X ::&L::rkU;U;>h';h';'@Z;Z;b|);|);;LH;H;iW;W;`>`T:T:`'r`T:T:`4:4:``:`: B8:8:"L::k@hT;hT;[@::| 6|-l`dZ  `+hh%`+hh^#hhK thth hhc`hh@`hhd`$h$hcrhhW# (h(h``phph ^`hh¥{ hhX hh Jhh ththw` hh@LhLh 6|-hOT^# n niOnOn` PQnPQn(6TnTnwO8Zn8ZnO\Xn\Xn2znnSsܠnܠndjndjn `WnWn`|en|enpnpn<xnxn'`4Vn4Vnrl`nnBz8nn8nnOx\nx\n`n`n\>L@ x?$MUXU>cUGcU U UcUnUyU ҴU$U(|(U,BU0$WU4(U8ҁU<U@ȰUD(UH|UL⁵UP(UT(UXo!r 6|-kI TzTz"lzlzAzz"zz*`zzzz@zzMzzp`z`z@pzzGpzzRB&@B@B(&`hFLBLB L?( 6|-.d.: Bpp}Ldpdp;@p@pppppppԦpp.,p,p:'xpxppp۫`XlplpOppFppds`.lplpX7@ _ 6|-S`#n``lڅڅX@npp,,fڅڅMddd Bdڅdڅ@܅܅ *od܅d܅#@o݅݅~o$$7o@څ@څ(@3@tQ@@ۅۅxM 6|-I@aQ  "P`#Q0`\`H1D h)bq*[]*go.shape.struct { internal/sync.node = internal/sync.node[go.shape.interface {},go.shape.interface {}]; internal/sync.dead sync/atomic.Bool; internal/sync.mu internal/sync.Mutex; internal/sync.parent *internal/sync.indirect[go.shape.interface {},go.shape.interface {}]; internal/sync.children [16]sync/atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }] }*func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error)*[0]*go.shape.struct { internal/sync.node = internal/sync.node[go.shape.interface {},go.shape.interface {}]; internal/sync.dead sync/atomic.Bool; internal/sync.mu internal/sync.Mutex; internal/sync.parent *internal/sync.indirect[go.shape.interface {},go.shape.interface {}]; internal/sync.children [16]sync/atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }] }~|> ErErH2T%b)T ܼ@V輴@V8 0 UR(?U,ȵ`¹4^#X@cTD1`Lr`P2H0o}`#nj<lXɵX Xh@*ɵ 2@$lX(i? 4zX8UU<x?UD3@VLyXP$XQRXRs`¹T `U dU `@?X-1 6|-VK9'`/Q@  x7@@TT̷`llnQ QطQ9@44`9\\xx`Q:`  n88PPddn@|:e 6|-e1VK9'`/Q@x7̷`nQ QطQ9@`9`Q:`nn@A, 6|-9'`88/88Q@88x79999̷`4949nH9H9Q p9p9Q::ط::Q9@::`9$;$;@;@;t;t;`;;Q;;:`;;n<<<<,<,<n@T<T< 6|-rs@9'`/Q@x7̷`nQ QطQ9@`9`Q:`nn@^ 6|-u@ ~ gwgw`fwfw@ iwiw^#HwHwNK``w`w `w`wwwW# bwbw] cwcw8sw8sw`؆w؆w` Bww],wwoz w wyzTwTw`wwhwhw`w`w 6|-}i bj@ mm/JXwmXwmK $m$m@wm@wm9 `vm`vm<tmtmrj@ tmtmM <pumpum= umummm vmvm]sOmm tmtmc@xm@xmy m ma`J8m8m̏m̏m` zmzmԥmԥm|m|m; 6|-`" [ܺܺv2 2 hhuԣԣ z2 2hha  `||YJ2أأΑV֣֣2|ǣ|ǣO@2"R 6|-!L ̗|̗|PX` ||) ||||#6L)b:iAqY dr) B CC/ aI 4WXGX .j\zzخfxzz9dzz(dhz$z$`z@zXzLzCgzXz%dztzRfzzZd8zz9@iTzzipzz@zz}X@fzzhz8zM@hzTzhzpzGgzz# 6|-M[ X8:~0?d\[dddddddddԵ@"d@"dHH@d@d[(#d(#dX$d$dk[ d d3 6|- | @<%l<%l%l%lx&l&l"P'lP'l7U`(l(l+w(l(lF)0*l0*l x*l*l.`xH-lH-l[w`.l`.l0@$/l$/l@/l/l(? 1l 1l?q nX/`#w,@O@.~ 6|-: .j0j0jjjkPkPkخfkkx;@kxlxl9d m m$`mmnnXnnCgoo%dooGkppRf`q`q9@iqqixrxr}X@frrlxsxsƲ@lssXittkuuGguu*func(context.Context, context.CancelCauseFunc, quic.sendConn, quic.connRunner, protocol.ConnectionID, *protocol.ConnectionID, protocol.ConnectionID, protocol.ConnectionID, protocol.ConnectionID, quic.ConnectionIDGenerator, *quic.statelessResetter, *quic.Config, *tls.Config, *handshake.TokenGenerator, bool, time.Duration, qlogwriter.Trace, utils.Logger, protocol.Version) *quic.wrappedConn*atomic.Pointer[go.shape.struct { internal/sync.node = internal/sync.node[go.shape.*internal/abi.Type,go.shape.interface {}]; internal/sync.dead sync/atomic.Bool; internal/sync.mu internal/sync.Mutex; internal/sync.parent *internal/sync.indirect[go.shape.*internal/abi.Type,go.shape.interface {}]; internal/sync.children [16]sync/atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }] }] ظJ׺``{U P1 (Y4hT@XHɍ@[LڍX덵Xd2hΑZtZ쑷XJuX 3`¹yXV X1@] X}g3]`pp$XſoW ?`秴@@@VxG@Vc@V)@VӴ@V@V$)`~Wc@VDZ@RӴ@V2)@Vر@V@VӴ@V鱵@VG<b@VW@VWE@)@Vn\p  ` R R R` ٷX0Zu ሴu(X08X1t4+w<<vHo@vTXu`մ shp{t`LGUd@VV>Vс.V.V3!LVVlVlV9!$V$V?!`KVKV.8KV8KVG0V0Vc4V4Vc'V'V.BVBV.@V@V 6|->TvTviTvTv{i` TvTvTvTvM\v\v94v4vgvvjvv3 vv`cvv0@xvxvXvXv84 @yv@yvT)`v`vOh` vXO0@3ۺ3dTYT5T !T-T#@{$UT06Tb6`s6'bHFPF%Fi66l 6|-H`#nͅͅląąXTυTυ@n<؅<؅̅̅fPƅPƅMڅڅW@ttdl҅l҅ BŅŅӅӅ@ȅȅ *oDžDž#@o<Ʌ<Ʌ~ЅЅo م م7o$Ņ$Ņ(@hՅhՅ3@tQ@@DDžDDž 6|-G9 !@ PP@ 0 0 f J`PP߇ խ`\\`l`DDJJ J@ x x `e@ 881ˇՇ f   H/ 6|-@I9 ! `v`v @x@xf vvJ` ߇ ,y,yխ ``uul`uu0P0P~~J||JzzJ ww`e QQ1ˇ}}Շ{{f zz`> 6|- (;]j]j{i<LdjLdj= = cj cjJ =cjcj'(`[j[j1`=_j_js=^j^jTl\jl\j(fjfjX=dbjdbj@,aj,ajDgjDgj0;`=ejej~=djdj`tajtaj( >ajajqxfjxfj@D^jD^j@]j]j0@fjfj@`j`j8;L`jL`j*lru.Cache[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]CI`aQaQ  (f`!"P`#Q0`\`H1D h0)Lؕbzq( *simplelru.LRU[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] ԹJ`{lsgU P1 (Y4hT@XHɍ`LڍX덵Xd2hΑt쑷XJuX 3`¹yXV X1 X}g3`pu ``emL`mLl msҍV 5V"f@ݍU5UµUPU̴V 荴y(شy,䴴y0lU45U8U<">#?#lT@µXAUB-lVD$VH)\L7lIPA#`:T\u`ZZl85@V/:  ĸ U'X$v](`{,B`H0"@8{@DkjHz]#T@V\:` `h1 l|p0ɴ Ix]`I|ȟq#XXF w`I0:EYZZl85@V/:  ĸ U'X$v](`{,B`H0"@8{@DkjHz]#T@V\:` `h1 l|p0ɴ Ix]`I|ȟq#XXF w`I0:ESRh@lӷT>fT(Tu(Tnܵ`¹ &@V,T0d@V8T<<TDDTL7TT}T\TdО DlP Dp Dt4`¹xպ DBպ`¹K D`¹E`¹T. D0T"T7 D"@ƿkH_׺lU EڤD (I>4$X@̮TD$XL XMXNR@[Pc\!XhSltZxgXS`¹#Z 89头]hXS\|δ` ]> @;?l$@V@VHG@V%T E$@ IU$O@V(\@V,Ƨ0N.T8Ҵ:@Yc@VDS@VH.@VLS:PѧTT]\ܧ@`(@Vdbc@Vhi@Vlv@VpҴUtҴUxҴU|X l+U.@J*internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]*go.shape.struct { encoding/json.name string; encoding/json.nameBytes []uint8; encoding/json.nameNonEsc string; encoding/json.nameEscHTML string; encoding/json.tag bool; encoding/json.index []int; encoding/json.typ reflect.Type; encoding/json.omitEmpty bool; encoding/json.omitZero bool; encoding/json.isZero func(reflect.Value) bool; encoding/json.quoted bool; encoding/json.encoder encoding/json.encoderFunc }*internal.LruList[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }]%k@yII @)E%@X5@XwVTz̮z"lzzAzz"zz*`zzzz@z0zMzzp`z@z@pzzGpzzRBP Z Zx `]DXL׵X]`1 . |x l:$ `,]`0`I4y6@l8=M@@y`{DV*H]@LWTLMXq#\9Pd`IhLl޶LpɴLt^׵x_bL]`H0:E.D @ x@T"Tr}@Vܵ@V̵TT 0@V(ŏT,'8T4T<OTDkǻ@VLCTP`TXT`Th}TpZfTx@V);TغT}T}T$@Vod@VTT(`¹*Tnܵ`¹((sj028>₵ ({!OlOTvviTvuv{i` Tv8vTvkvM\v{v94v{vgvwvjvv3 vv`cvhv0@xvsvXvkvT)`v~vOh` vvvȄvvX7 6|-@Er`+H+HIA p8Hp8H HH@V !H!H>` XHXHut%+@U ,H,Hn0H0HVP <5H<5H9+DIDIM+`O,7I7Ir`XA9H9HP2HP2HgsRHHz@HHg`(PHPH),m 6|-AEr`ȠNȠNIA |N|N NN@V NN>` ut%+@U nVP 9+M+`O,r`XAgsRz@g`(),? 6|-9'`$$/$$Q@$$x7%%$%$%̷`<%<%nP%P%Q x%x%Q&&bsLLط&&hhQ9@''`9,','H'H'``'`'Q''oH00:`''n''''((n@(((({! 6|-@OZ%`+gg^#ggK  h h]`ggd`hhcrDgDgW# `g`g`DhDh ^`hh¥{ h h g g JDhDh( | ggI=B$Z>ZC=Z=Z`;C?Z?Zq DAZAZq(AZ(AZq`DP@ZP@ZTDBZBZ` l7Zl7Z JZJZCZCZUDZZ U E4EZ4EZ `EGZGZEFZFZ#EFZFZq F|HZ|HZ`F4IZ4IZM=JZJZv 6|-Y VK9'`/Q@x7    ~"`w̷`^wܨܨ ? nQ QllطQ9@`9`44Qhh:`nn@ r 6|-VK9'`/Q@x7~"`w̷`^w ? nQ QطQ9@`9`Q:`nn@ 6|-ԛO#6"tt1 Xe ] Z @@#6$1s`-He Bػػ>6K6АА,2882Z.Zпп:~חM 6|-`h,,O`.4.46`/4`/4[ 0404[)D14D14 2424 2424nx34x34Z 444444gi 4444y 5454h` h64h64 $74$74 74749494$|:4|:4W# ;4;4f`$D<4D<4q <4<4D =4=4M p>4p>44u`V(&q P5 6|-18BZ @V LfLfV ff TfTf`V xx>|x|x2T@>xxp@>xxpxx=xxhxhxN<=xx4 xx`xx2p`5>38@Er?!!ErN\r &`UV UgAXd<Xe}h)tt#xL))nUH< sUV#U0ÁUvAAXXXXXXXXU3V d@=9|-ErAErbn`TNTNIA NN >I>I@V PNPN>` ut%+@U nVP 9+M+`O,r`XAgsRz@g`(),)pC!!@TT̵TG@VJ @V@V @V$ŏT(ԺT0ΰT8dT@OTH);TP}TXԷT`k4 hjݵTlƟTtݵT|(T|ݵTԺTT:T=`¹`¹r6 D D4@VJ00WMpp`Mooi{{̱8w8wh$u$ux0q0qرIyy`(V(V4   iHHQddddcb 6|- 5 ^#O'O'P&P&&&O'O'9 O'O' O'O'gi@H t&t&H && &&  P' P'c`XP'XP'5 P'P'@`P'P'd P'P'd`Q'Q' l&l&W# HQ'HQ'*L D&D&MH h&h&I &&TIiH &&M &&` xQ'xQ']iL x&x&MI D&D&C 6|-8^#pI'pI'8*&8*&+&+&I'I'9 I'I'F D4&D4& I'I'gi %&%& J'J'c`@J'@J'T8/&8/&!``T&`T&!0&0& -&-&,2&2&5 J'J'@`J'J'd J'J'd`J'J' %&%&W# 0K'0K'M (&(&TIi LG&LG&` `K'`K'M H&H&!ϭ 6|- =~.  ˈˈCQ 77l`] b ,È,È}V@ $ӈ$ӈ xxyu 66 `] t ؿؿu L3L3/@ ňňB@Q ܈܈C`] XXC $(.ttW#;HDDҘpp1. ݘ@X 6|-bd  `+̳n̳n%`+nn^#,n,nK ooP,n,n nn[ nn nnc`oo@` o od`x"ox"ocrt#ot#oW# nn`1``nn(`ЬnЬn`nnQa{ L$oL$o~d %o%od J8&o8&oʸ \'o\'om8` (o(o `G@)o)o%; 6|-z/ J h2h2[@ 22 `o 33O44B`55] `6`6[\ 77P 88. 99u`L:L:(` $;$;u4<4<%@H<H< @|=|="`>>=\`>>`??j\`8@8@`AA0@0C0CP CC2 DDy\ \RPص`R##6@` ʿau $@(D ,K@0䮴`¹4̮T@H@LXPD T-X`ʶXaVۻb@X2 Dڴ`DUUh`tXg2Rn5ķ. tG"0ʡ 6|- Er^#KKiKK` KK)`0K0K(5KKIsU KK!tKtKSsHKHKblKK7KK$K$K"MO,KKrl`V`,K,K5`KKKKNR̟ؖK̟K S(ضKضK?KK<. 6|-D &O`6ll"ܓܓ```xxw * PPnZ ԩԩgi h` \\ DD#`0@j`ĕĕ||$W# @@f`$q ԢԢD hhM ``#K  ݸ 6|-J@l:^#*r*rp+rp+r ,r ,r qq,r,r9 -r-rF -r-r .r.rgi h/rh/r /r/rc`0r0rT1r1r!`H2rH2r!3r3r 3r3r,t4rt4r5 5r5r@`5r5rd 6r6rd`7r7r 8r8rW# :r:rM `;r`;r= ` (4=44u`V(&q *go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }a9|-J`Xl:MJ^#H*rH*r*r*r+r+r$,r$,r9 ,r,rF D-rD-r -r-rgi .r.r /r/rc`0r0rT0r0r!`1r1r!2r2r D3rD3r,3r3r5 4r4r@`85r85rd ,6r,6rd`6r6r 7r7rW# 9r9rM :r:r= ` ;r;r  6|-c: .j}}~}~}k4~}4~}خf}}x;@kd{}d{}`34}4}9d$C$C$`@C@CP{}P{})}}XTCTCCg}}%dhChCGk{}{}Rfz}z}9@ipDpDiDD}X@fDDl$}$}Ʋ@l}}}}Xi|}|}k}}}}GgDDp]1~1~M~M~]}}ݝ}}x<IP p(CL@ڵ@.  CQ l`] b }V@  yu  `] t u /@ B@Q C`] B{(G%.XigPvP@e 6|-Er A #LLLL"%ȀLȀL`\L\LYLL MMLL L LA PLPLDMDM dLdLatMMMMVLL*[T``LLLLLL+DLDLrLLLLLLj`mLLLL LL$M$MmLL`}i 6|-`H 9'`--/--Q@ . .x7@.@.T.T...̷`//n$/$/Q L/L/Q00ط00t`x x Z@6` ` Q9@00`91111P1P1`h1h1Q11+`4 4 :`11p?`H H `` ` Ix@6 n111122n@0202Yз@v##?@Vpȴ@V$ @D @D˞@&(n4i@V8x8@V<'@V@7@VDV@VH$@VL\`BPHBT* \dk,@Vl@Vp=@VtQ@VxPB@V|z@V@VXB@V@Vz@Vz@Vz@V`B@Vz@Vz@V\Txյ@V"us0@usN 6|-3 ^#*d*d9 +d+d`P,dP,d$`l,dl,d\N-d-deN`@-d@-d~ c cgi \ d\ dd .d.d~ /d/dd 1d1d~ L2dL2dc`3d3d@`5d5dd`6d6dK@7d@7duj\7d\7d01`7d7d~ c cM |d|d:%Q/T h ^,~ u l,~  BP/ {/ 46e" " J h2U[@ 2U `o 3PVO4 4B`5pS] `6V[\ 7dP 8V. 9Yu`L:T(` $;gu4<$<%@H<U @|=<"`>R=\`>S`?`Sj\`8@U`AA0@0CBP Ci2 D0ky\ \RQc 6|-1@Fs ! f 88J`((խ@J xx``<<l`f00JJ   `e tt@@ˇTTՇ ‹ _`@ ` x` ``ͼ` *bbr.entry[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]*[]bbr.entry[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]aи`׺@&&6@`Z au @$@(D@,K@0䮴`¹4g@@̮TDL@PXT0XUb$XVBlTX$ZX`D d-XpʶXqVۻrAX2ڴUUh@[JXtXg2kn5"0\ʡ\pδ[֟K\`\/ `/ (6e/`J բ[@ (עhw `o XآzO\ڢ٢] ۢ[\ ܢ<ܢP ݢy. ޢp{u%@<$ @X`dj\`@p`0@4P p2 (W`o ~I` Xbm܁/ H|y\ \RI` *bbr.WindowedFilter[go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount },go.shape.uint64]*map[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }]*internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] 6|-? =O`==6=="==`==`==`==w *== ==n = =Z  = =gi L =L =h` t =t = = =#`X =X =0@t =t =j`<=<=4=4=$==W# t=t=f`$==q ==D ==M ==e0$`rKLg;g;= Fdj;dj;/ 6|-`HErxFxFbPFFcR@HFHFk`FFT YFYFmT h Fh F F FU 89F89FPGFGFx` 4F4F> PFPFvQ_F_Fk UFUF>@ @eF@eF>@Q4/F4/F1F1F @F@FFFwrt Ft Fr` F F)`>pFpF !F!FŊ@9݋ 6|-bN 7I`Ob`Ob^#UbUb/Mbb7`bb]ZЏbЏbiNDbDblZbbxN  b baDXbXbE8bbr|b|bZbb$ kb kbN VbVb Nbbbb`bbj``TQbTQbRyQbQbq0gb0gbXbXbZ pWbpWbqnobob D  db dbY`.qTT>T$CTCT"mQTQTuXDTXDTEfTfT%VZTZTTTj(T(T?TTɯjTjT[?T?TKgTgTگXqTqTYߦ`?mTmTd8Td8TvTvT4VTT$T$TtTtTqDTDT6TT?TTPdTdT?TTPTPT*[]struct { key go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }; elem *internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] }*[8]struct { key go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 }; elem *internal.Entry[go.shape.struct { Host string; Proto github.com/apernet/hysteria/extras/v2/outbounds/acl.Protocol; Port uint16 },go.shape.struct { Outbound go.shape.interface { TCP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (net.Conn, error); UDP(*github.com/apernet/hysteria/extras/v2/outbounds.AddrEx) (github.com/apernet/hysteria/extras/v2/outbounds.UDPConn, error) }; HijackAddress net.IP }] }(#ض@rEr))Er<@FXMt@ H{Vv)@$)@(Wt0m@8V@@ʵD3H)`dն;h۴þl9EpmþtVExD`|1T]X*Xd@VFT@VU@VfJa* xξնUw@Vm@V?`-*XpXw)p rɚ9|-@gW@^#  9 L L  @I MI 88h "  c`5 @`d d`@@ 44W# HHM $$#M@M 88tI "J pp=I  ` M @M I %WJ  6|-~@ ^#M'M'M'M'9 M'M' M'M'gi@H `m&`m&@I j&j&MI @Er! II %J%J"S`I`IK II89 IIU II&S I IrU DJDJ@BJBJTIIŕ|6J|6Jm)`=J=JЕ@xFJxFJK?@CJCJ  IIU@II4&J&JBHJHJە@4I4ISHIHIW#@,II@,DIDI\JJ\JJP$`I`IlrZ?MJMJ $LJ$LJ(KJ(KJl#IIh 6|-I !l[ ŐŐ@___U aa* Y $"$"@$$3u`[ < < H=[ 88ݐݐU bbSW8%8%B@\\x=u@Gu @(([ xǐxǐ C[ TːTːxxCxxkLLUHܐHܐ, (ؐ(ؐ(А(А))QuӐӐ,@tt    D@,k 6|-fQ!==+X=X=\p=p=}j=j=8to=to=Eg=g= g=g=ċ=ċ=H܄=܄=H = =[\e z=z=R,w=,w=t|=|=h l=l===_$=$=p=p=\==Q4=4=‡ ==l$=$=m==O==`$=$= r= r=moL=L=o==G}=}='~ = =)QN `,, Wxu@V6@Vz@V ̽@Vn@Vn@VZW@V K@V$7)@V(xY@V,W07@V4T8@A@V@) DD!@VHTL`TT @V\4@V`6@Vd@Vhq)@VlT@Vp @Vt@VxY@V|@V;7@Vh@V@V)@V@VT\.T@V~7@VTT T@V%@V, 6|-Ţ@I"`A,4747U[@8@8yM8M8yt%8t%8@J 8 8$8$8U8U83HW8HW84H8H8up8p8OJ?S8S8L8L8HP8HP877N8N8?[R8R8@8@8^J 8 8S`88u`77 `8 `8JhA 7 78888y y77h7h777U77H7H7`x 6|-}jӎ"TD5D5HD550;Tx"x"_ UHފHފPD`U4݊4݊`,,xT((}T xx!T$ $ T4Tl)l)T''T$$` ؊؊} ۊۊ ` ՊՊ ъъ ЊЊ~@ ӊӊcPԊPԊ~ϊϊ` يي ԊԊ0@h"h"j`xx?  #T||{~ UߊߊXDPP5,,*q 6|-""e,,l--ײl..FXe//m11m$ $ @A42429dP3P3d4d4p5p5A|6|6,77$`88999G::/;;u<<X==G>>@??@mAAGmBBm4C4CRlPDPD%dlElE2mFFRfGG9@iHHiII}X@fJJnLLGgMM@,N,N7n  \/ /  ( Y@VJ [@  `o OB`ԭ] $@[\ 4رP <. ,!0 u`T"(` "дu $#%@8$ $ @$T$"``%=\`&䭢`&ĭj\`((X'`)(0@+*P +2 ,.츢W`o I` 0bm/ y\ \RI`1 b`r@` (u`IeNPlX>@?d?@mA@GmBAm4CBRlPDC%dlED2mFERfGG9@iH$HiI@I}X@fJ\JnLxKGgML@,NM~L] --,-gX۴޻ `*nJ b@# U(UgX*1`,P@V0X4ˈX5H1X6ڴU8hK:\<@y`L꽵XadhTpJXxS@¾|Ծ۴XX"b#X2bBbRbT|@zq@z(_g  # ֈXKሴU"۴Ut@Vvػ$ tM mL--mL, k`Eߴr%ཹOy%( 4 `ù@ߴVL%VP%VTKVX%V\V`lVdVh%VlMVpVtkVx"V|OVkVHVP5V%V%VX5V`5Vh5Vߴù-`8ù ĹxTC`ĹNĹ`T `ĹOTRX  [ Y [Oӿm *T 6|--2`H4#7"7"PD5"D5"vr r?[G*"*",x,"x,"8\."\."an@0"@0"wT!"T!"{`3"`3"rA2rU2DG&"&"#<"<"$2"$2"Ǡwr0"0""""qm 6|-` #aadaaKȀaȀatDaDa+ؕaؕa vaval@ aa`aa |a|ad@ `1a`1aZaar!a!aZ Mpapa)@0a0a !a!aKaaB@aaYKxaxaDaDaaPgaPga M@ca@ca(?a(?aәaa2n8Ua8UaD$Va$Va+,Xt_a_a`%D`-a-a؎a؎a  M<\a<\a :ZۺZ 4[CӶ@CNV  ļH xܼ"SK D89 ľU D&S–rU ĖhÖ@Ė<ĖTŖĖŕ ƖŖm)`Ɩ8ƖЕ@ȖƖK?@ʖ\ʖ  t˖˖U@l̖˖4͖ ͖BDЖ͖ە@TӖҖW#@,ԖӖ@,Ֆ8Ֆ\ooE-bi26  6|--2#Pvr ,y,yr?[G,8anw{rA2rU2DGuu#kkǠwnnrLrLr"XXEĺj`7H..H80$qbTr@V pV@V'kQT 'k( ( 4(68 #@@VLXP1TѴ@V``<@Vd@VhҴl@Vx1|p|5@VSk''''((fV@V㿶XljX Ҵ@V0Cf@VV@VbXF@Vb`)@X  g=@Կ# F`g$j.g0R`f<lSgH 7T2 6|-@@ Er$ x.Nx.N ,/N,/N"S/N/NK 40N40N89 d1Nd1NU 2N2N&SP4NP4NrU 5N5N@6N6NT47N47Nŕ7N7Nm)`|8N|8NЕ@X:NX:NK?@N>N4P?NP?NBANANە@ENENSFNFNW#@,HNHN@, JN JN` PO,$lrZ?s`LL l#aV 6|- XW$YEZr)8p!X6`A/rF Uv>> 99Z|@|@=@s@@@;;H # qX7X7P_v"~Civ`Y`WF&F C ClDADAL`GG=0 6|-IP@p$.  CQ l`] b }V@  yu  `] t u Fxbxb/@ B@Q C`] &  6$y$yB{(G&XP% .XippgPzvP@00%+j кɕ 8H//HD0$qbTV V`V51Ѵ@V(Ҵ,@V81|p<!X@@VD0Ҵ@VHZXL<ҴqP#oTFhX1 id@Vpb`tR`fF@V Ҵ@V6(XZXsXy@X@VC@VHҴX,XTҴXX@V`4''''lFX 2X!b`i$@V( 7,M M 6|- Xn5$YEZr)8p!X6`A/rF Uv XXZT T =@s @H # q00P_v"~Civ`Y`WF&Fl  L`llJr 6|-`: $"ed}d}l8}8}ײl}}FXex}x}m}}}}@A } }`3t}t}9dFFd}d}}}A}},}}$`GG9}}G}}/4}4}u@}@}X$G$GG}}@}}@mx}x}Gm̄}̄}m}}Rl<}<}%d8G8G2mP}P}Rf}}9@i@H@Hi\H\H}X@fHHn}}GgHH@}}]XU~XU~h~h~_. 6|-4q$lR 88 BllB :44==L` hh$'`kj`ll^  p||!!7r XL  &`$$`/LrY ( ( g5 LLHPP1wxJS 6|-L@i% h`  `$F tt$ $`(3Lt4))L   .,,43303YYM0$`<@0%0%MM!M\<\<@??J83`  @3X X X@55ch X X t0t0*MPPHhh3M@@`hh7$c  6|-'`%"H:@ [[S,[[op@ [[S,l[l['(@ ؉[؉[P:,p[p[S@ [[X:,@[@[S  [ [w"@ `[`[`:,[[S@ [[h:,[[J(@ [[p:,[[S@ [[x:,[[@ \[\[Q(,[[:@ [[X(,̑[̑["`[[_(1[[f(@ h[h[:,([([S@ x[x[:,[[p[p[q@ ܊[܊[m(,[[:@ [[t(,T[T[} 2[[`2[[[[{(0[0[;Ȝ[Ȝ[ 04 4 "4o W@'@^p9  @I MI xh " h c`@5 4@`d dd`0 |t $ <W# M #M@M tI < "J  8N=I  X` < M @M I %WJ  6|-4 %^#,%,%pp9  gi_ <<@I MI h " hh c`5 @`d ddd`00 || $$ W# M #M@M M@_ tI "J 8N=I  X` M @M I %WJ G 6|-`%%<\ vv4 0M0Mu] @] dd] (X(X1 RR [ 臗臗 [ hh [ ^^V tt ] d}d}X NN@ |y|y^ u-@^ ff< pp) TT`^ $Z$Z^ JJAe_ K 썗썗Ve ```@_ lblbx hjhj*_ dHdH_ xnxn5` VV-< ww@` h{h{@ xlxl}` rrke` Ba PPb@  L\L\tR 8`8`kѣ 6|-Z% ļļ xxA f f"SK 89 U DD&S––rU ĖĖ@ĖĖTŖŖŕ Ɩ Ɩm)`ƖƖЕ@ȖȖK?@ʖʖ  t˖t˖U@l̖l̖4͖͖b BggBDЖDЖFzeeە@TӖTӖ@ccW#@,ԖԖ@,ՖՖM kk\ooE-bi26% 6|-;q: %!eȌ}Ȍ}l4}4}ײl$}$}FXe}}m}}@AP}P}`3`}`}9dEE`}`}}}A}},Ў}Ў}$`0E0E9}}G}}/0}0}u}}XDEDEG}}@p}p}@m܌}܌}Gm@}@}mP}P}Rlؒ}ؒ}%dXEXE2m}}Rf}}9@i`F`Fi|F|F}X@f}}nԓ}ԓ}GgFF@ } }p]t~t~`}`}](}(}Y(Er@11Er\\) s= UXAXp#"$T,@47 <U@H< sH|XP}QXQ2XRXSXT4˵X̛X\X<``TdTlݛ@Vp Ut@Vx)|ctcUفU6VֶUU{@UֶXXA@V@p@=#y T|4 6|-Er&SHSH^#dmHdmHx)Ix)IPUHPUH tpHtpHA` NH NHSsHcHHcH' &@WH@WH%4H4HY`^H^HA`kHkHF`mHmH``H`HT`\H\Hh?`0`nHnHȗ`2nHHBn`T`HT`HRn@HH`LHLH!ZHZHTO,A`/t`HH0pHpHhHhHʗOHOHAx\Hx\H),HHءHءHXx5Ix5Ij 6|-1&!9'`l l / `| Q@ x7 x   4  ̷` n< < Q Q8 8 طx x `| t|< < Q9@ `9X X  4x x  ` Q %@ mw`` ` +`, , :` p?` |` ` DK@  n  0@   n@  x?$ $ rOQn@1 6|-҉@: &exp}xp}.j$s}$s}خfls}ls}`3@t}@t}9dpq}pq}]@u}u}(dhr}r}$`Tp}Tp}Xq}q}CgHs}Hs}%dp}p}Rfq}q}Zd|r}|r}9@iDp}Dp}i(p}(p}@`r}`r}}X@ft}t}ht}t}M@hs}s}hs}s}Ggdp}dp}^,^`p.`t}t}` } }H~H~`<}<}3~~`}}%`H}H}]~~]}}ݝ } }: 6|-5`I' K /%/%@K "%"%K %%i@ <%<%K %%iK ,(%,(%jL t,%t,%  % %( %% $$%$$%%K d/%d/% 2%2%jd#d#d6h#h###4Ay##@K =%=%LL C%C%## 4%4%K I%I%\$\$1##XK \X%\X%@K W% W%dK S%S%j T%T% %%%jK /jL p \V%\V%0 ;K 9j_"" |hx#hx#(()@ Er Er!dNV ' &`N\ 1 @b# x.N-N ,/N.N"S/ND/NK 40N/N89 d1Nt0NU 2N\2N&SP4N3NrU 5N5N@6N5NT47N6Nŕ7NL7Nm)`|8N7NЕ@X:N8NK?@N=N4P?N>NBAN?Nە@ENlDNSFNENW#@,HN8HN@, JN|INP$lrZ? l#^!9M 6|-b./ '!K J ||[@ `o OB`pp] ``[\ pp1D P . u`(` u %@88 @1 "`ll=\`ppb   ||`4 4 j\`  ` 0@ P 2 W`o ͅ`I` bm/ y\ \RI`rI09|-1@&!9'`T T / `| Q@ x7 x  4ȼ ȼ < < ̷` n  Q h h Q  طX X `| t|D D Q9@ `98 8  4h h h h ` Ql l %@0 0 mw` +`H H :`Է Է p?` |t t DK@p p n  0@  n@ x?` ` rp p OQn@zj`44Z Q@$ 0+<I XH] LPK@VXj\1c`dLc6cX hclh@Rخ`؏`-u۴q ģX?XL@VbXxbX`¹ۣ`¹h`¹b`¹۴`E JuX,K`¹0 `¹<1HNTj`¹`̶`¹lK`¹x `¹`¹D'h `@V1wXGw@V1X @V7Xc`4H7X"+x44x {'K /@%@tCd 82tw$lw,V4 v<*@DHHp@lPvXv`lvhlvpŃWx*W䨴WpԴs|ԴWWWBUB@VR@l1XoUsDXb@l mX`XXYt"Ywrv1X1YX.X_XX@YXBXvNT ֧v'vv Xv(+.X0ui |-e mL(I`6`6`r6Altz`ht57@'l `\sU#`2f557&7@w P`Kl`57v`S7`,sNb7S`Bfei#\gf}#8uK~ 6|-@((V % [ LLݣ [ h 4@ @ޗ@ޗb  ,',' !!< [ ((1 [ \\ [ t%t%a ; [ [ t [ p p X ߗߗ " <# ,,@ ** l@ c ((3 = e x d#d#"   @   D ll@c `  pp# llBc  6|-(!@ 88 T`hٮhٮe]ƮƮ"ƮƮ D<D<"`ЮЮ ll@ 44  %%2 h#h#@Ӯ@Ӯ-]ծծ-]XҮXҮ9]ѮѮ@ @ T T w@ ȮȮh@ ʮʮY dϮdϮh خخe@ E DD HծHծW֮֮EE`ծծ1STh - (& $pĮpĮv `ͮ`ͮsa\D׮D׮ @]z$R 6|-n($^#ddJq@ BdBd@Bd@Bdfq@ \Bd\Bd#` BdBdL@ BdBd` CdCd1@ ,Cd,Cd9 CdCd`DdDdE DdDdk DdDdz,DdDd$`DdDd\NEdEdeN`EdEd~ tFdtFdgi FdFd`H`FdFd~ ddddc` d dz[GdGdJ,Gd,GdHGdHGd dGddGd@`ddG GdGdXH GdGdd`ddlGdGd-GdGdKGdGdujGdGd01`hHdhHd~ HdHdM HdHd:%Q/ 67 6|- :) %,A,A%AA% BB^#CC@DD%@EE EE4N FFN GGgi dHdHN 0I0I^  II@N JJc`KK@`XMXMd`OO pPpP Q Q  6|-d =) %\)\)%**% $+$+^#++@ - -%@H-H- ..4N ..N //N 00^  P1P1@N 22c`33@`44d`h6h6 77p8p8 99j`T;T;W# < <NN ==D D>D>M ??%$r6X%%N 4N  IiN@N ?`֑`"`l Nl# M 6|-"@x ):dXl\Xl\dl@qo\o\= j\j\@n\n\Sn\n\B`m\m\ o\o\yl o\o\X@ $m\$m\t* 4m\4m\* dk\dk\^Dm\Dm\LEy\y\BqTm\Tm\lqi\i\Yhj\hj\E @qGN4\4\lq\\w\\X,ؔ\ؔ\ M\\ M٨ {\ {\bN{\{\0Nq/<\<\ M\\}\}\0@q*_`oٗ<\<\lH +b/ ./ '( *`e!K ,J |[@ `o OB`p$] `|[\ p1D xP . u`|(` 蘢u %@8  @T1 `"`l܌=\`pЎb | |`4 j\` 8 ` 0@ x P P2 W`o ͅ`I` Đbm/ y\ \RI` Z 6|-j@9* %<<%% ((^#DD@%@\i\i jj4N kkN , ,gi nnN X*X*^  4+4+@N xxxxc`@`d` 88 j`00W# qqNN ssD zzM uu%؋؋$r6PPX%%N 4N  IiN / /@N 00?`@@֑`HH"`PPl N8|8|l# M   6|-rrVK*#9'`LlLl we`@k@kh?YQ`1x|x|xCG w1L}L}~"`w}}̷``l`l^w<< ? \\ w,,twTT1`i`i1tltl`2zmml tt%@8{8{mw`ȄȄ+`:`llp?`ԇԇwPy%G z z`i00DK@xyxy,k,k0@XjXjx?rȏȏO+00OQn@ZQUY 6|-J`1*$"`0303S33@f H3H3y 33Zg 33x@h 33i 33J:43437U@j @3@3dk 337 3333@m 33F)o 33%yo 4343@q 338?@335`33+`33%@33xA@ Ԡ3Ԡ3(,x3x3A 3 3PI`l3l3~` 33H3H30q 33ys 33y[@x D3D3t 3 3(?@u P3P3u 331[v 33,` 33+:h3h3=p:̡3̡3`33+|3|3y 33` 33[` `3`3+`t3t3n|-&`:)(!1 %,A@%ADA% B`B^#C C@D`D%@ED ED=M ?P?%$r6X%%N 4N  IiN@N ?`֑`"`l Nl# M 6|-;^@I,%!H@/ 00I  T`xDDf LL"@ۆTT \\خ@xYhhpp7U@$xx+@F)  @*(/$ $ @ 0@x!x!_!!B""A@##j## $ $(?$$u@%%%%0&&Y^```B`R`Ϻ`` a ~@Er`C::Er`Tp V@,V\@<$I(V!,ɵ!0 "4`"8"<U@H< sH s=P?TT \ldP<)hcXpɵXqɵXrXs@Vt S@VxɵU|?UɵUɵUpUUɵUT-{@U{@U@U6U}@ƿ5S@VX@XXsXJSXʵXsX`(?T@l "0- 6|-@a--\`BuBu v?u?u"[u[u`[u[upB`xYuxYuxB *@u@u *DuDu$_u_u\`^u^u *l\ul\u`$Yu$YuB`DYuDYu$ *l^ul^u)T_u_uB_u_u` [u [u`[u[u\`WuWu#` ]u]uB`[u[u HTuHTuy IuIunRuRuZ PSuPSugi LuLuy tKutKu GuGuvz HuHu"O`YuYu\`lVulVu#`YuYu=+LVuLVu\`<@u<@u#`p[up[u *]u]u\@_u_uj`BuBuW# BuBuf`$FuFu' *EuEuq NuNuD OuOuM pUupUuQuQu| QuQut%]9|-;^ @I,%>@X!H@/ ,,I  PPT`xf "@hhۆxx خ@xY7U@$((+@((88F)HHXX@hh*(/@0@88_HHBXXA@xxj(?u@0Y^```B`R`Ϻ``Fժ 6|-O<.! 0r!0r!| @s!@s!iHt!Ht!kHu!Hu! v!v!Nw!w!P4`x!x!M y!y!z!z!X4p{!p{!|!|!p}!p}!7H~!H~!x$!$!!!!ԁ!ԁ!x!!_!!4\!\!M!!q` !!3!!g!!w܉!܉!3` Q 7@X$U` aGQGx6&@8U nVlT!%h@HжVAAHtTS`¹`¹(T ST(MT0ST8c`¹@ȾLS@P`¹T`жT`Th@ƿpKTtĵ@+|9@+S&@+Y$S@+Wo@+q%9`ѹ`¹D `V#9999R n+9T: ` Tao@+@%TTTko6y55 %(`T)X-0N\<uoD1@P@VT":@VX%@V\ĵX`9Xa:Xbn Xc%Xd!XeXf%XgX@Vhtt 6|-g 2 Z || - |`Z hhZ $$a ÒÒx   ڑڑn ڑڑnZ BZ $ @2@2 `88u 4ב4ב} AAB [ `J`J`Y 0̸̸**h?NNϒϒT;;ZZ X XDDf(j(j?(_(_ Z ttAW C`[ NZ ÑÑPP(N(N @pƓpƓ<Z ۑ ۑ%@PPlU44QЧЧY00--˜ppx<\<\HԒԒ4lHlHO@ b( 6|-|hD3(| \L?\L?U>>D ??x" ??_??n` 0?0?"@ 4?4?Q 6?6?: 9?9?| B?B?e LF?LF?@ ,>w``>>g`M?`M?(>>o >>|t>t>`>>, ??2} ? ?   ? ?7 >> >>m `>`>3, H?H?0@>>>>>>84 TN?TN?8??|>|>t>t>`$>$>1`?`?>>>>D??"pn>pn>9'z 6|- 3-U`RR; BtQtQ1|QR|QR8@ 6R6R@NRNR'9R9R' 7R7RR>R`t>Rt>R 0R0R `MRMR9.`SRSRE94Q4Qb@RRl"Rl"R/%R%R@/8)R8)RX+R+R'/`-R`-R/4'R4'RU@5R5R$00R0RU@03R3Rb ,ER,ER~ X?RX?RdRR1@ R R lDRlDRE`GRGR0@ERERW#@ GRGR,'@ HRHR&lWRlWR1xXRxXRb #R#Rp` )R)RO .R .R` 3R3RSs0$|OcO1+4UV:U?@!`'HRO l'' t  | `9'(' (M'/ T`` "'$`3@i@, 5`Rt ('h09@'@ttch3P$g$9`\H' Ը`<@'`'X9`T0@e`(,j`'j@hH7 BCohdR;`R`X\(0(9  $OxO +i9st& 6|-vjv40@DpDpW>n >`&hsxvv  W*XF*>]}civvo0s!P1<vKYu> \v2G'{ * f5vg_v40@Dpt\Wl^ >Ȉn >`&hsLfXx0v v  W *pXhF*>]}uci0g!vt4v|mo$0Ss!\JP1Tz<v ]KY)u> \dbv2G'ȅ{ *HDB։`Z@nFFZX`byryu,@V0E4_Km81 .<@@`|H /P7tT`\ɴ``Ndh{tl`p`u] @<A7E-NTx {<(C@ft&x|xU@UmYT&@U&@U@UmXKPXXĎ@T&XPXX Xm`XLXώT ǹmV@UC8`(`G P ڎQ 厴UdUh`l Bx m@XR8@Vz@YUm &@lQ@CVVm4@6V6V @`a8` ``mlQ,'VX @V`2dC{ 6|-w G9/x1 c ^# ` tt@ @Vhh(@ h+ ~o+iif`܂܂G`c  v+N ďď0@N tt\ PZ`((w` h XXgi@G HG ̕̕HG ppYZ@ > hhL ||@N llc`zz@`zzd`8{8{sc c ` d i2`d Yd $Hd 88 e Ss ~~qddW# wL ԽԽ3H@L BHL \\| MH LLZG LLhG ̶̶8@ }Q4ssPȇȇx4'` xt`@t@t`tt*func(go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }, go.shape.struct { github.com/apernet/hysteria/core/v2/internal/congestion/bbr.extraAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.bytesAcked github.com/apernet/quic-go/congestion.ByteCount; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.timeDelta time.Duration; github.com/apernet/hysteria/core/v2/internal/congestion/bbr.round github.com/apernet/hysteria/core/v2/internal/congestion/bbr.roundTripCount }) int)q 6|-cO=/!`'RO ll''   | 9'((' ((M'/ ``"'`3@i@! 88,5`Rt ('hh9@@'@ttch3$$g9`\\' Ը`@'`'XX9`0@e`(j`'j@hh7  BCohhr LL9 84 R;`R`XX(00(99PP  OO +i9AGo9RM`R*struct { pragma.NoUnkeyedLiterals; Flags uint64; Size func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }) struct { pragma.NoUnkeyedLiterals; Size int }; Marshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error); Unmarshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error); Merge func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }; CheckInitialized func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error) }*func() *struct { pragma.NoUnkeyedLiterals; Flags uint64; Size func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Flags uint8 }) struct { pragma.NoUnkeyedLiterals; Size int }; Marshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8 }) (struct { pragma.NoUnkeyedLiterals; Buf []uint8 }, error); Unmarshal func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message; Buf []uint8; Flags uint8; Resolver interface { FindExtensionByName(protoreflect.FullName) (protoreflect.ExtensionType, error); FindExtensionByNumber(protoreflect.FullName, protowire.Number) (protoreflect.ExtensionType, error) }; Depth int }) (struct { pragma.NoUnkeyedLiterals; Flags uint8 }, error); Merge func(struct { pragma.NoUnkeyedLiterals; Source protoreflect.Message; Destination protoreflect.Message }) struct { pragma.NoUnkeyedLiterals; Flags uint8 }; CheckInitialized func(struct { pragma.NoUnkeyedLiterals; Message protoreflect.Message }) (struct { pragma.NoUnkeyedLiterals }, error) }vP9 6|-]?^#--../...4.4....9 tV-tV- L`Y-Y-R.. -- V-V-c`LW-LW-@`W-W-d`tX-tX-b..W# --QD.D.k@H$/H$/pt.t...e#8-8-)v "/"/bD-D- x/x/U--+K--v..}..s..8l-l-?vbP.P.P11..U22`h ,2,2Ǣ``22Um22@KUv|i1|i1u3--3-- --@z-@z---D--`-`-E2E2Ȏ`\1`\1335--X /X /l# ----kvH-H-@-@-+eŇ 6|-~G3@3q YY`BYYTBĻYĻY/=`B=B=BZZ CАZАZZZ`C`Z`ZCZZ`;CؓZؓZq DZZq0Z0Zq`D\Z\ZTD(Z(Z` dZdZ @Z@Z Z ZUDZZ U EМZМZ `EZZEZZ#E@Z@Zq FZZ`F,Z,ZATZTZ\ZZ ZZ2 hZhZ`ԦZԦZk 0Z0Z=ZZ=ZZ`ZZ(Z(Z 4Z4Z@Z@Zh ZZAZZ BİZİZpZpZt4Z4Zz H Z Z@ZZZZ@ZZ ZZZZ =@ZZ"0Z0Z@S Z ZM=0Z0ZQ`;= `H&#Q`З`=h`"k*R/ 6|-PFZB:477477` L=7L=7( K7K73@:c7c7W`O7O7F`aal%@:77z%h7h7Tz7z7u`c7c7a77(j7(j7@:77@:0$``A,?7?7FA7A7TB7TB7t@:777d]7d]7aAK Fa(FU-a0FX7X7_zaam%|;7|;7a@:77,`QFFΙ@(F(F;@ J\`TFTFIGIGsFFpGGlX<H1GH1GߙGG`GGO,HFHFf G GGtxGtxG_SL}GL}G>ԏGԏGhGGxxGxG`FF````UGUGv;G;G4G4GJ@]G]GlbGbGBGBG#,wG,wG)PGGPGGl@POGOGMVSGSG4pMGpMGSDGDG̽`FF`G`GؽdFdF 3G3GGG)`H-GH-GExGxG<G<G&GG)~)FF T2GT2GV`!G!Gë`/G/Gn`GG#FFy`FFl #lGlG),pGpG`TGTGgHFHFMGGGGX)GX)G^օ9|-33B3@q ZZ`BZZTBZZ/=`BtZtZ>=BPZPZ C \.\.? >>| UUv th&h&P4`e 0<<"`t?`ttt ? @a ll7Ut`3AA ll! SS,QQF)TY w` t#t#ZZg|W|W   ]Y !! w pp`;`;  4343F DD \\?  ( (  xx` L$L$ P P~p ?a ((fY u``w`u'wua ((uܿܿ`p==0@@@e PP)`>>D<<(?pp9 [[84 YY |7|7ppoY@a  || HH% ```L`L2rIg 6|-NCB/ .x7UJ̀t:.TbF&F׀F)KF/&T]bE\@Rh%@&&tPc vQvQa b &` nrDU{ 0@^%?((?fb.SU[/&v"@rfxpQxpQobbUq&@tQtQ *struct { LatDegrees int "json:\"lat_degrees,omitempty\""; LatMinutes int "json:\"lat_minutes,omitempty\""; LatSeconds int "json:\"lat_seconds,omitempty\""; LatDirection string "json:\"lat_direction,omitempty\""; LongDegrees int "json:\"long_degrees,omitempty\""; LongMinutes int "json:\"long_minutes,omitempty\""; LongSeconds int "json:\"long_seconds,omitempty\""; LongDirection string "json:\"long_direction,omitempty\""; Altitude int "json:\"altitude,omitempty\""; Size int "json:\"size,omitempty\""; PrecisionHorz int "json:\"precision_horz,omitempty\""; PrecisionVert int "json:\"precision_vert,omitempty\""; Service string "json:\"service,omitempty\""; Proto string "json:\"proto,omitempty\""; Name string "json:\"name,omitempty\""; Priority uint "json:\"priority,omitempty\""; Weight uint "json:\"weight,omitempty\""; Port uint "json:\"port,omitempty\""; Target string "json:\"target,omitempty\""; Flags int "json:\"flags,omitempty\""; Protocol int "json:\"protocol,omitempty\""; Algorithm int "json:\"algorithm,omitempty\""; KeyTag int "json:\"key_tag,omitempty\""; DigestType int "json:\"digest_type,omitempty\""; Usage int "json:\"usage,omitempty\""; Selector int "json:\"selector,omitempty\""; MatchingType int "json:\"matching_type,omitempty\""; Content string "json:\"content,omitempty\"" }ˆ*> 6|-3@IV8888":@@A` -S+P8P88?88%@ HA(88C[x@::[`88$`iv&@:8;Z`[G,@:t@:ܜ`0,QS77<=NI@:'`nI|tt_HT`JpJayJ@:`\[`ٳkyn`@:t"J`*[@:uy@:@:tl@:- 6|-F`Z[X@ 8lj8lj9 |mj|mj] njnjbj@ pojpoj0`Hojoj/JpjpjJ KrjrjK prjprjrjrj9 PsjPsjbx tjtj<8uj8ujrj@ lvjlvjM <wjwj= xjxjL`Kyjyj[ dzjdzj {j{j L|jL|jK }j }jzL0~j0~jc%`5%`GP`HjHjE`r^wrxx(@.cP^R< O% i% ж ^l j jM %U]|cn Dv53U KQ6^!M H}` `^KK^`ЀjЀj jj`jjԄjԄj_{` LT^`fc`L{`^'D_ e6  .M@x u[ 6|-nZ[X@ XeXe9 ee] H fH fbj@ @e@e0`Hff/JddJ KddK ddhfhf9 ffbx ff<PePerj@ eeM <8e8e= eeL`K|f|f[ f f ff ffKffzLdfdfcXeXe%`$e$e5%xexe` e eG8e8eP`ܟeܟeE`leler^eewrxffx0e0e(@ee.cPee^XeXeReeTueTue<  e eO% eei% ж TeTe;e;e^eelleleeeM XeXe%̖e̖eUee]ܘeܘe|cSeSen@%e@%e DXeXevHeHe5\he\he3seseUx_ex_e KQ6h'fh'f^ff!LfLfM H}`\e\e xexe` e e^K d dK e e^``f`f TfTf`ffff_{`5x>5 ?5?5Xj .5.5@ l/5l/57U@j F5F5x G5G5j W5 W5I W5W5j T5T5 U5U5dk pE5pE5@ F5F5S s4s4 h4h4t @4@4 x4x4x (4(4i ȭ4ȭ4` 44p -5-5 `=5`=5Ĺ` lD5lD5 S5S5+` 55x (5(5|` (5(5 p5p58: c5c5x i5 i5Gp n5n5I }5}5Qp 55#I` 55Z К5К5v `5`5 44 x5x5t D5D5"i 66"t 0606` @6@6 036036S (:6(:6 ?6?6 `E6`E6` K6K6x P6P6 _6_6mX4X4o(4(4P@k 55@k @5@5Z 85857k 55 \5\5+l 55@ 55x@l 55B@ 55' 55Zl 55y L5L5l @5@5 `5`5+m ̳5̳5@@ 55*5*5@m e5e5+m Xk5Xk5@ l5l5ym j5j5M j5j5+n p5p5@ q5q5@n @5@5@ 552In ~5~52t 55yn o5o5X Tp5Tp5F)o 55@ 55@o \5\5@ 5 5AIo 55Bt 4545%yo 55c @5@5)p 55+ ȝ5ȝ5Z@p ț5ț5/y@ d5d5/ xf5xf59yp 55n 55(p x5x5 55@q xd5xd5[@ e5e58?,44Rt` 4444` 445`55+`55(,&5&5Cy ,)5,)5A*5*5PI`44~` 44_I@q H4H4*5*5h4h4L4L4ơ,$4$40q ,5,55q 55 h5h5btr \5\5ס |5|5 [ 55Bq 66 66rtr 66 66O@r p6p6nIr !6!6t@ l"6l"6r P6P6 d 6d 6  \6\6ts @6@6 T6T6t@s p66p66 @ \76\76s @46@46m3 T56T56ys |5|5 P5P5t `<6`<6A@t A6A6[ B6B6t @6@6@ XA6XA6At G6G6[ XH6XH6u XF6XF6 F6F6(?@u dM6dM6([ ,N6,N6u L6L6@ L6L6+u S6S6A S6S6Myv Q6Q6 pR6pR6+ =6 =6@v \c6\c6@ d6 d6v a6a6}I 4b64b61[v ;6 ;6Wy ;6;6,` T5T5;w 55+ 55+90404=p944+55\44144q@  5 5(T5T5I55Z\5\5+`55sW^qr]:txidiv2., ; %!i))(tvrRuUeEaAlLsS01bBoOxX+-nNiIfFpPup??ip53->._: ..|0|1> ] [("")) ) +: @s PB n=][} ] > [ ] 25\x\a\b\f\n\r\t\v\u\UnsusmsPMAMpmam00µTZgteq__--[]to%v""%sts80TE//./]){}"::% ,W/h2%wteTe%T ">OKca*.EC%x%p" 0b0x0X0oOUCNST=# (LlLtLuMnLCPePcCcScPdNdMePfCfPiNlZlSmLmSkPsLoNoPoSoZpCoZsMcCsCnYi}}NSMXos%X+1%f%d%%%qjsorgeleltne${loCEh3\\\"ToA4V1V6V2V3V5A3INCSCHHSDHDSKXLPMBMDMFMGMRPXRPRTTA z=" "" m %tif{{/**/\d\'͏$1=: `#; # ;\;\#:= :| ''# [[, !! `!<<>&^+=-=*=/=%=&=|=^=&&||++==!=<=>=go msgudpsniuriTUNtcp443ymltlsaclurlB/sbpskeyRSADSAURInil01_cgodnsftpssh::1set): PWD../finptrobj() gc %: gp *(in n= - NaN P m= MPC=], < end > and...]: ???pc= G125625nanSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUTCµsμs") } top -zsh%s hclenvinitun///%25ip:%+v'"'newACKGETGet200404100://0 ,h1TXTtxtPUT853MD4MD5EOFKEMexpSETintmapKey�HanLaoMroNkoVaiTTLSOAPTRSRVOPT"}}dupmaxnet lennot" arg%#vb2bVia.js?*[ageviaIf-204206304400500‍‌ANYechPGPOIDAPLAVCCAACDSDLVEIDGIDHIPKEYL32L64LOCNIDNXTSIGSPFUIDX25:0x%0X qr aa tc rd ra ad cd\# macMAC %q = | for""" inf]] 1.1----0b-0oTAG allanytapgtpifbvrfsitvtigrecanEndbgpmrtntkrip @ %#xackptorawecnmtuAnyu00103503*/*302403421425get: ` delLZSDD;GT;Gg;Gt;Im;LT;Ll;Lt;Mu;Nu;Or;Pi;Pr;Re;Sc;Xi;ac;af;ap;dd;ee;eg;el;gE;ge;gg;gl;gt;ic;ii;in;it;lE;le;lg;ll;lt;mp;mu;ne;ni;nu;oS;or;pi;pm;pr;rx;sc;wp;wr;xi;AMPETHREGampdegethregshyumlyenADDSUB'''atmx25pppbifash=> neg#%djeqjgtjlejgejlttxataxINT<<=>>=&^=varoptreqrepb2sinfowarntimejsonobfsaddrnameyaml:443acmePOSThostquicKB/sMB/sGB/sKbpsMbpsGbpsarchtruemap[eEpPicmpigmp ftpshttppop3smtp) = dialreadfile on pipebindunixwaitseek/tmpHOMEopenstatsynclinkallgallprootitabsbrkidledead is LEAFheapbase at Has useddata of <==GOGC] = s + ,r2= pc=none+Inf-Inf: p=cas1cas2cas3cas4cas5cas6 m= sp= sp: lr: fp= gp= mp=) m=3125AtoiquitJuneJuly as hour in /etctrimrpad%s%s %v helpbool", "bashfish:%d tomlproppathargs\u00INFOWARNnull'\''DATAPINGIdleOpenHost<>HEADEtag0x%xDateconngzipdate%x Gone1080p256.keyhashsans127.fromocsp.crttypeAAAAipv6LinkConninithookusertcp4tcp6udp4udp6%08XAuthshashashaHPKEmd5asn1tag:int8uintchanfunccallElemCtrlkindArgsCall != MarkAhomChamKawiLisuMiaoModiNewaThaiTotobitsNameTypeMX: PrefMBoxtextPortCodeDataNone--%sintshtml* %sOsFsFullauto1RTT0RTT --From.css.gif.htm.jpg.mjs.pdf.png.svg.xmletagvaryxn--SHA1NONEalpnportPKIXSPKIIPIXIPGPATMAAXFRCERTGPOSISDNIXFRNSECNULLRKEYSVCBTKEYTLSATSIG-tlsTYPE%+v %+vcodePWD=PATH,#=:pcg:CASTshashashashashasha sha sha elsewith<%s> := listspancasevoidNodeFile.exe %s -inf...`%TAG.inf.nanTrueTRUENull.NaN.NAN.Inf.INFYAMLslowfast{%s}downvlanvethbondDOWNipipvti6xfrmsitebirdbootdhcpisisospfxorpenumlazyweakdonepingect0ect1scilsciddcildcidechoBoolTime!BUGlinepostflagcap -> fail%s%dX448certzlibzstdX509AMP;Acy;Afr;And;Bcy;Bfr;Cap;Cfr;Chi;Cup;Dcy;Del;Dfr;Dot;ENG;ETH;Ecy;Efr;Eta;Fcy;Ffr;Gcy;Gfr;Hat;Hfr;Icy;Ifr;Int;Jcy;Jfr;Kcy;Kfr;Lcy;Lfr;Lsh;Map;Mcy;Mfr;Ncy;Nfr;Not;Ocy;Ofr;Pcy;Pfr;Phi;Psi;Qfr;REG;Rcy;Rfr;Rho;Rsh;Scy;Sfr;Sub;Sum;Sup;Tab;Tau;Tcy;Tfr;Ucy;Ufr;Vcy;Vee;Vfr;Wfr;Xfr;Ycy;Yfr;Zcy;Zfr;acd;acy;afr;amp;and;ang;apE;ape;ast;bcy;bfr;bot;cap;cfr;chi;cir;cup;dcy;deg;dfr;die;div;dot;ecy;efr;egs;ell;els;eng;eta;eth;fcy;ffr;gEl;gap;gcy;gel;geq;ges;gfr;ggg;glE;gla;glj;gnE;gne;hfr;icy;iff;ifr;int;jcy;jfr;kcy;kfr;lEg;lap;lat;lcy;leg;leq;les;lfr;lgE;lnE;lne;loz;lrm;lsh;map;mcy;mfr;mho;mid;nap;ncy;nfr;nge;ngt;nis;niv;nle;nlt;not;npr;nsc;num;ocy;ofr;ogt;ohm;olt;ord;orv;par;pcy;pfr;phi;piv;prE;pre;psi;qfr;rcy;reg;rfr;rho;rlm;rsh;scE;sce;scy;sfr;shy;sim;smt;sol;squ;sub;sum;sup;tau;tcy;tfr;top;ucy;ufr;uml;vcy;vee;vfr;wfr;xfr;ycy;yen;yfr;zcy;zfr;zwj;AumlCOPYEumlIumlOumlQUOTUumlaumlcentcopyeumliumlmacrnbspordfordmoumlparaquotsectsup1sup2sup3uumlyumlacE;bne;nGg;nLl;ngE;nlE;*%#vBOOLdrop[]%sax25dlcisliprosehdlclapbfradskipfddiirdafcppfcalfcplXXX_LMQHmod dep or xjneqIMAGCHARgotoPathKindEnumdef=0000%02xsharedebugerror%s:%dlevellinuxcountemailbytesspeedtls: EarlyECDSAfalse(nil)ErrorsvqxXfileshttpsimap2imap3imapspop3shostsCNAMEwriteroute : close (at no IPchdirmkdirchmodlstatchowngetwdpipe2defersweeptestRtestWexecWhchanexecRschedsudogtimergscanmheaptracepanicsleepgcing MB, stack got= ... max=scav ptr ] = (trap:init ms, Go: r0 r1 r2 r3 r4 r5 r6 r7 r8 r9 r10 r11 r12 r13 r14 r15 r16 r17 r18 r19 r20 r21 r22 r23 r24 r25 r26 r27 r28 r29 r30 r31 pc link lo hi fault and tab= top=[...], fp:1562578125denyMarchAprilmonthLocal [P] [L]%s %sSliceArraypropsaliaspathsvaluesocksparsexxxxx/auth"NaN"fatalDEBUGERRORPANICFATALarray&"':***@%d %sRange:pathHTTP1HTTP2%s %q%s=%sHTTP/Allow:httpFound.jsonuserschain%s_%srenewlocks.locknamescache%v %vPATCHcleartokenHS256RS256ES256ES384ES512titleestabStateSHA-1P-224P-256P-384P-521int16int32int64uint8sliceSlotsfunc(kind=GreekOthercntrldigitpunctAdlamBamumBatakBuhidDograKhmerLatinLimbuNushuOghamOriyaOsageRunicTakriTamilTypeAClassRetryfcntlInts:Ptrs:orderfloatuintsbools[=%s]test.ValueipNetbreak.eEpPindexprintTRACE -%s for ,end PlainRegexretrylocal.avif.html.jpeg.wasm.webputf-8%s*%dtext/rangeRealmbad nauthzQUERYED448ISPKIAFSDBCSYNCDHCIDDNAMEEUI48EUI64HINFOHTTPSMAILAMAILBMINFONAPTRNINFONSEC3RRSIGSSHFPUINFOCLASSdns: udp: %d %d (%s)scopestatebasicBasic%s/%slabel%s-%sblockinputstylestart%s.%s.test%s%s --- .%09dline !!str!!seq!!map%YAML-.infFalseFALSE+.inf+.Inf+.INF-.Inf-.INF!!int%s %sdummyvxlanipoibownergroupGuardFloodencapEnd.XEnd.TEnd.Sbabeleigrpgatedzebrafieldctype0-RTT1-RTTip_v4ip_v6deltalimitInt64Group\u202%s%+dframematchrune commaspaceAopf;Ascr;Auml;Barv;Beta;Bopf;Bscr;CHcy;COPY;Cdot;Copf;Cscr;DJcy;DScy;DZcy;Darr;Dopf;Dscr;Edot;Eopf;Escr;Esim;Euml;Fopf;Fscr;GJcy;Gdot;Gopf;Gscr;Hopf;Hscr;IEcy;IOcy;Idot;Iopf;Iota;Iscr;Iuml;Jopf;Jscr;KHcy;KJcy;Kopf;Kscr;LJcy;Lang;Larr;Lopf;Lscr;Mopf;Mscr;NJcy;Nopf;Nscr;Oopf;Oscr;Ouml;Popf;Pscr;QUOT;Qopf;Qscr;Rang;Rarr;Ropf;Rscr;SHcy;Sopf;Sqrt;Sscr;Star;TScy;Topf;Tscr;Uarr;Uopf;Upsi;Uscr;Uuml;Vbar;Vert;Vopf;Vscr;Wopf;Wscr;Xopf;Xscr;YAcy;YIcy;YUcy;Yopf;Yscr;Yuml;ZHcy;Zdot;Zeta;Zopf;Zscr;andd;andv;ange;aopf;apid;apos;ascr;auml;bNot;bbrk;beta;beth;bnot;bopf;boxH;boxV;boxh;boxv;bscr;bsim;bsol;bull;bump;cdot;cent;chcy;cirE;circ;cire;comp;cong;copf;copy;cscr;csub;csup;dArr;dHar;darr;dash;diam;djcy;dopf;dscr;dscy;dsol;dtri;dzcy;eDot;ecir;edot;emsp;ensp;eopf;epar;epsi;escr;esim;euml;euro;excl;flat;fnof;fopf;fork;fscr;gdot;geqq;gjcy;gnap;gneq;gopf;gscr;gsim;gtcc;hArr;half;harr;hbar;hopf;hscr;iecy;imof;iocy;iopf;iota;iscr;isin;iuml;jopf;jscr;khcy;kjcy;kopf;kscr;lArr;lHar;lang;larr;late;lcub;ldca;ldsh;leqq;ljcy;lnap;lneq;lopf;lozf;lpar;lscr;lsim;lsqb;ltcc;ltri;macr;male;malt;mlcp;mldr;mopf;mscr;nbsp;ncap;ncup;ngeq;ngtr;nisd;njcy;nldr;nleq;nmid;nopf;npar;nscr;nsim;nsub;nsup;ntgl;ntlg;oast;ocir;odiv;odot;ogon;oint;omid;oopf;opar;ordf;ordm;oror;oscr;osol;ouml;para;part;perp;phiv;plus;popf;prap;prec;prnE;prod;prop;pscr;qint;qopf;qscr;quot;rArr;rHar;rang;rarr;rcub;rdca;rdsh;real;rect;rhov;ring;ropf;rpar;rscr;rsqb;rtri;scap;scnE;sdot;sect;semi;sext;shcy;sime;simg;siml;smid;smte;solb;sopf;spar;squf;sscr;star;subE;sube;succ;sung;sup1;sup2;sup3;supE;supe;tbrk;tdot;tint;toea;topf;tosa;trie;tscr;tscy;uArr;uHar;uarr;uopf;upsi;uscr;utri;uuml;vArr;vBar;varr;vert;vopf;vscr;wopf;wscr;xcap;xcup;xmap;xnis;xopf;xscr;xvee;yacy;yicy;yopf;yscr;yucy;yuml;zdot;zeta;zhcy;zopf;zscr;zwnj;AEligAcircAringEcircIcircOcircTHORNUcircacircacuteaeligaringcedilecircicirciexcllaquomicroocircpoundraquoszligthorntimesucirccaps;cups;gesl;gvnE;lesg;lvnE;nGtv;nLtv;nang;napE;nges;nles;npre;nsce;nvap;nvge;nvgt;nvle;nvlt;race;IDENTFLOATCOMMA%d:%dFlushTableFloattablegob: not etherchaosatalkcslipslip6rsrvdadapthwx25ddcmpltalkhippifcfb0fcfb1fcfb2fcfb3fcfb4fcfb5fcfb6fcfb7fcfb8fcfb9EntryStartpath add xsub xmul xdiv xmod xand xxor xlsh xrsh xja %dret aEd448COLONconstNamesIsMapOneofEnumsInput\%03oname=enum=json=weak=oneofclientserverloggerfwmarktls.calistenremotedarwinreqURLconfigstderrmethodnotext%.2f%%urgent%s[%d]0x%04XX25519%w%.0wlengthkem_idtls13 %s: %s, not StringFormat[]byte' for stringnetdnsdomaingophertelnetreturn.local.onionndots:sendtoip+netsocketspliceacceptwritevno '/'readatTMPDIRrenameremovewaitidsysmontimersefenceselectSIGEMTscalarGOROOTmipsleobject unused objs next= jobs=status goid sweep B -> % util alloc free span= prev= list=, i = code= addr=], sp= m->p= p->m=SCHED curg= ctxt: min= max= bad ts(...) m=nil base 390625hangupkilledallow/proc/errno SundayMondayFridayAugustminutesecond fi%%-%dsError: [LP]tfvarsdotenv$HOME/callerBasic heightudphopCauses"+Inf""-Inf"\ufffddpanicDPANICnumberGOAWAYClosedactiveclosedCANCELPADDEDCookie

bytes=schemeexpectstreamExpectPragma.
:httpssocks Locked

%s.
dns-01_truncrenew_obtainissuerforcedreason_plus_DELETEAcceptdetaildirectrejectStreamsecret-----
STREETuint16uint32uint64structchan<-<-chan ValueCommonLetterNumberSymbolArabicBrahmiCarianChakmaCopticGothicHangulHatranHebrewKaithiKhojkiLepchaLycianLydianRejangSyriacTai_LeTangsaTangutTeluguThaanaWanchoYezidiheaderAnswerTypeNSTypeMXLengthMBox: SerialExpireMinTTLPort: WeightTarget want cmd/goipMaskprintf'"&<>\u%04X3:04PM%w: %ssquash%v=%v

    	geoip:ECT(0)ECT(1)--%s
Servercookieoriginsocks5%s: %wSHA256GOST94SHA384SHA512IQUERYSTATUSNOTIFYUPDATERSAMD5NOTIMPBADSIGBADKEYBADALGACPKIXDNSKEYNIMLOCSMIMEATALINKUNSPECZONEMDnil rr, id: ZONE: \\\044\\\0920.%02d%.2fm %.0fm %0.16x%0.16XbearerBearervpc_idiso_idreboot/v2/osexec: definescriptexportlayout%s=%s
\u%04xtoml: yaml: !!bool!!nullonlink802.1qbackupalwaysbetterfollowlayer2stableunspecdevicebridgetuntapipvlanipvtapACTIVEBACKUPgenevegretapip6tnlip6greGw: %sinlineEnd.B6End.BMEnd.ASEnd.AMnh4 %snh6 %siif %diif %soif %doif %sin: %skernelstatic%s:%d proto2proto3Proto2Proto3sint32sint64doublesyntaxpackedjstypefailedframescryptooffsetUint64goawayempty rune1 brotlipsk_keAElig;Acirc;Alpha;Amacr;Aogon;Aring;Breve;Ccirc;Colon;Cross;Dashv;Delta;Ecirc;Emacr;Eogon;Equal;Gamma;Gcirc;Hacek;Hcirc;IJlig;Icirc;Imacr;Iogon;Iukcy;Jcirc;Jukcy;Kappa;OElig;Ocirc;Omacr;Omega;Prime;RBarr;Scirc;Sigma;THORN;TRADE;TSHcy;Theta;Tilde;Ubrcy;Ucirc;Umacr;Union;Uogon;UpTee;Uring;VDash;Vdash;Wcirc;Wedge;Ycirc;acirc;acute;aelig;aleph;alpha;amacr;amalg;angle;angrt;angst;aogon;aring;asymp;awint;bcong;bdquo;bepsi;blank;blk12;blk14;blk34;block;boxDL;boxDR;boxDl;boxDr;boxHD;boxHU;boxHd;boxHu;boxUL;boxUR;boxUl;boxUr;boxVH;boxVL;boxVR;boxVh;boxVl;boxVr;boxdL;boxdR;boxdl;boxdr;boxhD;boxhU;boxhd;boxhu;boxuL;boxuR;boxul;boxur;boxvH;boxvL;boxvR;boxvh;boxvl;boxvr;breve;bsemi;bsime;bsolb;bumpE;bumpe;caret;caron;ccaps;ccirc;ccups;cedil;check;clubs;colon;comma;crarr;cross;csube;csupe;ctdot;cuepr;cuesc;cupor;cuvee;cuwed;cwint;dashv;dblac;ddarr;delta;dharl;dharr;diams;disin;doteq;dtdot;dtrif;duarr;duhar;eDDot;ecirc;efDot;emacr;empty;eogon;eplus;epsiv;eqsim;equiv;erDot;erarr;esdot;exist;fflig;filig;fllig;fltns;forkv;frasl;frown;gamma;gcirc;gescc;gimel;gneqq;gnsim;grave;gsime;gsiml;gtcir;gtdot;harrw;hcirc;hoarr;icirc;iexcl;iiint;iiota;ijlig;imacr;image;imath;imped;infin;iogon;iprod;isinE;isins;isinv;iukcy;jcirc;jmath;jukcy;kappa;lAarr;lBarr;langd;laquo;larrb;lbarr;lbbrk;lbrke;lceil;ldquo;lescc;lhard;lharu;lhblk;llarr;lltri;lneqq;lnsim;loang;loarr;lobrk;lopar;lrarr;lrhar;lrtri;lsime;lsimg;lsquo;ltcir;ltdot;ltrie;ltrif;mDDot;mdash;micro;minus;mumap;nabla;napos;natur;ncong;ndash;neArr;nearr;ngsim;nhArr;nharr;nhpar;nlArr;nlarr;nless;nlsim;nltri;notin;notni;nprec;nrArr;nrarr;nrtri;nsime;nsmid;nspar;nsube;nsucc;nsupe;numsp;nwArr;nwarr;ocirc;odash;oelig;ofcir;ohbar;olarr;olcir;oline;omacr;omega;operp;oplus;orarr;order;ovbar;parsl;phone;plusb;pluse;pound;prcue;prime;prnap;prsim;quest;rAarr;rBarr;radic;rangd;range;raquo;rarrb;rarrc;rarrw;ratio;rbarr;rbbrk;rbrke;rceil;rdquo;reals;rhard;rharu;rlarr;rlhar;rnmid;roang;roarr;robrk;ropar;rrarr;rsquo;rtrie;rtrif;sbquo;sccue;scirc;scnap;scsim;sdotb;sdote;seArr;searr;setmn;sharp;sigma;simeq;simgE;simlE;simne;slarr;smile;sqcap;sqcup;sqsub;sqsup;srarr;starf;strns;subnE;subne;supnE;supne;swArr;swarr;szlig;theta;thkap;thorn;tilde;times;trade;trisb;tshcy;twixt;ubrcy;ucirc;udarr;udhar;uharl;uharr;uhblk;ultri;umacr;uogon;uplus;upsih;uring;urtri;utdot;utrif;uuarr;vBarv;vDash;varpi;vdash;veeeq;vltri;vprop;vrtri;wcirc;wedge;xcirc;xdtri;xhArr;xharr;xlArr;xlarr;xodot;xrArr;xrarr;xutri;ycirc;AacuteAgraveAtildeCcedilEacuteEgraveIacuteIgraveNtildeOacuteOgraveOslashOtildeUacuteUgraveYacuteaacuteagraveatildebrvbarccedilcurrendivideeacuteegravefrac12frac14frac34iacuteigraveiquestmiddotntildeoacuteograveoslashotildeplusmnuacuteugraveyacutefjlig;lates;napid;nbump;nedot;nesim;ngeqq;nleqq;npart;nsubE;nsupE;nvsim;smtes;vnsub;vnsup;NUMBERSTRINGLBRACKLBRACEPERIODRBRACKRBRACEASSIGNtoken([%d]%seetherpronetarcnetcslip6ip/ddppimregeconetfcfb10fcfb11fcfb12%v: %v.proto 	
"`build	ld #%dor #%dimportswitchIsWeakSyntaxIsListMapKeyFieldsOneofsValuesOutputGoTypevarintUnknownversionconsolewindowsandroidreqAddrdisabledns-santls.keyzerosslacme.caduckdnsgodaddydefaulttcp-tlscommand%.2f %schanneltlssha1tls3desInitialEd25519MD5-RSAserial:(PANIC=booleanbdoUxXvintegercomplexfloat32float64runningopenbsdsuccessoptionsrecvmsgsendmsgconnectlookup writeto::ffff:no portsymlink (trap writeatchtimesforcegcallocmWcpuprofallocmRunknowngctraceIO waitsyscallwaitingforevernetworkUNKNOWNcleanup:events, goid=  mark  s=nil
 (scan  MB in pacer: % CPU ( zombiegc bits, j0 = head = ,errno=panic: GODEBUG nmsys= locks= dying= allocssignal Signal  m->g0= pad1=  pad2=  text= minpc= 	value= (scan)	types : type 19531259765625abortedstoppedTuesdayJanuaryOctober-070000Z070000, time.[flags]ignoredinvalidCONNECTUpgradebalancecapitalISO8601RFC3339iso8601rfc3339Verbose%sErrornil keynumber HEADERSTrailerRefererCookie2expiresmax-age; Path=OPTIONS
flags= len=%d:method:scheme:status (conn) %v=%v,trailerhttp://upgradechunkednosniffCreatedIM Usedsocks5hHTTP/1.privatemailto:http-01accountattemptelapsedmanagedrenewalissuersED25519storagersa2048rsa4096ed25519rsa8192timeoutexpiredrevokedcontentBearer verbosedomains&limit=pendingheaders, url: Alt-Svc/onlineSHA-224SHA-256SHA-384SHA-512AES-CBCHPKE-v1eae_prkderivednumeric2.5.4.62.5.4.32.5.4.52.5.4.72.5.4.82.5.4.9uintptrSwapperChanDir using , type=closure Value>ConvertControlAvestanBengaliBrailleCypriotDeseretElbasanElymaicGranthaHanunooKannadaMakasarMandaicMarchenMultaniMyanmarOsmanyaSharadaShavianSiddhamSinhalaSogdianSoyomboTagalogTibetanTirhutaTypeSOATypePTRTypeTXTTypeSRVTypeOPTTypeWKSTypeALLanswers recordRetry: Refreshaccept4Floats:cgroup2runtimeos/execfips140strings[="%s"]ipSliceprintlnLOG: nsuµmhUsage: , need ,start tcp+udpsuffix:(empty)initialExpiresSubject%03d %sutf-8''charsetrefererrefreshname %qproblem[%s] %wbad keyRSASHA1BlockedNOERRORFORMERRREFUSEDYXRRSETNXRRSETNOTAUTHNOTZONEBADTIMEBADMODEBADNAMEdohpathIACPKIXCDNSKEYcreatedmoduluspublishbad offQUERY: NOTIMPL$ORIGIN%16.16x%12.12x%s/haltdns_sec/v2/isoquic ivquic hp{{end}} actionoperandDEFAULTBOM: %vcomment := :=fnrt%s%s%s !!merge!!float (with 802.1adfailure802.3adgenerictestingdormantmacvlanmacvtapbareudptunnel6HairpinDst: %dDst: %sVia: %sSrc: %snowhereEnd.DX2End.DX6End.DX4End.DT6End.DT4out: %smroutedmap keyfixed32fixed64messagepackageserviceeditiontargetsNot-ECT%s (%s) %s %#vcapablequic kuport_v4port_v6triggermin_rttmaximum(devel)Float64!BADKEYalt-svcpurposeInstAltInstNopalt -> nop -> any -> requestOpenPGPDEFLATEdkp_prkAacute;Abreve;Agrave;Assign;Atilde;Barwed;Bumpeq;Cacute;Ccaron;Ccedil;Colone;Conint;CupCap;Dagger;Dcaron;DotDot;Dstrok;Eacute;Ecaron;Egrave;Exists;ForAll;Gammad;Gbreve;Gcedil;HARDcy;Hstrok;Iacute;Igrave;Itilde;Jsercy;Kcedil;Lacute;Lambda;Lcaron;Lcedil;Lmidot;Lstrok;Nacute;Ncaron;Ncedil;Ntilde;Oacute;Odblac;Ograve;Oslash;Otilde;Otimes;Racute;Rarrtl;Rcaron;Rcedil;SHCHcy;SOFTcy;Sacute;Scaron;Scedil;Square;Subset;Supset;Tcaron;Tcedil;Tstrok;Uacute;Ubreve;Udblac;Ugrave;Utilde;Vdashl;Verbar;Vvdash;Yacute;Zacute;Zcaron;aacute;abreve;agrave;andand;angmsd;angsph;apacir;approx;atilde;barvee;barwed;becaus;bernou;bigcap;bigcup;bigvee;bkarow;bottom;bowtie;boxbox;bprime;brvbar;bullet;bumpeq;cacute;capand;capcap;capcup;capdot;ccaron;ccedil;circeq;cirmid;colone;commat;compfn;conint;coprod;copysr;cularr;cupcap;cupcup;cupdot;curarr;curren;cylcty;dagger;daleth;dcaron;dfisht;divide;divonx;dlcorn;dlcrop;dollar;drcorn;drcrop;dstrok;eacute;easter;ecaron;ecolon;egrave;egsdot;elsdot;emptyv;emsp13;emsp14;eparsl;eqcirc;equals;equest;female;ffilig;ffllig;forall;frac12;frac13;frac14;frac15;frac16;frac18;frac23;frac25;frac34;frac35;frac38;frac45;frac56;frac58;frac78;gacute;gammad;gbreve;gesdot;gesles;gtlPar;gtrarr;gtrdot;gtrsim;hairsp;hamilt;hardcy;hearts;hellip;hercon;homtht;horbar;hslash;hstrok;hybull;hyphen;iacute;igrave;iiiint;iinfin;incare;inodot;intcal;iquest;isinsv;itilde;jsercy;kappav;kcedil;kgreen;lAtail;lacute;lagran;lambda;langle;larrfs;larrhk;larrlp;larrpl;larrtl;latail;lbrace;lbrack;lcaron;lcedil;ldquor;lesdot;lesges;lfisht;lfloor;lharul;llhard;lmidot;lmoust;loplus;lowast;lowbar;lparlt;lrhard;lsaquo;lsquor;lstrok;lthree;ltimes;ltlarr;ltrPar;mapsto;marker;mcomma;midast;midcir;middot;minusb;minusd;mnplus;models;mstpos;nVDash;nVdash;nacute;ncaron;ncedil;nearhk;nequiv;nesear;nexist;nltrie;nprcue;nrtrie;nsccue;nsimeq;ntilde;numero;nvDash;nvHarr;nvdash;nvlArr;nvrArr;nwarhk;nwnear;oacute;odblac;odsold;ograve;ominus;origof;oslash;otilde;otimes;parsim;percnt;period;permil;phmmat;planck;plankv;plusdo;plusdu;plusmn;preceq;primes;prnsim;propto;prurel;puncsp;qprime;rAtail;racute;rangle;rarrap;rarrfs;rarrhk;rarrlp;rarrpl;rarrtl;ratail;rbrace;rbrack;rcaron;rcedil;rdquor;rfisht;rfloor;rharul;rmoust;roplus;rpargt;rsaquo;rsquor;rthree;rtimes;sacute;scaron;scedil;scnsim;searhk;seswar;sfrown;shchcy;sigmaf;sigmav;simdot;smashp;softcy;solbar;spades;sqsube;sqsupe;square;squarf;ssetmn;ssmile;sstarf;subdot;subset;subsim;subsub;subsup;succeq;supdot;supset;supsim;supsub;supsup;swarhk;swnwar;target;tcaron;tcedil;telrec;there4;thetav;thinsp;thksim;timesb;timesd;topbot;topcir;tprime;tridot;tstrok;uacute;ubreve;udblac;ufisht;ugrave;ulcorn;ulcrop;urcorn;urcrop;utilde;vangrt;varphi;varrho;veebar;vellip;verbar;wedbar;wedgeq;weierp;wreath;xoplus;xotime;xsqcup;xuplus;xwedge;yacute;zacute;zcaron;zeetrf;nbumpe;notinE;nparsl;nrarrc;nrarrw;sqcaps;sqcups;vsubnE;vsubne;vsupnE;vsupne;ILLEGALCOMMENTHEREDOCillegalInvalidCommentInteger%s %s; ieee802rawhdlcnetlinkproto: = "`ldx #%dld [%d]ld #lenld #nlald #cpuadd #%dsub #%dmul #%ddiv #%dmod #%dand #%dxor #%dlsh #%drsh #%dret #%d%s: %s PackageDefaultMessageImportsMethodsbad loghysteriainsecureHysteriaplatformtls.certacl.filepassworduserpasshttps://filenameprogresstlsmlkemCurveID(tls echDOWNGRDDOWNGRDhttp/1.1finishedSHA1-RSADSA-SHA1DNS nameGoString01234567beEfFgGvnetedns0[::1]:53loopbackcontinueunixgramtimeout:trust-adshutdownrecvfromfile+netinvalid address raw-readsendfilereadfromsignal: readlinktruncateunlinkatopenfdatscavengepollDescsynctesttraceBufdeadlockraceFinipanicnilcgocheckrunnable is not pointer, errno=BAD RANK status unknown(trigger= npages= nalloc= nfreed=) errno=runtime.[signal reflect.GODEBUG= newval= mcount= bytes, ----- stack=[ minLC= maxpc= stack=[ minutes status= etypes 48828125infinitystrconv.parsing ParseIntno anodeEMT trap/uid_map/gid_mapThursdaySaturdayFebruaryNovemberDecembertime.UTC%!Month(_filedir_%s() { [flags]%s %v=%vintSlicepositionTrailerselementsROOT ** PANIC=%vomitzeroPRIORITYSETTINGSfont/ttffont/otfhijackedNO_ERRORLocationhttponlysamesite; SecureHTTP/1.0If-MatchIf-Range data=%q incr=%v ping=%qbad_flowpriorityprotocolHTTP/2.0Trailer:trailers%s_%s_%soverlapsdisjointboundaryHTTP/1.1no-cachePROPFINDidentityhttp/1.0ContinueAcceptedConflict[^\w@.-]subjectsfc00::/7lock_keycert_key%s/%s/%ssso-key instancerejected%s|%s|%s/trafficReq-AddrTX-BytesRX-BytesLifetimeMD5+SHA1SHA3-224SHA3-256SHA3-384SHA3-512SHA2-256nil PoolexporterECDH PCToptionalexplicitdefault:2.5.4.102.5.4.112.5.4.17FuncTypestruct {ArmenianBalineseBopomofoBugineseCherokeeCyrillicDuployanEthiopicGeorgianGujaratiGurmukhiHiraganaJavaneseKatakanaKayah_LiLinear_ALinear_BMahajaniOl_ChikiPhags_PaTagbanwaTai_ThamTai_VietTifinaghUgariticVithkuqiClassANYQuestionTypeAAAATypeAXFRSerial: Expire: MinTTL: Weight: Target: Priorityoverflow used: group slot go/typesnet/httpgo/buildchacha8:bytesHexdurationurlqueryCRITICAL/dev/tungeosite:GET_0RTT (local)HTTP/3.0\.pN\d+_distinct --%s %s: %s Receivedus-asciiif-matchlocationbad_pathif-rangeNO_PROXYno_proxybad timeECC-GOSTINDIRECTCensoredFilteredSERVFAILNXDOMAINYXDOMAINBADTRUNCipv4hintipv6hintAMTRELAYIPSECKEYReservedNSAP-PTRactivatePrime1: Prime2: flags:; ; EDE: ; ESU: %s: (%s)PREREQ: UPDATE: ANSWER: $INCLUDEbad inst%s %s:%dusername%s/start%s/plans/v2/vpcs/v2/vpc2quic key#fips140readbuf:CTR_DRBGSHA2-512template%.10q...{{else}}%s:%d:%dtextarearequired\\([^$])Duration2006-1-2!!binarylayer3+4layer2+3encap2+3encap3+4datagramredirectmode(%d)LearningProxyArpuniversetable %dxmit: %sdnroutededitionsrepeatedOptionalRequiredRepeatedsfixed32sfixed64BoolKindEnumKindKind(%d)extendeefeaturesreserved15:04:05draft-29gQUIC %d[%d, %d]quic-go1no_errorkey_typemax_dataphoturisfunctionsettingsno-storetext/cssbytes=0-prefetchMessagesInstFailInstRune[:word:]Assignedbracketsnumberedunixnanocert_req1609Dot2Because;Cayleys;Cconint;Cedilla;Diamond;DownTee;Element;Epsilon;Implies;LeftTee;NewLine;NoBreak;NotLess;Omicron;OverBar;Product;UpArrow;Uparrow;Upsilon;alefsym;angrtvb;angzarr;asympeq;backsim;because;bemptyv;between;bigcirc;bigodot;bigstar;boxplus;ccupssm;cemptyv;cirscir;coloneq;congdot;cudarrl;cudarrr;cularrp;curarrm;dbkarow;ddagger;ddotseq;demptyv;diamond;digamma;dotplus;dwangle;epsilon;eqcolon;equivDD;gesdoto;gtquest;gtrless;harrcir;intprod;isindot;larrbfs;larrsim;lbrksld;lbrkslu;ldrdhar;lesdoto;lessdot;lessgtr;lesssim;lotimes;lozenge;ltquest;luruhar;maltese;minusdu;napprox;natural;nearrow;nexists;notinva;notinvb;notinvc;notniva;notnivb;notnivc;npolint;nsqsube;nsqsupe;nvinfin;nwarrow;olcross;omicron;orderof;orslope;pertenk;planckh;pluscir;plussim;plustwo;precsim;quatint;questeq;rarrbfs;rarrsim;rbrksld;rbrkslu;rdldhar;realine;rotimes;ruluhar;searrow;simplus;simrarr;subedot;submult;subplus;subrarr;succsim;supdsub;supedot;suphsol;suphsub;suplarr;supmult;supplus;swarrow;topfork;triplus;tritime;uparrow;upsilon;uwangle;vzigzag;zigrarr;bnequiv;npreceq;nsubset;nsucceq;nsupset;nvltrie;nvrtrie;%s %s %sKeyValueDateTimemetricomieee1394proto: %d to %d_UNKNOWNprotobufXXX_weakNum(%#q)dst mathrecoveryrecvmmsgsendmmsgld M[%d]ldb [%d]ldh [%d]ld #typeld #poffld #nlanld #markld #randst M[%d]%s %s,%dKyber512Kyber768SigEd448IsPublicFullNameJSONNameIsPackedMapValueExtendeeServicesIsClosedzigzag32zigzag6400000000Ping modespeedtestobfs.typepinSHA256hysteria2ParseBoolinterfaceping modeconnectedlog-levellog levelacme.typeauth.typeTCP errorsessionIDUDP errordata-sizeuse-bytesuploadingtlsrsakex%s %x %x config_idHandshakeProc-Type method: (MISSING)%!(EXTRA 01234567_broadcastmulticastfiles,dnsdns,filesipv6-icmplocalhostip6.arpa.attempts:no-reloadraw-writemissing ] parsing fork/execcontinuedRemoveAlltimerSendpollCacheprofBlockstackpoolhchanLeafwbufSpansGC (idle)mSpanDeadinittracescavtracepanicwaitchan sendpreemptedcoroutinesignal 32signal 33signal 34signal 35signal 36signal 37signal 38signal 39signal 40signal 41signal 42signal 43signal 44signal 45signal 46signal 47signal 48signal 49signal 50signal 51signal 52signal 53signal 54signal 55signal 56signal 57signal 58signal 59signal 60signal 61signal 62signal 63signal 64signal 65signal 66signal 67signal 68signal 69signal 70signal 71signal 72signal 73signal 74signal 75signal 76signal 77signal 78signal 79signal 80signal 81signal 82signal 83signal 84signal 85signal 86signal 87signal 88signal 89signal 90signal 91signal 92signal 93signal 94signal 95signal 96signal 97signal 98signal 99copystackfinalizer ms cpu, (forced) spanq.n= wbuf1.n= wbuf2.n= s.limit= s.state= B work ( B exp.) marked unmarked in use) , size = , tail = newosprocrecover: not in [ctxt != 0, oldval=, newval= threads=: status= blocked= lockedg=atomicor8 runtime= sigcode= m->curg=(unknown)total < 0traceback(durable)} stack=[ gp.goid= lockedm=244140625ParseUintinterruptbus errorWednesdaySeptember-07:00:00Z07:00:00localtimetwo_word_help for tun-stack%s %q: %sempty urlgeoip.datundefinedLevel(%d)LEVEL(%d) of type omitemptyimage/bmpimage/gifimage/pngvideo/avifont/woff; Domain=HTTP/1.1 :protocol[%v = %d]data_flowauthorityhttp2: %wwebsocketnet/http.HTTP/1.0 value for arg %d: %w2006-01-02add route /data/userRootDomainconnectionuser-agentlocal addrmultipart- --%s-- Content-IdMessage-Idimage/avifset-cookieHTTP_PROXYhttp_proxyFeatureID(PRIVATEDNSPRIVATEOIDProhibitedNSEC3PARAMOPENPGPKEYdns: privatekey, status: at line: hmac-sha1._%s._%s.%sgrant_typeoauth2: %q%s/%s/ipv4%s/%s/ipv6%s/%s/halt%s/%s/vpcs%s/%s/vpc2/v2/blocksread_write%s/%s/forknetwork_id/v2/iso/%scluster_id%s/convertquicv2 keydefinitionunusedKeysObjectListObjectType%s%s = %s stream endbalance-rrGOING_DOWNGOING_BACKNewDst: %sWeight: %dSYS_WRITEVSyntax(%d)Sint32KindUint32KindSint64KindUint64KindDoubleKindStringKinddependencyoneof_declgo_packagedeprecatedinput_typeMinRTT: %spath_probeerror_codelatest_rttevent_typetimer_typeframe_typefinal_sizeecho reply!PANIC: %v(no stack)name_bytesearly-datasameorigin[:^alnum:][:^alpha:][:^ascii:][:^blank:][:^cntrl:][:^digit:][:^graph:][:^lower:][:^print:][:^punct:][:^space:][:^upper:][:xdigit:]rune token_typeexpires_inocsp_multipsk_dhe_keauthz_dataBackslash;CenterDot;CircleDot;Congruent;Coproduct;DoubleDot;DownArrow;DownBreve;Downarrow;HumpEqual;LeftArrow;LeftFloor;Leftarrow;LessTilde;Mellintrf;MinusPlus;NotCupCap;NotExists;OverBrace;PlusMinus;Therefore;ThinSpace;TripleDot;UnionPlus;backprime;backsimeq;bigotimes;centerdot;checkmark;complexes;dotsquare;downarrow;gtrapprox;gtreqless;heartsuit;leftarrow;lesseqgtr;nparallel;nshortmid;nsubseteq;nsupseteq;pitchfork;rationals;spadesuit;subseteqq;subsetneq;supseteqq;supsetneq;therefore;triangleq;varpropto;NotSubset;gvertneqq;lvertneqq;ngeqslant;nleqslant;ArrayTable_reserved1infinibandieee802.11%v See %v UnknownX%XUNKNOWN_%dweakFieldsAlpha(%#q)slow_startld #hatypeld #rxhashjneq %s,%djset %s,%dEnumRangesHasDefaultExtensionsIsMapEntrywrong sizeClient modeServer modeclient mode  HTTP closedconfig fileletsencryptserver modeTCP requestUDP requestskip-uploaddownloadingtls10servertls: alert(local errorpublic_namec e traffictraffic updApplicationCERTIFICATEPRIVATE KEYinvalid oid%!(BADPREC)bad verb '%0123456789_submissionsnil contextsetnonblocki/o timeoutraw-control/dev/stdout/dev/stderrunreachableassistQueuenetpollInitreflectOffsglobalAllocmSpanManualstart traceclobberfreegccheckmarkscheddetailunspecifiedcgocall nil s.nelems= of size ) returned runtime: p ms clock, nBSSRoots=runtime: P exp.) for minTrigger=GOMEMLIMIT=bad m value, elemsize= freeindex= span.list=not reached, npages = , a123456=[ p->status= in status idleprocs= gcwaiting= schedtick= timerslen= mallocing=bad timedivfloat64nan1float64nan2float64nan3float32nan1float32nan2float32nan3GOTRACEBACK) at entry+ (targetpc= , plugin: running < 0runtime: g : frame.sp=created by 30517578125bad addressfile existsbroken pipebad messagealarm clocktime: file _filedir -dstringArraystringSlicegeosite.datmust be setleft child:[%dm%sRFC3339Nanorfc3339nano.WithCancel.WithValue(MarshalJSONMarshalTexthttp-serverhttp2serverhttp2clientEND_HEADERSENABLE_PUSHpartitionedCookie.Path; Max-Age=0/index.html ErrCode=%v, settings:stream_idleack_mysterybad_connectmoreGeneralTTL expiredEarly HintsBad RequestBad Gatewayacme_clienttls-alpn-01identifiersretrying_incert_failedstorage_keyserver_namedistributednum_choicesocsp_statusthis_updatenext_updateremote_portmaintenancecertificate%s/zones?%sduckdns.orgdeactivatedHTTP %d: %sstatus_codeRetry-After,"nonce":%qsubproblemsLast-ActiveSHA-512/224SHA-512/256BLAKE2s-256BLAKE2b-256BLAKE2b-384BLAKE2b-512short writepsk_id_hashgeneralizedapplicationbad argSizemethodargs(reflect.SetMath_SymbolPrivate_UsePunctuationDives_AkuruMedefaidrinNag_MundariNandinagariNew_Tai_LueOld_PersianOld_SogdianPau_Cin_HauSignWritingWarang_CitiClassHESIODdnsmessage.authoritiesadditionalsend of file (deleted) gocachehashgocachetestrandseednoparchive/tarcrypto/x509archive/zipbytesBase64 -%s, --%s%d.%d.%d.%dstringToIntcall of nil02 Jan 2006parse errorfinal tokenread packetunset rule path closedremote-addrH3_NO_ERRORH3_ID_ERRORIn-Reply-ToReturn-Pathretry-afterHTTPS_PROXYhttps_proxymissing CSRid mismatchcoefficientExponent1: Exponent2: flags: do; ; SUBNET: ; COOKIE: ; EXPIRE: ;; opcode: AUTHORITY: device_code/v2/account/v2/backups%s/%s/start%s/%s/usage%s/%s/users/v2/domainsdescription/v2/regionsinstance_id%s/%s/nodes bytes ... invalid KEMexpected :=empty field{{template array tablemapping endyYnNtTfFoO~!!timestampbalance-xorbalance-tlbbalance-albnot-presentIfindex: %dFixed32KindFixed64KindMessageKindnested_typeoneof_indexallow_aliasoutput_typejson_formatdeclarationchosen_alpnmax_streamsstream_typeerror_spacepacket_type (replaced)cancel_pushmax_push_idInstCaptureInstRuneAny[:^xdigit:]named_curveAES-128-GCMAES-256-GCMExport-onlyHKDF_SHA256HKDF_SHA384HKDF_SHA512x: %v y: %vBernoullis;CirclePlus;EqualTilde;Fouriertrf;ImaginaryI;Laplacetrf;LeftVector;Lleftarrow;NotElement;NotGreater;Proportion;RightArrow;RightFloor;Rightarrow;TildeEqual;TildeTilde;UnderBrace;UpArrowBar;UpTeeArrow;circledast;complement;curlywedge;eqslantgtr;gtreqqless;lessapprox;lesseqqgtr;lmoustache;longmapsto;mapstodown;mapstoleft;nLeftarrow;nleftarrow;precapprox;rightarrow;rmoustache;sqsubseteq;sqsupseteq;subsetneqq;succapprox;supsetneqq;upuparrows;varepsilon;varnothing;ThickSpace;nsubseteqq;nsupseteqq;InlineTableEnumOptionsFileOptionsString(%#q)empty stackld [x + %d]%s %s,%d,%dfallthroughFieldRangesFileImportsCardinalityHasJSONNameHasPresenceIsExtensionTESTING KEYempty sliceping addresscheck-updateShow version%s %s %s %sbandwidth.upTCP redirectaddress.ipv4address.ipv6HTTP requesttls.sniGuardtls.clientCAacme.domainsContent-Typeauth.commandtlsunsafeekmclose notifyremote errorc hs traffics hs trafficc ap traffics ap traffic PRIVATE KEYECDSA-SHA256ECDSA-SHA384ECDSA-SHA512SSL_CERT_DIR%!(BADWIDTH)multipathtcp127.0.0.1:53pointtopointno such hostunknown portCIDR addressinvalid portcan't happenexit status readdirnamessweepWaiterscleanupQueuetraceStringsspanSetSpinemspanSpecialtraceTypeTabgcBitsArenasmheapSpecialgcpacertraceharddecommitmadvdontneeddumping heapchan receivesynctest.Runcleanup wait span.limit= span.state=bad flushGen MB stacks, scan: total scan: class worker mode nDataRoots= nSpanRoots= wbuf1= wbuf2= gcscandone runtime: gp= found at *( s.elemsize= B (∆goal , cons/mark maxTrigger= pages/byte s.sweepgen= allocCount page summarytimer_deletens} value: {}, want {r1= [recovered]bad recoveryGOTRACEBACK=bad g statusentersyscallwirep: p->m=) p->status=releasep: m= sysmonwait= preemptoff=cas64 failed m->gsignal=-byte limit runtime: sp=abi mismatchout of rangewrong timerstrace buffer152587890625762939453125illegal seekinvalid slothost is downchild exitedI/O possible_ACTIVE_HELPthis commandversion for Subcommand 'reading fileright child:capitalColorcontext.TODOPUSH_PROMISECONTINUATIONhttpmuxgo121image/x-iconCookie.Valuehttp2debug=1http2debug=2push_promisedata_on_idleheaders_evendup_trailers100-continuerecv_goaway_content-typemoreSpecificstatus code Multi-StatusNot ModifiedUnauthorizedI'm a teapotNot Extendedproxyconnectregistrationmax_durationFileStorage:client_hellocert_managercertificates.compromisedstorage_path/v1/domains/Replay-Noncehttp requestunauthorizeddial error: short bufferinvalid baseSERIALNUMBER has no name has no typereflect.CopyCased_LetterOther_LetterOther_NumberOther_SymbolSpacing_MarkCypro_MinoanMeetei_MayekPahawh_HmongSora_SompengSyloti_NagriRCodeSuccessRCodeRefusednot pollableinvalid path capacity: gotypesaliasrandautoseedfloat32Slicefloat64Sliceinvalid kindmapstructureLittleEndianwrite packet/dev/net/tununset rule6 Protocol(%d)Hysteria-UDPidle_timeoutempty packetGSO disabledhttp3-serveridle timeoutMime-VersionX-ImforwardsX-Powered-Bymax-forwardsMax-Forwards (sensitive)max_attemptsauthz_statusbad key sizeStale AnswerDNSSEC BogusNSEC MissingCached ErrorInvalid DataPrivateKey: ; PADDING: bad rdlength MsgHdrADDITIONAL: bad SVCB keyhmac-sha224.hmac-sha256.hmac-sha384.hmac-sha512.unmarshal %sredirect_uri%s/%s/reboot/v2/registry%s/plan/list%s/%s/dbs/%s%s/%s/alerts%s/%s/dnssecinstance_ids%s/%s/config%s/%s/attach%s/%s/detach/v2/ssh-keys/dev/urandomunknown size{{continue}}block clausecaller errorstream startdocument endsequence endtail commentnot a number' in struct family errorBondMode(%d)LacpRate(%d)ProxyArpWiFizero IPRangeSfixed32KindSfixed64Kindmessage_typejava_packageoptimize_forswift_prefixruby_packagedebug_redactdouble_valuestring_valueverificationis_extensionPhase: DRAINToken: %#x, Doing 0-RTT.EventNoEventlocal_updateis_coalescedsmoothed_rttrtt_varianceacked_rangesreset_streamstop_sendingdata_blockedbad kind: %sunknown nameInstAltMatchunexpected )altmatch -> anynotnl -> access_tokenuncompressedCircleMinus;CircleTimes;Equilibrium;GreaterLess;LeftCeiling;LessGreater;MediumSpace;NotPrecedes;NotSucceeds;OverBracket;RightVector;Rrightarrow;RuleDelayed;SmallCircle;SquareUnion;SubsetEqual;UpDownArrow;Updownarrow;VerticalBar;backepsilon;blacksquare;circledcirc;circleddash;curlyeqprec;curlyeqsucc;diamondsuit;eqslantless;expectation;nRightarrow;nrightarrow;preccurlyeq;precnapprox;quaternions;straightphi;succcurlyeq;succnapprox;thickapprox;updownarrow;NotLessLess;NotSuperset;ParseLiteralunknown type = struct { ieee802.15.4FieldOptionsOneofOptionsprotobuf_keyprotobuf_valldb [x + %d]ldh [x + %d]ld #vlan_tciillegal charFieldNumbersnot extendedShow version.bindInterfacequic.sockoptstls.clientKeyobfs-passwordSOCKS5 servername is emptyTUN listeningTUN TCP errorTUN UDP erroracme.dns.nameempty domainsresolver.typeauth.passwordauth.userpassauth.http.urlskip-downloadtlsmaxrsasizeaccess denieduser canceledPKCS1WithSHA1ECDSAWithSHA1cipher_suiteskey expansionmaster secretCLIENT_RANDOMSHA256-RSAPSSSHA384-RSAPSSSHA512-RSAPSStrailing dataSSL_CERT_FILEemail addresslame referral/etc/servicesinvalid port stop signal: wakeableSleepprofMemActiveprofMemFuturetraceStackTabexecRInternaltestRInternalGC sweep waitsynctest.WaitSIGQUIT: quitSIGKILL: killout of memory is nil, not value method heap metadataunimplemented span.base()=bad flushGen created at: , not pointer != sweepgen MB globals, work.nproc= work.nwait= nStackRoots= flushedWork double unlock s.spanclass= MB) workers=min too large-byte block (runtime: val=runtime: seq= failed with timer_settimefatal error: idlethreads= syscalltick=load64 failedxadd64 failedxchg64 failedmp.g0 stack [nil stackbase} sched={pc:, gp->status= pluginpath= : unknown pc called from runtime: pid=3814697265625invalid base level 3 resetexchange fulltimer expiredsrmount errorpower failure/etc/zoneinfoparsing time out of range in duration is too large_activeHelp_ __start_%s() missing Levelbind-protocoltun-pre-check in host namesni guard: %wtree is empty right child:no children |not supportedWINDOW_UPDATESTREAM_CLOSEDCONNECT_ERRORAuthorization; PartitionedCache-ControlLast-ModifiedContent-RangeAccept-RangesIf-None-Match403 Forbiddeninvalid range[FrameHeader unknown timersend_too_muchempty patternFQDN too longsocks connectReset ContentLoop Detectedfield name %q%v %w (ca=%s)removing_hashstapling OCSP172.16.0.0/12lock acquiredcert_obtainedXDG_DATA_HOMEAppendRecordsDeleteRecordsAuthenticatorresolve error/dump/streamsinvalid ASN.1bad IV lengthshared_secretempty integerunsupported: dalTLDpSugct? relative to Letter_NumberGunjala_GondiMasaram_GondiMende_KikakuiOld_Hungarianname too longData: []byte{crypto/subtlegocacheverifyinstallgoroothtml/templateUsage of %s: durationSlice (default %q) (default %s)stringToInt64encoding/json (default %v)cleanup rulesTUNSETOFFLOADbad socksaddrHysteria-Authimage/svg+xmlaccept-rangesauthorizationcache-controlcontent-rangeif-none-matchlast-modifiedgzip, deflatecpu features:bad algorithmbad signatureForged AnswerNot SupportedNetwork Errorin-addr.arpa.Coefficient: MBZ: 0x%04x, unknown classaccess_deniedexpired_tokenresponse_typerefresh_tokenbaremetal_ids/v2/blocks/%s/v2/databases%s/%s/backups%s/%s/restore%s/%s/records/v2/firewallsgovultr/3.6.4/v2/instances%s/%s/ipv4/%s/v2/snapshots#failfipscastHMAC-SHA2-256HKDF-SHA2-256unexpected %sdefine clauseempty commanddecodedFields%\(([^)]+)\)scannot set %spremature EOFmissing tablemissing fieldmapping startinput error: write error: active-backuplack of bytesEnd.B6.Encapsunknown valuereserved_namedefault_valuephp_namespaceINVALID_TOKENpto (Initial)remote_updateinvalid_tokenpacket_numbermax_ack_delayconnection_idreliable_sizebidirectionalpath_responseack_frequencyimmediate_ackkey_phase_bittime exceededheader_fields1; mode=blockinvalid UTF-8client_secret[DEBUG] %s %sKyber768-X448DownArrowBar;DownTeeArrow;ExponentialE;GreaterEqual;GreaterTilde;HilbertSpace;HumpDownHump;Intersection;LeftArrowBar;LeftTeeArrow;LeftTriangle;LeftUpVector;NotCongruent;NotLessEqual;NotLessTilde;Proportional;RightCeiling;RoundImplies;ShortUpArrow;SquareSubset;UnderBracket;VerticalLine;blacklozenge;exponentiale;risingdotseq;triangledown;triangleleft;NotHumpEqual;varsubsetneq;varsupsetneq;ParseListTypeLocalDateTimegetTypeInfo: MethodOptionsXXX_sizecacheunknownFields for message short messageshort addressld #vlan_tpidjset %s,%d,%dIsPlaceholderReservedNamesunsupported dk must be oddquic.sockopts.transport.typebandwidth.downTCP forwardingUDP forwardingfailed to run TUN TCP closedTUN UDP closed/etc/hysteria/unsupported CAsniff.tcpPortssniff.udpPortsoutbounds.nameoutbounds.typebad record MACinternal errorX25519MLKEM768/etc/ssl/certsx509sha256skid/etc/protocols.in-addr.arpa.single-request/proc/net/igmpunknown mode: prefix length not an ip:portinvalid Prefix (core dumped)/proc/self/exeuserArenaStateGC (dedicated)read mem statsupdatemaxprocsasynctimerchangcstoptheworldprofstackdepthtraceallocfreeGC assist waitfinalizer waitsync.Cond.WaitSIGABRT: aborts.allocCount= Value of type runtime: mmap(nil elem type! to finalizer scan: class L finalizers + GC worker initruntime: full=runtime: want=MB; allocated allspans arrayno deferreturnbad restart PC, called from -thread limit stopm spinning nmidlelocked= needspinning= schedticks=[ randinit twicestore64 failedmemprofileratesemaRoot queuebad allocCountbad span statestack overflow untyped args out of range no module data in goroutine runtime: seq1=runtime: goid=invalid syntax1907348632812595367431640625no such deviceis a directorytext file busyfile too largetoo many linkslevel 3 haltedlevel 2 haltedprotocol errortoo many userswindow changedtime.Location(: extra text: /etc/localtimetrimRightSpacehelp [command]stringToStringBasic realm=%qinvalid format.WithoutCancel.WithDeadline(Content-LengthPROTOCOL_ERRORINTERNAL_ERRORREFUSED_STREAMMAX_FRAME_SIZE; SameSite=Laxbytes %d-%d/%dERR_UNKNOWN_%dfirst_settingsping_on_streamtrailers_boguscontent-lengthread_frame_eof{$} not at endempty wildcardinvalid methodPRI * HTTP/2.0parsing %q: %wunknown error unknown code: Not AcceptableCloseWrite: %w %s at: %s inserting_hashcache_capacitynew_expiration192.168.0.0/16acquiring lockcert_obtainingreleasing lock[%s] Renew: %wstatus unknownacmez (%s; %s)UDPIdleTimeoutzero parameterunexpected EOFdata truncatedunsafe.Pointer on zero Valuereflect.Value.unknown methodCombining_MarkDecimal_NumberEnclosing_MarkLine_SeparatorRCodeNameErrorResourceHeaderunreachable: malformed filesyscall failed localDepth: growthLeft: crypto/fips140mime/multipartlen of type %senable offloadinvalid offsetHysteria-CC-RX0-RTT rejecteddos_preventionH3 error (%#x)H3_FRAME_ERRORquic-go HTTP/3Accept-CharsetDkim-Signatureaccept-charsetneed more dataREQUEST_METHODchallenge_typeACME challengeEC PRIVATE KEYDSA-NSEC3-SHA1DNSKEY MissingRRSIGs Missingpublicexponent ; KEEPALIVE: ; LOCAL OPT: , timeout %dms20060102150405\.+*?()|[]{}^$/v2/backups/%s%s/%s/upgrades/v2/registriesexpiry_seconds%s/region/list%s/%s/users/%s/v2/iso-public ... omitting invalid packetunknown dsbyteunknown node: missing quotesObjectItem: %s%04d-%02d-%02d%02d:%02d:%02ddocument startsequence startLink not foundsegs %d [ %s ]reserved_rangefield_presencePhase: STARTUPNO_VIABLE_PATHpacing limitedtime_thresholdcleanup failedpayload_lengthchosen_versioninternal_errorno_viable_pathunidirectionalpath_challengeraw_error_codehandshake_donemax-age=604800InstEmptyWidthinvalid headerrequest failedtypes mismatchKyber1024-X448Raw Public Keyexplicit_primeexplicit_char2ApplyFunction;DifferentialD;DoubleLeftTee;DoubleUpArrow;LeftTeeVector;LeftVectorBar;LessFullEqual;LongLeftArrow;Longleftarrow;NotTildeEqual;NotTildeTilde;Poincareplane;PrecedesEqual;PrecedesTilde;RightArrowBar;RightTeeArrow;RightTriangle;RightUpVector;SucceedsEqual;SucceedsTilde;SupersetEqual;UpEquilibrium;VerticalTilde;VeryThinSpace;bigtriangleup;blacktriangle;divideontimes;fallingdotseq;hookleftarrow;leftarrowtail;leftharpoonup;longleftarrow;looparrowleft;measuredangle;ntriangleleft;shortparallel;smallsetminus;triangleright;upharpoonleft;NotEqualTilde;varsubsetneqq;varsupsetneqq;expected 'inf'expected 'nan'protobuf errorMessageOptionsServiceOptionsinvalid kind: protobuf_oneofXXX_OneofFuncsXXX_extensionsinvalid optionld #vlan_availhttptest.serveillegal char: ReservedRangesSpeed test modeTUN TCP requestTUN UDP request$HOME/.hysteriaacme.dns.configgandi_api_tokennamedotcom_uservultr_api_tokenempty auth typeempty proxy urlmasquerade.typefailed to servehttps://%s:%d%sspeed test modeupload completex509keypairleafrecord overflowbad certificatePKCS1WithSHA256PKCS1WithSHA384PKCS1WithSHA512ClientAuthType(extensions typeextensions dataclient finishedserver finishedunknown versionx509usepoliciesmissing address/proc/net/igmp6unknown networknegative offsetnot a directorycopy_file_rangecomputeMaxProcsupdateMaxProcsGallocmRInternalGC (fractional)write heap dumpasyncpreemptoffcheckfinalizersforce gc (idle)sync.Mutex.Lockruntime.Goschedmalloc deadlockruntime error: scan missed a gmisaligned maskruntime: min = runtime: inUse=runtime: max = requested skip=bad panic stackrecovery failedmorestack on g0stopm holding pstartm: m has ppreempt SPWRITEmissing mcache?ms: gomaxprocs=randinit missed] morebuf={pc:: no frame (sp=runtime: frame ts set in timertraceback stuckruntime.gopanicunexpected kind476837158203125no such processadvertise errornetwork is downno medium foundkey has expiredbad system call: cannot parse ,M3.2.0,M11.1.0flags+=("-%s") no-descriptionskey is an aliasUDP not enabledHalfClosedLocalapplication/pdfapplication/oggfont/collectionapplication/zip; SameSite=Nonenegative updatehttp2xconnect=1trailers_pseudobad_path_methodAccept-Encodingrecv_rststream_multipart/mixedIdempotency-KeyPartial ContentRequest TimeoutLength RequiredNot ImplementedGateway Timeoutunexpected typebad trailer keywrite error: %wX-Forwarded-For[%s] Obtain: %wcert_cache_fillempty authz urlHTTP %d %s - %sidentifier_typeresolve error: Hooked-Req-Addrconnect error: is unavailableinvalid integer0601021504Z0700invalid booleannon-minimal tagunknown Go typeBelowExactAboveinvalid argSizeCurrency_SymbolModifier_LetterModifier_SymbolNonspacing_MarkSpace_SeparatorHanifi_RohingyaPsalter_Pahlavireflectlite.Setinvalid pointernot in a cgroupincomplete linetable{ index: jstmpllitinterptarinsecurepathzipinsecurepath not a functionJan _2 15:04:05invalid paddingInvalid Versionsocket open: %ssocket bind: %snet-tcp-dial-%snet-udp-dial-%snothing to packkey_unavailableIgnoring Retry.stateless_resetECN unsupportedaccept-encoding#multipartfilesAccept-Language/etc/mime.typesaccept-languagex-forwarded-forbad private keyECDSAP256SHA256ECDSAP384SHA384no-default-alpnprivateexponentunknown RR type/v2/bare-metals%s/%s/bandwidth%s/%s/user-data%s/%s/reinstall%s/%s/migration%s/%s/neighbors/v2/marketplace/v2/plans-metal/v2/ssh-keys/%s Go fipsinfo unclosed actionno dot in fieldtemplate clause(?i)<(/?)script^([\t\f ]+)(.*)impossible dateAddRange(%v-%v)invalid IPRangeinvalid kind %vCardinality(%d)weak_dependencyextension_rangeproto3_optionalunverified_lazyfeature_supportutf8_validationaggregate_valueedition_removedPhase: PROBE_BW0-RTT Protectedpto (Handshake)client_versionsserver_versionsbytes_in_flightreordering_timereset_stream_atmax_stream_datastreams_blockedsequence_numberretire_prior_totimestamp replyGroup: bad kindmax-age=2592000x-frame-options%s (status: %d)wrong seed sizeKyber512-X25519Kyber768-X25519/proc/self/auxvupn_domain_hintDiacriticalDot;DoubleRightTee;DownLeftVector;GreaterGreater;HorizontalLine;InvisibleComma;InvisibleTimes;LeftDownVector;LeftRightArrow;Leftrightarrow;LessSlantEqual;LongRightArrow;Longrightarrow;LowerLeftArrow;NestedLessLess;NotGreaterLess;NotLessGreater;NotSubsetEqual;NotVerticalBar;OpenCurlyQuote;ReverseElement;RightTeeVector;RightVectorBar;ShortDownArrow;ShortLeftArrow;SquareSuperset;TildeFullEqual;UpperLeftArrow;ZeroWidthSpace;curvearrowleft;doublebarwedge;downdownarrows;hookrightarrow;leftleftarrows;leftrightarrow;leftthreetimes;longrightarrow;looparrowright;nshortparallel;ntriangleright;rightarrowtail;rightharpoonup;trianglelefteq;upharpoonright;EOF token foundParseObjectListParseObjectItemParseObjectTypeexpected 'true'google.protobufextensionFieldsfractional bytedata/check mathinvalid addressContainingOneofRequiredNumbersExtensionRangesunsupported eta0123456789abcdefSOCKS5 TCP errorSOCKS5 UDP errornamedotcom_tokenunsupported modeoutbounds.directclient connectedSkip upload testupdate availableno renegotiationSignatureScheme(expected integerexpected newlinehostLookupOrder=/etc/resolv.confnon-IPv4 addressnon-IPv6 addressunknown network no colon on lineinvalid ip:port invalid AddrPortinteger overflowdecoratemappingsgcshrinkstackofftracefpunwindoffGC scavenge waitGC worker (idle)page trace flushselect (durable)SIGNONE: no trapheap reservation/gc/gogc:percent, not a functiongc: unswept span KiB work (bg), mheap.sweepgen=runtime: nelems=workbuf is emptymSpanList.removemSpanList.insertbad special kindpage alloc indexbad summary dataruntime: addr = runtime: base = runtime: head = already; errno= runtime stack: invalid g statusGOTRACEBACK=nonecastogscanstatusbad g transitionschedule: in cgoreflect mismatch untyped locals missing stackmapbad symbol tablenon-Go function pointerless type not in ranges: sigaction failed23841857910156250123456789ABCDEFinvalid argumentinvalid exchangeobject is remotemessage too longremote I/O errorno route to hoststopped (signal)time: bad [0-9]*__completeNoDesc commands=() open sink %q: %wProxy-Connectionunsupported unitcontext canceledafter object keyhttpcookiemaxnumHalfClosedRemoteapplication/wasmSETTINGS_TIMEOUTFRAME_SIZE_ERROR*http2.TransportWww-Authenticatehttp: nil Cookie Content-Encodingnil *http.Serverinvalid settingssetting_win_sizestream_went_downover_max_streamscontent-encodingread_frame_otherUnencryptedHTTP2at offset %d: %w%s %s HTTP/1.1 User-Agent: %s transport is nilunexpected type unknown locationhost unreachableAlready ReportedMultiple ChoicesPayment RequiredUpgrade RequiredContent-Length: X-Forwarded-Hostinvalid host: %wacme.zerossl.comunable to unlock_acme-challenge.challenge_tokensapplication/json/records?offset=Duplicate Recordauthorization %sresponse_headers, problem %q: %sHost unreachableprotocol error: GODEBUG: value "TLSv1.3-SHA2-256TLSv1.2-SHA2-256length too largeinvalid rune %#Udivision by zeroRel: can't make reflect.MakeFunc: value of type Dash_PunctuationLowercase_LetterOpen_PunctuationTitlecase_LetterUppercase_LetterImperial_AramaicMeroitic_CursiveZanabazar_Squareinvalid dns nameRCodeFormatErrorunpacking headeroutput too smallallowmultiplevcsno such flag -%vtemplate: %s: %sunknown node: %s%s overflows intbinary.BigEndianHysteria-Paddingversion_mismatch-> Sending Retryproxy-connectionH3_MESSAGE_ERRORH3_CONNECT_ERRORhandling requestquoted-printable()<>@,;:\"/[]?= short response: Content-Languagecontent-languagecontent-locationwww-authenticateinvalid encodingchallenge failedPublicExponent: dns: bad netmaskdns: bad addressunbalanced braceregexp: Compile(/v2/applications%s/%s/records/%s/v2/firewalls/%s%s/%s/iso/attach%s/%s/iso/detach%s/%s/node-pools/v2/reserved-ips/v2/snapshots/%sexec: no commandcandidate is oneincorrect length[bisect-match 0xunclosed commentunexpected tokenextra charactersunknown event %dduplicated key 'lower-layer-downVlanProtocol(%d)BondAdSelect(%d)AddPrefix(%v/%v)source_code_infocc_enable_arenascsharp_namespacephp_class_prefixclient_streamingserver_streamingedition_defaultsmessage_encodingidentifier_valueleading_commentsunknown type: %TPhase: PROBE_RTTFINAL_SIZE_ERRORKEY_UPDATE_ERRORCRYPTO_ERROR %#xToken: (empty), unexpected writeconnection_errorcrypto_error_%#xfinal_size_errorkey_update_errorkeys_unavailableapplication_datamax_idle_timeoutinitial_max_dataconnection_closebad time type %Tquater_stream_idframe_type_bytesno dynamic tablemax-age=31536000x-xss-protectionInstRuneAnyNotNLretrying requestEd448-Dilithium3ChaCha20Poly1305derive key errorCloseCurlyQuote;ContourIntegral;DoubleDownArrow;DoubleLeftArrow;DownRightVector;LeftRightVector;LeftTriangleBar;LeftUpTeeVector;LeftUpVectorBar;LowerRightArrow;NotGreaterEqual;NotGreaterTilde;NotLeftTriangle;OverParenthesis;RightDownVector;ShortRightArrow;UpperRightArrow;bigtriangledown;circlearrowleft;curvearrowright;downharpoonleft;leftharpoondown;leftrightarrows;nLeftrightarrow;nleftrightarrow;ntrianglelefteq;rightleftarrows;rightsquigarrow;rightthreetimes;straightepsilon;trianglerighteq;vartriangleleft;NotHumpDownHump;NotSquareSubset;ParseObjectValueexpected 'false'ieee802.11/prismgoogle/protobuf/EnumValueOptionsXXX_unrecognizedldx 4*([%d]&0xf)-httptest.serve= for polynomial shouldn't happeninvalid decodingCheck for updatesHTTP proxy serverno mode specifiedroute.ipv4Excluderoute.ipv6ExcludeSOCKS5 TCP closedSOCKS5 UDP closedfailed to connectHYSTERIA_ACME_DIRduckdns_api_tokengodaddy_api_tokennamedotcom_serverresolver.tcp.addrresolver.udp.addrresolver.tls.addrdownload completedecryption failedhandshake failureillegal parametermissing extensionunrecognized name/etc/ssl/cert.peminvalid BMPStringinvalid IA5String0123456789ABCDEFX0123456789abcdefxreflect.Value.Intillegal hex digitcan't scan type: pidfd_send_signalcontainermaxprocsgoroutine profileAllThreadsSyscallGC assist markingselect (no cases)sync.RWMutex.Lockwait for GC cycletrace proc statusSIGINT: interruptSIGBUS: bus errorSIGCONT: continuesync.(*Cond).Wait: missing method notetsleepg on g0bad TinySizeClassimmortal metadataruntime: pointer g already scannedmark - bad statusscanobject n == 0swept cached spanmarkBits overflowruntime: summary[runtime: level = , p.searchAddr = futexwakeup addr=, 0, {interval: {ns}}, nil) errno=results: got {r1=internal/runtime/thread exhaustionlocked m0 woke upentersyscallblock spinningthreads=gp.waiting != nilunknown caller pcstack: frame={sp:trace arena allocruntime: nameOff runtime: typeOff runtime: textOff 1192092895507812559604644775390625invalid bit size exec format errorpermission deniedno data availableunknown error 141unknown error 142stale file handlewrong medium typeTime.AppendText: corrupt zip file fractional secondCOBRA_ACTIVE_HELP flags+=("--%s%s [command-line]Transfer-Encodingrename failed: %win string literalseeker can't seekinvalid stream IDCOMPRESSION_ERRORENHANCE_YOUR_CALMHTTP_1_1_REQUIREDHEADER_TABLE_SIZE; SameSite=StrictIf-Modified-Sinceframe_ping_lengthtruncated headersunencrypted_http2bogus greeting %qreset_idle_streamtransfer-encodinginvalid method %qmissing form bodyX-Idempotency-Keyhttp: nil handlerMoved PermanentlyFailed DependencyToo Many RequestsX-Forwarded-Prototext/event-stream Email address: removing_subjectsload_if_necessarycert_ocsp_revoked^https://.+\.com$session is closedconnection closedunexpected result060102150405Z0700integer too large%%!%c(big.Int=%s)unknown type kind has invalid namereflect: call of reflect.Value.Capreflect.Value.Lenreflect: New(nil)Close_PunctuationFinal_PunctuationOther_PunctuationOld_North_ArabianOld_South_Arabian from a write of multipartmaxpartswinreadlinkvolume (DEPRECATED: %s)too many segmentsbatch read packetinvalid IP lengthunexpected_packetpath %s validatednot a ClientHellodeadline exceededH3_INTERNAL_ERRORH3_EXCESSIVE_LOADH3_SETTINGS_ERRORH3_DATAGRAM_ERRORmessage too largeif-modified-sincex-forwarded-protosolving challengebad key algorithmSignature ExpiredNot AuthoritativePrivateExponent: ; UPDATE LEASE: , timeout omitted%s/%s/vpcs/attach%s/%s/vpc2/detach%s/%s/vpc2/attach%s/%s/maintenance%s/%s/vpcs/detach os/exec.Command(exec: killing Cmdexec: not startednot a QUIC packetdivisor too largecandidate is evenKAS-ECC-SSC P-256bad character %#U%s at position %dLink %s not foundxmit headroom: %dmarshaling %s: %vpublic_dependencyobjc_class_prefixtrailing_commentsidempotency_levelQUIC_GO_LOG_LEVELAPPLICATION_ERROR, MinAckDelay: %sUnknown EventKindapplication_errorcongestion_windowpackets_in_flightpreferred_addressnew_connection_idinvalid conn typeparameter problemgzip, deflate, br^.*\._Ctype_char$missing closing )missing closing ]error_descriptionheartbeat_requestuser_mapping_dataDiacriticalAcute;DiacriticalGrave;DiacriticalTilde;DoubleRightArrow;DownArrowUpArrow;EmptySmallSquare;GreaterEqualLess;GreaterFullEqual;LeftAngleBracket;LeftUpDownVector;LessEqualGreater;NonBreakingSpace;NotRightTriangle;NotSupersetEqual;RightTriangleBar;RightUpTeeVector;RightUpVectorBar;UnderParenthesis;UpArrowDownArrow;circlearrowright;downharpoonright;ntrianglerighteq;rightharpoondown;rightrightarrows;twoheadleftarrow;vartriangleright;NotPrecedesEqual;NotSucceedsEqual;NotSucceedsTilde;unknown type: %T illegal characternon-hex characterincomplete numberinvalid characternextId too large:Wrong socket typeinvalid range: %vXXX_OneofWrappersqr: too much data--httptest.serve=ContainingMessageIsStreamingClientIsStreamingServerwrong scalar sizeGenerate share URICheck for updates.100.100.100.101/30SOCKS5 TCP requestSOCKS5 UDP requestHTTP CONNECT errorTCP redirect errorHYSTERIA_LOG_LEVELempty http addressoutbounds.http.urlinvalid port unionempty auth commandmasquerade requestSkip download testupload test failedunexpected messageexport restrictionx509negativeserial/etc/pki/tls/certscannot be negativereflect.Value.Uintunexpected newlineserver misbehavinginvalid IP address/etc/nsswitch.confinvalid criteria: unable to parse IPnetip.ParsePrefix(adaptivestackstartdontfreezetheworldtraceadvanceperiodtracebackancestorsgarbage collectionsync.RWMutex.RLockGC worker (active)stopping the worldwait until GC endssystem page size ( but memory size /gc/pauses:seconds because dotdotdotruntime: npages = invalid skip valueruntime: range = {index out of rangeruntime: gp: gp=runtime: getg: g=forEachP: not done in async preempt instruction bytes:mp.gsignal stack [bad manualFreeListruntime: textAddr frames elided... , locked to thread, synctest bubble value out of range298023223876953125input/output errorno child processesidentifier removedno locks availableRFS specific errormultihop attemptedfile name too longstreams pipe errorconnection refusedoperation canceledsegmentation fault: day out of rangeTime.MarshalJSON: Time.MarshalText: unknown time zone appendIfNotPresentmay not contain %qProxy-Authenticatefailed to send: %winvalid character context.Backgroundexceeded max depthin numeric literalhttp: blank cookiereceived from peerhttp: no such fileapplication/x-gzipFLOW_CONTROL_ERROR404 page not foundframe_goaway_shortUNKNOWN_SETTING_%dconnection is idleunexpected type %Ttrailers_not_endedGo-http-client/2.0Go-http-client/1.1Temporary RedirectPermanent RedirectMethod Not AllowedExpectation Failedbad Content-Lengthfield value for %qresponse write: %vresponse flush: %vinvalid IP-literalinserting_subjectsissuer %d (%s): %vtls-alpn challengeattempt %d: %s: %wmust be at least 8Connection refusedunsupported KDF idunsupported KEM idnon-minimal lengthtruncated sequencesequence truncatednegative bit indexreflect.Value.Callreflect.Value.Elemreflect.Value.Sendreflect.Value.Typereflect: Zero(nil)Caucasian_AlbanianRCodeServerFailureuse of closed file/cpu.cfs_quota_us/proc/self/cgroupunknown flag: --%slen of nil pointerfield is not validflag %q contains =flag redefined: %sbufio: buffer fullsocket connect: %sbatch write packetinvalid pool indexempty GeoSite nameheader_parse_errorunexpected_version<- Received Retry:invalid IPTOS sizeproxy-authenticateRequest.URL is nildecoding error: %vcleaning up solverchallenge acceptedsignature requiredbad authenticationbad extended rcodeno signature foundno secrets definedRSASHA1-NSEC3-SHA1private-key-formatuse tcp keep-alive ;; ZONE SECTION: overflow packing aauthorization_code%s/%s/repositories%s/%s/read-replica%s/%s/ipv6/reverse%s/%s/ipv4/reverse/v2/load-balancers/v2/object-storage%s/%s/nodes/attach%s/%s/nodes/detachsupported_versionsrsa: key too smallcrypto/rsa: p == qgo fips object v1 unknown type: %T empty key name: %sempty section nameexpansion too deepunhandled part: %stag:yaml.org,2002:XmitHashPolicy(%d)RemoveRange(%v-%v)positive_int_valuenegative_int_valueedition_introducededition_deprecatedHYSTERIA_BBR_DEBUGCONNECTION_REFUSEDSTREAM_LIMIT_ERRORSTREAM_STATE_ERRORPROTOCOL_VIOLATIONAEAD_LIMIT_REACHED (frame type: %#x)unknown frame typeserver_0rtt_secretserver_1rtt_secretclient_0rtt_secretclient_1rtt_secretconnection_refusedflow_control_errorstream_limit_errorstream_state_errorprotocol_violationaead_limit_reachedreordering_packetsack_delay_exponentinvalid connectionhttp3:frame_parsedget, post, options^(.+)\[([0-9]+)\]$performing requestheartbeat_responseDoubleUpDownArrow;DoubleVerticalBar;DownLeftTeeVector;DownLeftVectorBar;FilledSmallSquare;GreaterSlantEqual;LeftDoubleBracket;LeftDownTeeVector;LeftDownVectorBar;LeftTriangleEqual;NegativeThinSpace;NotReverseElement;NotTildeFullEqual;RightAngleBracket;RightUpDownVector;SquareSubsetEqual;VerticalSeparator;blacktriangledown;blacktriangleleft;leftrightharpoons;rightleftharpoons;twoheadrightarrow;NotGreaterGreater;NotLessSlantEqual;NotNestedLessLess;NotSquareSuperset;Unknown token: %+vunquote %s err: %sneed a \n after \rduplicate name: %qqr: internal errorunknown token kindEd25519-Dilithium2wrong input lengthn must be positivefdControlUnixSocketconnected to serverHTTP CONNECT closedTCP redirect closedHYSTERIA_LOG_FORMATempty outbound nameresolver.https.addrempty auth passwordempty auth userpassempty auth http urlmasquerade.file.dirclient disconnectedshow URI as QR codespeed test completeno update availablerevoked certificateexpired certificateunknown certificateunknown cipher typemaximum_name_lengthx509: malformed OIDx509: trailing datax509: unknown errorreflect.Value.IsNilreflect.Value.Floatbad unicode format parsenetlinkmessagecriterion too short too large for IPv4 too large for IPv6strongFromWeakQueueGC mark terminationsync.WaitGroup.Waitchan send (durable)SIGTRAP: trace trapwait for debug callcgocall unavailablepanicwrap: no ( in panicwrap: no ) in called using nil *unknown wait reasonnotesleep not on g0GC work not flushedunaligned sysUnused/gc/scan/heap:bytes/gc/heap/goal:bytes/gc/heap/live:bytesmarkroot: bad indexnwait > work.nprocs, gp->atomicstatus=marking free object KiB work (eager), [controller reset]mspan.sweep: state=sysMemStat overflowbad sequence numberpanic during mallocpanic holding locksmissing deferreturnunexpected gp.parampanic during panic , g->atomicstatus=unexpected g status_cgo_setenv missingbad runtime·mstartm not found in allmstopm holding lockssemaRoot rotateLeftbad notifyList sizeruntime: preempt g0runtime: pcdata is unsupported version14901161193847656257450580596923828125bad file descriptortoo many open filesdevice not a streamdirectory not emptydisk quota exceededillegal instructionstopped (tty input)/proc/self/uid_map/proc/self/gid_mapbad value for field/usr/lib/locale/TZ/time: unknown unit commands+=(%q) Proxy-Authorizationinvalid URL escape missing ']' in host%v write error: %v after array elementhttp: Server closedINADEQUATE_SECURITYINITIAL_WINDOW_SIZEIf-Unmodified-Sinceframe_data_stream_0 (%d bytes omitted)err must be non-nilTLS version too lowflow_on_data_lengthheaders_half_closedhost/path missing /multipart/form-dataContent-Length: 0 non-nil leaf fieldsinvalid header namenetwork unreachableSwitching ProtocolsPrecondition FailedMisdirected RequestService Unavailableinvalid Trailer keyConnection: close already registeredunknown status codeapi.letsencrypt.orgcached_managed_certtrying issuer %d/%dtls_get_certificateobtain_if_necessaryrequest failed: %worder took too long (%s_identifier=%s)RequestHook enabledinvalid status codeNetwork unreachableconnection closed: unknown hash value negative coordinatesync.Cond is copiedunsupported AEAD id20060102150405Z0700unknown Go type: %vskip this directory2006-01-02 15:04:05reflect.Value.Bytesreflect.Value.Fieldreflect.Value.Indexreflect.Value.Slicereflect.Value.Clear are not comparableInitial_PunctuationParagraph_SeparatorCanadian_AboriginalKhitan_Small_Scriptzero length segmentRCodeNotImplemented/cpu.cfs_period_usembedfollowsymlinksgotestjsonbuildtextmultipartmaxheadersfile already existsfile does not existfile already closedbad flag syntax: %s2006-01-02T15:04:0502 Jan 06 15:04 MSTJan _2 15:04:05.000binary.LittleEndianpacket is too shortempty domain suffixpath does not existunsupported_versionversion_negotiationClosing connection.quic: server closedQUIC_GO_DISABLE_GSOQUIC_GO_DISABLE_ECNH3_FRAME_UNEXPECTEDH3_MISSING_SETTINGSH3_REQUEST_REJECTEDH3_VERSION_FALLBACKContent-Dispositionmime: no media typecontent-dispositionif-unmodified-sinceproxy-authorizationinvalid Host headervalue for header %qevictCount overflowNo Zone Key Bit Setno private key seenAPL prefix too longAPL length too longextra closing brace%02d %02d %0.3f %s invalid port %s: %vunexpected InstFail/v2/billing/history%s/%s/repository/%s%s/%s/node-pools/%s/v2/startup-scriptsexec: canceling Cmdno DoH URL providedmodulus must be > 1unclosed left parenunknown branch typetemplate: %s:%d: %sunexpected %s in %s%s: unknown type %Tunsupported type %swhile parsing a tagBondArpValidate(%d)BondFailOverMac(%d)RemovePrefix(%v/%v)descriptor mismatchjava_multiple_filescc_generic_servicespy_generic_servicesdeprecation_warninginvalid perspectiveinvalid sample sizetoken too short: %dpacket_number_spaceunknown stream typestream_data_blockedrouter solicitationextended echo replyhttp3:frame_createdtiming-allow-originP256Kyber768Draft00 "(),/:;<=>?@[]\{}DownRightTeeVector;DownRightVectorBar;LongLeftRightArrow;Longleftrightarrow;NegativeThickSpace;PrecedesSlantEqual;ReverseEquilibrium;RightDoubleBracket;RightDownTeeVector;RightDownVectorBar;RightTriangleEqual;SquareIntersection;SucceedsSlantEqual;blacktriangleright;longleftrightarrow;NotLeftTriangleBar;array is incompleteieee802.11/radiotapinvalid nil pointerExtensionRangeArrayfield %v is invalidapplication_limitedunknown JumpTest %villegal char escapegoogle.protobuf.AnyHTTP CONNECT requestTCP forwarding errorUDP forwarding errorTCP redirect connectdisable-update-checkdisable update checkcloudflare_api_tokeninvalid IPv4 addressinvalid IPv6 addressempty socks5 addressempty file directorymasquerade.proxy.urlempty string contentdownloading databasedownload test failedupload test completechecking for updatesunknown PSK identitycertificate requiredcipher_suites kdf_idx509usefallbackrootsgetCert can't be nilinvalid UTF-8 stringx509: malformed spkitype not a pointer: invalid DNS responseunrecognized addressunexpected network: missing IPv6 addressunexpected characternegative Prefix bitsfloating point errorGC sweep terminationResetDebugLog (test)chan send (nil chan)flushing proc cachesSIGALRM: alarm clockSIGTERM: terminationclose of nil channelnotetsleep not on g0bad system page size to unallocated span/gc/scan/stack:bytes/gc/scan/total:bytes/gc/heap/frees:bytes/gc/gomemlimit:bytesp mcache not flushed markroot jobs done pacer: assist ratio=workbuf is not emptybad use of bucket.mpbad use of bucket.bpruntime: double waitpreempt off reason: forcegc: phase errorgopark: bad g statusgo of nil func valueselectgo: bad wakeupsemaRoot rotateRightreflect.makeFuncStubtrace: out of memorywirep: already in go37252902984619140625invalid request codebad font file formatis a named type fileconnection timed outkey has been revokedurgent I/O conditionstopped (tty output)time: invalid number/usr/share/zoneinfo/ noun_aliases=() last_command=%q DebugFlags called onBASH_COMP_DEBUG_FILEjson: Unmarshal(nil)json: Unmarshal(nil json: error calling pad length too largehttp2: stream closedhttplaxcontentlengthMAX_HEADER_LIST_SIZE%s connection error: %sframe_settings_mod_6No space found in %qconn_close_lost_pingsettings_big_or_dupsURL must have a hostassigned stream ID 0read_frame_too_largeinvalid use of queuebad wildcard name %qhttp: POST too largeHTTP/%d.%d %03d %s invalid header valueunknown address typeRequest URI Too LongUnprocessable EntityInsufficient Storagecertificate is emptyrenewing certificate%s: file info is nilchoosing certificateencoding payload: %vcreating request: %wh3=":%d"; ma=2592000https://%s/dns-queryno address availableinvalid write resultSeek: invalid whenceSeek: invalid offsetunsupported suite IDinvalid integer typeasn1: syntax error: number has no digitsbad karatsuba lengthreflect: cannot use returned zero Valuereflect.Value.IsZeroreflect.Value.Methodreflect.Value.SetIntreflect.Value.Slice3Egyptian_HieroglyphsMeroitic_Hieroglyphsif/with can't use %vnil is not a commanderror calling %s: %windex of untyped nilindex of nil pointerslice of untyped nilflag: help requestedno route to interneterror at line %d: %slistener already setSetting DF for IPv4.Setting DF for IPv6.H3_REQUEST_CANCELLED%s=":%d"; ma=2592000http3: panic servingform-data; name="%s"gzip: invalid headerheader line too longno identifiers foundno solver configuredbad OCSP signature: DNSSEC Indeterminate ;; ANSWER SECTION: ;; UPDATE SECTION: overflow unpacking aoverflow packing hexoverflow packing opt/v2/billing/invoices/v2/blocks/%s/attach/v2/blocks/%s/detach%s/%s/firewall-rules%s/apps/%s/variables/v2/private-networksKEM is not supportedKDF is not supportedinvalid PCG encodingsha3: Sum after Readinteger overflow: %qmissing value for %sunclosed section: %sunknown property: %smalformed expressionexpected digit (0-9)invalid map key: %#vunknown scalar styleinvalid parser statewhile parsing a nodewhile scanning a tag/sys/class/net/%s/%sinvalid MPLS RTA_DSTjava_outer_classnameuninterpreted_option[BBRSender] [%s] %s FRAME_ENCODING_ERRORreordering_thresholdunexpected event: %vDropping 0-RTT keys.EventDiscard0RTTKeysquic-go token sourceframe_encoding_errorrecovery:mtu_updatedrecovery:packet_lostsecurity:key_updatedmax_udp_payload_sizeretire_connection_idrouter advertisementLogValue panicked %ssettings_h3_datagram^.*\._Ctype_uint8_t$expression too largeinvalid repeat countpeer_allowed_to_sendDoubleLongLeftArrow;DownLeftRightVector;LeftArrowRightArrow;NegativeMediumSpace;RightArrowLeftArrow;SquareSupersetEqual;leftrightsquigarrow;NotGreaterFullEqual;NotRightTriangleBar;unknown bool value: invalid field numberWARNING: %v See %v invalid map key typeqr: invalid pad sizecongestion_avoidanceunknown JumpTest %#villegal octal number^[[:space:]]*%s\r*\ztls.clientCertificateTCP transparent proxyUDP transparent proxyTCP forwarding closedUDP forwarding closedunsupported SNI guardunsupported ACME typeoutbounds.direct.modeoutbounds.socks5.addrunsupported auth typeserver up and runningdecompression failureunsupported extensioncipher_suites aead_idinvalid NumericStringx509: invalid versionunsupported operationreflect.Value.Complexsingle-request-reopenparsenetlinkrouteattrIPv4 address too longunexpected slice sizenegative shift amountdataindependenttimingsystem goroutine wait/gc/heap/allocs:bytesruntime: work.nwait= previous allocCount=, levelBits[level] = runtime: searchIdx = profiler hash bucketsdefer on system stackpanic on system stackasync stack too large_cgo_unsetenv missingstartm: m is spinningstartlockedm: m has pfindrunnable: wrong ppreempt at unknown pcreleasep: invalid argcheckdead: runnable g from outside bubble runtime: newstack at runtime: newstack sp=runtime: confused by pcHeader.textStart= timer data corruption186264514923095703125931322574615478515625block device requiredread-only file systempackage not installedlink has been severedstate not recoverabletrace/breakpoint trapuser defined signal 1user defined signal 2virtual timer expired/proc/self/setgroupstime zone offset hour_%s_root_command() { Did you mean this? failed to connect: %wfailed to receive: %wkey is not comparableafter top-level valuein string escape codefeature not supportedhttp: nil Request.URLUNKNOWN_FRAME_TYPE_%dframe_ping_has_streamover_max_streams_racetoo_many_early_resetsRoundTrip failure: %vheader list too largeUnhandled Setting: %vnet/http: nil Contexttoo many Host headershttp: invalid patternmalformed Host header%03d status code %d unknown address type command not supportedPrecondition RequiredInternal Server Errorhttp: proxy error: %vinvalid hex charactergetting directory: %wno certificate chainscached_unmanaged_certobtaining certificateunknown PEM header %qqueueing renewal taskadvancing OCSP staplemissing directory URLapplication/jose+jsonBandwidthConfig.MaxTxBandwidthConfig.MaxRxinvalid outbound modeCommand not supportedoutbound %s not foundmessage limit reachedsequence tag mismatchset bit is not 0 or 1unknown ABI part kind of unexported methodunexpected value stepreflect.Value.SetZeroreflect.Value.Pointerreflect.Value.SetUintConnector_PunctuationAnatolian_HieroglyphsInscriptional_Pahlavibad type in compare: /proc/self/mountinfoconcurrent map writespflag: help requested%s flag redefined: %s02 Jan 06 15:04 -0700record on line %d: %vflag %q begins with -bufio: negative countcause on an nil errorip: unknown version: interface not found: duplicate stream dataConnection %s closed.unknown_connection_idpayload_decrypt_errormisrouted packet: %#vtoo many open streamserror handling streamerror writing requestH3_INCOMPLETE_REQUESTduplicate setting: %dmissing :status fielduserinfo_in_authorityunknown OCSP status: buffer size too smallStale NXDOMAIN Answeroverflow packing aaaaoverflow packing nsecoverflow packing SVCBauthorization_pending%s/%s/version-upgradehttps://api.vultr.com%s/%s/backup-schedule%s/%s/ipv6/reverse/%s/v2/object-storage/%sexec: already startedAEAD is not supporteddecryption failed: %wsimulated PCT failureinvalid scalar lengthcrypto/rsa: p is evenbad number syntax: %qundefined variable %qunknown config formatunhandled kv part: %sinvalid emitter stateexpected STREAM-STARTexpected DOCUMENT-ENDcannot marshal type: write handler not setBondArpAllTargets(%d)unknown SEG6 Type: %dno hyphen in range %qjava_generic_servicesHYSTERIA_BRUTAL_DEBUGinvalid varint lengthinvalid ECN value: %dinvalid reserved bitsunknown ECN state: %dECN mangling detectedinvalid send mode: %dserver_initial_secretclient_initial_secretEventWriteInitialDataEventReceivedReadKeysDropping key phase %dtransport:packet_sentstateless_reset_tokenrequest_max_ack_delayextended echo requesthttp3:datagram_parsedinvalid named capturecannot handle type %Tcontext not supportedCapitalDifferentialD;DoubleLeftRightArrow;DoubleLongRightArrow;EmptyVerySmallSquare;NestedGreaterGreater;NotDoubleVerticalBar;NotLeftTriangleEqual;NotSquareSubsetEqual;OpenCurlyDoubleQuote;ReverseUpEquilibrium;NotGreaterSlantEqual;no object keys found!invalid character %#Uexpected character %cmessage_set_extensionExtensionRangeOptionsmismatching field: %vinvalid QR version %dinvalid option lengthinvalid header lengthfinished without errorTCP redirect listeningTCP forwarding connectUDP forwarding connectinvalid config: %s: %sempty cert or key pathempty resolver addressmasquerade.listenHTTPSdownload test completeperforming upload testerror decoding messageinappropriate fallbackTLS_AES_128_GCM_SHA256TLS_AES_256_GCM_SHA384ECDSAWithP256AndSHA256ECDSAWithP384AndSHA384ECDSAWithP521AndSHA512extended master secrethkdf: counter overflow/etc/ssl/ca-bundle.pemx509: malformed issuerreflectlite.Value.Type0123456789aAbBcCdDeEfFexpected quoted stringmissing ']' in addressinvalid address familyoperation was canceledIPv4 address too shortmultiple :: in addressbad bits after slash: integer divide by zeroCountPagesInUse (test)ReadMetricsSlow (test)trace reader (blocked)trace goroutine statusGC weak to strong waitchan receive (durable)SIGTSTP: keyboard stopsend on closed channelgetenv before env initinterface conversion: freeIndex is not valids.freeindex > s.nelemsbad sweepgen in refillspan has no free spaceruntime: out of memory/gc/scan/globals:bytes/gc/heap/frees:objectsruntime: work.nwait = runtime:scanstack: gp=scanstack - bad statusheadTailIndex overflowruntime.main not on m0set_crosscall2 missingbad g->status in readywirep: invalid p stateassembly checks failed received during fork stack not a power of 2minpc or maxpc invalidnon-Go function at pc=4656612873077392578125argument list too longcannot allocate memoryremote address changedprotocol not availableprotocol not supportedaddress already in usenetwork is unreachable/lib/time/zoneinfo.zipHelp about any commandunrecognized level: %qmust be at least 16384unknown field type: %v into Go struct field json: unknown field %qhttp2: frame too largewrite on closed bufferbody closed by handlerapplication/postscriptDEBUG_HTTP2_GOROUTINESMAX_CONCURRENT_STREAMSframe_data_pad_too_bigunexpected empty hpackmalformed HTTP requestmalformed HTTP versionX-Content-Type-OptionsUnsupported Media Typecreating lock file: %v/v4/domains/%s/records<(.+?)>;\s*rel="(.+?)"encoding inner JWS: %vperforming request: %wmust be at least 65536overflowing coordinatezero length BIT STRINGInt.Scan: invalid verbinvalid number base %dinternal inconsistencyreflect.Value.MapIndexreflect.MapIter.SetKeyunexpected method stepreflect.Value.SetFloat to array with length Inscriptional_ParthianNyiakeng_Puachue_Hmongreflectlite.Value.Elemskipping Question Nameskipping Question Typeexit hook invoked exitflag %q does not existfailed to parse IP: %qundefined variable: %sindex out of range: %dJan _2 15:04:05.000000wrong number of fieldsipv4: fragment droppedinvalid address lengthinvalid padding lengthinvalid message lengthpath not yet validatedinvalid conn id lengthquic: transport closedwrite on closed streamhttp3: nil Request.URL/usr/share/mime/globs2/etc/apache/mime.typesgzip: invalid checksumaccess-control-max-ageinvalid HTTP header %sinvalid Trailer key %qhpack: string too longheader field %q = %q%sidna: invalid label %qcreating new order: %wUnknown hash algorithmbad OCSP response typeinvalid responder nameconn has no connectionNo Reachable Authorityunrecognized address: overflow packing uint8 ;; QUESTION SECTION: overflow unpacking txtoverflow unpacking hexoverflow unpacking optnsec bits out of orderextra APL address bitsport cannot be < 0: %d%s/%s/connection-pools%s/%s/advanced-options/v2/firewalls/%s/rules%s/%s/private-networks%s/%s/forwarding-rulessimulated CAST failureout-of-range candidatecrypto/rsa: p * q != nsha3: Write after Readunexpected right parenexpected end; found %sparenthesized pipelineapplication/javascriptunknown slice type: %T0123456789abcdefABCDEFexpected a : separatortoml: cannot write: %wmode %s segs %d [ %s ]java_string_check_utf8php_metadata_namespaceSetMaxDatagramSize: %dCRYPTO_BUFFER_EXCEEDEDpto (Application Data)Dropping Initial keys.EventHandshakeCompletecrypto_buffer_exceededrecovery:spurious_losssecurity:key_discardedhttp3:datagram_createdx-content-type-optionsunexpected length codeerror parsing regexp: CloseCurlyDoubleQuote;DoubleContourIntegral;FilledVerySmallSquare;NegativeVeryThinSpace;NotPrecedesSlantEqual;NotRightTriangleEqual;NotSucceedsSlantEqual;oneof type already setunknown parent type %TXXX_InternalExtensionsnon-numeric string %#qbuild line missing '='illegal UTF-8 encodingcomment not terminatedheredoc not terminatedliteral not terminatedinvalid UTF-8 detectedVerify that 1 < w < 32server address is emptylisten address is emptySOCKS5 server listeningremote address is emptyempty DNS provider nameduckdns_override_domaindo not show URI as textunsupported certificateno application protocolech accept confirmationCLIENT_TRAFFIC_SECRET_0SERVER_TRAFFIC_SECRET_0tls: invalid PSK binderQUICEncryptionLevel(%v)/etc/pki/tls/cacert.peminvalid PrintableStringx509: malformed UTCTimex509: invalid key usagex509: malformed versionreflectlite.Value.IsNil0123456789aAbBcCdDeEfF_unexpected address typemissing port in addressindex out of range [%x]ReadMemStatsSlow (test)chan receive (nil chan)garbage collection scanSIGSYS: bad system callSIGIO: i/o now possiblemakechan: bad alignmentclose of closed channelunlock of unlocked lock) must be a power of 2 system huge page size (runtime: s.allocCount= s.allocCount > s.nelems/gc/heap/allocs:objectsruntime: internal errorwork.nwait > work.nprocleft over markroot jobsgcDrain phase incorrectMB during sweep; swept bad profile stack countruntime: eventfd failedruntime: netpoll failedpanic during preemptoffnanotime returning zeroschedule: holding locksinternal/runtime/atomicprocresize: invalid argmisuse of profBuf.writeunexpected signal valuespan has no free stacksstack growth after forkshrinkstack at bad timereflect.methodValueCall23283064365386962890625operation not permittedinterrupted system calldevice or resource busyno space left on deviceoperation not supportedprofiling timer expiredCPU time limit exceededtime zone offset minutetime zone offset secondtime: invalid duration trimTrailingWhitespaces noun_aliases+=(%q) command_aliases=() ShellCompDirectiveErrorUnknown help topic %#q checking if file existsprotocol already in usemissing protocol schemeinvalid URI for requestjson: cannot unmarshal into Go value of type unexpected map key typehttp2: handler panickedhttp: request too largenet/http: abort Handlertext/xml; charset=utf-8ENABLE_CONNECT_PROTOCOLError reading directoryunknown error code 0x%xframe_goaway_has_streamframe_headers_pad_shortframe_rststream_bad_lennet/http context value unknown relationship %qmalformed HTTP responsemulti wildcard not lastnon-zero reserved fieldnetwork not implementedcommand not implementedVariant Also Negotiatesaccessing lock file: %vmaking OCSP request: %v%s/zones/%s/dns_recordshttps://api.godaddy.comsigning EAB content: %wprovisioning client: %wHTTP request failed: %dbytes.Buffer: too large", missing CPU support asn1: structure error: truncated tag or lengthbad karatsubaSqr lengthreflect.Value.Interfacereflect.Value.NumMethodtoo many pointers (>10)segment length too longunpacking Question.Nameunpacking Question.Typeskipping Question Classexit hook invoked panictemplate %q not definedcannot assign nil to %sexpected bool; found %serror decoding '%s': %sget file descriptor: %sunsupported domain typeunknown packet type: %stoo short connection IDmultiple SNI extensionsSNI host_name not foundmultiple ECH extensionspeer sent too much dataunknown error code: %#x:protocol must be emptyinvalid status code: %wmultipart: NextPart: %winvalid response code: /etc/apache2/mime.typestext/css; charset=utf-8invalid HTTP trailer %svarint integer overflowfinalizing order %s: %wdone waiting for solverauthorization finalizedSignature Not Yet Validoverflow packing uint16overflow packing uint32 ; LONG LIVED QUERIES: ; DS HASH UNDERSTOOD: dns: bad address family ;; AUTHORITY SECTION: overflow unpacking aaaaoverflowing header sizeoverflow packing uint64overflow packing base32overflow packing base64overflow unpacking SVCBrecord type not SRV: %s/v2/billing/invoices/%s/v2/kubernetes/clusters/v2/kubernetes/versions%s/%s/firewall-rules/%sexec: Stdin already setapplication/dns-messagesetsockopt(IPV6_V6ONLY)setsockopt(TCP_NODELAY)unsupported version: %xFIPS 140-3 PCT passed: P224 point not on curveP256 point not on curveP384 point not on curveP521 point not on curveEd25519 sign and verifyed25519: bad public keyRSA sign and verify PCTcrypto/rsa: d too smallpattern bits too long: 0123456789abcdefABCDEF_function %q not definedmissing required key %sinvalid unicode literalunsupported encoding %vproperties: Line %d: %scircular reference in: unknown character widthwhile scanning an aliasBondPrimaryReselect(%d)Family: %d, Address: %smessage_set_wire_formatrepeated_field_encoding[BrutalSender] [%s] %s unknown packet type: %dinvalid first ACK rangetoken must not be emptyserver_handshake_secretclient_handshake_secretEventWriteHandshakeDataunknown cipher suite %dPeer updated keys to %dinitial_max_streams_unimax_datagram_frame_sizeack_eliciting_thresholddestination unreachablecalled from %s (%s:%d) (rest of stack elided) content-security-policyflate: internal error: invalid escape sequenceunknown empty width arginvalid scalar encodingDiacriticalDoubleAcute;NotSquareSupersetEqual;expected value, not eofbad %s slice length: %dmultiple files named %qmismatching cardinalityunsupported edition: %vinvalid Message.Get on invalid Message.Set on unknown connection typeinvalid scratch slot %dunknown accessor: %v.%s%v has unknown kind: %vobfs.salamander.passwordTCP forwarding listeningUDP forwarding listeningunsupported DNS providerperforming download testHTTP reverse proxy errorerror decrypting messagecertificate unobtainableTLS_RSA_WITH_RC4_128_SHAtls: malformed ECHConfigtls: server rejected ECHx509: malformed validityaddress string too shorttracecheckstackownershiphash of unhashable type cannot open standard fdsspan has no free objectsruntime: found obj at *(/cgo/go-to-c-calls:calls/gc/heap/objects:objects/sched/latencies:secondsqueuefinalizer during GCcheckfinalizers: queue: update during transitionruntime: markroot index can't scan our own stackgcDrainN phase incorrectpageAlloc: out of memoryruntime: p.searchAddr = range partially overlapsruntime: epollctl failed [recovered, repanicked]stack trace unavailable runtime: mp.lockedInt = runqsteal: runq overflowgoroutine stack (system)unexpected syncgroup setdouble traceGCSweepStartbad use of trace.seqlock116415321826934814453125582076609134674072265625level 2 not synchronizedlink number out of rangeout of streams resourcesfunction not implementedconnection reset by peerstructure needs cleaningfloating point exceptionfile size limit exceededRawSockaddrAny too small/usr/share/lib/zoneinfo/While parsing config: %smust start with a letterfailed to set fwmark: %wfailed to control fd: %wjson: unsupported type: Mon Jan _2 15:04:05 2006text/html; charset=utf-8unexpected buffer len=%vinvalid pseudo-header %qframe_headers_prio_shortread_frame_conn_error_%sstream %d already openedapplication/octet-streamPRI * HTTP/2.0 SM ConnContext returned nilRequest Entity Too Largehttp: nil Request.Headercreating ACME client: %vdecoding private key: %vgetting ACME account: %vfinal attempt; giving upcertificate has no namesdeleting private key: %vunsupported key type: %Tunknown private key typeNS %s returned %s for %sapplication/ocsp-requestgot errors: HTTP %d: %+vauthorization failed: %wapplication/problem+jsonpolling order status: %wunknown request type: %dreflect.MapIter.SetValuereflect.StructOf: field reflect.Value.SetComplexreflect.Value.UnsafeAddrresource length too longunpacking Question.Classdnsmessage.MustNewName("dnsmessage.Option{Code: invalid ChaCha8 encodingexpected float; found %s2006-01-02T15:04:05-07002006-01-02 15:04:05Z0700unable to parse date: %sresult must be a pointer%s: unsupported type: %screate vectorised writerbuild IPv4 route addressbuild IPv6 route addressempty GeoIP country codeinvalid CIDR address: %squic: tls.Config not setinvalid QUIC version: %serror parsing packet: %sDATAGRAM frame too largeunknown encryption levelcannot close active pathError parsing packet: %sinvalid IPV6_TCLASS sizeAdding connection ID %s.http3: headers too largehttp3: conn unusable: %sexpected Base to be zeroduplicate control streamH3_STREAM_CREATION_ERRORinvalid request :path %qMalformed Content-Lengthcould not write trailersignoring invalid trailerhttp3: invalid method %qinvalid argument to Intnidna: disallowed rune %Uvalidating authorizationinvalid responder id tag ;; ADDITIONAL SECTION: overflow unpacking uint8%s/%s/docker-credentials%s/%s/available-upgradesexec: Stdout already setexec: Stderr already setinvalid argument to IntNbigmod: division by zerochacha20: wrong key sizeinvalid pattern syntax: sha3: invalid hash statestreamSafe was not reset(\$)(\{?([A-Z0-9_]+)\}?)text/plain;charset=utf-8ErrorHandler should exitduplicate %TAG directiveread handler must be setexceeded max depth of %dwhile scanning an anchorMore than one link foundrange %v to %v not validnot a long header packetACK decreases ECN countsnegative bytes_in_flightunknown cypher suite: %dDropping Handshake keys.keys updated too quicklytransport:packet_droppedrecovery:metrics_updatedtransport:parameters_setdisable_active_migrationinitial_max_streams_bidiValue kind is %s, not %spublic, max-age=31536000flate: maxBits too largeGODEBUG sys/cpu: value "", required CPU feature peer_not_allowed_to_sendhpke: invalid HPKE suiteNotNestedGreaterGreater;expected: STRING got: %sneed a character after \encodeArray: nil elementinvalid field number: %dmismatching enum lengthsunknown instruction: %#ved448: bad seed length: expected '/' for commentempty DNS provider configoutbounds.direct.bindIPv4outbounds.direct.bindIPv6unsupported outbound typeunsupported resolver typemasquerade.string.contenttls: protocol is shutdownx509: invalid RDNSequencex509: invalid RSA modulusx509: malformed extensionx509: malformed signature2006-01-02T15:04:05Z07:00no hex data for %x stringno answer from DNS serverinvalid network interfaceno such network interfaceno suitable address foundunexpected '[' in addressunexpected ']' in addressIPv4 field has value >255/proc/sys/kernel/hostnamegoroutine profile cleanupGOMAXPROCS updater (idle)chansend: spurious wakeup when attempting to open runtime·lock: lock countbad system huge page sizearena already initialized to unused region of spanunaligned sysNoHugePageOS/sched/gomaxprocs:threadsmissing type in finalizerremaining pointer buffersruntime: epollwait on fd slice bounds out of range_cgo_thread_start missingallgadd: bad status Gidleruntime: program exceeds startm: p has runnable gsstoplockedm: not runnablereleasep: invalid p statecheckdead: no p for timercheckdead: no m for timerunexpected fault address missing stack in newstackbad status in shrinkstackmissing traceGCSweepStart2910383045673370361328125no such file or directoryno such device or addressinvalid cross-device linkresource deadlock avoidedsocket type not supportedno buffer space availableoperation now in progressunknown command %q for %q aliashash[%q]=%q ' does not support flag 'ShellCompDirectiveNoSpaceShellCompDirectiveDefaultno encoder name specifiednet/url: invalid userinfoQUICConfig.MaxIdleTimeoutcontext deadline exceededjson: Unexpected key typereflect.Value.OverflowIntjson: unsupported value: not at beginning of valuehttp: invalid cookie nametext/plain; charset=utf-8http: invalid Cookie.Name500 Internal Server Errorhttp2: Framer %p: read %vframe_data_pad_byte_shortframe_settings_has_streamframe_headers_zero_streamframe_headers_pad_too_bigframe_priority_bad_lengthhttp2: invalid header: %vhttp2: unsupported schemeread_frame_unexpected_eof{...} wildcard not at endhttp: invalid Host headerHTTP/1.1 100 Continue port number out of range invalid username/passwordreading email address: %v()[]{}<> "\!@#$%^&|;'+=no certificates availableobtaining new certificateserved key authenticationcreating OCSP request: %vreading OCSP response: %vparsing OCSP response: %v/v4/domains/%s/records/%srolling key on server: %wreading response body: %wno IPv4 address availableno IPv6 address availableinvalid protocol/port: %secdsa: invalid public keyGODEBUG: can not enable "unknown Go type for sliceexplicit tag has no childinvalid object identifierreflect.Value.SetMapIndexreflect: Bits of nil Typereflect.StructOf: field "inconsistent poll.fdMuteximpossible cgroup versionhash of unhashable type: can't evaluate command %qexpected string; found %scan't print %s of type %s2006-01-02 15:04:05Z07:002006-01-02 15:04:05 -0700Jan _2 15:04:05.000000000%d error(s) decoding: %s'%s' has invalid keys: %s'%s' has unset fields: %smissing interface addressipv4: udp: invalid packetipv6: udp: invalid packetGeoSite name %s not foundunexpected frame type: %sDestroying connection: %sBUG: invalid send mode %ddatagram support disabledswitching to path %d (%s)write on closed stream %dunexpected type byte: %#xH3_GENERAL_PROTOCOL_ERRORH3_CLOSED_CRITICAL_STREAMunknown pseudo header: %scould not flush to streamhttp3: nil Request.Headerblake2b: invalid key sizeContent-Transfer-Encodingstrict-transport-securitytrying to solve challengeocsp: error from server: overflow unpacking uint16overflow unpacking uint32overflow unpacking uint64overflow unpacking base32overflow unpacking base64overflow packing anything%s/%s/connection-pools/%s/v2/firewalls/%s/rules/%d%s/%s/forwarding-rules/%sinvalid argument to UintNcrypto/rsa: invalid primetesting simulated failureillegal number syntax: %q_html_template_urlescaper(?i)<(script|/script|!--)section %q does not existhour cannot be greater 23unable to parse float: %w2006-1-2 15:4:5.999999999while parsing a flow nodedid not find expected keyinvalid Unicode characterdid not find expected '!'required field %v not setleading_detached_commentsTRANSPORT_PARAMETER_ERRORCONNECTION_ID_LIMIT_ERRORnot a short header packet, EnableResetStreamAt: %tECN capability confirmed.Skipping packet number %d updated RTT: %s (σ: %s)transport_parameter_errorconnection_id_limit_errortransport:packet_receivedtransport:packet_bufferedslog: level string %q: %wupgrade-insecure-requests^.*\._Ctype_unsignedchar$unexpected HTTP status %swrong size for public keywrong size for ciphertextansiX962_compressed_primeansiX962_compressed_char2HPKE_KEM_P256_HKDF_SHA256HPKE_KEM_P384_HKDF_SHA384HPKE_KEM_P521_HKDF_SHA512HPKE_KEM_X448_HKDF_SHA512ClockwiseContourIntegral;DoubleLongLeftRightArrow;windows new line expectedcheckId: %d should be %d bootstrap type wrong id: cb27e3aa (May 26th, 2020)google/protobuf/api.protoinvalid Message.Clear on got %v, want *struct kindinvalid oneof descriptor ed448: bad hash algorithmgf256: invalid generator blake2s: invalid key sizeunsupported transport typeunsupported log level: %s bad certificate hash valueECDSA verification failurex509: malformed parametersx509: malformed extensionsreflect.Value.CanInterfaceinteger overflow on token cannot marshal DNS messagetoo many colons in addressSRV header name is invalidunclosed criterion bracketcriterion lacks equal signAs4 called on IPv6 addressprefix length out of rangeall goroutines stack traceSIGSTOP: stop, unblockableGC background sweeper waitnotewakeup - double wakeuppersistentalloc: size == 0/gc/cycles/total:gc-cyclesbad type kind in finalizernegative idle mark workersuse of invalid sweepLockerruntime: bad span s.state=forEachP: P did not run fnwakep: negative nmspinningstartlockedm: locked to meinittask with no functionscorrupted semaphore ticketout of memory (stackalloc)invalid use of gostartcallshrinking stack in libcallruntime: pcHeader: magic= traceRegion: out of memory1455191522836685180664062572759576141834259033203125no message of desired typeno CSI structure availableinvalid request descriptorname not unique on networkrequired key not available: day-of-year out of range flags_completion+=(:) must_have_one_flag=() must_have_one_noun=() Unsupported Config Type %qmust specify logging levelmalformed request body: %vmux-listen: %s[%s]: %s: %vsocket closed unexpectedlyinvalid port %q after hostintegrity check failed: %wunexpected status code: %dQUICConfig.KeepAlivePeriodmust be between 2s and 60sreflect.Value.OverflowUintencountered a cycle via %shttp: invalid cookie valueread from empty dataBuffernet/http: request canceledstopped after 10 redirectsduplicate pseudo-header %qhttp2: Framer %p: wrote %vframe_windowupdate_bad_lenframe_priority_zero_streaminternal error: bad Writerduplicate wildcard name %qliterals differ: %q and %qmalformed HTTP status codeaddress type not supportedHTTP Version Not SupportedreadLoopPeekFailLocked: %wgenerating private key: %vcertificate already cachedadded certificate to cachedeleting metadata file: %v%s/zones/%s/dns_records/%s%s/zones/%s/dns_records?%sLiveDNS returned a %v (%v)final order is invalid: %wAddress type not supportedecdsa: invalid private keyed25519: bad seed length: crypto/rsa: missing primescrypto/rsa: prime P is nilcrypto/rsa: prime Q is nilempty buffer in CopyBuffercryptobyte: internal errormlkem: invalid seed lengthbase 128 integer too largetruncated base 128 integerasn1: invalid UTF-8 stringnon sequence tagged as set using unaddressable valueunknown ABI parameter kind using zero Value argumentreflect.Value.MethodByNamesegment prefix is reserveddnsmessage.NSResource{NS: flag needs an argument: %sinvalid value; expected %sexpected integer; found %sexpected complex; found %stoo many slice indexes: %dnon-function %s of type %snon-comparable type %s: %v2006-01-02 15:04:05 -07:00bare " in non-quoted-fieldbinary.Read: invalid type unknown session with port buffer overflow: capacity quic: transport closed: %sRemoving connection ID %s.http3: transport is closedreceiving datagrams failedQPACK_DECOMPRESSION_FAILEDinvalid content length: %whttp3: invalid Host headerhandling connection failedinvalid argument to Int63ninvalid argument to Int31nblake2b: invalid hash size/etc/httpd/conf/mime.typesid (%v) <= evictCount (%v)malformed chunked encodinginvalid CR in chunked linedeactivating authorizationinvalid responder key hashUnsupported DS Digest Type ; NSEC3 HASH UNDERSTOOD: ;; PREREQUISITE SECTION: overflow unpacking NSEC(3) ;; TSIG PSEUDOSECTION: ; %s/%s/promote-read-replica%s/%s/ipv4/reverse/defaultnot supported cipher suiteinvalid argument to Int64Ninvalid argument to Int32Ned25519: invalid signaturechacha20: wrong nonce sizechacha20: counter overflowunterminated quoted stringunexpected . after term %q_html_template_attrescaper_html_template_htmlescapertemplate escaped correctlyinvalid date-time timezoneunknown line break settingfound undefined tag handlewhile parsing a block nodeinvalid character sequencewhile scanning a directiveApplication error %#x (%s)received a stateless reset, StatelessResetToken: %#x, MaxDatagramFrameSize: %dretry_source_connection_idactive_connection_id_limitrecovery:ecn_state_updatedtransport:alpn_informationgithub.com/apernet/quic-go^([^\[]*)\[([^\]]+)\](.*)$certificate is not trustedwrong size for private keyinline table is incompleteEncodeSEG6Srh: No Segmentsgoogle.golang.org/genprotogoogle/protobuf/type.protoinvalid source register %vinvalid target register %villegal hexadecimal numberzero-length heredoc anchorindexes outside (%v,%v,%v)failed to initialize clientHTTP proxy server listeningTCP transparent proxy errorUDP transparent proxy errorunsupported log format: %s must set either tls or acmeunsupported masquerade typefailed to initialize serverfailed to download databasefailed to check for updatesinsufficient security levelCurveP256CurveP384CurveP521cryptobyte: length overflowtls: short read from Rand: hrr ech accept confirmationunsupported string type: %vx509: malformed certificatex509: no valid chains builtcurrent time %s is after %scryptobyte: invalid OID: %vcgo stub: cgo not availableIPv6 field has value >=2^16As4 called on IP zero valueinconsistent process statusos: unsupported signal typeos: process not initializedPageCachePagesLeaked (test)SIGILL: illegal instructionSIGXCPU: cpu limit exceededmakechan: size out of rangeG waiting list is corruptedM structure uses sizeclass runtime·unlock: lock countprogToPointerMask: overflow/gc/cycles/forced:gc-cycles/memory/classes/other:bytes/memory/classes/total:bytesfailed to set sweep barrierwork.nwait was > work.nproc not in stack roots range [allocated pages below zero?address not a stack addressmspan.sweep: bad span stateinvalid profile bucket typeruntime: corrupted polldescruntime: netpollinit failedruntime: asyncPreemptStack=runtime: thread ID overflowstopTheWorld: holding locksgcstopm: not waiting for gcruntime: checkdead: nmidle=runtime: checkdead: find g runlock of unlocked rwmutexsignal received during forksigsend: inconsistent statemakeslice: len out of rangemakeslice: cap out of rangegrowslice: len out of rangestack size not a power of 2timer when must be positive: unexpected return pc for 363797880709171295166015625channel number out of rangefile locking deadlock errorcommunication error on sendnot a XENIX named type filekey was rejected by serviceunknown command %q for %q%s flags_completion+=(%q) Run '%v --help' for usage. ShellCompDirectiveKeepOrderadding path to search pathsno sink found for scheme %qcan't parse %q as a URL: %vfailed to stat key file: %wmust be between 4s and 120sreflect.Value.OverflowFloatafter object key:value pairnet/http: use last responsehttpservecontentkeepheadersinvalid dependent stream IDhttp2: response body closednet/http: request completedhttp: invalid Cookie.DomainDATA frame with stream ID 0frame_rststream_zero_streamframe_pushpromise_pad_shorthttp2: server read frame %vignoring invalid trailer %qinvalid WriteHeader code %vadd DATA on non-open streamnet/http: invalid method %qunsupported protocol schemenet/http: invalid header %suser must agree to CA terms%s: caching certificate: %vloading managed certificateloading renewed certificate/.well-known/acme-challengeno OCSP stapling for %v: %vunsupported record type: %sCan't find such a DNS valuebase64-decoding MAC key: %wauthorization took too longmust be between 2s and 600sdevice name cannot be emptyboringcrypto: not availableinvalid ASN.1 from SignASN1cipher: incorrect length IVreflect.Value.UnsafePointer is not assignable to type reflectlite.Value.Interfacereflectlite.Value.NumMethoddnsmessage.SOAResource{NS: abi.NewName: tag too long: failed to parse IP mask: %qinvalid type for comparisonrange can't iterate over %vmap has no entry for key %qcan't index item of type %scan't slice item of type %sinvalid boolean flag %s: %vflag needs an argument: -%sipv4: udp: fragment droppedSIOCETHTOOL ETHTOOL_GTXCSUMSIOCETHTOOL ETHTOOL_STXCSUM<- Received Initial packet.duplicate pseudo header: %sinvalid HTTP header name %qaccepting stream failed: %whttp3: invalid response: %winvalid argument to Shuffleaccess-control-allow-originhttp chunk length too largeauthorization already validoverflow unpacking anythingunrecognized address familyoverflow packing APL prefixdns: empty question section/v2/object-storage/clusters/v2/regions/%s/availabilityfailed to parse host %s: %wNewInitialProtectionKey: %winvalid P224 point encodinginvalid P256 point encodinginvalid P384 point encodinginvalid P521 point encodinginvalid argument to Uint64Ninvalid argument to Uint32Ninput overflows the modulusextendedGCD: a or m is zero in action started at %s:%d{{break}} outside {{range}}too many declarations in %snot a pointer to struct: %sfloat cannot end with a dottag value must not be emptyinvalid leading UTF-8 octetincomplete UTF-16 characterexpected low surrogate areawhile scanning a simple keycould not find expected ':'while increasing flow levelunknown MPLS Encap Type: %dlwt bpf SetProg: invalid fd{Largest: %d, Smallest: %d}unexpected encryption levelinvalid packet number spaceInvalid cipher suite id: %dtransport:connection_closedinitial_max_stream_data_unirecovery:loss_timer_updatedexpression nests too deeplyerror reading response bodyhkdf: entropy limit reachedHPKE_KEM_X25519_HKDF_SHA256NAF digits must fit in int8expected key but found noneunterminated literal string%v %v is already registeredmismatching message lengthsinvalid Message.Mutable on %v: assigning invalid valuenon-alphanumeric string %#qbuild line with missing keyinvalid load byte length %ded448: bad context length: numbers cannot start with 0gf256: invalid polynomial: ed25519: bad hash algorithmunsupported on this platformunsupported obfuscation typefailed to read client configTCP transparent proxy closedUDP transparent proxy closedfailed to load client configcannot set both tls and acmemasquerade.string.statusCodefailed to read server configfailed to load server configtls: malformed ECHConfigListEd25519 verification failureTLS_CHACHA20_POLY1305_SHA256TLS_RSA_WITH_AES_128_CBC_SHATLS_RSA_WITH_AES_256_CBC_SHAx509: invalid RSA public keyx509: invalid DSA public keyx509: invalid DSA parametersx509: negative serial numberx509: unknown elliptic curvecurrent time %s is before %serrors: target cannot be niloverflow on character value cannot unmarshal DNS message/proc/sys/net/core/somaxconnos: process already finishedos: process already releasedSIGHUP: terminal line hangupSIGWINCH: window size changeGC mark assist wait for workcomparing uncomparable type notewakeup - double wakeup (region exceeds uintptr range/gc/heap/frees-by-size:bytes/gc/heap/tiny/allocs:objects/sched/goroutines:goroutinesgcBgMarkWorker: mode not setmspan.sweep: m is not lockedfound pointer to free objectmheap.freeSpanLocked - span fatal: morestack on gsignal runtime: casgstatus: oldval=gcstopm: negative nmspinningfindrunnable: netpoll with psave on system g not allowednewproc1: newg missing stacknewproc1: new g is not GdeadFixedStack is not power-of-2missing stack in shrinkstack args stack map entries for invalid runtime symbol tableruntime: no module data for mismatched isSending updates[originating from goroutine traceRegion: alloc too large18189894035458564758300781259094947017729282379150390625protocol driver not attachedfile descriptor in bad statedestination address requiredunsupported compression for flag_parsing_disabled=1 ShellCompDirectiveNoFileCompShellCompDirectiveFilterDirssearching for config in path%q is not a valid scheme: %vIgnored key without a value..hysteria-geoloader.dlpart.*https://api.hy2.io/v1/updatecan't unmarshal a nil *Level2006-01-02T15:04:05.000Z0700json: Unmarshal(non-pointer !#$%&()*+-./:;<=>?@[]^_{|}~ unexpected end of JSON inputhttp2: client conn is closedtext/plain; charset=utf-16betext/plain; charset=utf-16leapplication/x-rar-compressedhttp: invalid Cookie.Expiresinvalid header field name %qhttp2: header list too largeforgetting unknown stream idhttp2: Transport received %shttp: request body too largeunsupported protocol versionmissing required Host headerunexpected protocol version general SOCKS server failureTransfer-Encoding: chunked invalid empty Content-Lengthnet/http: invalid trailer %shttp: no Host in request URL%s: renewing certificate: %wprivate key not found for %sconverting '%s' to ASCII: %vmatched certificate in cache/.well-known/acme-challenge/panic: active locking: %v %sencoding old private key: %vSOCKS5 authentication failedmust provide a positive sizebytes: negative Repeat countcrypto/rsa: decryption errorcrypto/aes: counter overflowasn1: string not valid UTF-8big: misuse of expNNWindowednegative n for ProbablyPrimereflect.MakeSlice: len > capreflect: In of non-func typereflect: Key of non-map typednsmessage.MXResource{Pref: dnsmessage.PTRResource{PTR: abi.NewName: name too long: invalid path escape sequence%q is not a defined functionnil pointer evaluating %s.%sinvalid slice index: %d > %dMon Jan _2 15:04:05 MST 2006cannot parse '%s' as int: %s%#x doesn't fit into 62 bitsRemoving 0-RTT queue for %s.Setting up connection failedquic-go/http3 context value multipart: message too largemultipart: boundary is emptymalformed MIME header line: /usr/local/share/mime/globs2access-control-allow-headersaccess-control-allow-methodsinvalid byte in chunk lengthinvalid proxy address %q: %vpresenting for challenge: %wUnsupported DNSKEY Algorithmdns: svcbalpn: empty alpn-id%s/%s/node-pools/%s/nodes/%serror parsing public key: %spacket is too short: %d < %dDetECDSA P-256 SHA2-512 signfips140: verified code+data _html_template_rcdataescaper_html_template_urlnormalizerminutes cannot be greater 59seconds cannot be greater 60expected %s event but got %sincompatible %YAML directivetag handle must not be emptytag handle must end with '!'tag prefix must not be emptywhile parsing a flow mappinginvalid trailing UTF-8 octetfound unknown directive nameyaml: unmarshal errors: %slwt bpf SetProg:invalid modefailed to encode RTA_VIA: %vinvalid To IP %q in range %qexceeded max recursion depthcannot encode %d in %d bytesinvalid Connection ID length, ECT0: %d, ECT1: %d, CE: %dtransport:connection_startedinitial_source_connection_idunknown encryption level: %dhpke: invalid KEM identifierhpke: invalid KEM public keyinvalid P224Element encodinginvalid P256Element encodinginvalid P384Element encodinginvalid P521Element encodingexpected newline but got %#Uinvalid character in commentcan't happen: encode type %sgob: cannot encode nil valueWrong Seq nr %d, expected %dmismatching end group markermissing Go struct field for invalid Message.NewField on failed to parse client config2001::ffff:ffff:ffff:fff1/126TCP transparent proxy connectUDP transparent proxy connectHYSTERIA_DISABLE_UPDATE_CHECKfailed to parse server configfailed to serve traffic statsunknown certificate authorityTLS_RSA_WITH_3DES_EDE_CBC_SHAtls: too many ignored recordstls: invalid outer extensionstls: invalid NextProtos valuetls: invalid server key sharetls: invalid client key sharetls: invalid session encodingtls: unknown session encodingx509: unsupported time formatx509: cannot parse URI %q: %sx509: malformed serial numberx509: cannot parse dnsName %qsyntax error scanning booleanmismatched local address typeunknown IP protocol specifiedsync.WaitGroup.Wait (durable)SIGPIPE: write to broken pipeSIGPWR: power failure restartruntime: mmap: access denied /cpu/classes/idle:cpu-seconds/cpu/classes/user:cpu-seconds/gc/heap/allocs-by-size:bytes/gc/stack/starting-size:bytesgc done but gcphase != _GCoffruntime: p.gcMarkWorkerMode= scanobject of a noscan objectruntime: marking free object addspecial on invalid pointerruntime: summary max pages = runtime: levelShift[level] = doRecordGoroutineProfile gp1=runtime: eventfd failed with runtime: sudog with non-nil centersyscall inconsistent bp entersyscall inconsistent sp gfput: bad status (not Gdead)LockOSThread nesting overflowsemacquire not on the G stackruntime: split stack overflowstring concatenation too longinvalid function symbol tabletrace: reading after shutdownruntime: traceback stuck. pc=tried to trace dead goroutineruntime: impossible type kind45474735088646411895751953125too many open files in systemnumerical result out of rangemachine is not on the networkprotocol family not supportedno XENIX semaphores availableoperation already in progressTime.UnmarshalBinary: no data two_word_flags+=("--%s") must_have_one_noun+=(%q) Eq called on unsupported typeCommand %q is deprecated, %s required flag(s) "%s" not setsearching for config in pathsinvalid type %T for bandwidthPSK must be at least %d byteshttp: '=' not found in cookiewrite on uninitialized bufferhttp2: client conn not usableMon, 02 Jan 2006 15:04:05 GMTapplication/vnd.ms-fontobjecthttp: idle connection timeoutMon, 02 Jan 2006 15:04:05 MSTMon, 02-Jan-2006 15:04:05 MSTinternal error: took too muchframe_pushpromise_zero_streamframe_pushpromise_pad_too_bigmethod %q must be GET or HEADhttp2: client connection lostHTTP/1.1 %d %s: %s%s%d %s: %shttp: panic serving %v: %v %sNon-Authoritative InformationProxy Authentication RequiredUnavailable For Legal Reasonsdup idle pconn %p in freelistcould not save account %v: %vreplaced certificate in cachereloading managed certificate%s: obtaining certificate: %w[%s] Renew: saving assets: %vdeleting certificate file: %vrenewing managed certificatesno URL to issuing certificateHTTP request failed; retryingunrecognized order status: %sQUICConfig.MaxIncomingStreamsio: read/write on closed pipecrypto/aes: invalid key size crypto/des: invalid key size crypto/rc4: invalid key size integer not minimally-encodedzero length OBJECT IDENTIFIER20060102150405.999999999Z0700reflect: Key of non-map type reflect: In of non-func type reflect.Value.OverflowComplex cannot be converted to type reflect: Out of non-func typenil data; no entry for key %qcannot 3-index slice a stringunable to cast negative valueinvalid decode hook signaturecannot parse '%s' as uint: %scannot parse '%s' as bool: %s'%s' expected a map, got '%s'bufio.Scanner: token too longpadding contained in alphabetbind forwarder to interface: invalid ip header version: %dtcp header len is invalid: %dinvalid syntax at line %d: %sSwitching to QUIC version %s.GSO failed when sending to %snumOutStandingFrames negativeChanging connection ID to %s.Setting DF for IPv4 and IPv6.missing QUIC Datagram supportinvalid quarter stream id: %winvalid header field name: %qhttp3: no Host in request URLblake2b: XOF length too largemime: invalid boundary lengthmime: invalid media parameteraccess-control-expose-headersaccess-control-request-methodtoo many compression pointersoverflow unpacking APL prefix/v2/billing/invoices/%d/items%s/%s/users/%s/access-control%s/%s/private-networks/attach%s/%s/private-networks/detach/v2/snapshots/create-from-urlexec: Wait was already calledFIPS 140-3 self-test failed: FIPS 140-3 self-test passed: crypto/rsa: |p - q| too smallpoly1305: unexpected overflowmax expression depth exceeded%s: map must have string keysmissing closing key quote: %sinvalid timezone offset hoursfloat cannot start with a dotcannot assign boolean to a %talias value must not be emptywhile parsing a block mappingwhile parsing a flow sequenceunexpected low surrogate areacannot decode %s `%s` as a %swhile increasing indent leveldid not find the expected '>'did not find expected tag URIwhile scanning a block scalarwhile parsing a quoted scalarwhile scanning a plain scalarlwt bpf decode: lack of bytesBUG: internal error (unknown)descriptor mismatch: %v != %vjava_generate_equals_and_hashtext too long to encode as QRunexpect encryption level: %sRetrySourceConnectionID: %s, ACK doesn't contain ECN marks newly acked packets (%d): %drest when unpacking token: %dtransport:version_informationtransport:parameters_restoredinvalid character class rangeoauth2: cannot parse json: %vstopped after \d+ redirects\zhpke: invalid KEM private keyarray cannot start with commainvalid escaped character %#Utoml: table %s already existsgob: encoder: message too bigfile %q is already registerednon-contiguous repeated fieldmismatching extension lengthsinvalid type: got %v, want %v%T does not implement Marshalfield %v has invalid type: %vblake2s: XOF length too largesyntax error (line %d:%d): %vfailed to parse CA certificatecannot bind both IP and deviceprotocol version not supportedTLS_ECDHE_RSA_WITH_RC4_128_SHAcalled entry on non-entry noderuntime.AddCleanup: ptr is nilx509: invalid ECDSA parametersx509: SAN dNSName is malformedx509: malformed issuerUniqueIDinvalid network interface nametrailing garbage after addresserrSymlink is not user-visibleassignment to entry in nil mapSIGUSR1: user-defined signal 1SIGUSR2: user-defined signal 2SIGVTALRM: virtual alarm clockSIGPROF: profiling alarm clock (types from different scopes)failed to get system page sizeruntime: found in object at *( in prepareForSweep; sweepgen is reachable from finalizer /cpu/classes/total:cpu-seconds/gc/cycles/automatic:gc-cycles/sched/pauses/total/gc:seconds/sync/mutex/wait/total:seconds/godebug/non-default-behavior/runtime: epollctl failed with panic called with nil argumentcheckdead: inconsistent countsrunqputslow: queue is not fullruntime: bad pointer in frame invalid pointer found on stack locals stack map entries for abi mismatch detected between runtime: impossible type kind unsafe.Slice: len out of range227373675443232059478759765625strings: negative Repeat countinappropriate ioctl for devicesocket operation on non-socketprotocol wrong type for socketmemory page has hardware erroryear outside of range [0,9999] must_have_one_flag+=("--%s has_completion_function=1 command_aliases+=(%q) Config File %q Not Found in %qMultiple errors without a key.failed to create tun stack: %wlooking for beginning of valuein exponent of numeric literalMonday, 02-Jan-06 15:04:05 MSThttp: named cookie not presentnegative content size computedstream error: stream ID %d; %vframe_settings_ack_with_lengthillegal window increment valueHEADERS frame with stream ID 0frame_continuation_zero_streamhttp2: decoded hpack field %+vrunning on the wrong goroutinehttp2: panic serving %v: %v %spersistConn was already in LRUremoved certificate from cache[%s] Obtain: saving assets: %vdeleting test key from storagedeleting site asset folder: %vno certificate resources founddecoding lockfile contents: %wOCSP response needs refreshingattempting certificate renewalgetting issuer certificate: %vreading issuer certificate: %vparsing issuer certificate: %vexpected 1 zone, got %d for %sgot error status: HTTP %d: %+vhttps://www.duckdns.org/update/v4/domains/%s/records?page=%dSOCKS5 request failed: %s (%d)crypto/rsa: verification errorcrypto/cipher: counter wrappedGODEBUG: unknown cpu feature "mlkem: invalid encoding lengthcrypto/ecdh: mismatched curvesasn1: cannot marshal nil valuesquare root of negative numberMapIter.Key called before Nextreflect: Elem of invalid type reflect: Out of non-func type reflect: Len of non-array typeruntime: cgroup buffer length Mon Jan 02 15:04:05 -0700 2006cannot parse '%s' as float: %sGot NegotiationReply: %#v %#v build local socket address: %sipv4: tcp: session not found: ipv6: tcp: session not found: package to include not found: package to exclude not found: negative packetBuffer refCountpacketBuffer refCount not zerounexpected PATH_RESPONSE frametoo many gaps in received dataquic: ConnContext returned nilError sending Retry packet: %sduplicate QPACK encoder streamduplicate QPACK decoder streamhttp3: reserved frame type: %dmultipart/form-data; boundary=missing validateFirstLine functext/javascript; charset=utf-8mime: duplicate parameter nameaccess-control-request-headerschunked line ends with bare LFurn:ietf:params:acme:error:dnsurn:ietf:params:acme:error:tlstrailing data in OCSP responseunsupported critical extensiondomain must be fully qualifiedoverflow unpacking APL addressendpoint missing DeviceAuthURLoauth2: cannot auth device: %vfips: invalid self-test name: sync: inconsistent mutex statesync: unlock of unlocked mutexfips140: verification mismatchsubtle.XORBytes: dst too shortunterminated raw quoted string{{continue}} outside {{range}}transform: short source buffer(\\)?(\$)(\{?([A-Z0-9_]+)?\}?)line `%s` doesn't match format%s: unknown type for string %Tfloat cannot be assigned to %sunknown anchor '%s' referencedtag handle must start with '!'anchor value must not be emptyfound duplicate %TAG directivewhile parsing a %TAG directivedid not find URI escaped octetwhile scanning a quoted scalarfound unexpected end of streamfound unknown escape characterinvalid From IP %q in range %qApplication error %#x (%s): %soauth2: cannot fetch token: %v[ERR] %s %s request failed: %vEncapsulate is not implementedKey() is not supported on a %smissing keyKind string mappingunaddressable value of type %stype %s has no exported fieldsattempt to register empty nameoverlapping ranges: %v with %vtype mismatch: got %T, want %vunquoted key %q must be quotedinvalid character %q in stringTCP transparent proxy listeningUDP transparent proxy listeninga certificate cache is requiredtls: no certificates configuredbad certificate status responseencrypted client hello requiredtls: unsupported public key: %TTLS_RSA_WITH_AES_128_CBC_SHA256TLS_RSA_WITH_AES_128_GCM_SHA256TLS_RSA_WITH_AES_256_GCM_SHA384failed to parse certificate: %wTLS: sequence number wraparoundtls: invalid inner client helloCLIENT_HANDSHAKE_TRAFFIC_SECRETSERVER_HANDSHAKE_TRAFFIC_SECRETtls: failed to sign handshake: x509: malformed GeneralizedTimecrypto/ecdh: invalid public keyx509: invalid basic constraintsx509: malformed tbs certificatex509: malformed subjectUniqueIDinvalid elliptic key public keyx509: certificate is valid for %d chains with invalid policiesencoding/hex: invalid byte: %#Ufmt: unknown base; can't happeninvalid network interface indexsotypeToNet unknown socket typezone must be a non-empty stringpattern contains path separatorslice bounds out of range [:%x]slice bounds out of range [%x:]SIGSEGV: segmentation violationinternal error - misuse of itab) not in usable address space: runtime: cannot allocate memorycheckmark found unmarked object/memory/classes/heap/free:bytes/memory/classes/os-stacks:bytespacer: sweep done at heap size non in-use span in unswept listcasgstatus: bad incoming valuesresetspinning: not a spinning mruntime: profBuf already closedfatal: bad g in signal handler signal_recv: inconsistent stateruntime: split stack overflow: ...additional frames elided... unsafe.String: len out of range11368683772161602973937988281255684341886080801486968994140625.lib section in a.out corruptedcannot assign requested addressmalformed time zone informationtime: missing unit in duration # ex: ts=4 sw=4 et filetype=sh ShellCompDirectiveFilterFileExtdisable completion descriptionstrying to resolve absolute pathOnly GET and PUT are supported.address family not IPv4 or IPv6failed to bind to interface: %wjson: invalid number literal %qin literal true (expecting 'r')in literal true (expecting 'u')in literal true (expecting 'e')in literal null (expecting 'u')in literal null (expecting 'l')expected colon after object keymultipart/byteranges; boundary=http2: connection error: %v: %vframe_headers_prio_weight_shortPRIORITY frame with stream ID 0too many authentication methodsRequested Range Not SatisfiableRequest Header Fields Too LargeNetwork Authentication Requiredtoo many transfer encodings: %qnet/http: TLS handshake timeoutunable to acquire lock '%s': %vissuer %d (%s) is not a Revokerno certificates found in bundleloaded certificate from storageforcefully renewing certificateexpected one record, got %d: %vunexpected status code: HTTP %dJSON-decoding response body: %w{"e":"%s","kty":"RSA","n":"%s"}UDP not supported by HTTP proxyBindIP4 must be an IPv4 addressBindIP6 must be an IPv6 addressapplication/json; charset=utf-8ecdsa: signature did not verifycrypto/rsa: prime factor is nilcrypto/aes: len(dst) < len(src) cannot produce iter.Seq[Value]reflect: Len of non-array type reflect.MakeSlice: negative lenreflect.MakeSlice: negative capreflect: NumIn of non-func typeinvalid return from write: got missing argument for comparisonrange over send-only channel %vvalue has type %s; should be %sMon, 02 Jan 2006 15:04:05 -0700Sent NegotiationReply: %#v %#v unsupported virtio GSO type: %dGeoIP country code %s not foundconnection ID manager is closedsending path probe packet to %sreceived a HANDSHAKE_DONE frameunexpected encryption level: %scannot use GSO with a basicConncannot use ECN with a basicConnconnection in graceful shutdownhttp3: ConnContext returned nilhttp3: parsing frame failed: %wconnection operation prohibitedaccount status is not valid: %sgetting authorization at %s: %wdns: reading random id failed: overflow unpacking domain namesunrecognized APL address familydns: svcbalpn: alpn-id too longmergeRuneSets odd length []runeecdsa: reseed interval exceededed25519: bad signature length: unterminated character constantline `%s` has an unset variableinvalid timezone offset minutescouldn't parse octal number: %wcannot store a table in a slice2006-1-2T15:4:5.999999999Z07:002006-1-2t15:4:5.999999999Z07:00found duplicate %YAML directiveincomplete UTF-8 octet sequencewhile scanning a %TAG directivefield %v contains invalid UTF-8cannot reset invalid %v messageno_standard_descriptor_accessorclient sent a preferred_address Ignoring all packets below %d.Canceling loss detection timer.session ticket keys unavailablenot implemented on linux/mipslettl=%d src=%v dst=%v ifindex=%dsettings_max_field_section_sizereflect.Value has no flag fieldhpke: invalid KEM shared secretheredoc doesn't contain newlinetabwriter: panic during %s (%v)windows new line should be \r\ncannot call BytesRange with niltoml: key %s is already definedencodeReflectValue: nil elementGot short response from netlinkcannot parse reserved wire typeinvalid Go type %v for field %v%T does not implement Unmarshalexpected 2 or 3 columns; got %ded25519: bad context length: %vx: %v y: %v z: %v ta: %v tb: %vfailed to initialize logger: %s https://acme.zerossl.com/v2/DV90unsupported protocol scheme "%s"TLS_ECDHE_ECDSA_WITH_RC4_128_SHAchacha20poly1305: bad key lengthtls: unknown Renegotiation valuetls: NextProtos values too largetls: Start called more than oncetls: failed to parse private keytls13: label or context too long/etc/pki/tls/certs/ca-bundle.crtx509: unsupported elliptic curvex509: invalid constraint value: x509: malformed subjectPublicKeyx509: invalid private key lengthx509: cannot parse rfc822Name %qx509: ECDSA verification failurex509: unknown extended key usageinvalid policy object identifierx509: unknown SignatureAlgorithmgo package net: addrLookupOrder(go package net: hostLookupOrder(unexpected character, want colonpidStatus called in invalid modeslice bounds out of range [::%x]slice bounds out of range [:%x:]slice bounds out of range [%x::]SIGFPE: floating-point exceptionSIGTTOU: background write to tty (types from different packages)end outside usable address spaceruntime: fixalloc size too largeinvalid limiter event type foundscanstack: goroutine not stoppedscavenger state is already wiredsweep increased allocation countremovespecial on invalid pointergetWeakHandle on invalid pointerruntime: root level max pages = _cgo_pthread_key_created missingruntime: sudog with non-nil elemruntime: sudog with non-nil nextruntime: sudog with non-nil prevruntime: mcall function returnednon-Go code disabled sigaltstackruntime: newstack called from g=runtime: stack split at bad timepanic while printing panic value28421709430404007434844970703125resource temporarily unavailablenumerical argument out of domainsoftware caused connection abort: day-of-year does not match day flags_with_completion+=(%q) __%s_handle_subdirs_in_dir_flag must_have_one_flag+=("-%s") failed to create unix socket: %wpeer attempted to open stream %din literal false (expecting 'a')in literal false (expecting 'l')in literal false (expecting 's')in literal false (expecting 'e')invalid range: failed to overlapframe_windowupdate_zero_inc_connhttp2: server ignoring frame: %vread limit of %d bytes exhaustedwaiting on internal rate limitercertificate renewed successfullycould not determine the zone: %wfell back to default certificate[ERROR] key auth HTTP server: %vone usage of each socket addresspanic: http solver server: %v %spanic: certificate worker: %v %sapi returned unexpected responseecdsa: Sign called with nil optsecdsa: internal error: r is zeroecdsa: internal error: s is zeroed25519: bad public key length: crypto/rsa: public key missing Ncrypto/rsa: prime factor is <= 1sync: Unlock of unlocked RWMutexsync: negative WaitGroup countercrypto/des: input not full blockcrypto/aes: input not full blockcrypto/cipher: counter decreased" not supported for cpu option "ABCDEFGHIJKLMNOPQRSTUVWXYZ234567mlkem: invalid ciphertext lengthcrypto/ecdh: invalid private keyinteger is not minimally encodedcannot represent time as UTCTimereflect.MapOf: invalid key type MapIter.Value called before Nextreflect: NumIn of non-func type reflect.Value.Grow: negative lenreflect: NumOut of non-func typednsmessage.CNAMEResource{CNAME: dnsmessage.AResource{A: [4]byte{use of closed network connectioninitial table capacity too largeunable to parse %s as net.IPMaskbufio: invalid use of UnreadBytebufio: invalid use of UnreadRunebufio: tried to fill full buffercan't determine encryption levelinvalid frame for send stream %dblake2b: write to XOF after readmime: invalid boundary characterunexpected multi-line response: mime: expected token after slashaccess-control-allow-credentials ; DNSSEC ALGORITHM UNDERSTOOD: string exceeded 255 bytes in txtsetsockopt(TCP_FASTOPEN_CONNECT)unable to assemble crypto framescrypto/rsa: invalid CRT exponentinput overflows the modulus sizesubtle.XORBytes: invalid overlapchacha20: invalid buffer overlapmalformed character constant: %sreadPythonMultilines: parsing %qValue %d for key %s out of rangedate time should have a timezonecouldn't parse binary number: %wwhile parsing a block collectiondid not find expected ',' or ']'did not find expected ',' or '}'found incompatible YAML documentincomplete UTF-16 surrogate pairwhile scanning a %YAML directivedid not find expected whitespacemultiple ,inline maps in struct invalid packet number length: %dinvalid connection ID length: %dnon-sequential packet number use lost packet %d (time threshold)unexpected read encryption levelEventReceivedTransportParametersEventRestoredTransportParameterssettings_enable_connect_protocol0123456789ABCDEFGHIJKLMNOPQRSTUVCounterClockwiseContourIntegral;expected: IDENT | STRING got: %sunimplemented Value for type: %sbasic string not terminated by "bootstrap type already present: variable length integer overflowgoogle/protobuf/field_mask.protogoogle/protobuf/descriptor.protoexceeded maximum recursion depthweak message %v is not linked in%v already implements proto.Enumfield %v has invalid nil pointerinvalid quoted key in build linebuild line missing '=' after keyunquoted value %q must be quotedsha3: write to sponge after readunexpected null character (0x00)could not parse value for %v: %qgf256: invalid check byte lengthSigEd25519 no Ed25519 collisionsblake2s: write to XOF after readinvalid escape code %q in stringuse this URI to share your serverapplication/x-www-form-urlencodedbytes.Buffer.Grow: negative counttls: malformed outer client hellotls: failed to write to key log: tls: invalid server finished hashtls: invalid client finished hashtls: unexpected ServerKeyExchangetls: unknown public key algorithmx509: invalid RSA public exponentx509: SAN rfc822Name is malformedx509: invalid extended key usagesgo package net: confVal.netCgo = slice bounds out of range [%x:%y]SIGCHLD: child status has changedSIGTTIN: background read from ttySIGXFSZ: file size limit exceededbase outside usable address spaceruntime: memory allocated by OS [misrounded allocation in sysAlloc/cpu/classes/gc/pause:cpu-seconds/cpu/classes/gc/total:cpu-seconds/gc/limiter/last-enabled:gc-cycle/memory/classes/heap/stacks:bytes/memory/classes/heap/unused:bytes/sched/pauses/stopping/gc:seconds/sched/pauses/total/other:secondsmin must be a non-zero power of 2runtime: failed mSpanList.insert runtime: epollcreate failed with runtime: morestack on g0, stack [runtime: castogscanstatus oldval=stoplockedm: inconsistent lockingfindrunnable: negative nmspinningfreeing stack not in a stack spanstackalloc not on scheduler stackruntime: goroutine stack exceeds runtime: text offset out of rangetimer period must be non-negativetoo many concurrent timer firingsruntime: name offset out of rangeruntime: type offset out of range142108547152020037174224853515625710542735760100185871124267578125too many levels of symbolic linksCalled Execute() on a nil Commandattempting to read in config fileno encoder registered for name %qQUICConfig.MaxStreamReceiveWindowhttp: invalid or unsafe file pathpseudo header field after regularhttp2: recursive push not allowedhttp: invalid Read on closed Bodynet/http: skip alternate protocolhttp: CloseIdleConnections calledhttp: error reading directory: %vinvalid header field value for %qpad size larger than data payloadframe_pushpromise_promiseid_shorthttp2: invalid pseudo headers: %vtimeout waiting for PING responsehttp: multiple registrations for invalid concurrent Body.Read callconnection not allowed by rulesetinvalid username/password versionunsupported transfer encoding: %qhijacked connection copy completecertificate obtained successfullyencoding certificate metadata: %vdecoding certificate metadata: %vno certificate available for '%s'cleaning up embedded provider: %vchecking authorization status: %wapplication/pem-certificate-chainno IPv4 or IPv6 address availablecrypto: requested hash function #bytes.Reader.Seek: invalid whencesync: RUnlock of unlocked RWMutexcrypto/des: output not full blockcrypto/aes: output not full blockGODEBUG: no value specified for "indefinite length found (not DER)struct contains unexported fieldsskip everything and stop the walkreflect: slice index out of rangereflect: NumOut of non-func type of method on nil interface valuereflect: Field index out of rangereflect: array index out of rangereflect.Value.Equal: invalid Kind to pointer to array with length too many Answers to pack (>65535)dnsmessage.SRVResource{Priority: dnsmessage.UnknownResource{Type: waiting for unsupported file typeunaligned 64-bit atomic operationconcurrent map read and map writetable must have positive capacityflag accessed but not defined: %sunknown shorthand flag: %q in -%sflag needs an argument: %q in -%s%s must be formatted as key=valuecannot index slice/array with nil'%s' expected type '%s', got '%s'decoder not found for this formatinvalid value %q for flag -%s: %vNo compatible QUIC version found.Closing connection with error: %ssending path probe packet from %ssendQueue.Send would have blockedGOAWAY frame: inconsistent lengthinvalid request pseudo header: %sinvalid TE header field value: %qpeer sent an unexpected frame: %Tempty hex number for chunk lengthsolving challenges: %w (order=%s)unsupported issuer hash algorithmdns: bad MatchingType or Selectoroverflow packing uint64 as uint48overflow unpacking signed messageoauth2: Transport's Source is niled25519: bad private key length: SigEd25519 no Ed25519 collisionsSigEd25519 no Ed25519 collisionssha3: invalid hash state functionkey-value delimiter not found: %sinvalid timezone offset charactercouldn't parse decimal number: %wnumber cannot end with underscoreanchor '%s' value contains itselfexpected nothing after STREAM-ENDwhile scanning for the next tokeninvalid zero-length connection IDreceived ACK for an unsent packetunexpected write encryption levelerror creating new AES cipher: %srecovery:congestion_state_updatedleafCounts[maxBits][maxBits] != nregexp: unhandled case in compileoauth2: cannot parse response: %vGODEBUG sys/cpu: can not enable "scalar has high bit set illegallyslice offset larger than int (%d)no support for proto1 weak fieldsinvalid SetUnknown on nil Messagebuf must be of size PublicKeySizecould not format value for %v: %vno support for proto1 MessageSetsfailed to serve masquerade HTTP(S)expected an RSA public key, got %TTLS_ECDHE_RSA_WITH_AES_128_CBC_SHATLS_ECDHE_RSA_WITH_AES_256_CBC_SHAconnection doesn't support Ed25519tls: malformed key_share extensionTLS 1.3, server CertificateVerifyTLS 1.3, client CertificateVerify/etc/ssl/certs/ca-certificates.crtadding nil Certificate to CertPoolx509: unknown public key algorithmx509: invalid certificate policies%s %q is excluded by constraint %qx509: Ed25519 verification failurex509: unhandled critical extensionslice bounds out of range [:%x:%y]slice bounds out of range [%x:%y:]SIGURG: urgent condition on socketruntime: standard file descriptor out of memory allocating allArenas... too many potential issues ... /memory/classes/heap/objects:bytesruntime.SetFinalizer: cannot pass too many pages allocated in chunk?mspan.ensureSwept: m is not lockedruntime: netpollBreak write failedforEachP: sched.safePointWait != 0schedule: spinning with local workentersyscallblock inconsistent bp entersyscallblock inconsistent sp runtime: g is running but p is notinvalid timer channel: no capacity3552713678800500929355621337890625too many references: cannot splice: day-of-year does not match monthcobra_annotation_flag_set_by_cobraCommand can't be a child of itselffailed to create tun interface: %win \u hexadecimal character escapeexpected comma after array elementtimeout waiting for client prefacehttp2: aborting request body writehttp: connection has been hijackedhttp: persistConn.readLoop exitinghttp: read on closed response bodystream error: stream ID %d; %v; %vframe_settings_window_size_too_bigframe_windowupdate_zero_inc_streamnewWriterAndRequestNoBody(%+v): %v%s matches the same requests as %shttp: MultipartReader called twicehttp: invalid Content-Length of %qBaseContext returned a nil contextunsupported authentication method looking up account with server: %vDo you agree to the terms? (y/n): certificate should not be obtainedrenewing and reloading certificatelooking up info for HTTP challengemaxEvents cannot be less than zerochecking DNS propagation of %q: %wfetching new nonce from server: %wserver rejected upload request: %sbytes: Join output length overflowcrypto/rsa: missing public moduluscrypto/des: invalid buffer overlapcrypto/aes: invalid buffer overlapcrypto/rc4: invalid buffer overlapmlkem: invalid polynomial encodinginvalid padding bits in BIT STRINGreflect: Method index out of rangereflect: ChanDir of non-chan type reflect: Field of non-struct type reflect: Field index out of boundsreflect.FuncOf: too many argumentsreflect.StructOf: duplicate field " is anonymous but has PkgPath setreflect: string index out of rangereflect: recv on send-only channelreflect: send on recv-only channelreflect.Value.Grow: slice overflowconcurrent map clone and map writeFlag --%s has been deprecated, %s can't evaluate field %s in type %scan't handle %s for arg of type %svalue is nil; should be of type %scannot squash non-struct type '%s'flag provided but not defined: -%sillegal base64 data at input byte set socket option: SO_NONBLOCK: %sparsing socket control message: %sError sending CONNECTION_CLOSE: %sRestoring Transport Parameters: %sProcessed Transport Parameters: %smissing retry_source_connection_idListening for %s connections on %sheader field is not lower-case: %sinvalid response pseudo header: %sDATA frame received after trailersinvalid Upgrade request header: %qempty NSEC(3) block in type bitmaprepeated SVCB keys are not allowedsigner name doesn't match key name%s/%s/delete-with-linked-resourcesexecutable file not found in $PATHnon-200 status-code=%d for host %scrypto/rsa: public modulus is evenextendedGCD: both a and m are evenchacha20: wrong HChaCha20 key size%s: unsupported type to struct: %s%s: %s asked for 'key', impossiblehandleValue not implemented for %sdid not find expected node contentinvalid length of a UTF-8 sequencecontrol characters are not allowedvalue doesn't fit into 62 bits: %doriginal_destination_connection_idinitial_max_stream_data_bidi_localillegal base32 data at input byte invalid nested repetition operatorinvalid or unsupported Perl syntaxGODEBUG sys/cpu: can not disable "EncodeSEG6Encap: No Segment in srhbad tag in lazy extension decodingmismatching field: got %v, want %vinvalid quoted value in build lineseed must be of length KeySeedSizess must be of length SharedKeySizept must be of length PlaintextSizebuf must be of size PrivateKeySizetraffic stats server up and runningunsupported signature algorithm: %vTLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHAtls: too many non-advancing recordstls: server selected an invalid PSKtls: invalid or missing PSK bindersx509: malformed extension OID fieldx509: wrong Ed25519 public key sizex509: invalid authority info accessx509: failed to marshal curve OID: encoding/hex: odd length hex stringunsigned integer overflow on token os/signal: Notify using nil channelpersistentalloc: align is too large/memory/classes/heap/released:bytesgreyobject: obj not pointer-alignedmismatched begin/end of activeSweepmheap.freeSpanLocked - invalid freefailed to get or create weak handleattempt to clear non-empty span setruntime: close polldesc w/o unblockruntime: inconsistent read deadlinefindrunnable: netpoll with spinningpidleput: P has non-empty run queuefake timer executing with no bubbletraceback did not unwind completely1776356839400250464677810668945312588817841970012523233890533447265625ryuFtoaFixed32 called with prec > 9strings.Reader.Seek: invalid whencenetwork dropped connection on resettransport endpoint is not connected2006-01-02T15:04:05.999999999Z07:00non-positive interval for NewTicker__%[1]s_handle_go_custom_completioncobra_annotation_mutually_exclusivemissing EncodeTime in EncoderConfigfailed to stat certificate file: %whttp: server closed idle connectionCONTINUATION frame with stream ID 0Prohibited TLS 1.2 Cipher Suite: %xhttp2: server: client %v said hellohttp2: server processing setting %vWrite called after Handler finishedcertificate for '%s' is not managedpresenting with embedded solver: %vdirectory missing newNonce endpointurn:ietf:params:acme:error:badNonceserver rejected our nonce; retryingtraffic logger requested disconnectecdsa: invalid signature: r is zeroecdsa: invalid signature: s is zerocrypto/rsa: invalid PSS salt lengthcrypto/md5: invalid hash state sizesuperfluous leading zeros in length'_' must separate successive digits" is unexported but missing PkgPathreflect.MakeSlice of non-slice typetoo many Questions to pack (>65535)file type does not support deadlineinvalid argument %q for %q flag: %vexpected unsigned integer; found %snon-comparable types %s: %v, %s: %v%s: unsupported type for squash: %sGot Reply: %#v %#v %#v %#v %#v %#v set socket option: SO_REUSEADDR: %sip header version: %d, GSO type: %dclose called for canceled stream %dinvalid frame for receive stream %dcrypto/blake2b: cannot marshal MACsform-data; name="%s"; filename="%s"mime: bogus characters after %%: %qhpack: invalid Huffman-encoded datadynamic table size update too largeoverflow unpacking uint64 as uint48dns: TSIG not last RR in additionalP224 point is the point at infinityP256 point is the point at infinityP384 point is the point at infinityP521 point is the point at infinitycrypto/rsa: invalid CRT coefficientcrypto/rsa: public exponent is evenbigmod: modulus is smaller than natbigmod: modulus for Exp must be oddchacha20: output smaller than inputsha3: invalid hash state identifierrange can only initialize variablestransform: short destination buffer%s: unknown kind to decode into: %s%s: not an object type for map (%T)nanoseconds need at least one digitnumber cannot start with underscoretoml: cannot encode a nil interfaceshould not be called with empty keynumber %f does not fit in a float32must set the input source only oncedid not find expected '-' indicatorfound extremely long version numberfound unexpected document indicatorWrong sender portid %d, expected %dtimeout: no recent network activity %s &wire.NewTokenFrame{Token: %#x}%d exceeds the maximum stream countclient sent a stateless_reset_tokendidn't expect ECN to be unsupportedunexpected multiple session tickets0-RTT not allowed. Rejecting 0-RTT.unknown session ticket revision: %dinitial_max_stream_data_bidi_remotemax-age=31536000; includesubdomainsflate: corrupt input before offset %s %s giving up after %d attempt(s)basic strings cannot have new linesfile %q has a name conflict over %vfound wrong type: got %v, want enumstring field contains invalid UTF-8%v already implements proto.Messagect must be of length CiphertextSizebuf must be of length PublicKeySizeunimplemented HCLToken for type: %scrypto/blake2s: cannot marshal MACsdelimiters may only be "{}" or "<>"expected an ECDSA public key, got %TTLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHATLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHAtls: keys must have at least one keyunsupported SSLv2 handshake receivedtls: server did not send a key sharetls: server selected unoffered curvex509: zero or negative DSA parameterx509: invalid CRL distribution pointx509: invalid subject key identifierx509: malformed algorithm identifierx509: invalid X25519 private key: %vOIDFromInts(%v) unexpected error: %vx509: serial number must be positivesyntax error scanning complex numberlfstack node allocated from the heap) is larger than maximum page size (objects with pointers must be zeroedruntime: invalid typeBitsBulkBarrieruncaching span but s.allocCount == 0Scan trace for cleanup/finalizer on /memory/classes/metadata/other:bytes/sched/pauses/stopping/other:secondsuser arena span is on the wrong listruntime: marked free object in span runtime: unblock on closing polldescruntime: inconsistent write deadlineruntime: netpoll: eventfd ready for runtime: sudog with non-nil waitlinkruntime: mcall called on m->g0 stackfatal: recursive switchToCrashStack startm: P required for spinning=true) is not Grunnable or Gscanrunnable updateMaxProcsGoroutine: phase errorruntime: bad notifyList size - sync=signal arrived during cgo execution accessed data from freed user arena runtime: wrong goroutine in newstackruntime: invalid pc-encoded table f=444089209850062616169452667236328125ryuFtoaFixed64 called with prec > 180123456789abcdefghijklmnopqrstuvwxyzstrings.Builder.Grow: negative countstrings: Join output length overflowaccessing a corrupted shared libraryTime.UnmarshalBinary: invalid length__%s_handle_filename_extension_flag Completion ended with directive: %s could not discover absolute path: %w%s is not supported on this platforminvalid semicolon separator in queryjson: encoding error for type %q: %qhttp: no Location header in responsehttp: unexpected EOF reading trailerhttp: invalid byte %q in Cookie.Path LastStreamID=%v ErrCode=%v Debug=%qhttp2: server rejecting conn: %v, %sHeader called after Handler finishedRoundTrip retrying after failure: %vno acceptable authentication methodsHijack failed on protocol switch: %v%s: insecure CA URL (HTTPS required)unexpected response code '%s' for %s%s: could not make path relative: %vcustom certificate selection resultsmaintaining newly-loaded certificateusing externally-managed certificatepanic: tls-alpn solver server: %v %shttps://api.cloudflare.com/client/v4computing account JWK thumbprint: %vserver rejected download request: %sbytes: Repeat output length overflowbytes.Reader.ReadAt: negative offsetbytes.Reader.Seek: negative positioncrypto/rsa: missing private exponentcrypto/cipher: input not full blockscrypto/sha1: invalid hash state sizecrypto/rand: argument to Int is <= 0hkdf: requested key length too largeIA5String contains invalid charactermethod ABI and value ABI don't alignreflect.Value.Equal: values of type reflect: NumField of non-struct typeexceeded maximum template depth (%v)%s is not a method but has argumentsinternal error: associate not commonunable to cast %#v of type %T to intcannot parse '%s', %d overflows uintcannot parse '%s', %f overflows uintinvalid boolean value %q for -%s: %vGot NegotiationRequest: %#v %#v %#v Sent Reply: %#v %#v %#v %#v %#v %#v build destination socket address: %sDestroying connection with error: %sserver disabled connection migrationDropping Version Negotiation packet.Increased send buffer size to %d kiBurn:ietf:params:qlog:events:http3-12reading stream type on stream failedcould not read quarter stream id: %wmime: SetBoundary called after writemalformed MIME header initial line: waiting for solver before continuinginitiating challenge with server: %wPrivate-key-format: v1.3 Algorithm: address and mask lengths don't matchoverflowing unpacking signed message%s/%s/node-pools/%s/nodes/%s/recycledns query failed with %s for host %spacket with long header is too smallECDSA P-256 SHA2-512 sign and verifyinvalid ChaCha8 Read buffer encodingchacha20: wrong HChaCha20 nonce sizeinvalid pattern syntax (+ after -): %s: cannot decode into interface: %Ttoml: cannot encode value of type %smust set the output target only onceunknown problem parsing YAML contentdocument contains excessive aliasingdid not find expected did not find expected version numberlabel must begin with interface nameinvalid IPRanges during Ranges mergecannot merge into invalid %v messagestream data overflows maximum offsetmissing initial_source_connection_idInstalled 0-RTT Read keys (using %s)Installed 1-RTT Read keys (using %s)[DEBUG] %s: retrying in %s (%d left)HPKE_KEM_X25519_KYBER768_HKDF_SHA256edwards25519: invalid point encodingrange length is larger than capacityError converting to netlink sockaddrgoogle/protobuf/source_context.proto%v: MessageSet with no unknown fieldbuf must be of length PrivateKeySizeinvalid characters in heredoc anchored25519: bad context length: %v > %vinvalid hex escape code %q in stringTUN is not supported on this platformmust specify one and only one addressfailed to parse client CA certificatemasquerade HTTP server up and runningcrypto: Size of unknown hash functiontls: unsupported certificate key (%T)TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256tls: failed to verify certificate: %sx509: malformed extension value fieldx509: RSA key missing NULL parametersx509: invalid CRL distribution pointsx509: unsupported private key versionx509: invalid Ed25519 private key: %v%d chains with incompatible key usagex509: unsupported public key type: %Teach group must have 4 or less digitsruntime: allocation size out of range) is smaller than minimum page size (/cpu/classes/gc/mark/idle:cpu-secondssetprofilebucket: profile already setfailed to reserve page summary memory_cgo_notify_runtime_init_done missingfatal: concurrent switchToCrashStack startTheWorld: inconsistent mp->nextpCouldn't put Gs into empty local runqruntime: unexpected SPWRITE function all goroutines are asleep - deadlock!semaphore wake of synctest goroutine 2220446049250313080847263336181640625value too large for defined data typecannot exec a shared library directlyoperation not possible due to RF-killtimezone hour outside of range [0,23]QUICConfig.InitialStreamReceiveWindowQUICConfig.MaxConnectionReceiveWindowcannot create context from nil parentbytes.Buffer: truncation out of rangehttp: invalid byte %q in Cookie.Valueunexpected CONTINUATION for stream %dhttp2: unencrypted HTTP/2 not enabledhttp2: Transport sending health checkhttp2: Transport health check successRoundTrip on uninitialized ClientConnhttp2: server encoding header %q = %qhttp: TLS handshake error from %s: %vcould not save account to storage: %vaccount pre-registration callback: %vdone waiting on internal rate limiterunable to parse PEM certificate chaincertificate already exists in storagecould not get certificate from issuerserved key authentication certificatedefault certificate selection resultsrenewing certificate on-demand failedpanic: tls-alpn solver handler: %v %ssubtle: slices have different lengthscipher: message authentication failedcrypto/cipher: invalid buffer overlapcrypto/cipher: incorrect GCM tag sizegodebug: unexpected IncNonDefault of out does not point to an integer typecrypto/ecdh: invalid private key sizeexplicitly tagged member didn't matchreflect: Bits of non-arithmetic Type reflect: NumField of non-struct type reflect: IsVariadic of non-func type reflect: OverflowInt of non-int type needKeyUpdate called on non-key type reflect: funcLayout of non-func type reflect.Value.Bytes of non-byte slicereflect.Value.Bytes of non-byte arrayreflect.Value.Bytes of non-rune slicemethod ABI and value ABI do not alignreflect.Value.Convert: value of type too many Authorities to pack (>65535)too many Additionals to pack (>65535)dnsmessage.TXTResource{TXT: []string{runtime: cgroup invalid buffer length%q is an incomplete or empty templatedereference of nil pointer of type %scannot index slice/array with type %sunable to cast %#v of type %T to Timeunable to cast %#v of type %T to boolunable to cast %#v of type %T to uintparse error on line %d, column %d: %vvariable value type must be a pointerSent NegotiationRequest: %#v %#v %#v Got Request: %#v %#v %#v %#v %#v %#v set socket option: IP_TRANSPARENT: %sgVisor is not supported in this fork.allocator Put() incorrect buffer sizeError sending INVALID_TOKEN error: %sError sending Version Negotiation: %sTemporary error reading from conn: %wuse of http3.Server without TLSConfigaccepting bidirectional stream failedinvalid header field value for %s: %qopening the control stream failed: %winvalid Connection request header: %qwaiting for solver %T to be ready: %wurn:ietf:params:acme:error:connectionNSEC(3) block too long in type bitmapdns: svcbalpn: alpn array overflowing/v2/object-storage/%s/regenerate-keysexec: StdinPipe after process startedencountered unexpected frame type: %dbigmod: internal error: shrinking natcrypto/rsa: unsupported hash functionbisect.Hash: unexpected argument typecomment ends before closing delimiterunrecognized character in action: %#Ucouldn't parse hexadecimal number: %wcannot have underscore after exponentcannot store TOML string into a Go %sexpected DOCUMENT-START or STREAM-ENDcannot parse invalid wire-format data%d not allowed at encryption level %sall ECN testing packets declared lostInstalled 0-RTT Write keys (using %s)Installed 1-RTT Write keys (using %s)unexpected write encryption level: %sPeer confirmed key update to phase %d[ERR] error reading response body: %vinvalid character at start of key: %cliteral strings cannot have new linestype not registered for interface: %sgob NewTypeObject can't handle type: GOLANG_PROTOBUF_REGISTRATION_CONFLICTdilithium: cannot sign hashed messageshow QR code for server config sharingno certificate matches the pinned hashfailed to send ZeroSSL EAB request: %wmasquerade HTTPS server up and runningtls: invalid ClientKeyExchange messagetls: invalid ServerKeyExchange messageexpected an Ed25519 public key, got %Tinternal error: unknown signature typetls: server selected unsupported grouptls: unsupported signing key type (%T)tls: early_data without pre_shared_keytls: client sent unexpected early datatls: failed to sign ECDHE parameters: tls: server selected unsupported curvetls: missing ServerKeyExchange messagetls: internal error: unsupported curvex509: invalid subject alternative namex509: invalid authority key identifierx509: empty name constraints extensionx509: failed to parse EC private key: x509: cannot validate certificate for IPv4 field has octet with leading zerosyscall: readInt with unsupported sizeindex out of range [%x] with length %ymakechan: invalid channel element typeunreachable method called. linker bug?gcBgMarkWorker: blackening not enabledcannot read stack of running goroutineruntime: blocked read on free polldescruntime: sudog with non-false isSelectarg size to reflect.call more than 1GBv could not fit in traceBytesPerNumber1110223024625156540423631668090820312555511151231257827021181583404541015625strings.Reader.ReadAt: negative offsetstrings.Reader.Seek: negative positionstrings: Repeat output length overflowcan not access a needed shared librarynon-positive interval for Ticker.Resettime: missing Location in call to Date%s is not a valid port number or rangeafter decimal point in numeric literalfailed to parse Location header %q: %vhttp2: server connection from %v on %phttp: Accept error: %v; retrying in %vregistering account %v with server: %wTLS handshake aborted by event handlerhandshake aborted by event handler: %wsuccessfully stapled new OCSP responsepanic: ring buffer rate limiter: %v %sunable to find the main domain for: %scrypto/sha256: invalid hash state sizeecdsa: public key does not match curveinternal error: unknown string type %dasn1: Unmarshal recipient value is nilreflect.typeptrdata: unexpected type, reflect: close of receive-only channelreflect: Method on nil interface valueinsufficient data for base length typeconcurrent map iteration and map writetemplate: %s: executing %q at <%s>: %scan't give argument to non-function %sindirection through explicit nil in %sevalEmptyInterface: nil (can't happen)unable to cast %#v of type %T to int64unable to cast %#v of type %T to []intresult must be addressable (a pointer)error decoding json.Number into %s: %sflag %s set at %s before being definedSent Request: %#v %#v %#v %#v %#v %#v Could not determine native endianness.QUIC_GO_DISABLE_CLIENTHELLO_SCRAMBLINGaccepting unidirectional stream failedunexpected size for SETTINGS frame: %dhttp3: unsupported protocol scheme: %smime: expected slash after first tokenexec: StdoutPipe after process startedexec: StderrPipe after process startedunexpected content-type=%s for host %sinvalid P224 compressed point encodinginvalid P256 compressed point encodinginvalid P384 compressed point encodinginvalid P521 compressed point encodingrsa: internal error: gcd(a, b) is evenrsa: internal error: gcd(a, b) is zerobigmod: internal error: bad arithmeticcrypto/sha512: invalid hash state size%s: not an object type for struct (%T)readPythonMultilines: matched %d partserror creating new key: empty key nameextra bytes at the end of the timezonecannot have underscore before exponenttoml: number %d does not fit in an intline %d: cannot unmarshal %s%s into %sline %d: field %s not found in type %sdid not find expected could not find expected directive namefound an incorrect leading UTF-8 octetinvalid headroom size. range is 0 - %dunexpected additional overlap scenariono support for message_set_wire_format%v: unable to resolve extension %v: %vdeprecated_legacy_json_field_conflictstype mismatch: cannot convert %v to %sinvalid connection ID length: %d bytes lost packet %d (reordering threshold)negative number of outstanding packetsCryptoSetup: keys were already droppedReceived 0-RTT read key for the clientfailed to read session ticket revisionGODEBUG sys/cpu: unknown cpu feature "nested object expected: LBRACE got: %sobject expected closing RBRACE got: %sKind.String() not implemented for '%d'found wrong type: got %v, want messagename reference must be fully qualifiedinvalid field: no encoder for %v %v %vcannot encode %d bits into %d-bit codeinvalid octal escape code %q in stringfailed getting EAB credentials: HTTP %dcannot set both acl.file and acl.inlineData size for download and upload teststls: unsupported certificate curve (%s)TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256tls: internal error: wrong nonce lengthno mutually supported protocol versionschain is not signed by an acceptable CAx509: invalid subject alternative namesx509: invalid NameConstraints extensionx509: failed to parse URI constraint %qx509: invalid policy mappings extensionx509: failed to marshal private key: %vmath/big: buffer too small to fit valuex509: unknown EC private key version %d because it doesn't contain any IP SANsx509: invalid elliptic curve public keyx509: signing with MD5 is not supportedx509: trailing data after X.509 SubjectIPv4 field must have at least one digitmismatched count during itab table copyout of memory allocating heap arena map/cpu/classes/gc/mark/assist:cpu-seconds/cpu/classes/scavenge/total:cpu-seconds/memory/classes/profiling/buckets:bytesmspan.sweep: bad span state after sweepruntime: blocked write on free polldescsuspendG from non-preemptible goroutineruntime: casfrom_Gscanstatus failed gp=stack growth not allowed in system calltraceback: unexpected SPWRITE function traceRegion: alloc with concurrent drop277555756156289135105907917022705078125transport endpoint is already connectedSetctty set but Ctty not valid in childsyscall.releaseForkLock: negative count2006-01-02 15:04:05.999999999 -0700 MSTcobra_annotation_bash_completion_custom local_nonpersistent_flags+=("-%s") cobra_annotation_required_if_others_sethop interval must be at least 5 secondshttp: putIdleConn: keep alives disabledusername/password authentication failedcache full; evicting random certificateconverting identifier '%s' to ASCII: %vno certificate matching TLS ClientHellono OCSP server specified in certificateadding temporary record for zone %q: %wecdsa: unsupported curve by crypto/ecdhecdsa: public key point is the infinityecdsa: private key does not match curvecrypto/rsa: invalid options for Decryptcipher: incorrect tag size given to GCMcrypto/cipher: incorrect GCM nonce sizemlkem: invalid encapsulation key lengthtags don't match (%d vs %+v) %+v %s @%dasn1: Unmarshal recipient value is nil cannot produce iter.Seq2[Value, Value]reflect: OverflowUint of non-uint type reflect.MakeMapWithSize of non-map typednsmessage.AAAAResource{AAAA: [16]byte{unable to cast %#v of type %T to uint64unable to cast %#v of type %T to uint32unable to cast %#v of type %T to stringextraneous or missing " in quoted-fieldcsv: invalid field or comment delimiterGot UserPassNegotiationReply: %#v %#v set socket option: IPV6_TRANSPARENT: %sdropped unexpected encryption level: %sIncreased receive buffer size to %d kiBError sending Stateless Reset to %s: %scrypto/blake2b: invalid hash state sizemultipart: can't write to finished partinvalid indexed representation index %dvalidations succeeded; finalizing orderno certificate chains offered by serverurn:ietf:params:acme:error:unauthorizedbad signature on embedded certificate: ;; OPT PSEUDOSECTION: ; EDNS: version comment length insufficient for parsingexec: environment variable contains NULed25519: bad Ed25519ph context length: rsa: internal error: e*d != 1 mod λ(N)fips140: no verification checksum foundcannot add shadow to another shadow keymissing closing key quote from %q to %qcannot store inline table in Go type %stoml: number %d does not fit in an int8cannot decode node with unknown kind %dunknown problem generating YAML contentcannot marshal invalid UTF-8 data as %scannot encode node with unknown kind %dfound an incorrect trailing UTF-8 octetdid not find expected hexdecimal numberSEG6_LOCAL_NH4 has invalid IPv4 addressEither Dst.IP, Src.IP or Gw must be set %s &wire.MaxDataFrame{MaximumData: %d} Setting ACK timer to max ack delay: %sUnmarshalling session ticket failed: %sReceived 0-RTT write key for the servermissing argument to repetition operatortrailing backslash at end of expression%s %s giving up after %d attempt(s): %wunexpected token while parsing list: %sExpected object, got unknown token: %+vgob: cannot encode nil pointer of type can't represent recursive pointer type google.golang.org/genproto/protobuf/apigoogle.golang.org/protobuf/types/known/%v: MessageSet with no extensions fieldinvalid value: merging into nil messagebuild line missing '=' after quoted keycrypto/blake2s: invalid hash state sizefailed to creare ZeroSSL EAB request: %wclient doesn't support certificate curveoversized record received with length %dtls: received empty certificates messagetls: client didn't provide a certificatex509: malformed extension critical fieldx509: cannot parse IP address of length %s %q is not permitted by any constrainterrors: target must be a non-nil pointertime: Stop called on uninitialized TimerIPv6 zones cannot be present in a prefixinvalid span in heapArena for user arenabulkBarrierPreWrite: unaligned argumentsruntime: typeBitsBulkBarrier with type refill of span with free space remaining/cpu/classes/scavenge/assist:cpu-secondsruntime.SetFinalizer: first argument is failed to acquire lock to reset capacitymarkWorkerStop: unknown mark worker modecannot free workbufs when work.full != 0runtime: out of memory: cannot allocate runtime: netpollBreak write failed with stopTheWorld: broken CPU time accountingglobal runq empty with non-zero runqsizemust be able to track idle limiter eventgoroutine stack size is not a power of 213877787807814456755295395851135253906256938893903907228377647697925567626953125ryuFtoaFixed32 called with negative precaddress family not supported by protocolports not allowed with file URLs: got %vhttp2: timeout awaiting response headersFrame accessor called on non-owned Frameinternal error: expecting non-nil streamrequest header %q is not valid in HTTP/2http2: Transport encoding header %q = %qprotocol error: headers after END_STREAMwriteData(stream=%d, p=%d, endStream=%v)host contains '{' (missing initial '/'?)bad wildcard segment (must end with '}')unrecognized or unsupported key type: %surn:ietf:params:acme:error:orderNotReadyauthentication error, HTTP status code: crypto/rsa: input must be hashed messagecrypto/cipher: output smaller than inputcipher: the nonce can't have zero lengthchacha20poly1305: invalid buffer overlapNumericString contains invalid charactercannot represent time as GeneralizedTimeMapIter.Key called on exhausted iteratorreflect: FieldByName of non-struct type reflect.Value.Call: call of nil functionreflect.Value.Call: wrong argument countattempted to copy pointer to FP registerreflect.Value.SetBytes of non-byte slicereflect.Value.setRunes of non-rune sliceunable to cast %#v of type %T to float64Sent UserPassNegotiationReply: %#v %#v reading original destination address: %sDropping (potentially) duplicate packet.received NEW_TOKEN frame from the clientconnection BUG: unexpected send mode: %dfailed to determine send buffer size: %wActivating reading of ECN bits for IPv4.Activating reading of ECN bits for IPv6.http3: invalid http header field name %qmultipart: unexpected line in Next(): %qmalformed MIME header: missing colon: %qevictOldest(%v) on table with %v entriesoverflowing NSEC(3) block in type bitmaped25519: bad Ed25519ctx context length: rsa: prime size must be at least 16 bitsrsa: internal error: inconsistent lengthfloat can have at most one decimal pointtoml: number %d does not fit in an int32toml: number %d does not fit in an int16line %d: field %s already set in type %sunsupported flag %q in tag %q of type %sclient sent a retry_source_connection_idCannot drop keys for encryption level %sflow controller reset after reading datamismatching version. Got %d, expected %d0-RTT was rejected. Dropping 0-RTT keys.Installed Handshake Read keys (using %s)time.Time year outside of range [0,9999]quotedprintable: invalid hex byte 0x%02xeddilithium4: cannot sign hashed messageedwards25519: use of uninitialized Pointunicode point needs %d character, not %dtoml: key %s should be a table, not a %sfound wrong type: got %v, want extensionmessage %T is neither a v1 or v2 Messageinvalid type: no encoder for %v %v %v/%veddilithium2: cannot sign hashed messageSignature does not fit in that bytesliceinvalid Unicode escape code %q in stringreceived signal, shutting down gracefullytls: internal error: unsupported key (%T)tls: handshake has not yet been performedinvalid value length: expected %d, got %dtls: unsupported decryption key type (%T)tls: failed to parse client certificate: tls: internal error: failed to clone hashtls: internal error: unknown cipher suitetls: no supported elliptic curves offeredtls: internal error: empty verified chainx509: cannot parse URI %q: invalid domaincolon must be followed by more charactersunexpected call to os.Exit(0) during test closed, unable to open /dev/null, errno=runtime: typeBitsBulkBarrier without typeWARNING: LIKELY CLEANUP/FINALIZER ISSUES /memory/classes/metadata/mspan/free:bytesruntime.SetFinalizer: second argument is gcSweep being done but phase is not GCoffobjects added out of order or overlappingmheap.freeSpanLocked - invalid stack freemheap.freeSpanLocked - invalid span stateattempted to add zero-sized address rangeruntime: blocked read on closing polldescstopTheWorld: not stopped (stopwait != 0) received on thread with no signal stack invalid timer: fake time but no syncgroup34694469519536141888238489627838134765625strconv: illegal AppendInt/FormatInt baseclone(CLONE_PIDFD) failed to return pidfdtime: Reset called on uninitialized Timertime: missing Location in call to Time.InTime.UnmarshalBinary: unsupported version help [path to command] for full details.Generate the autocompletion script for %snet/url: invalid control character in URLQUICConfig.InitialConnectionReceiveWindowwriteEndsStream called on nil writeFramerinvariant; can't close stream in state %vhttp2: server ignoring unknown setting %vCloseNotify called after Handler finishedWriteHeader called after Handler finishedhttp2: no cached connection was availablehttp2: Transport health check failure: %vtransport got GOAWAY with error code = %vmaking TLS-ALPN challenge certificate: %vcould not decode name.com's response: %wserver does not support newAuthz endpointunrecognized Content-Type from server: %s{"crv":"%s","kty":"EC","x":"%s","y":"%s"}bytes.Buffer.WriteTo: invalid Write countbytes.Reader.WriteTo: invalid Write countsync/atomic: swap of nil value into Valuecrypto/md5: invalid hash state identifierasn1: internal error in parseTagAndLength%s slice too big: %d elements of %d bytescan't call pointer on a non-pointer ValueMapIter.Next called on exhausted iteratorreflect: FieldByIndex of non-struct type reflect: OverflowFloat of non-float type reflect.Value.Addr of unaddressable valuetrying to get %s value of flag of type %swrong type for value; expected %s; got %sunable to cast %#v of type %T to Durationunable to cast %#v of type %T to []stringInvalid Version of Username Password Authconvert file descriptor to connection: %sset socket option: IP_RECVORIGDSTADDR: %sunable to obtain original destination: %sread len %d overflows bufs element len %denqueueing PATH_CHALLENGE for new path %sDropping a packet with an unknown versionSetting DF failed for both IPv4 and IPv6.http3: no cached connection was availableexpected Required Insert Count to be zerocontradicting content lengths (%s and %s)idna: internal error in punycode encodingurn:ietf:params:acme:error:serverInternaldns: length mismatch, want 0/2 but got %dout of order NSEC(3) block in type bitmapfips140: unknown GODEBUG setting fips140=RSASSA-PKCS-v1.5 2048-bit sign and verifyexpecting colon between hours and minutesfound an indentation indicator equal to 0Installed Handshake Write keys (using %s)unexpected Retry integrity tag length: %dreflect.Value flag field has changed kindGODEBUG sys/cpu: no value specified for """" not allowed in multiline basic stringtoml: expected %s to be a table, not a %sgoogle.golang.org/genproto/protobuf/ptypemismatching message name: got %v, want %vinvalid Message.WhichOneof descriptor on unexpected character after quoted key: %qseed must be of length EncryptionSeedSizetls: malformed ECHConfig, invalid %s fieldtls: private key does not match public keyruntime.AddCleanup: ptr is arena-allocatedx509: %q cannot be encoded as an IA5Stringx509: RSA modulus is not a positive numberx509: invalid policy constraints extensionx509: invalid inhibit any policy extensionall candidate chains have invalid policiesgo package net: using the Go DNS resolver bytes; incompatible with mutex flag mask persistentalloc: align is not a power of 2/cpu/classes/gc/mark/dedicated:cpu-seconds/memory/classes/metadata/mcache/free:bytes/memory/classes/metadata/mspan/inuse:bytesnon-empty mark queue after concurrent marksweep: tried to preserve a user arena spanruntime: blocked write on closing polldescunexpected state passed to panicrangestateacquireSudog: found s.elem != nil in cachefatal error: cgo callback before cgo call on a locked thread with no template threadunexpected signal during runtime execution received but handler not on signal stack stop of synctest timer from outside bubbletraceStopReadCPU called with trace enabledattempted to trace a bad status for a procout of memory allocating checkmarks bitmap173472347597680709441192448139190673828125867361737988403547205962240695953369140625time: Reset called on uninitialized TickerTime.MarshalBinary: unexpected zone offsetUnable to find a command for arguments: %vError while parsing flags from args %v: %s%s?cver=%s&plat=%s&arch=%s&chan=%s&side=%stried to delete unknown outgoing stream %dtried to delete unknown incoming stream %dlooking for beginning of object key stringmix of request and response pseudo headersPRIORITY frame payload size was %d; want 5Failed to parse goroutine ID out of %q: %vhttp2: server connection error from %v: %vpromised request headers cannot include %qbad wildcard segment (must start with '{')http: multipart handled by MultipartReaderhttp: ContentLength=%d with Body length %dcould not decode account's private key: %vstarted background certificate maintenancestopped background certificate maintenancecould not determine zone for domain %q: %vcrypto/rsa: salt length cannot be negativecrypto/sha1: invalid hash state identifierpoly1305: write to MAC after Sum or Verifysync/atomic: store of nil value into ValuePrintableString contains invalid characterMapIter.Value called on exhausted iteratorreflect: negative length passed to ArrayOfreflect: Call with too few input argumentsmismatch between ABI description and typesreflect: cannot convert slice with length insufficient data for resource body lengthdeprecated message for flag %q must be setinternal error: no fields in evalChainNodefunction name %q is not a valid identifierdecoder already registered for this formatencoder already registered for this formatenable offload: check IFF_VNET_HDR enabledclosing connection in order to recreate itSwitching destination connection ID to: %sError occurred handling initial packet: %sError sending CONNECTION_REFUSED error: %sinvalid value for SETTINGS_H3_DATAGRAM: %dinvalid HTTP header value %q for header %qexpected first frame to be a HEADERS framehttp3: failed to read response headers: %winternal error: call to runtimeSource.Seeddomain name exceeded %d wire-format octetsSVCB keys not in strictly increasing orderdns: svcbipv6hint: expected ipv6, got ipv4gave up after %d attempts, last error : %sgave up after %d attempts, last error: %#verror parsing data source: unknown type %qleading zero not allowed on decimal numbercannot have underscore after decimal pointinvalid array: want %d elements but got %dIncorrect element type in vf info list: %ddecoding failed: address family %d unknownmissing original_destination_connection_idreceived duplicate transport parameter %#xSending ACK because the ACK timer expired.packet %d not found in sent packet historyquotedprintable: invalid bytes after =: %qKeyValue should have at least two childrenarray elements must be separated by commasgob: encoded unsigned integer out of rangeexpected 3 columns for replacement; got %dcould not parse Go build info: line %d: %wcrypto: requested unavailable XOF functionheredoc expected second '<', didn't see itTLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256tls: received unexpected key update messagetls: no supported elliptic curves for ECDHEtls: server did not select an ALPN protocoltls: server sent unrequested session tickettls: received malformed key_share extensiontls: invalid early data for QUIC connectiontls: client's Finished message is incorrecttls: handshake data received at wrong leveltls: SendSessionTicket called on the clientx509: failed to parse dnsName constraint %qx509: invalid X25519 private key parametersruntime: opened unexpected file descriptor /memory/classes/metadata/mcache/inuse:bytesruntime.SetFinalizer: first argument is nilruntime.SetFinalizer: finalizer already setgcBgMarkWorker: unexpected gcMarkWorkerModenon in-use span found with specials bit setgrew heap, but no adequate free space foundroot level max pages doesn't fit in summaryruntime: releaseSudog with non-nil gp.paramunknown runnable goroutine during bootstrapruntime: casfrom_Gscanstatus bad oldval gp=runtime:stoplockedm: lockedg (atomicstatus=methodValueCallFrameObjs is not in a modulereset of synctest timer from outside bubblesynctest timer accessed from outside bubbleGcSlice can't handle on-demand gcdata typesmult64bitPow10: power of 10 is out of rangeinterrupted system call should be restarted local_nonpersistent_flags+=("--%[1]s") http2: client conn could not be establishedno multipart boundary param in Content-Typenet/http: timeout awaiting response headerstimeout waiting for SETTINGS frames from %vhttp2: server closing client connection: %vhttp2: unexpected ALPN protocol %q; want %qTransport: unhandled response frame type %TError enabling Transport HTTP/2 support: %vunable to write OCSP staple file for %v: %vhttps://api.gandi.net/v5/livedns/domains/%scould not encode form data for request: %wresponse had invalid Retry-After header: %sorder pending, authorizations remaining: %vmultiple Read calls return no data or errorexplicit time type given to non-time memberreflect: nil type passed to Type.Implementsreflect: CallSlice of non-variadic functionreflect: Call with too many input argumentsFlag shorthand -%s has been deprecated, %s invalid string being converted to IPNet: %s%s is an unexported field of struct type %swrong number of args for %s: want %d got %dwrong number of args for %s: got %d want %dbufio: tried to rewind past start of bufferset socket option: IPV6_RECVORIGDSTADDR: %sserver cannot initiate connection migrationstream %d canceled by %s with error code %dfailed to determine receive buffer size: %whttp3: too many 1xx informational responseschunked encoding contains too much non-dataoauth2: cannot fetch token: %v Response: %sexec: WaitDelay expired before I/O completefailed to parse dns answers for host %s: %wrsa: internal error: modulus size incorrectnon executable command in pipeline stage %dreadPythonMultilines: end of value, got: %qexpecting colon between minutes and secondscannot have underscore before decimal pointtoml: type %s is not supported as a map keytoml: decoding pointer target cannot be nilextra characters at the end of a local time!!binary value contains invalid base64 datafound character that cannot start any tokendid not find expected comment or line breakfound unexpected non-alphabetical characterfound invalid Unicode character escape coderefusing to Unmarshal into non-zero IPRangetimeout: handshake did not complete in time %s &wire.DataBlockedFrame{MaximumData: %d}sent packet with unexpected ECN marking: %sedwards25519: invalid point encoding length''' not allowed in multiline literal stringfile %q has a package name conflict over %vreplacement with no module on previous linefailed decoding ZeroSSL EAB API response: %wtls: server's Finished message was incorrecttls: server sent an incorrect legacy versiontls: invalid server X25519MLKEM768 key sharetls: invalid X25519MLKEM768 server key sharetls: invalid X25519MLKEM768 client key sharetls: SendSessionTicket called multiple timestls: StoreSessionTicket called on the serverx509: invalid RDNSequence: invalid attributex509: invalid Ed25519 private key parametersx509: invalid Ed25519 private key length: %dx509: internal error: cannot parse domain %qcrypto/x509: error fetching intermediate: %wx509: failed to unmarshal raw CSR Attributesuse of WriteTo with pre-connected connectionspan on userArena.faultList has invalid sizesend on synctest channel from outside bubbleout of memory allocating heap arena metadataruntime: cannot remap pages in address space/cpu/classes/scavenge/background:cpu-secondsruntime: unexpected metric registration for gcmarknewobject called while doing checkmarkactive sweepers found at start of mark phaseno P available, write barriers are forbiddencannot trace user goroutine on its own stackunsafe.Slice: ptr is nil and len is not zeromult128bitPow10: power of 10 is out of range local_nonpersistent_flags+=("--%[1]s=") %v Logger.check error: failed to get caller fragments not allowed with file URLs: got %vfailed to send fd to control unix socket: %whttp: putIdleConn: too many idle connectionshttp: attempting to traverse a non-directoryconnection exceeded flow control window sizehttp2: could not negotiate protocol mutuallyhttp2: 1xx informational responses too largehttp: Request.ContentLength=%d with nil Bodyunexpectedly found more than 1 record for %vretrieving next certificate in chain: %s: %wunsupported SOCKS5 authentication method: %dcrypto/sha256: invalid hash state identifiercipher: NewGCM requires 128-bit block cipherreflect: call of MakeFunc with non-Func typereflect: Value.SetIterKey called before Nextreflect: FieldByNameFunc of non-struct type reflect: funcLayout with interface receiver using value obtained using unexported fieldreflect: function created by MakeFunc using reflect: slice length out of range in SetLeninsufficient data for calculated length typeincompatible types for comparison: %v and %vencoding alphabet contains newline characterencoding alphabet includes duplicate symbolsError parsing Version Negotiation packet: %sDATAGRAM frame too large (maximum: %d bytes)activating ECN failed for both IPv4 and IPv6http3: server didn't enable Extended CONNECThttp3: received pseudo header in trailer: %smultipart: expecting a new Part; got line %qmime: unexpected content after media subtypeinvalid Transfer-Encoding request header: %qurn:ietf:params:oauth:grant-type:device_codefailed to build dns question for host %s: %wfailed to finish dns message for host %s: %wfailed to skip dns questions for host %s: %wed25519: bad Ed25519ph message hash length: crypto/sha512: invalid hash state identifiertemplate: multiple definition of template %qneed at least one digit after fraction pointyaml internal error: please report the issueneither tag nor implicit flags are specifiedmapping keys are not allowed in this contextdid not find expected digit or '.' characterdecoding failed: buffer too small (%d bytes)ackhandler BUG: ackedPackets slice not emptyPTO timer in unexpected encryption level: %smax-age=31536000; includesubdomains; preloadoauth2: server response missing access_tokenquery: Values() expects struct input. Got %vmultiline basic string not terminated by """this should not be a top level node type: %s%s previously from: %q currently from: %qseed must be of length EncapsulationSeedSizeTLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256tls: internal error: unexpected renegotiationtls: invalid reconstructed inner client hellotls: no server certificates in client sessiontls: failed to find any PEM data in key inputx509: IP constraint contained invalid mask %xx509: certificate signed by unknown authorityhandleTransientAcquire called in invalid modehandleTransientRelease called in invalid modeclose of synctest channel from outside bubble may be in the same tiny block as finalizer transitioning GC to the same state as before?produced a trigger greater than the heap goaltried to run scavenger from another goroutineruntime: failed mSpanList.remove span.npages=exitsyscall: syscall frame is no longer validunsafe.String: ptr is nil and len is not zerocannot send after transport endpoint shutdownrequires at least %d arg(s), only received %dsink factory already registered for scheme %qIgnored key-value pairs with non-string keys.context: internal error: missing cancel errorjson.RawMessage: UnmarshalJSON on nil pointerhttp: putIdleConn: connection is in bad statehttp: no Client.Transport or DefaultTransportunbuffered done channel passed in for type %Thttp: multipart handled by ParseMultipartFormHTTP/1.1 %d %s%sUnsupported transfer encodingnet/http: internal error: connCount underflowclient tried to switch to invalid protocol %qcould not determine authoritative nameserverscertificate has no names; removing from cachecertificate expires soon; queuing for renewaloverride disables querying OCSP responder: %v[ERROR] TLS-ALPN challenge server: accept: %vinvalid url scheme, expecting https:// prefixecdsa: curve not supported by PublicKey.Bytescrypto/rsa: message too long for RSA key sizezero length explicit tag was not an asn1.Flagmath/big: cannot unmarshal %q into a *big.Intreflect: OverflowComplex of non-complex type reflect: nil type passed to Type.AssignableToreflect: internal error: invalid method indexparsing/packing of this section has completed%q shorthand is more than one ASCII characterbufio.Scanner: Read returned impossible countretired connection ID %d (highest issued: %d)Dropping packet with version %x. Expected %x.received HTTP/3 frame on bidirectional streaminvalid request :path %q from URL.Opaque = %qcrypto/blake2b: invalid hash state identifierno response matching the supplied certificatefailed to start dns questions for host %s: %wfailed to create http request for host %s: %wfloat integer part cannot have leading zeroesDisabling ECN. All testing packets were lost.AuthDecapsulate is not supported for this KEMAuthEncapsulate is not supported for this KEMw must be at least 2 by the definition of NAFExpected object value, got unknown token: %+vescape sequence is invalid Unicode code pointdetected mutation on the default bytes for %vdecode failure in lazy extension decoding: %v0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ $%*+-./:crypto/blake2s: invalid hash state identifierhttps://acme-v02.api.letsencrypt.org/directoryPSSWithSHA256PSSWithSHA384PSSWithSHA512Ed25519tls: server chose an unconfigured cipher suitetls: failed to parse certificate from server: tls: server did not echo the legacy session IDtls: server accepted 0-RTT with the wrong ALPNtls: received new session ticket from a clientruntime.AddCleanup: ptr not in allocated blockx509: failed to unmarshal elliptic curve pointx509: failed to parse rfc822Name constraint %qx509: malformed signature algorithm identifierx509: unknown curve while marshaling to PKCS#8x509: invalid elliptic curve private key valueslice bounds out of range [:%x] with length %ypanicwrap: unexpected string after type name: memory reservation exceeds address space limittried to park scavenger from another goroutinereleased less than one physical page of memorysysGrow bounds not aligned to pallocChunkBytesruntime: failed to create new OS thread (have runtime: panic before malloc heap initialized stopTheWorld: not stopped (status != _Pgcstop)select on synctest channel from outside bubbleruntime: name offset base pointer out of rangeruntime: type offset base pointer out of rangeruntime: text offset base pointer out of rangeboth Setctty and Foreground set in SysProcAttrTime.UnmarshalJSON: input is not a JSON stringERROR: unexpected ShellCompDirective value: %dcan't register a sink factory for empty stringfirst path segment in URL cannot contain colon%v Unsafe CheckedEntry re-use near Entry %+v. request Content-Type isn't multipart/form-dataGOAWAY close timer fired; closing conn from %vinternal error: cannot create stream with id 0http2: Transport creating client conn %p to %vprotocol error: received DATA after END_STREAMclient sent an HTTP request to an HTTPS servernet/http: internal error: misuse of tryDeliverbackend tried to switch to invalid protocol %q%s: caching certificate after obtaining it: %vcould not find the start of authority for %s%stimed out waiting to obtain certificate for %sunexpected state: %s - order already finalizedbytes.Reader.UnreadByte: at beginning of slicebytes.Reader.UnreadRune: at beginning of sliceecdsa: curve not supported by PrivateKey.Bytescipher.NewCTR: IV length must equal block sizemath/big: mismatched montgomery number lengthsreflect: Value.SetIterValue called before Nextreflect: nil type passed to Type.ConvertibleToreflect.Struct: fields with different PkgPath reflect.StructOf: illegal embedded field type returned value obtained from unexported fieldreflect: slice capacity out of range in SetCapreflect.Value.Slice: slice index out of boundsinvariant failed: growthLeft is unexpectedly 0invalid string being converted to Bytes: %s %sOCSP response contains bad number of responsesdns: svcbipv4hint: expected ipv4, hint is ipv6dns: svcbipv6hint: expected ipv6, hint is ipv4failed to perform http request for host %s: %wed25519: internal error: setting scalar failedrsa: generated p == q, random source is brokencrypto/hmac: hash does not support hash.Cloneredwards25519: invalid field element input sizemapping values are not allowed in this contextdid not find expected whitespace or line breaklwt bpf decode: failed parsing route attributeerror while reading transport parameter %d: %sTransport parameters changed. Rejecting 0-RTT.multiline literal string not terminated by '''google.golang.org/genproto/protobuf/field_maskUse bytes per second instead of bits per secondtls: malformed encrypted_client_hello extensionfirst record does not look like a TLS handshaketls: handshake did not verify certificate chaintls: incorrect renegotiation extension contentstls: server selected unadvertised ALPN protocoltls: internal error: pskBinders length mismatchtls: server selected TLS 1.3 in a renegotiationtls: malformed encrypted client hello extensiontls: server sent two HelloRetryRequest messagestls: Config MinVersion must be at least TLS 1.3x509: malformed public key algorithm identifierx509: internal error: IP SAN %x failed to parseunexpected error wrapping poll.ErrFileClosing: slice bounds out of range [::%x] with length %yreceive on synctest channel from outside bubbleruntime·lock: sleeping while lock is availableP has cached GC work at end of mark terminationfailed to acquire lock to start a GC transitionfinishGCTransition called without starting one?tried to sleep scavenger from another goroutineracy sudog adjustment due to parking on channelfunction symbol table not sorted by PC offset: attempted to trace a bad status for a goroutineattempting to link in too many shared librariescobra_annotation_bash_completion_subdirs_in_dirhttp: server gave HTTP response to HTTPS clientflow control update exceeds maximum window sizewr.done != nil for write100ContinueHeadersFrame1xx informational response with END_STREAM flagprotocol error: received DATA on a HEAD request[FrameWriteRequest stream=%d, ch=%v, writer=%v]missing config pointer (must use NewACMEIssuer)opening distributed challenge token file %s: %vunable to delete stale lockfile; deadlocked: %wtimed out waiting for certificate renewal of %secdsa: hash length does not match hash functionchacha20poly1305: message authentication failedcrypto/ecdh: public key is the identity elementasn1: Unmarshal recipient value is non-pointer explicit string type given to non-string memberreflect.Value.Bytes of unaddressable byte arrayreflect: CallSlice with too few input argumentsregister-based return value has stack componentreflect.Value.Slice3: slice index out of boundsreflect.Value.UnsafeAddr of unaddressable valuebufio: reader returned negative count from Read^(\w+)\s*\(([^,]+)(?:,([^,]+))?(?:,([^,]+))?\)$Queueing packet (%d bytes) for later decryption:path, :authority and :method must not be emptyinvalid :protocol header in non-CONNECT requestbigmod: modulus for ExpShortVarTime must be oddfloat decimal point must be preceded by a digitfloat decimal point must be followed by a digittoml: encoding a nil interface is not supportedfound a tab character that violates indentationAckFrame: ACK frame contains invalid ACK rangesNot doing 0-RTT. Has sealer: %t, has params: %tinvalid string length %d: exceeds input size %dmap field %v cannot be set with read-only valuetls: CloseWrite called before handshake completeunable to generate random session ticket key: %vfailed to parse certificate #%d in the chain: %wtls: no FIPS compatible certificate chains foundtls: no supported symmetric ciphersuites for ECHtls: invalid EncryptedClientHelloKeys Config: %stls: CurvePreferences includes unsupported curvex509: X25519 key encoded with illegal parametersx509: SAN uniformResourceIdentifier is malformedx509: IP constraint contained value of length %dx509: internal error: cannot parse constraint %qx509: internal error: URI SAN %q failed to parsex509: only RSA, ECDSA and Ed25519 keys supportedx509: only CAs are allowed to specify MaxPathLenx509: failed to serialise extensions attribute: slice bounds out of range [:%x] with capacity %y is reachable from cleanup or cleanup argument runtime: cannot map pages in arena address spaceruntime: malformed profBuf buffer - invalid sizeattempt to trace invalid or unsupported P statusstrconv: illegal AppendFloat/FormatFloat bitSizenot enough significant bits after mult64bitPow10group id '%s' is not defined for subcommand '%s'peer tried to open stream %d (current limit: %d)net/http: extended connect not supported by peerinternal error: should have a body in this statenet/http: Hijack called after ServeHTTP finishedcertificate appears to have been renewed already[ERROR] TLS-ALPN challenge server: handshake: %vcould not decode the response from name.com: %wserver set unrecognized authorization status: %sretrieving alternate certificate chain at %s: %w%-8s %-12s %12s %8s %12s %12s %12s %12s %-16s %sout points to big.Int, but defaultValue does notInt.GobDecode: encoding version %d not supportedreflect: CallSlice with too many input argumentsparsing/packing of this type isn't available yetinvalid string being converted to IP address: %scan't use %v iterate over more than one variable'%s' needs a map with string keys, has '%s' keysbufio: writer returned negative count from Writelength of packet (%d) < virtioNetHdr.hdrLen (%d)connection BUG: unspecified error type (msg: %s)Activating reading of packet info bits for IPv4.Activating reading of packet info bits for IPv6.additional HEADERS frame received after trailersmalformed SRV value; expected: ' 'crypto/rsa: input must be hashed with given hashdates are expected to have the format YYYY-MM-DDextra characters at the end of a local date timetoml: negative number %d does not fit in an uintreceived %d bytes on stream %d, allowed %d byteserror while trying to parse list within list: %sinvalid Mutable on field with non-composite typefield %v has invalid type: got %v, want map kindlist field %v cannot be set with read-only valueinvalid status code (must be 200-599, except 233)crypto/tls: ExportKeyingMaterial context too longtls: server advertised unrequested ALPN extensiontls: server sent a cookie in a normal ServerHellotls: client offered only unsupported versions: %xtls: client using inappropriate protocol fallbacktls: client illegally modified second ClientHello/etc/pki/ca-trust/extracted/pem/tls-ca-bundle.pemx509: invalid RDNSequence: invalid attribute typex509: Ed25519 key encoded with illegal parametersx509: private key contains zero or negative valuex509: private key contains zero or negative primex509: signature returned by signer is invalid: %wthe :: must expand to at least one field of zerosslice bounds out of range [::%x] with capacity %yinvalid memory address or nil pointer dereferencepanicwrap: unexpected string after package name: s.allocCount != s.nelems && freeIndex == s.nelemsruntime.reflect_makemap: unsupported map key typesweeper left outstanding across sweep generationsfully empty unfreed span set block found in resetcasgstatus: waiting for Gwaiting but is Grunnablenot enough significant bits after mult128bitPow10strings.Reader.UnreadByte: at beginning of stringstrings.Reader.UnreadRune: at beginning of stringstrings.Reader.WriteTo: invalid WriteString countinvalid or incomplete multibyte or wide character# bash completion for %-36s -*- shell-script -*- # fish completion for %-36s -*- shell-script -*- tried to delete incoming stream %d multiple timeshttp2: request body closed due to handler exitinghttp: wrote more than the declared Content-Length (Client.Timeout exceeded while awaiting headers)http: partitioned cookies must be set with Secureunexpected Peek failure reading buffered byte: %vnet/http: Transport.Dial hook returned (nil, nil)%s: reloading renewed certificate into memory: %vrenewing certificate aborted by event handler: %wdecoding challenge token file %s (corrupted?): %vfailed to decode PEM block containing private keynot configured for on-demand certificate issuancesubject name does not qualify for certificate: %scould not remove compromised private key from useecdsa: internal error: truncated hash is too longcrypto/elliptic: internal error: invalid encodingchacha20poly1305: bad nonce length passed to Sealchacha20poly1305: bad nonce length passed to Openreflect.Value.Slice: slice of unaddressable arrayputPacketBuffer called with packet of wrong size!connection BUG: couldn't pack %s probe packet: %vDropping long header packet of type %s (%d bytes)Activating reading of ECN bits for IPv4 and IPv6.error parsing connection ID on packet from %s: %shttp3: expected first frame to be a HEADERS framefailed to read http response body for host %s: %wcrypto/rsa: public exponent too small or negativedatetime separator is expected to be T or a spacetoml: negative number %d does not fit in an uint8lwt bpf decode: failed parsing attribute. err: %vclient sent an original_destination_connection_idVersion Negotiation packet has empty version listDisabling ECN. ECN counts decreased unexpectedly.received packet with unknown encryption level: %sPeer doesn't await address validation any longer.Congestion limited: bytes in flight %d, window %dexpected character %c but the document ended heresubslice address (%d) is before data address (%d)gob: registering duplicate types for %q: %s != %sgob: registering duplicate names for %s: %q != %qhttps://api.zerossl.com/acme/eab-credentials-emailcryptobyte: attempted write while child is pendingtls: received unexpected CertificateStatus messagetls: invalid signature by the server certificate: tls: invalid signature by the client certificate: tls: client offered TLS version older than TLS 1.3x509: missing ASN.1 contents; use ParseCertificatex509: invalid RDNSequence: invalid attribute valuex509: RSA public exponent is not a positive numberx509: unknown key type while marshaling PKCS#8: %Tmallocgc called with gcphase == _GCmarkterminationrecursive call during initialization - linker skewattempt to execute system stack code on user stackcobra_annotation_bash_completion_one_required_flagnet/http: cannot rewind body after connection losshttp: putIdleConn: CloseIdleConnections was calledgot CONTINUATION for stream %d; expected stream %dhttp: suspiciously long trailer after chunked bodynet/http: Transport failed to read from server: %vnet/http: HTTP/1.x transport connection broken: %wobtaining certificate aborted by event handler: %wunknown key type; only RSA and ECDSA are supportedinvalid hijack address (must be an IP address): %scrypto/elliptic: nistec rejected normalized scalarcrypto/rsa: prime factors are not relatively primecrypto/cipher: incorrect nonce length given to GCMchacha20: SetCounter attempted to rollback countercrypto/ecdh: public key does not match private keyreflect.Value.Slice3: slice of unaddressable array%s has arguments but cannot be invoked as functionfunction %s has %d return values; should be 1 or 2Not adding connection ID %s, as it already exists.http3: HEADERS frame too large: %d bytes (max: %d)dns: svcbport: port length is not exactly 2 octetsoauth2: token expired and refresh token is not setfailed to parse dns message header for host %s: %wcannot add shadow to auto-increment or boolean keytoml: negative number %d does not fit in an uint64toml: negative number %d does not fit in an uint32toml: negative number %d does not fit in an uint16^[-+]?[0-9][0-9_]*(?::[0-5]?[0-9])+(?:\.[0-9_]*)?$ACK rate: %.2f (total=%d, ack=%d, loss=%d, rtt=%d)initial_max_streams_uni too large: %d (maximum %d)unknown transport parameter marshaling version: %d Queuing ACK because the packet was ECN-CE marked.received an ACK for skipped packet number: %d (%s)LogValue called too many times on Value of type %Treflect.Value read-only flag has changed semanticsedwards25519: invalid SetUniformBytes input lengthexpected: IDENT | STRING | ASSIGN | LBRACE got: %serror while trying to parse object within list: %sslice offset (%d) is farther than data length (%d)invalid uint data length %d: exceeds input size %dgoogle.golang.org/genproto/protobuf/source_contextinvalid Mutable on map with non-message value typefield %v has invalid type: got %v, want slice kindcache must have GetConfigForCert set in its optionstls: missing signature_algorithms from TLS 1.2 peertls: VerifyHostname called on TLS server connectioncrypto/tls: reserved ExportKeyingMaterial label: %stls: server's identity changed during renegotiationtls: server selected unsupported compression formattls: server offered only incompatible point formatstls: server sent an unexpected early_data extensiontls: client did not request an application protocoltls: client offered only incompatible point formatsx509: certificate has expired or is not yet valid: ScanState's Read should not be called. Use ReadRuneinternal error: too many releases of process handlelimiterEvent.stop: invalid limiter event type foundpotentially overlapping in-use allocations detectedfatal: systemstack called from unexpected goroutinequery parameters not allowed with file URLs: got %vJSON decoder out of sync - data changing underfoot?protocol error: received %T before a SETTINGS framehttp: Transport does not support unencrypted HTTP/2loading managed certificate for %v from storage: %vgot nil TLS-ALPN challenge certificate but no errorunable to forcefully get new certificate for %v: %wcould not encode the form data for the request: %wcrypto/elliptic: Add was called on an invalid pointgodebug: Value of name not listed in godebugs.All: can't use %v to iterate over more than one variable'%s': source data must be an array or slice, got %sdefault type does not match variable type: %v != %vIgnoring Retry, since we already received a packet.Ignoring Retry, since a Retry was already received.HTTP Datagrams enabled, but QUIC Datagrams disabledauthz %s has unexpected status; order will fail: %secdsa: internal error: request size exceeds maximumcrypto/ecdh: internal error: isLess input too largereadPythonMultilines: failed to peek with error: %vline %d: mapping key %#v already defined at line %dlwt bpf decode: received unknown attribute type: %dinitial_max_streams_bidi too large: %d (maximum %d) Queueing ACK because packet %d was missing before.expected = after a key, but the document ends thereslice ends (%d+%d) is farther than data length (%d)invalid AppendMutable on list with non-message typeextension %v extends %v outside the extension rangefield %v has invalid type: got %v, want struct kindfield %v has invalid type: %v does not implement %vunicode code point U+E123 reserved for internal usetls: invalid EncryptedClientHelloKeys PrivateKey: %stls: server selected unsupported protocol version %xtls: received a session ticket with invalid lifetimetls: internal error: session ticket keys unavailabletls: private key type does not match public key typex509: cannot verify signature: insecure algorithm %verrors: *target must be interface or implement errorfailed to correctly flush all P-owned cleanup blocksruntime: cannot disable permissions in address spaceruntime.SetFinalizer: pointer not in allocated blockruntime: use of FixAlloc_Alloc before FixAlloc_Init span set block with unpopped elements found in resetcasfrom_Gscanstatus: gp->status is not in scan statecobra_annotation_bash_completion_filename_extensionsRegisterFlagCompletionFunc: flag '%s' does not existuser and password not allowed with file URLs: got %v request header "TE" may only be "trailers" in HTTP/2http2: Transport readFrame error on conn %p: (%T) %vprotocol error: received DATA before a HEADERS framedid not find chain matching preferences; using firstdeleting temporary record for name %q in zone %q: %wrequest to delete the record was not successful: %wrequest to update the record was not successful: %wecdsa: internal error: unexpectedly masking off bitsdnsmessage.OPTResource{Options: []dnsmessage.Option{wrong number of args for %s: want at least %d got %dwrong number of args for %s: got %d want at least %dGot UserPassNegotiationRequest: %#v %#v %#v %#v %#v Ignoring spoofed Retry. Integrity Tag doesn't match.Activating reading of packet info for IPv4 and IPv6.activating packet info failed for both IPv4 and IPv6:path must be empty and :authority must not be emptyhttp3: invalid http header field value %q for key %vdownloading certificate chain from %s: %w (order=%s)successfully downloaded available certificate chainsrsa: internal error: b is not divisible by gcd(a, b)internal error: missing handler for resolver table: source and destination ip are not the same IP familyinvalid value for max_ack_delay: %dms (maximum %dms) setting loss timer for packet %d (%s) to %s (in %s)Starting key drop timer to drop key phase %d (in %s)unexpected character 'i' while scanning for a numberunexpected character 'n' while scanning for a numberprototext: error parsing unknown field wire type: %vfailed to connect (server may not support speed test)tls: unable to generate random session ticket key: %vtls: received unexpected handshake message of type %Ttls: unexpected server_name extension in server hellotls: client does not support uncompressed connectionstls: failed to find any PEM data in certificate inputx509: certificate specifies an incompatible key usageunique.canonMap: ran out of hash bits while iteratingunique.canonMap: ran out of hash bits while insertingnon-concurrent sweep failed to drain all sweep queuesexited a goroutine internally locked to the OS threadhttp: putIdleConn: too many idle connections for hosthttp2: Framer %p: failed to decode just-written frameillegal use of AllowIllegalReads with ReadMetaHeadershttp2: Transport failed to get client conn for %s: %vnon-CONNECT pattern with unclean path can never matchdescribeConflict called with non-conflicting patternsnet/http: CloseNotify called after ServeHTTP finishedsubject does not qualify for a public certificate: %sfound preferred certificate chain by root common namefound unknown private key type in PKCS#8 wrapping: %Tgetting certificate from external certificate managerforcefully renewing certificate due to REVOKED statusHTTP %d: JSON-decoding problem details: %w (raw='%s')crypto/elliptic: attempted operation on invalid pointsync/atomic: compare and swap of nil value into Valuepem: cannot encode a header key that contains a colonmath/big: internal error: cannot find (D/n) = -1 for reflect: non-interface type passed to Type.Implementsreflect.Value.Slice: string slice index out of boundssmall map with no empty slot (concurrent map writes?)bufio.Scan: too many empty tokens without progressingSent UserNameNegotiationRequest: %#v %#v %#v %#v %#v <- Reading packet %d (%d bytes) for connection %s, %sserver sent reduced limits after accepting 0-RTT data-> Sending packet %d (%d bytes) for connection %s, %sreceived crypto data after change of encryption levelDiscarding received DATAGRAM frame (%d bytes payload)wire.PutStreamFrame called with packet of wrong size!received a packet with an unexpected connection ID %sAdding connection IDs %s and %s for a new connection.chacha20: internal error: wrong dst and/or src lengthcrypto/ecdh: internal error: mismatched isLess inputs^[-+]?(\.[0-9]+|[0-9]+(\.[0-9]*)?)([eE][-+]?[0-9]+)?$did not find expected alphabetic or numeric character %s &wire.RetireConnectionIDFrame{SequenceNumber: %d}wrong length for reset_stream_at: %d (expected empty)min_ack_delay (%s) is greater than max_ack_delay (%s)invalid value for ack_delay_exponent: %d (maximum %d)script-src 'none'; object-src 'none'; base-uri 'none'invalid GOLANG_PROTOBUF_REGISTRATION_CONFLICT value: unkown field number %d while unmarshalling GoFeaturesunkown field number %d while unmarshalling FeatureSethaving only HTTP server without HTTPS is not supportedcertificate is not valid for requested server name: %wcryptobyte: Builder is exceeding its fixed-size buffertls: server resumed a session with a different versiontls: server accepted 0-RTT with the wrong cipher suitetls: certificate used with invalid signature algorithmtls: Encrypted Client Hello cannot be used pre-TLS 1.3tls: client indicated early data in second ClientHellotls: failed to create cipher while encrypting ticket: tls: found unknown private key type in PKCS#8 wrappingx509: cannot verify signature: algorithm unimplementedx509: invalid RDNSequence: invalid attribute value: %sURI with IP (%q) cannot be matched against constraintsfmt: scanning called UnreadRune with no rune available, square brackets can only be used with IPv6 addresses, IPv6 addresses must be surrounded by square bracketsruntime.m memory alignment too small for spinbit mutexmin size of malloc header is not a size class boundarygcControllerState.findRunnable: blackening not enabledno goroutines (main called runtime.Goexit) - deadlock!trace: non-empty full trace buffer for done generationtrace: non-empty full trace buffer for next generation goroutine running on other thread; stack unavailable http: Request.Write on Request with no Host or URL setread loop ending; caller owns writable underlying conninternal error: expected to be already writing a framehttp2: received GOAWAY %+v, starting graceful shutdownhttp2: handler wrote more than declared Content-Lengthtarget must be an absolute URL or an absolute path: %qnet/http: can't write control character in Request.URLhttputil: ReverseProxy read error during body copy: %vhttps://acme-staging-v02.api.letsencrypt.org/directoryno matching certificates and no custom selection logicremoved certificate's compromised private key from usebytes.Buffer: reader returned negative count from Readecdsa: curve not supported by deterministic signaturescrypto/elliptic: Double was called on an invalid pointreflect: Value.SetIterKey called on exhausted iteratorname is not in canonical format (it must end with a .)panic calling String method on zero %v for flag %s: %vbinary.Write: some values are not fixed-sized in type virtioNetHdr.hdrLen (%d) < virtioNetHdr.csumStart (%d)end of checksum offset (%d) exceeds packet length (%d)expected first connection ID to have sequence number 0error parsing packet, couldn't parse connection ID: %sexpected retry_source_connection_id to equal %s, is %sClient offered version %s, sending Version Negotiationinvalid value for SETTINGS_ENABLE_CONNECT_PROTOCOL: %dreceived pseudo header %s after a regular header fieldquic: HKDF-Expand-Label invocation failed unexpectedlytoml: cannot decode TOML %s into a Go value of type %stag handle must contain alphanumerical characters onlyexplicitly tagged !!binary data must be base64-encodedblock sequence entries are not allowed in this contextoption ,inline needs a map with string keys in struct Not enough samples (total=%d, ack=%d, loss=%d, rtt=%d) %s &wire.MaxStreamsFrame{Type: uni, MaxStreamNum: %d}received %d bytes for the connection, allowed %d bytesquotedprintable: invalid unescaped byte 0x%02x in bodyfield %v has invalid type: got %v, want interface kindpacked public key must be of mode3.PublicKeySize bytespacked public key must be of mode2.PublicKeySize bytestls: internal error: handshake should have had a resulttls: server sent non-zero legacy TLS compression methodx509: authority info access incorrectly marked criticalx509: too many intermediates for path length constraintx509: failed to load system roots and no roots providedeach colon-separated field must have at least one digitos: invalid use of WriteAt on file opened with O_APPENDinternal error: negative process handle reference countmheap.freeSpanLocked - invalid free of user arena chunkcasfrom_Gscanstatus:top gp->status is not in scan statenet/http: request canceled while waiting for connectionnet/http: invalid byte %q in %s; dropping invalid byteshttp2: server: error reading preface from client %v: %vinternal error: can only be writing one frame at a timehttp2: Transport received GOAWAY from server ErrCode:%vfound preferred certificate chain by issuer common name[WARNING] Unable to delete invalid OCSP staple file: %vcould not start listener for challenge server at %s: %vcould not get records: Domain: %s; Status: %v; Body: %smust set at least one of Certificates or GetCertificateecdsa: internal error: shift can only be by 1 to 7 bitscipher.NewCBCEncrypter: IV length must equal block sizecipher.NewCBCDecrypter: IV length must equal block sizereflect: internal error: invalid use of makeMethodValuereflect.FuncOf: last arg of variadic func must be sliceunable to cast %#v of type %T to map[string]interface{}cannot assign type '%s' to map value field of type '%s'bufio.Scanner: SplitFunc returns negative advance countSending a keep-alive PING to keep the connection alive.request header list larger than peer's advertised limitdns: svcbmandatory: value length is not a multiple of 2error when getting key of section %q: key %q not existstimes are expected to have the format HH:MM:SS[.NNNNNN]number must have at least one digit between underscoresmap merge requires map or sequence of maps as the valuealias value must contain alphanumerical characters only %s &wire.MaxStreamsFrame{Type: bidi, MaxStreamNum: %d}expected preferred_address to be %d long, read %d bytesedwards25519: invalid SetBytesWithClamping input lengtherror parsing list, expected comma or list end, got: %sDecodeSEG6Srh: error parsing Segment List (buf len: %d)extension number %d is already registered on message %vindent may only be composed of space and tab characterstls: TLS 1.3 client supports illegal compression methodstls: SendSessionTicket called before handshake completedstrings: illegal use of non-zero Builder copied by valuex509: subject key identifier incorrectly marked criticalx509: internal error: empty chain when appending CA certx509: invalid MaxPathLen, must be greater or equal to -1range function continued iteration after loop body panicrange function continued iteration after whole loop exitprofilealloc called without a P or outside bootstrappingdetected possible issues with cleanups and/or finalizersin gcMark expecting to see gcphase as _GCmarkterminationruntime: netpoll: eventfd ready for something unexpectedsemaphore wake of synctest goroutine from outside bubbleRegisterFlagCompletionFunc: flag '%s' already registeredfile URLs must leave host empty or use localhost: got %vptrEncoder.encode should have emptied ptrSeen via defershttp2: request body larger than specified content lengthhttp2: response header list larger than advertised limithttp: Request.RequestURI can't be set in client requestspromised request headers cannot include pseudo header %qnet/http: Transport.DialContext hook returned (nil, nil)b4050a850c04b3abf54132565044b0b7d7bfd8ba270b39432355ffb4b70e0cbd6bb4bf7f321390b94a03c1d356c21122343280d6115c1d21bd376388b5f723fb4c22dfe6cd4375a05a07476444d5819985007e34crypto/cipher: internal error: generic CBC used with AEScrypto/cipher: internal error: generic CTR used with AESnon-empty pointer map passed for non-pointer-size valuesreflect: Value.SetIterValue called on exhausted iteratorrecord on line %d; parse error on line %d, column %d: %v<- Reading packet %d (%d bytes) for connection %s, 1-RTTexpected initial_source_connection_id to equal %s, is %sSTREAM frames are handled with their respective streams.Rejecting new connection due to ConnContext callback: %sConn has send buffer of %d kiB (wanted: at least %d kiB)cannot add nested value to auto-increment or boolean keytoml: not encoding uint (%d) greater than max int64 (%d)attempted to go past the end of stream; corrupted value?anchor value must contain alphanumerical characters onlyoption ,inline may only be used on a struct or map field %s &wire.StreamsBlockedFrame{Type: uni, MaxStreams: %d}StreamFrame: attempting to write empty frame without FINremaining length (%d) smaller than parameter length (%d)wrong length for stateless_reset_token: %d (expected 16)TransportParameter BUG: transport parameter %d not foundhttps://protobuf.dev/reference/go/faq#namespace-conflictpacked private key must be of mode3.PrivateKeySize bytespacked private key must be of mode2.PrivateKeySize bytesa powerful, lightning fast and censorship resistant proxyAperture Internet Laboratory tls: client sent invalid encrypted_client_hello extensiontls: Ed25519 public keys are not supported before TLS 1.2received record with version %x when expecting version %xtls: server sent an unnecessary HelloRetryRequest messagetls: server selected an invalid PSK and cipher suite pairtls: no key exchanges supported by both client and servertls: client sent invalid encrypted client hello extensionx509: failed to parse EC private key embedded in PKCS#8: runtime: checkmarks found unexpected unmarked object obj=runtime: failed to disable profiling timer; timer_delete(non-Go code set up signal handler without SA_ONSTACK flaghttp2: TLS conn unexpectedly found in unencrypted handoffbackend tried to switch protocol %q when %q was requestedloading existing private key for reuse with issuer %s: %vsync: WaitGroup misuse: Add called concurrently with Waitsync: WaitGroup.Add called from multiple synctest bubblescrypto/cipher: invalid buffer overlap of output and inputcan't handle assignment of %s to empty interface argumentcannot run executable found relative to current directory (set GODEBUG=execwait=2 to capture stacks for debugging)crypto/drbg: internal error: request size exceeds maximumlwt bpf encode: bpf obj definitions returned empty buffercongestion BUG: decreased max datagram size from %d to %d %s &wire.StreamsBlockedFrame{Type: bidi, MaxStreams: %d}invalid value for max_udp_payload_size: %d (minimum 1200)ACK contains more ECN counts than ECN-marked packets sentMax outstanding limited: tracking %d packets, maximum: %dDecodeSEG6Encap: error parsing Segment List (buf len: %d)unkown field number %d while unmarshalling EditionDefaulttls: FIPS 140-3 requires the use of Extended Master Secrettls: server changed cipher suite after a HelloRetryRequestcalled CompareAndSwap when value is not of comparable typex509: authority key identifier incorrectly marked criticalx509: certificate contains duplicate extension with OID %qx509: failed to parse RSA private key embedded in PKCS#8: x509: provided PrivateKey doesn't match parent's PublicKeyDNS response contained records which contain invalid names"help" flag declared as non-bool. Please correct your codeGenerate the autocompletion script for the specified shelljson: cannot set embedded pointer to unexported struct: %vcannot push URL with scheme %q from request with scheme %qhttp2: client connection force closed via ClientConn.Closecache must be initialized with a GetConfigForCert callbackno information found to solve challenge for identifier: %sno matching certificate; will choose from all certificatescrypto/elliptic: ScalarMult was called on an invalid pointsync/atomic: swap of inconsistently typed value into Valuecrypto/ecdh: bad X25519 remote ECDH input: low order pointreceived conflicting connection IDs for sequence number %dreceived CRYPTO frame with unexpected encryption level: %sdns: svcbnodefaultalpn: no-default-alpn must have no valueGODEBUG=execwait=2 detected a leaked exec.Cmd created by: inline table cannot contain nested tables, only key-valuesfailed to ParseRouteAttr for IFLA_MACVLAN_MACADDR_DATA: %vIncreasing receive flow control window for stream %d to %dreceived ACK for key phase %d, but peer didn't update keysgob: cannot encode nil pointer of type %s inside interfaceThis should only happen 1 in 2^{128}: something is wrong.tls: server resumed a session with a different cipher suitetls: server selected TLS 1.3 using the legacy version fieldtls: server sent an unnecessary HelloRetryRequest key_sharetls: client didn't send one key share in second ClientHellotls: client sent unexpected key share in second ClientHelloruntime: mmap: too much locked memory (check 'ulimit -l'). tried to trace goroutine with invalid or unsupported statushttp2: Transport received Server's graceful shutdown GOAWAYRoundTripper returned a response & error; ignoring responsehttp: superfluous response.WriteHeader call from %s (%s:%d)http: response.Write on hijacked connection from %s (%s:%d)unsupported scheme for HTTP proxy (use http:// or https://)ecdsa: internal error: ordInverse produced an invalid valuesync: WaitGroup is reused before previous Wait has returnedcrypto/rc4: use of RC4 is not allowed in FIPS 140-only modesync/atomic: store of inconsistently typed value into Valuecrypto/ecdh: private key and public key curves do not matchcrypto/md5: use of MD5 is not allowed in FIPS 140-only modereflect: reflect.Value.Elem on an invalid notinheap pointerreflect: indirection through nil pointer to embedded structbufio.Scanner: SplitFunc returns advance count beyond inputneed one more IPv4 address in first prefix for system stackneed one more IPv6 address in first prefix for system stackRejecting new connection due to GetConfigForClient callbackConn has receive buffer of %d kiB (wanted: at least %d kiB)tried to send an ECN-marked packet although ECN is disabledhpke: mandatory-to-implement cipher suite not supported: %stoml: decoding can only be performed into a pointer, not %stoml: cannot convert map key of type %s to expected type %sRetire Prior To value (%d) larger than Sequence Number (%d)key '%s' expected start of object ('{') or assignment ('=')Generate a hysteria2:// URI from a client config for sharingtls: no supported versions satisfy MinVersion and MaxVersiontls: initial handshake had non-empty renegotiation extensiontls: server resumed a session with a different EMS extensiontls: client requested unsupported application protocols (%q)called CompareAndDelete when value is not of comparable typex509: certificate is valid for %d names, but none matched %smanual span allocation called with non-manually-managed typeaddr range base and limit are not in the same memory segmentruntime: failed to configure profiling timer; timer_settime(runtime: malformed profBuf buffer - tag and data out of sync (Client.Timeout or context cancellation while reading body)internal error: attempt to send frame on a closed stream: %vmalformed response from server: missing status pseudo headernet/http: server response headers exceeded %d bytes; abortedfailed storage check: %v - storage is probably misconfiguredexternal certificate manager: %s: filling cert from leaf: %vbytes.Reader.UnreadRune: previous operation was not ReadRunesync/atomic: compare and swap of inconsistently typed valuesreflect: call of reflect.Value.Cap on ptr to non-array Valuereflect: call of reflect.Value.Len on ptr to non-array ValueBUG: readPosInFrame (%d) > frame.DataLen (%d) in stream.Readhttp3: invalid use of RequestStream.Read before ReadResponsefound a tab character where an indentation space is expectedinvalid value for active_connection_id_limit: %d (minimum 2) Queuing ACK because there's a new missing packet to report.Loss detection alarm fired in loss timer mode. Loss time: %sLoss detection alarm for %s fired in PTO mode. PTO count: %dCryptoSetup: keys at this encryption level not yet availablestart pointer address (%d) is after end pointer address (%d)failed getting ZeroSSL EAB credentials: HTTP %d: %s (code %d)tls: unsupported certificate: private key is %T, expected *%Ttls: EncryptedClientHelloConfigList contains no valid configstls: server sent a ServerHello extension forbidden in TLS 1.3tls: received a session ticket with empty opaque ticket labeltls: client certificate used with invalid signature algorithmx509: failed to parse URI constraint %q: cannot be IP address is in a tiny block with other (possibly long-lived) values runtime: may need to increase max user processes (ulimit -u) "version" flag declared as non-bool. Please correct your codeto request completion choices for the specified command-line.net/http: invalid Cookie.Domain %q; dropping domain attributeReverseProxy must have exactly one of Director or Rewrite setreflect: wrong return count from function created by MakeFuncReceived a Version Negotiation packet. Supported Versions: %sSending stateless reset to %s (connection ID: %s). Token: %#xexec: Cmd started a Process but leaked without a call to Waitbigmod: internal error: u and v are not in the expected stateinvalid base '%c', should have been checked by scanIntOrFloatinternal error: unexpected tail comment event (please report)lwt bpf decode: received unknown attribute: type: %d, len: %dpacked public key must be of eddilithium4.PublicKeySize bytespacked public key must be of eddilithium2.PublicKeySize bytestls: server echoed TLS 1.3 compatibility session ID in TLS 1.2tls: server did not send a quic_transport_parameters extensiontls: client used the legacy version field to negotiate TLS 1.3tls: client did not send a quic_transport_parameters extensiontls: certificate cannot be used with the selected cipher suitex509: failed to marshal EC private key while building PKCS#8: x509: certificate is not authorized to sign other certificatesx509: certificate is valid for %d IP SANs, but none matched %sURI with empty host (%q) cannot be matched against constraintsx509: certificate private key does not implement crypto.Signerfound bad pointer in Go heap (incorrect use of unsafe or cgo?)limiterEvent.stop: found wrong event in p's limiter event slotslice length too short to convert to array or pointer to arrayruntime: internal error: misuse of lockOSThread/unlockOSThreadstrings.Reader.UnreadRune: previous operation was not ReadRunetrying to put back buffer of the wrong size in the copyBufPoolno configuration associated with certificate; unable to managecrypto/sha1: use of SHA-1 is not allowed in FIPS 140-only mode0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZreflect.ArrayOf: array size would exceed virtual address spacereflect: reflect.Value.Pointer on an invalid notinheap pointerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789expected original_destination_connection_id to equal %s, is %sDropping packet from %s (%d bytes). Server receive queue full.Received a stateless reset with token %#x. Closing connection.toml: cannot decode TOML %s into struct field %s.%s of type %scannot have key %q in inlined map: conflicts with struct fieldgateway, source, and destination ip are not the same IP familywrong length for disable_active_migration: %d (expected empty)AuthEncapsulateDeterministically is not supported for this KEMtls: unexpected encrypted client hello extension in serverHellotls: unexpected switch in encrypted client hello extension typeinternal/sync.HashTrieMap: ran out of hash bits while iteratinginternal/sync.HashTrieMap: ran out of hash bits while insertingruntime.AddCleanup: ptr is equal to arg, cleanup will never runcrypto/ecdh: use of X25519 is not allowed in FIPS 140-only mode may be in the same tiny block as cleanup or cleanup argument malformed GOMEMLIMIT; see `go doc runtime/debug.SetMemoryLimit`Request shell completion choices for the specified command-linehttp2: push would exceed peer's SETTINGS_MAX_CONCURRENT_STREAMSrequest declared a Content-Length of %d but only wrote %d bytes

HTTP Error 431

Request Header Field(s) Too Large

internal error: exactly one of res or err should be set; nil=%vcryptobyte: BuilderContinuation reallocated a fixed-size buffercrypto/ecdh: internal error: public key is the identity elementreceived invalid offset %d on crypto stream, maximum allowed %dPacketPacker BUG: packet too large (%d bytes, allowed %d bytes)http3: invalid duplicate use of RequestStream.SendRequestHeaderdns: internal error: unpack should never be called on RR_Headergave up after %d attempts, last error unavailable (resp == nil)parser should not permit expression of kind %s at document rootnew destination and destination are not the same address familypacked private key must be of eddilithium4.PrivateKeySize bytespacked private key must be of eddilithium2.PrivateKeySize bytestls: certificate private key does not implement crypto.Decrypterruntime.SetFinalizer: first argument was allocated into an arenaattempted to trace stack of a goroutine this thread does not own0000000000000000000000000000000000000000000000000000000000000000 json: invalid number literal, trying to unmarshal %q into Numberhttp: request method or response status code does not allow bodyhttp2: too many control frames in send queue, closing connection Content-Type: text/plain; charset=utf-8 Connection: close suppressing panic for copyResponse error in test; copy error: %vcan't switch protocols using non-Hijacker ResponseWriter type %Terror while checking if stored certificate is also expiring soon5ac635d8aa3a93e7b3ebbd55769886bc651d06b0cc53b0f63bce3c3e27d2604b6b17d1f2e12c4247f8bce6e563a440f277037d812deb33a0f4a13945d898c2964fe342e2fe1a7f9b8ee7eb4a7c0f9e162bce33576b315ececbb6406837bf51f5reflect.StructOf: struct size would exceed virtual address spaceABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_shouldn't queue undecryptable packets after handshake completionClient sent an invalid retry token. Sending INVALID_TOKEN to %s.failed to increase send buffer size (wanted: %d kiB, got %d kiB). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . readPythonMultilines: failed to skip to the end, returning errorRestoring of transport parameters from session ticket failed: %sunmarshaling transport parameters from session ticket failed: %sDropping key phase %d ahead of scheduled time. Drop time was: %sextension %v has mismatching containing message: got %v, want %vtls: internal error: attempted to read record with QUIC transporttls: server selected an invalid version after a HelloRetryRequesttls: session supported extended_master_secret but client does nottls: second client hello missing encrypted client hello extensionx509: policy constraints inhibitPolicyMapping field overflows intx509: inner and outer signature algorithm identifiers don't matchx509: issuer name does not match subject from issuing certificatex509: certificate request contains duplicate requested extensionsuser arena chunk size is not a multiple of the physical page sizeruntime.SetFinalizer: pointer not at beginning of allocated blockhttp: response.WriteHeader on hijacked connection from %s (%s:%d)net/http: Transport.DialTLS or DialTLSContext returned (nil, nil)crypto/des: use of TripleDES is not allowed in FIPS 140-only modecryptobyte: high-tag number identifier octets not supported: 0x%xcryptobyte: pending child length %d exceeds %d-byte length prefixreflect: StructOf does not support methods of embedded interfaces'%s' expected type '%s', got unconvertible type '%s', value: '%v'Received first packet. Switching destination connection ID to: %sencryption level changed, but crypto stream has more data to readextended CONNECT: :scheme, :path and :authority must not be emptynistec: internal error: p224Table called with out-of-bounds valuenistec: internal error: p256Table called with out-of-bounds valuenistec: internal error: p384Table called with out-of-bounds valuenistec: internal error: p521Table called with out-of-bounds value %s &wire.MaxStreamDataFrame{StreamID: %d, MaximumStreamData: %d}cryptoSetup BUG: unexpected QUICStoreSession event for the servertls: certificate private key (%T) does not implement crypto.Signerclient doesn't support ECDHE, can only use legacy RSA key exchangetls: server sent an unexpected quic_transport_parameters extensiontls: client sent an unexpected quic_transport_parameters extensionx509: policy constraints requireExplicitPolicy field overflows intx509: certificate is not valid for any names, but wanted to match x509: requested SignatureAlgorithm does not match private key typeruntime: unexpected error while checking standard file descriptor casGToWaitingForSuspendG with non-isWaitingForSuspendG wait reasonsender tried to send more than declared Content-Length of %d bytesunable to get configuration to manage certificate; unable to renewsync: WaitGroup.Add called from inside and outside synctest bubblereflect: indirection through nil pointer to embedded struct field Got Datagram. data: %#v %#v %#v %#v %#v %#v datagram address: %#v received conflicting stateless reset tokens for sequence number %dParsed a coalesced packet. Part %d: %d bytes. Remaining: %d bytes.Dropping %s packet (%d bytes) because we already dropped the keys.-> Sending packet %d (%d bytes) for connection %s, 1-RTT (ECN: %s)-> Sending coalesced packet (%d parts, %d bytes) for connection %sreceived packet for path %s that was already probed, validated: %tfailed to parse version for sending version negotiation packet: %shttp3: invalid use of RequestStream.Write before SendRequestHeadercan only use a single QUIC version for dialing a HTTP/3 connectionskipping challenge initiation because authorization is not pendinginternal error: attempted to parse unknown event (please report): Increasing receive flow control window for the connection to %d kBtoml: key %s already exists as a %s, but should be an array tableDescriptor.Options called without importing the descriptor packagetls: server sent certificate containing RSA key larger than %d bitstls: client sent certificate containing RSA key larger than %d bitsx509: internal error: supported public key does not implement EqualHelp provides help for any command in the application. Simply type cannot make valid ACMEIssuer without an associated CertMagic configcannot make a valid config without a pointer to a certificate cachecrypto/cipher: invalid buffer overlap of output and additional dataReceived %d packets after sending CONNECTION_CLOSE. Retransmitting.Dropping %s packet (%d bytes) that could not be unpacked. Error: %sfailed to increase receive buffer size (wanted: %d kiB, got %d kiB)no compatible QUIC version found (we support %s, server offered %s)inconsistent transport parameter length for transport parameter %#xinvalid logger type passed, must be Logger or LeveledLogger, was %Tfield %v with invalid Mutable call on field with non-composite typeif non-empty, httptest.NewServer serves on this address and blocks.tls: internal error: sending non-handshake message to QUIC transportcrypto/hmac: hash generation function does not produce unique valuesembedded IPv4 address must replace the final 2 fields of the addressAllThreadsSyscall6 results differ between threads; runtime corruptedFailed to find flag %q and mark it as being required in a flag grouppadding bytes must all be zeros unless AllowIllegalWrites is enabledhttp2: Transport conn %p received error from processing frame %v: %vhttp2: Transport received unsolicited DATA frame; closing connectionhttp: message cannot contain multiple Content-Length headers; got %qcertificate does not need to be renewed, but renewal is being forced[ERROR] TLS-ALPN challenge server: expected tls.Conn but got %T: %#v2695994666715063979466701508701963067355791626002630814351006629888126959946667150639794667015087019625940457807714424391721682722368061crypto/rsa: only crypto/rand.Reader is allowed in FIPS 140-only modebig: invalid 2nd argument to Int.Jacobi: need odd integer but got %sreflect: reflect.Value.UnsafePointer on an invalid notinheap pointercan not look up shorthand which is more than one ASCII character: %qreceived retry_source_connection_id, although no Retry was performedDropping a packet that is too small to be a valid Initial (%d bytes)Replacing connection for connection IDs %s with a closed connection.strict mode: fields in the document are missing in the target structexpected SCALAR, SEQUENCE-START, MAPPING-START, or ALIAS, but got %vVersion Negotiation packet has a version list with an invalid lengthinvalid descriptor: using edition features in a proto with syntax %sextension %v does not implement protoreflect.ExtensionTypeDescriptortls: peer doesn't support the certificate custom signature algorithmstls: handshake message of length %d bytes exceeds maximum of %d bytestls: client certificate contains an unsupported public key of type %Ttoo many hex fields to fit an embedded IPv4 at the end of the addresshttp2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)%s matches more methods than %s, but has a more specific path pattern%s matches fewer methods than %s, but has a more general path patternin case of issues. You can leave it blank, but we don't recommend it.invalid: OCSP response for %v valid after certificate expiration (%s)response Content-Type is %s but target container is not io.Writer: %Tcrypto/ecdh: only crypto/rand.Reader is allowed in FIPS 140-only modereflect: embedded interface with unexported method(s) not implemented'%s': expected source data to have length less or equal to %d, got %dOnLost callback called although there's no MTU probe packet in flightpacket too small, expected at least 20 bytes after the header, got %d %s &wire.StreamDataBlockedFrame{StreamID: %d, MaximumStreamData: %d}edwards25519: internal error: setShortBytes called with a long stringx509: PKCS#8 wrapping contained private key with unknown algorithm: %vx509: certificate relies on legacy Common Name field, use SANs insteadgot %s for stream %d; expected CONTINUATION following %s for stream %dbytes.Buffer: UnreadByte: previous operation was not a successful readcrypto/ecdsa: only crypto/rand.Reader is allowed in FIPS 140-only modecrypto/ed25519: use of Ed25519ctx is not allowed in FIPS 140-only modesync/atomic: compare and swap of inconsistently typed value into ValueOnAcked callback called although there's no MTU probe packet in flightskipping validation of new path %s since no connection ID is availabledns: svcbipv6hint: ipv6 address byte array length not a multiple of 16 %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, DelayTime: %s%s}ACK contains fewer new ECN counts than acknowledged ECN-marked packetstls: peer doesn't support any of the certificate's signature algorithmsx509: issuer has name constraints but leaf doesn't have a SAN extensionrange function recovered a loop body panic and did not resume panickingif any flags in the group [%v] are set they must all be set; missing %vjson: invalid use of ,string struct tag, trying to unmarshal %q into %vinternal error: attempt to send frame on a half-closed-local stream: %vinternal error: 101 switching protocols response with non-writable bodyPlease enter your email address to signify agreement and to be notifiedthere is only one chain offered; selecting it regardless of preferencesall external certificate managers yielded no certificates and no errorsDuckDNS request failed, expected (OK) but got (%s), url: [%s], body: %scrypto/ecdsa: use of custom curves is not allowed in FIPS 140-only modetoo many concurrent operations on a single file or socket (max 1048575)PacketPacker BUG: payload size inconsistent (expected %d, got %d bytes)Not adding connection ID %s for a new connection, as it already exists.dynamic table size update MUST occur at the beginning of a header blockexec: command with a non-nil Cancel was not created with CommandContextpacket length (%d bytes) is smaller than the expected length (%d bytes) %s &wire.ResetStreamFrame{StreamID: %d, ErrorCode: %#x, FinalSize: %d}toml: cannot redefine table %s that has already been explicitly definedclient doesn't support any cipher suites compatible with the certificatetls: server's certificate contains an unsupported type of public key: %Ttls: second client hello encrypted client hello extension does not matchtls: certificate private key of type %T does not implement crypto.Signerruntime.Goexit called in a thread that was not created by the Go runtime{{with .Name}}{{printf "%s " .}}{{end}}{{printf "version %s" .Version}} crypto/rsa: use of multi-prime keys is not allowed in FIPS 140-only modecrypto/fips140: FIPS 140-3 mode enabled, but integrity check didn't passreflect: embedded type with methods not implemented for non-pointer typeIgnoring Retry, since the server didn't change the Source Connection ID.received packet for previously unseen path %s, but already have %d pathsdns: svcbipv4hint: ipv4 address byte array length is not a multiple of 4tls: received unexpected handshake message of type %T when waiting for %Ttls: internal error: handshake returned an error but is marked successfultls: found a certificate rather than a key in the PEM for the private keygo package net: GODEBUG=netdns contains an invalid dns mode, ignoring it coalesced packet has different destination connection ID: %s, expected %sconnection doesn't allow setting of send buffer size. Not a *net.UDPConn?RESET_STREAM_AT: reliable size can't be larger than final size (%d vs %d)Limited by the number of tracked packets: tracking %d packets, maximum %dreceived inconsistent final offset for stream %d (old: %d, new: %d bytes)tls: certificate RSA key size too small for supported signature algorithms if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; thenhttps://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geoip.datbytes.Buffer: UnreadRune: previous operation was not a successful ReadRunemalformed response from server: malformed non-numeric status pseudo headernet/http: server replied with more than declared Content-Length; truncatedcrypto/rsa: use of keys with odd size is not allowed in FIPS 140-only modecrypto/rand: failed to read random data (see https://go.dev/issue/66821): received NEW_CONNECTION_ID frame but zero-length connection IDs are in useDropping undecryptable packet (%d bytes). Undecryptable packet queue full.Amplification window limited. Received %d bytes, already sent out %d bytesAddAttrs unsafely called on copy of Record made without using Record.Clonetls: internal error: attempted to read record with pending application datatls: client sent encrypted_client_hello extension with unsupported versionstls: client sent encrypted_client_hello extension but did not offer TLS 1.3%[2]s is a special command that is used by the shell completion logic %[1]sUnsolicited response received on idle HTTP channel starting with %q; err=%vcertificate revoked, but unable to fully clean up assets from issuer %s: %vno configuration associated with certificate; unable to manage OCSP staplesACK rate too low: %.2f, clamped to %.2f (total=%d, ack=%d, loss=%d, rtt=%d)Disabling ECN. Received less ECT(0) + ECN-CE than packets sent with ECT(0).Disabling ECN. Received less ECT(1) + ECN-CE than packets sent with ECT(1).tls: failed to send closeNotify alert (but connection was closed anyway): %wtls: no cipher suite supported by both client and server; client offered: %xtls: server certificate contains incorrect key type for selected ciphersuitehttps://cdn.jsdelivr.net/gh/Loyalsoldier/v2ray-rules-dat@release/geosite.datHTTP/1.0 400 Bad Request Client sent an HTTP request to an HTTPS server. on-demand certificate's OCSP status is REVOKED; will try to forcefully renewcrypto/rsa: use of even public exponent is not allowed in FIPS 140-only modeunable to redefine %q shorthand in %q flagset: it's already used for %q flagconnection doesn't allow setting of receive buffer size. Not a *net.UDPConn? %s &wire.CryptoFrame{Offset: %d, Data length: %d, Offset + Data length: %d}crypto/tls: ExportKeyingMaterial is unavailable when renegotiation is enabledgithub.com/apernet/quic-go/internal/utils/ringbuffer: pop from an empty queueinvalid Body.Read call. After hijacked, the original Request must not be usedMapIter.Next called on an iterator that does not have an associated map Valueinvalid function signature for %s: second return value should be error; is %sgithub.com/quic-go/quic-go/internal/utils/ringbuffer: pop from an empty queueRemoving connection IDs %s for a closed connection after it has been retired.received offset %d for stream %d, but final offset was already received at %dreceived final offset %d for stream %d, but already received offset %d beforex509: signature check attempts limit reached while verifying certificate chainrange function continued iteration after function for loop body returned falseThis is a command line tool. You need to open cmd.exe and run it from there. Failed to find flag %q and mark it as being in a mutually exclusive flag groupgithub.com/apernet/quic-go/internal/utils/ringbuffer: peek from an empty queuepattern %q (registered at %s) conflicts with pattern %q (registered at %s): %sinvalid configuration: maxEvents = 0 and window != 0 does not allow any events115792089210356248762697446949407573530086143415290314195533631308867097853951115792089210356248762697446949407573529996955224135760342422259061068512044369crypto/rsa: use of PKCS#1 v1.5 encryption is not allowed in FIPS 140-only modereflect: embedded type with methods not implemented if type is not first fieldgithub.com/quic-go/quic-go/internal/utils/ringbuffer: back from an empty queuenistec: internal error: p256AffineTable.Select called with out-of-bounds valueinvalid quic-go log level, see https://github.com/apernet/quic-go/wiki/LoggingDisabling ECN. ECN-marked packet acknowledged, but no ECN counts on ACK frame.receivedPacketTracker BUG: ReceivedPacket called for old / duplicate packet %dtls: client certificate private key of type %T does not implement crypto.Signercannot convert slice with length %y to array or pointer to array with length %xhttp2: server closing client connection; error reading frame from client %s: %vinvalid configuration: maxEvents = 0 and window != 0 would not allow any eventscould not append records: Domain: %s; Record: %s, Status: %v; Body: %s; PUT: %sgithub.com/quic-go/quic-go/internal/utils/ringbuffer: offset from invalid indexgithub.com/quic-go/quic-go/internal/utils/ringbuffer: front from an empty queuename %v does not contain enough fields; expected format: '_service._proto.name'local datetimes are expected to have the format YYYY-MM-DDTHH:MM:SS[.NNNNNNNNN]toml: type %s implementing the TextMarshaler interface cannot be a root elementtls: either ServerName or InsecureSkipVerify must be specified in the tls.Configx509: invalid signature: parent certificate cannot sign this kind of certificatehttp: RoundTripper implementation (%T) returned a nil *Response with a nil errorbug: unexpected way for two patterns %s and %s to conflict: methods %s, paths %scrypto/ecdh: internal error: nistec ScalarBaseMult failed for a fixed-size inputDropping %s packet (%d bytes) for which we couldn't unpack the header. Error: %sno port can be announced, specify it explicitly using Server.Port or Server.AddrUnable to extract port from listener, will not be announced using SetQUICHeaderscrypto/rand: blocked for 60 seconds waiting to read random data from the kernel Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sVersion: %s}Disabling ECN. Received more ECT(0) / ECT(1) acknowledgements than packets sent.received packet number %d on a 0-RTT packet after receiving %d on a 1-RTT packet (bad use of unsafe.Pointer or having race conditions? try -d=checkptr or -race) if any flags in the group [%v] are set none of the others can be; %v were all set[ERROR] Keeping lock file fresh: %v - terminating lock maintenance (lockfile: %s)could not delete requested records: Domain: %s; Records: %v, Status: %v; Body: %scrypto/rsa: use of public exponent <= 2¹⁶ is not allowed in FIPS 140-only modecrypto/rsa: use of primes of different sizes is not allowed in FIPS 140-only modeBUG: ackhandler would have acked wrong packet %d, while evaluating range %d -> %dx509: a root or intermediate certificate is not authorized to sign for this name: certificate expires soon but is already being renewed; serving current certificateno memory of presenting a DNS record for %q (usually OK if presenting also failed)refusing to use HTTP_PROXY value in CGI environment; see golang.org/s/cgihttpproxytls: failed to decrypt second client hello encrypted client hello extension payloadcrypto/hkdf: use of keys shorter than 112 bits is not allowed in FIPS 140-only modex509: issuer has name constraints but leaf contains unknown or unconstrained name: (possibly because of %q while trying to verify candidate authority certificate %q)expected all size classes up to min size for malloc header to fit in one-page spansjson: invalid use of ,string struct tag, trying to unmarshal unquoted value into %vno issuers configured; impossible to renew or check existing certificate in storagecrypto/rsa: use of keys smaller than 2048 bits is not allowed in FIPS 140-only modecrypto/cipher: use of CBC with non-AES ciphers is not allowed in FIPS 140-only modecrypto/cipher: use of CTR with non-AES ciphers is not allowed in FIPS 140-only modecrypto/cipher: use of GCM with non-AES ciphers is not allowed in FIPS 140-only modecrypto/hmac: use of keys shorter than 112 bits is not allowed in FIPS 140-only modereflect: embedded type with methods not implemented if there is more than one fieldhttp3: invalid duplicate use of RequestStream.ReadResponse before SendRequestHeadergave up after %d attempts, last error unavailable (error reading response body: %v)BandwidthEstimate: %s, CongestionWindowGain: %.2f, PacingGain: %.2f, PacingRate: %stls: downgrade attempt detected, possibly due to a MitM attack or a broken middleboxx509: signature algorithm specifies an %s public key, but have public key of type %TpacketPacker BUG: Peeked and Popped packet numbers do not match: expected %d, got %dDropping a packet with an unsupported version number %d that is too small (%d bytes)x509: failed to parse private key (use ParseECPrivateKey instead for this key format)http: WriteHeader called with both Transfer-Encoding of %q and a Content-Length of %dunable to obtain new to certificate after OCSP status of REVOKED; removing from cachecrypto/rsa: use of PSS salt longer than the hash is not allowed in FIPS 140-only modereflect.Value.Interface: cannot return value obtained from unexported field or methodDropping a packet with an unknown version for which we failed to parse connection IDsPacketConn is not a net.UDPConn. Disabling optimizations possible on UDP connections.tls: MinVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedtls: MaxVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedx509: a root or intermediate certificate is not authorized for an extended key usage: certificate has expired, but is already being renewed; waiting for renewal to completereflect: New of type that may not be allocated in heap (possibly undefined cgo C type) %s &wire.AckFrame{LargestAcked: %d, LowestAcked: %d, AckRanges: {%s}, DelayTime: %s%s}Sent %d packets with current key phase. Initiating key update to the next key phase: %dx509: failed to parse private key (use ParsePKCS8PrivateKey instead for this key format)x509: failed to parse private key (use ParsePKCS1PrivateKey instead for this key format)no issuers configured; impossible to obtain or check for existing certificate in storage Short Header{DestConnectionID: %s, PacketNumber: %d, PacketNumberLen: %d, KeyPhase: %s}certificate expires soon, but is already renewed in storage; reloading stored certificateDropping Initial packet (%d bytes) with unexpected source connection ID: %s (expected %s)%s: no solvers available for remaining challenges (configured=%v offered=%v remaining=%v)http2: server sent GOAWAY and closed the connection; LastStreamID=%v, ErrCode=%v, debug=%qOCSP status for managed certificate is REVOKED; attempting to replace with new certificatetls: unexpected encrypted client hello extension in server hello despite ECH being acceptedfailed to sufficiently increase send buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)Received %d packets with current key phase. Initiating key update to the next key phase: %dtls: server sent encrypted client hello retry configs after accepting encrypted client hellotls: handshake hash for a client certificate requested after discarding the handshake bufferIPv6 is not supported or enabled on this system, TUN device is created without IPv6 support.[INFO][%s] Lock for '%s' is stale (created: %s, last update: %s); removing then retrying: %shttp3: invalid use of RequestStream.SendRequestHeader with a request that has a request bodytls: unsupported certificate: private key is *ed25519.PrivateKey, expected ed25519.PrivateKeycrypto/rsa: %d-bit keys are insecure (see https://go.dev/pkg/crypto/rsa#hdr-Minimum_key_size)retired connection ID %d (%s), which was used as the Destination Connection ID on this packet----------------------------------------------------------------------------------------------failed to sufficiently increase receive buffer size (was: %d kiB, wanted: %d kiB, got: %d kiB)deprecated: golang.org/x/oauth2: Transport.CancelRequest no longer does anything; use contexts&wire.TransportParameters{OriginalDestinationConnectionID: %s, InitialSourceConnectionID: %s, size mismatch (see https://github.com/golang/protobuf/issues/1609): calculated=%d, measured=%dPerform a speed test through the proxy server. The server must have speed test support enabled.b3312fa7e23ee7e4988e056be3f82d19181d9c6efe8141120314088f5013875ac656398d8a2ed19d2a85c8edd3ec2aefaa87ca22be8b05378eb1c71ef320ad746e1d3b628ba79b9859f741e082542a385502f25dbf55296c3a545e3872760ab73617de4a96262c6f5d9e98bf9292dc29f8f41dbd289a147ce9da3113b5f0b8c00a60b1ce1d7e819d7a431d7c90ea0e5fcrypto/rsa: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modecrypto/hkdf: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modehttp: RoundTripper implementation (%T) returned a *Response with content length %d but a nil Bodyname.com will not allow an update to a record that has identical values to an existing record: %wcrypto/hmac: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modeNoClientCertRequestClientCertRequireAnyClientCertVerifyClientCertIfGivenRequireAndVerifyClientCertunable to get automation config for certificate; maintenance for this certificate will likely failcrypto/ecdsa: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modeload yielded different value than was stored; expected %d bytes, got %d bytes of differing elements %s &wire.StreamFrame{StreamID: %d, Fin: %t, Offset: %d, Data length: %d, Offset + Data length: %d}ed25519: expected opts.Hash zero (unhashed message, for standard Ed25519) or SHA-512 (for Ed25519ph)sentPacketHandler BUG: PTO fired, but bytes_in_flight is 0 and Initial and Handshake already droppedcgocheck > 1 mode is no longer supported at runtime. Use GOEXPERIMENT=cgocheck2 at build time instead.http2: failed reading the frame payload: %w, note that the frame header looked like an HTTP/1.1 header\A\s*(?:export\s+)?([\w\.]+)(?:\s*=\s*|:\s+?)('(?:\'|[^'])*'|"(?:\"|[^"])*"|[^#\n]+)?\s*(?:\s*\#.*)?\zHTTP/1.1 400 Bad Request Content-Type: text/plain; charset=utf-8 Connection: close 400 Bad Request Queueing ACK because packet %d packets were received after the last ACK (using initial threshold: %d).ed25519: expected opts.HashFunc() zero (unhashed message, for standard Ed25519) or SHA-512 (for Ed25519ph)asn1: time did not serialize back to the original value and may be invalid: given %q, but serialized as %qconfig returned for certificate %v is not nil and points to different cache; got %p, expected %p (this one)Starting new connection to %s (%s -> %s), source connection ID %s, destination connection ID %s, version %sgo package net: ignoring GODEBUG=netdns=cgo as the binary was compiled without support for the cgo resolver crypto/cipher: use of GCM with arbitrary IVs is not allowed in FIPS 140-only mode, use NewGCMWithRandomNonceinvalid nil message info; this suggests memory corruption due to a race or shallow copy on the message structtimed out waiting for record to fully propagate; verify DNS provider configuration is correct - last error: %v[INFO][%s] %s: Empty lockfile (%v) - likely previous process crashed or storage medium failure; treating as stale %s &wire.NewConnectionIDFrame{SequenceNumber: %d, RetirePriorTo: %d, ConnectionID: %s, StatelessResetToken: %#x}http2: Transport: cannot retry err [%v] after Request.Body was written; define Request.GetBody to avoid this errorhttp3: Transport: cannot retry err [%w] after Request.Body was written; define Request.GetBody to avoid this errorIncreasing receive flow control window for the connection to %d, in response to stream flow control window increase3940200619639447921227904010014361380507973927046544666794829340424572177149687032904726608825893800186160697311231939402006196394479212279040100143613805079739270465446667946905279627659399113263569398956308152294913554433653942643Perform a TCP ping to a specified remote address through the proxy server. Can be used as a simple connectivity test.tls: failed to find "CERTIFICATE" PEM block in certificate input after skipping PEM blocks of the following types: %vVersion: %s BuildDate: %s BuildType: %s Toolchain: %s CommitHash: %s Platform: %s Architecture: %s Libraries: quic-go=%s flags=() two_word_flags=() local_nonpersistent_flags=() flags_with_completion=() flags_completion=() tls: failed to find certificate PEM data in certificate input, but did find a private key; PEM inputs may have been switched{{with (or .Long .Short)}}{{. | trimTrailingWhitespaces}} {{end}}{{if or .Runnable .HasSubCommands}}{{.UsageString}}{{end}}--qr flag is deprecated and will be removed in future release, please use `share` subcommand to generate share URI and QR codeYour sites will be served over HTTPS automatically using an automated CA. By continuing, you agree to the CA's terms of service --------------------------------------------------------------------------------------------------------------------------------================================================================================================================================\000\001\002\003\004\005\006\007\008\009\010\011\012\013\014\015\016\017\018\019\020\021\022\023\024\025\026\027\028\029\030\031tls: failed to find PEM block with type ending in "PRIVATE KEY" in key input after skipping PEM blocks of the following types: %v Long Header{Type: %s, DestConnectionID: %s, SrcConnectionID: %s, %sPacketNumber: %d, PacketNumberLen: %d, Length: %d, Version: %s}0051953eb9618e1c9a1f929a21a0b68540eea2da725b99b315f3b8b489918ef109e156193951ec7e937b1652c0bd3bb1bf073573df883d2c34f1ef451fd46b503f0000c6858e06b70404e9cd9e3ecb662395b4429c648139053fb521f828af606b4d3dbaa14b5e77efe75928fe1dc127a2ffa8de3348b3c1856a429bf97e7e31c2e5bd66011839296a789a3bc0045c8a5fb42c7d1bd998f54449579b446817afbd17273e662c97ee72995ef42640c550b9013fad0761353c7086a272c24088be94769fd16650HTTP/1.1 431 Request Header Fields Too Large Content-Type: text/plain; charset=utf-8 Connection: close 431 Request Header Fields Too LargeGenerate the autocompletion script for %[1]s for the specified shell. See each sub-command's help for details on how to use the generated script. crypto/tls: ExportKeyingMaterial is unavailable when neither TLS 1.3 nor Extended Master Secret are negotiated; override with GODEBUG=tlsunsafeekm=1if [[ $(type -t compopt) = "builtin" ]]; then complete -o default -F __start_%s %s else complete -o default -o nospace -F __start_%s %s fi Received invalid IPv6 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.Received invalid IPv4 packet info control message: %+x. This should never occur, please open a new issue and include details about the architecture.68647976601306097149819007990813932172694353001433054093944634591855431833976560521225596406614545549772963113914808580371219879997166438125740282911150571516864797660130609714981900799081393217269435300143305409394463459185543183397655394245057746333217197532963996371363321113864768612440380340372808892707005449netlink socket in Android is banned by Google, use the root or system (ADB) user to run sing-box, or switch to the sing-box Adnroid graphical interface client[WARNING] OS reports a contradiction: %v - but we cannot connect to it, with this error: %v; continuing anyway 🤞 (I don't know what causes this... if you do, please help?)%[1]s and %[2]s both match some paths, like %[3]q. But neither is more specific than the other. %[1]s matches %[4]q, but %[2]s doesn't. %[2]s matches %[5]q, but %[1]s doesn't.http2: TLSConfig.CipherSuites is missing an HTTP/2-required AES_128_GCM_SHA256 cipher (need at least one of TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 or TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256)00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899duplicate registration of %q The generated definition for this file has moved: from: %q to: %q A dependency on the %q module must be at version %v or higher. Upgrade the dependency by running: go get -u %v InitialMaxStreamDataBidiLocal: %d, InitialMaxStreamDataBidiRemote: %d, InitialMaxStreamDataUni: %d, InitialMaxData: %d, MaxBidiStreamNum: %d, MaxUniStreamNum: %d, MaxIdleTimeout: %s, AckDelayExponent: %d, MaxAckDelay: %s, ActiveConnectionIDLimit: %d  @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?Generate the autocompletion script for powershell. To load completions in your current shell session: %[1]s completion powershell | Out-String | Invoke-Expression To load completions for every new session, add the output of the above command to your powershell profile. Generate the autocompletion script for the fish shell. To load completions in your current shell session: %[1]s completion fish | source To load completions for every new session, execute once: %[1]s completion fish > ~/.config/fish/completions/%[1]s.fish You will need to start a new shell for this setup to take effect. ░█░█░█░█░█▀▀░▀█▀░█▀▀░█▀▄░▀█▀░█▀█░░░▀▀▄ ░█▀█░░█░░▀▀█░░█░░█▀▀░█▀▄░░█░░█▀█░░░▄▀░ ░▀░▀░░▀░░▀▀▀░░▀░░▀▀▀░▀░▀░▀▀▀░▀░▀░░░▀▀▀ \127\128\129\130\131\132\133\134\135\136\137\138\139\140\141\142\143\144\145\146\147\148\149\150\151\152\153\154\155\156\157\158\159\160\161\162\163\164\165\166\167\168\169\170\171\172\173\174\175\176\177\178\179\180\181\182\183\184\185\186\187\188\189\190\191\192\193\194\195\196\197\198\199\200\201\202\203\204\205\206\207\208\209\210\211\212\213\214\215\216\217\218\219\220\221\222\223\224\225\226\227\228\229\230\231\232\233\234\235\236\237\238\239\240\241\242\243\244\245\246\247\248\249\250\251\252\253\254\255Generate the autocompletion script for the bash shell. This script depends on the 'bash-completion' package. If it is not installed already, you can install it via your OS's package manager. To load completions in your current shell session: source <(%[1]s completion bash) To load completions for every new session, execute once: #### Linux: %[1]s completion bash > /etc/bash_completion.d/%[1]s #### macOS: %[1]s completion bash > $(brew --prefix)/etc/bash_completion.d/%[1]s You will need to start a new shell for this setup to take effect. Generate the autocompletion script for the zsh shell. If shell completion is not already enabled in your environment you will need to enable it. You can execute the following once: echo "autoload -U compinit; compinit" >> ~/.zshrc To load completions in your current shell session: source <(%[1]s completion zsh) To load completions for every new session, execute once: #### Linux: %[1]s completion zsh > "${fpath[1]}/_%[1]s" #### macOS: %[1]s completion zsh > $(brew --prefix)/share/zsh/site-functions/_%[1]s You will need to start a new shell for this setup to take effect. Hysteria Traffic Stats API Server

This is a Hysteria Traffic Stats API server.

Check the documentation for usage.

{ local cur prev words cword split declare -A flaghash 2>/dev/null || : declare -A aliashash 2>/dev/null || : if declare -F _init_completion >/dev/null 2>&1; then _init_completion -s || return else __%[1]s_init_completion -n "=" || return fi local c=0 local flag_parsing_disabled= local flags=() local two_word_flags=() local local_nonpersistent_flags=() local flags_with_completion=() local flags_completion=() local commands=("%[1]s") local command_aliases=() local must_have_one_flag=() local must_have_one_noun=() local has_completion_function="" local last_command="" local nouns=() local noun_aliases=() __%[1]s_handle_word } firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHRESETHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTOPEXTTMETSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastIDUsage:{{if .Runnable}} {{.UseLine}}{{end}}{{if .HasAvailableSubCommands}} {{.CommandPath}} [command]{{end}}{{if gt (len .Aliases) 0}} Aliases: {{.NameAndAliases}}{{end}}{{if .HasExample}} Examples: {{.Example}}{{end}}{{if .HasAvailableSubCommands}}{{$cmds := .Commands}}{{if eq (len .Groups) 0}} Available Commands:{{range $cmds}}{{if (or .IsAvailableCommand (eq .Name "help"))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{else}}{{range $group := .Groups}} {{.Title}}{{range $cmds}}{{if (and (eq .GroupID $group.ID) (or .IsAvailableCommand (eq .Name "help")))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{if not .AllChildCommandsHaveGroup}} Additional Commands:{{range $cmds}}{{if (and (eq .GroupID "") (or .IsAvailableCommand (eq .Name "help")))}} {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{end}}{{end}}{{if .HasAvailableLocalFlags}} Flags: {{.LocalFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasAvailableInheritedFlags}} Global Flags: {{.InheritedFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasHelpSubCommands}} Additional help topics:{{range .Commands}}{{if .IsAdditionalHelpTopicCommand}} {{rpad .CommandPath .CommandPathPadding}} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableSubCommands}} Use "{{.CommandPath}} [command] --help" for more information about a command.{{end}} -----BEGIN RSA TESTING KEY----- MIIEvgIBADANBgkqhkiG9w0BAQEFAASCBKgwggSkAgEAAoIBAQDFyXr1E4l3GM34 wlmdsWtjHJCigAMKwnpUOS4zI1AiLH8eTXk2T+4XIFfUx775oSkaZjdEhjh9S8Qu pP+yu8AexNfBVVK20xxjylwAWZdKqjfHgy5RMb+MJfdV+2PSvcQzkzwiZjWvMD+O pNMsmDTSsP4Oa4MAFypC+hfD9FXzDXJNGLkE+gcMUP8BZO39iAy+TWXZir/EjxVs xQimMGgZfFaxJ69DmLazWaT3/JnO7RiynW1OXMOo49rjKwWMGK11eLB/GPG2/mde o4I/muF4o7SxYuTR960ynU5XklIkwAnDpzZkySVTZYyoASlGN0T+8d8i42D7IZpF GojTs1lFAgMBAAECggEAIYthUi1lFBDd5gG4Rzlu+BlBIn5JhcqkCqLEBiJIFfOr /4yuMRrvS3bNzqWt6xJ9MSAC4ZlN/VobRLnxL/QNymoiGYUKCT3Ww8nvPpPzR9OE sE68TUL9tJw/zZJcRMKwgvrGqSLimfq53MxxkE+kLdOc0v9C8YH8Re26mB5ZcWYa 7YFyZQpKsQYnsmu/05cMbpOQrQWhtmIqRoyn8mG/par2s3NzjtpSE9NINyz26uFc k/3ovFJQIHkUmTS7KHD3BgY5vuCqP98HramYnOysJ0WoYgvSDNCWw3037s5CCwJT gCKuM+Ow6liFrj83RrdKBpm5QUGjfNpYP31o+QNP4QKBgQDSrUQ2XdgtAnibAV7u 7kbxOxro0EhIKso0Y/6LbDQgcXgxLqltkmeqZgG8nC3Z793lhlSasz2snhzzooV5 5fTy1y8ikXqjhG0nNkInFyOhsI0auE28CFoDowaQd+5cmCatpN4Grqo5PNRXxm1w HktfPEgoP11NNCFHvvN5fEKbbQKBgQDwVlOaV20IvW3IPq7cXZyiyabouFF9eTRo VJka1Uv+JtyvL2P0NKkjYHOdN8gRblWqxQtJoTNk020rVA4UP1heiXALy50gvj/p hMcybPTLYSPOhAGx838KIcvGR5oskP1aUCmFbFQzGELxhJ9diVVjxUtbG2DuwPKd tD9TLxT2OQKBgQCcdlHSjp+dzdgERmBa0ludjGfPv9/uuNizUBAbO6D690psPFtY JQMYaemgSd1DngEOFVWADt4e9M5Lose+YCoqr+UxpxmNlyv5kzJOFcFAs/4XeglB PHKdgNW/NVKxMc6H54l9LPr+x05sYdGlEtqnP/3W5jhEvhJ5Vjc8YiyVgQKBgQCl zwjyrGo+42GACy7cPYE5FeIfIDqoVByB9guC5bD98JXEDu/opQQjsgFRcBCJZhOY M0UsURiB8ROaFu13rpQq9KrmmF0ZH+g8FSzQbzcbsTLg4VXCDXmR5esOKowFPypr Sm667BfTAGP++D5ya7MLmCv6+RKQ5XD8uEQQAaV2kQKBgAD8qeJuWIXZT0VKkQrn nIhgtzGERF/6sZdQGW2LxTbUDWG74AfFkkEbeBfwEkCZXY/xmnYqYABhvlSex8jU supU6Eea21esIxIub2zv/Np0ojUb6rlqTPS4Ox1E27D787EJ3VOXpriSD10vyNnZ jel6uj2FOP9g54s+GzlSVg/T -----END RSA TESTING KEY-----  37?/* & * ; 9 %#>'  1<   0 ")  7  +19$p$: r.r,r:>,s<s*L$L; )  4 4  ! #ʠʣʢʥʤʧʦʩʨؓߔ0 ,)4< '2869/9 :::%;/;%46 7*000.111022-33>'   #(66' &     5     <+)?45454)/)5+++ +<*&*"&8!!"+.4=    <>5<5!5#5&4447133.<.):)<) )+-+5$$''&"6" "   ?  (0 == =1 =, =  ?? < 9! 9) 97 99 6  6 6 7' 78 73 ' '&   3 /    "      > + / 6     <3 ;* 9" 9) 97 + (( &5 $ $ % #< #0 #  # !: ! ! 5  - ( .     $ "   2 =  & 1 : # <     2 1   / +     5 9 = ?1364<  % .2>13 %$8;422/,?  /><>>>:>+?>"4.<% 09'  # ! & " / , $ ' % ; = ? 9. 7 .:9' 1&90  96#20 2 0(2,3 :8% 5*;.-, 87/ ,--/( 57.97 *%60 ;'2.2=$=' 6,;., 2 5 4 ; > 8 * / , % & # !%$+.*&8>460 -2-2-2-2-2-2-2@ @ (3  )1;* # 0 ! !0 ?5   7 +# # 2   #;='  1  3. /,#>8 " 8> /'" + " /1 74 ","?$5<3=*8  7+7(;?  $$;,$  >>  )    '< .' " )*)<,  . # ' 8 %2+&0 )4   * $ 0 *( 29,4'  : . . +0   "0 ;,/"1 .  7 2 . 1 :/0+- , =  ;/ :  . 4  1#4"'8>57&9+ .  ,> 4#%"  +  +  +   =   &0(75'6.=;;, > < % < %!   0' = >4>&? ?( - :3 8:   72% "< /<>+ '?   <=  "  )= /4 7 : ?3 :/   7"0(  %< +  70 >570 =%, 9# >  < +,:%" $ =+ /  ' #   22< 1  -  ?   1& / $<3 $  ?5 ##02(+   +02  + -? #: # %$ >+ 01 1 9    *) - .1 .2 < >  3  2  %,&!"9(  2    #().1 $ '8 07#7-)2 6  (!5  / , 3 ,1 /5 "1 "  ?% <, ?# > &  : + " )   - ( ) /  . , /* -9 "8 %  : ; ? 3% 6 6 7 , ,    8*/24:"+ 0& ;>$>292:1,1<17#7* '-4*7'!%7  1 .0=  :*1-"32:0$6445  7  +  +- 8 8 8 8% 8! 8- 8/ 8+ 87 85 9  9  9 9 u uuu  9 9 `;`>`9`8`7`*`-`,  & =. =% > > ? ?  ?  ?  ? > > >  >, >  ? ? ? ? ? ? ? ? ? ?  ? ? ?  =2 =6 < <:!:#8 :&8 :$:,88:*:7:5:;::<:4:':-:%:?:=:):/s' = +* 99 9; 9? )  (%(')+/ " " "' "/ "3 "$$!8745' 2=;: $ ) $ , .  .# (/ % 90 4  # , 2  :3      0> -> <+ 8 3  % "&   %9 &2 &0 ! !7 5 =4 ? >  : 9  % - - ,4 ., )  6! 1 3 + 8  8= ( ( +   3)!  %#>"%*;70 ; /-715+>79+, "0 ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전)(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)212223242526272829303132333435참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパートアルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキログラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポイントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlklfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhahpinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日18日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմխיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּוֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئمئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحطمظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمينجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترتزتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيسىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميحمىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمىفخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنمينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمينحيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليهوسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\$%@ـًـَـُـِـّـْءآأؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا"'/^|~¢£¬¦¥ːˑʙɓʣꭦʥʤɖɗᶑɘɞʩɤɢɠʛʜɧʄʪʫꞎɮʎøɶɷɺɾʀʨʦꭧʧʈⱱʏʡʢʘǀǁǂ𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκλμνξοστυψ∇∂ϝабгежзиклмпруфхцчшыэюꚉәіјөүӏґѕџҫꙑұٮڡٯ0,1,2,3,4,5,6,7,8,9,(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)〔s〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申割営配〔本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉卑博即卽卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢㠯巽帨帽幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最暜肭䏙朗望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸瑇瑜瑱璅瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦若茝荣莭茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷䧦雃嶲霣䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻AAAAAA C'EEEEIIIINOOOOOUUUUYaaaaaa c'eeeeiiiinooooouuuuyyAaAaA(a(CcCc C c C  c  D d EeEeEeE(e(E e GgGgG g!G'"g'#H$h%I(i)I*i+I,i-I(.i(/I0J4j5K'6k'7L9l:L';l'<L =l >NCnDN'En'FN Gn HOLoMONoOO Po QRTrUR'Vr'WR Xr YSZs[S\s]S'^s'_S `s aT'bt'cT dt eUhuiUjukUlumU nu oU pu qU(ru(sWtwuYvywYxZyzzZ{z|Z }z ~OoUuA a I i O o U u   &'G g K k O(o(  j GgNnAaAaEeEeIi I i O o OoRrRrUuUuS&s&T&t&H h A&a'E'(e')*+,-O.o/.0/1Y2y3  #895P5Q3SVW:\8]C^tvuw60056788>-M#C#C# C 'G+K'S"'T#HT$'U%JT&TTT ( < ) 0 < 1 3 < 4 G V H G > K G W L F V H F > J G > K F W L %.&55 5  5  55:5;<5=>5@?5AB5CA%a%BbB#b#B1b1 D d D# d# D1d1D'd'D-d-E-e-E0e0()FfG g!H"h#H#$h#%H&h'H'(h')H.*h.+I0,i0-./K0k1K#2k#3K14k15L#6l#76879L1:l1;L-<l-=M>m?M@mAM#Bm#CNDnEN#Fn#GN1Hn1IN-Jn-KLMNOLPMQLRMSPTpUPVpWRXrYR#Zr#[Z\[]R1^r1_S`saS#bs#cZd[e`fagbhciTjtkT#lt#mT1nt1oT-pt-qU$ru$sU0tu0uU-vu-whxiyjzk{V|v}V#~v#WwWwWwWwW#w#XxXxYyZzZ#z#Z1z1h1tw y A#a#A a     E#e#E e Ee  I i I#i#O#o#O o     ##U#u#U u   ##YyY#y#Y y YyBB       B B ! "!# $!% B&!B'()(*)+(,)-(B.)B/01021304150B61B7898:9;8<9=8B>9B?@A@BAC@DAEHIHJIKHLIMPQPRQSPTQUPBVQBWYY[Y]YB_`a`bac`dae`BfaBghihjikhlimhBniBoprtvxz|EEEEEEEEE E E E E EEE E!E"E#E$E%E&E'E(E)E*E+E,E-E.E/E`EaEbEcEdEeEfEgEhEiEjEkElEmEnEoEpEEEBEEBtEEEBEEBBBBBB|EEEBEE!8!!8!!8!!8!!8!!8!"8""8" " 8" "#8"$"%8"&"<8"A"C8"D"E8"G"H8"I=8"`"a8"b"M8"m<8"n>8"o"d8"p"e8"q"r8"t"s8"u"v8"x"w8"y"z8""{8""8""8""8""8""8""8""8""8""|8""}8""8""8""8""8""8""8"0K00L0M00N0O00P0Q00R0S00T0U00V0W00X0Y00Z0[00\0]00^0_00`0a00b0d00e0f00g0h00i0o00p0o00q0r00s0r00t0u00v0u00w0x00y0x00z0{00|0{00}0F000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001'.2'/G>KGWL508#compdef %[1]s compdef _%[1]s %[1]s # zsh completion for %-36[1]s -*- shell-script -*- __%[1]s_debug() { local file="$BASH_COMP_DEBUG_FILE" if [[ -n ${file} ]]; then echo "$*" >> "${file}" fi } _%[1]s() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d local lastParam lastChar flagPrefix requestComp out directive comp lastComp noSpace keepOrder local -a completions __%[1]s_debug "\n========= starting completion logic ==========" __%[1]s_debug "CURRENT: ${CURRENT}, words[*]: ${words[*]}" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CURRENT location, so we need # to truncate the command-line ($words) up to the $CURRENT location. # (We cannot use $CURSOR as its value does not work when a command is an alias.) words=("${=words[1,CURRENT]}") __%[1]s_debug "Truncated words[*]: ${words[*]}," lastParam=${words[-1]} lastChar=${lastParam[-1]} __%[1]s_debug "lastParam: ${lastParam}, lastChar: ${lastChar}" # For zsh, when completing a flag with an = (e.g., %[1]s -n=) # completions must be prefixed with the flag setopt local_options BASH_REMATCH if [[ "${lastParam}" =~ '-.*=' ]]; then # We are dealing with a flag with an = flagPrefix="-P ${BASH_REMATCH}" fi # Prepare the command to obtain completions requestComp="${words[1]} %[2]s ${words[2,-1]}" if [ "${lastChar}" = "" ]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go completion code. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} \"\"" fi __%[1]s_debug "About to call: eval ${requestComp}" # Use eval to handle any environment variables and such out=$(eval ${requestComp} 2>/dev/null) __%[1]s_debug "completion output: ${out}" # Extract the directive integer following a : from the last line local lastLine while IFS='\n' read -r line; do lastLine=${line} done < <(printf "%%s\n" "${out[@]}") __%[1]s_debug "last line: ${lastLine}" if [ "${lastLine[1]}" = : ]; then directive=${lastLine[2,-1]} # Remove the directive including the : and the newline local suffix (( suffix=${#lastLine}+2)) out=${out[1,-$suffix]} else # There is no directive specified. Leave $out as is. __%[1]s_debug "No directive found. Setting do default" directive=0 fi __%[1]s_debug "directive: ${directive}" __%[1]s_debug "completions: ${out}" __%[1]s_debug "flagPrefix: ${flagPrefix}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then __%[1]s_debug "Completion received error. Ignoring completions." return fi local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} local startIndex=$((${#activeHelpMarker}+1)) local hasActiveHelp=0 while IFS='\n' read -r comp; do # Check if this is an activeHelp statement (i.e., prefixed with $activeHelpMarker) if [ "${comp[1,$endIndex]}" = "$activeHelpMarker" ];then __%[1]s_debug "ActiveHelp found: $comp" comp="${comp[$startIndex,-1]}" if [ -n "$comp" ]; then compadd -x "${comp}" __%[1]s_debug "ActiveHelp will need delimiter" hasActiveHelp=1 fi continue fi if [ -n "$comp" ]; then # If requested, completions are returned with a description. # The description is preceded by a TAB character. # For zsh's _describe, we need to use a : instead of a TAB. # We first need to escape any : as part of the completion itself. comp=${comp//:/\\:} local tab="$(printf '\t')" comp=${comp//$tab/:} __%[1]s_debug "Adding completion: ${comp}" completions+=${comp} lastComp=$comp fi done < <(printf "%%s\n" "${out[@]}") # Add a delimiter after the activeHelp statements, but only if: # - there are completions following the activeHelp statements, or # - file completion will be performed (so there will be choices after the activeHelp) if [ $hasActiveHelp -eq 1 ]; then if [ ${#completions} -ne 0 ] || [ $((directive & shellCompDirectiveNoFileComp)) -eq 0 ]; then __%[1]s_debug "Adding activeHelp delimiter" compadd -x "--" hasActiveHelp=0 fi fi if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then __%[1]s_debug "Activating nospace." noSpace="-S ''" fi if [ $((directive & shellCompDirectiveKeepOrder)) -ne 0 ]; then __%[1]s_debug "Activating keep order." keepOrder="-V" fi if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local filteringCmd filteringCmd='_files' for filter in ${completions[@]}; do if [ ${filter[1]} != '*' ]; then # zsh requires a glob pattern to do file filtering filter="\*.$filter" fi filteringCmd+=" -g $filter" done filteringCmd+=" ${flagPrefix}" __%[1]s_debug "File filtering command: $filteringCmd" _arguments '*:filename:'"$filteringCmd" elif [ $((directive & shellCompDirectiveFilterDirs)) -ne 0 ]; then # File completion for directories only local subdir subdir="${completions[1]}" if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" pushd "${subdir}" >/dev/null 2>&1 else __%[1]s_debug "Listing directories in ." fi local result _arguments '*:dirname:_files -/'" ${flagPrefix}" result=$? if [ -n "$subdir" ]; then popd >/dev/null 2>&1 fi return $result else __%[1]s_debug "Calling _describe" if eval _describe $keepOrder "completions" completions $flagPrefix $noSpace; then __%[1]s_debug "_describe found some completions" # Return the success of having called _describe return 0 else __%[1]s_debug "_describe did not find completions." __%[1]s_debug "Checking if we should do file completion." if [ $((directive & shellCompDirectiveNoFileComp)) -ne 0 ]; then __%[1]s_debug "deactivating file completion" # We must return an error code here to let zsh know that there were no # completions found by _describe; this is what will trigger other # matching algorithms to attempt to find completions. # For example zsh can match letters in the middle of words. return 1 else # Perform file completion __%[1]s_debug "Activating file completion" # We must return the result of this command, so it must be the # last command, or else we must store its result to return it. _arguments '*:filename:_files'" ${flagPrefix}" fi fi fi } # don't run the completion function when being source-ed or eval-ed if [ "$funcstack[1]" = "_%[1]s" ]; then _%[1]s fi function __%[1]s_debug set -l file "$BASH_COMP_DEBUG_FILE" if test -n "$file" echo "$argv" >> $file end end function __%[1]s_perform_completion __%[1]s_debug "Starting __%[1]s_perform_completion" # Extract all args except the last one set -l args (commandline -opc) # Extract the last arg and escape it in case it is a space set -l lastArg (string escape -- (commandline -ct)) __%[1]s_debug "args: $args" __%[1]s_debug "last arg: $lastArg" # Disable ActiveHelp which is not supported for fish shell set -l requestComp "%[10]s=0 $args[1] %[3]s $args[2..-1] $lastArg" __%[1]s_debug "Calling $requestComp" set -l results (eval $requestComp 2> /dev/null) # Some programs may output extra empty lines after the directive. # Let's ignore them or else it will break completion. # Ref: https://github.com/spf13/cobra/issues/1279 for line in $results[-1..1] if test (string trim -- $line) = "" # Found an empty line, remove it set results $results[1..-2] else # Found non-empty line, we have our proper output break end end set -l comps $results[1..-2] set -l directiveLine $results[-1] # For Fish, when completing a flag with an = (e.g., -n=) # completions must be prefixed with the flag set -l flagPrefix (string match -r -- '-.*=' "$lastArg") __%[1]s_debug "Comps: $comps" __%[1]s_debug "DirectiveLine: $directiveLine" __%[1]s_debug "flagPrefix: $flagPrefix" for comp in $comps printf "%%s%%s\n" "$flagPrefix" "$comp" end printf "%%s\n" "$directiveLine" end # this function limits calls to __%[1]s_perform_completion, by caching the result behind $__%[1]s_perform_completion_once_result function __%[1]s_perform_completion_once __%[1]s_debug "Starting __%[1]s_perform_completion_once" if test -n "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Seems like a valid result already exists, skipping __%[1]s_perform_completion" return 0 end set --global __%[1]s_perform_completion_once_result (__%[1]s_perform_completion) if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completions, probably due to a failure" return 1 end __%[1]s_debug "Performed completions and set __%[1]s_perform_completion_once_result" return 0 end # this function is used to clear the $__%[1]s_perform_completion_once_result variable after completions are run function __%[1]s_clear_perform_completion_once_result __%[1]s_debug "" __%[1]s_debug "========= clearing previously set __%[1]s_perform_completion_once_result variable ==========" set --erase __%[1]s_perform_completion_once_result __%[1]s_debug "Succesfully erased the variable __%[1]s_perform_completion_once_result" end function __%[1]s_requires_order_preservation __%[1]s_debug "" __%[1]s_debug "========= checking if order preservation is required ==========" __%[1]s_perform_completion_once if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "Error determining if order preservation is required" return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveKeepOrder %[9]d set -l keeporder (math (math --scale 0 $directive / $shellCompDirectiveKeepOrder) %% 2) __%[1]s_debug "Keeporder is: $keeporder" if test $keeporder -ne 0 __%[1]s_debug "This does require order preservation" return 0 end __%[1]s_debug "This doesn't require order preservation" return 1 end # This function does two things: # - Obtain the completions and store them in the global __%[1]s_comp_results # - Return false if file completion should be performed function __%[1]s_prepare_completions __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" # Start fresh set --erase __%[1]s_comp_results __%[1]s_perform_completion_once __%[1]s_debug "Completion results: $__%[1]s_perform_completion_once_result" if test -z "$__%[1]s_perform_completion_once_result" __%[1]s_debug "No completion, probably due to a failure" # Might as well do file completion, in case it helps return 1 end set -l directive (string sub --start 2 $__%[1]s_perform_completion_once_result[-1]) set --global __%[1]s_comp_results $__%[1]s_perform_completion_once_result[1..-2] __%[1]s_debug "Completions are: $__%[1]s_comp_results" __%[1]s_debug "Directive is: $directive" set -l shellCompDirectiveError %[4]d set -l shellCompDirectiveNoSpace %[5]d set -l shellCompDirectiveNoFileComp %[6]d set -l shellCompDirectiveFilterFileExt %[7]d set -l shellCompDirectiveFilterDirs %[8]d if test -z "$directive" set directive 0 end set -l compErr (math (math --scale 0 $directive / $shellCompDirectiveError) %% 2) if test $compErr -eq 1 __%[1]s_debug "Received error directive: aborting." # Might as well do file completion, in case it helps return 1 end set -l filefilter (math (math --scale 0 $directive / $shellCompDirectiveFilterFileExt) %% 2) set -l dirfilter (math (math --scale 0 $directive / $shellCompDirectiveFilterDirs) %% 2) if test $filefilter -eq 1; or test $dirfilter -eq 1 __%[1]s_debug "File extension filtering or directory filtering not supported" # Do full file completion instead return 1 end set -l nospace (math (math --scale 0 $directive / $shellCompDirectiveNoSpace) %% 2) set -l nofiles (math (math --scale 0 $directive / $shellCompDirectiveNoFileComp) %% 2) __%[1]s_debug "nospace: $nospace, nofiles: $nofiles" # If we want to prevent a space, or if file completion is NOT disabled, # we need to count the number of valid completions. # To do so, we will filter on prefix as the completions we have received # may not already be filtered so as to allow fish to match on different # criteria than the prefix. if test $nospace -ne 0; or test $nofiles -eq 0 set -l prefix (commandline -t | string escape --style=regex) __%[1]s_debug "prefix: $prefix" set -l completions (string match -r -- "^$prefix.*" $__%[1]s_comp_results) set --global __%[1]s_comp_results $completions __%[1]s_debug "Filtered completions are: $__%[1]s_comp_results" # Important not to quote the variable for count to work set -l numComps (count $__%[1]s_comp_results) __%[1]s_debug "numComps: $numComps" if test $numComps -eq 1; and test $nospace -ne 0 # We must first split on \t to get rid of the descriptions to be # able to check what the actual completion will be. # We don't need descriptions anyway since there is only a single # real completion which the shell will expand immediately. set -l split (string split --max 1 \t $__%[1]s_comp_results[1]) # Fish won't add a space if the completion ends with any # of the following characters: @=/:., set -l lastChar (string sub -s -1 -- $split) if not string match -r -q "[@=/:.,]" -- "$lastChar" # In other cases, to support the "nospace" directive we trick the shell # by outputting an extra, longer completion. __%[1]s_debug "Adding second completion to perform nospace directive" set --global __%[1]s_comp_results $split[1] $split[1]. __%[1]s_debug "Completions are now: $__%[1]s_comp_results" end end if test $numComps -eq 0; and test $nofiles -eq 0 # To be consistent with bash and zsh, we only trigger file # completion when there are no other completions __%[1]s_debug "Requesting file completion" return 1 end end return 0 end # Since Fish completions are only loaded once the user triggers them, we trigger them ourselves # so we can properly delete any completions provided by another script. # Only do this if the program can be found, or else fish may print some errors; besides, # the existing completions will only be loaded if the program can be found. if type -q "%[2]s" # The space after the program name is essential to trigger completion for the program # and not completion of the program name itself. # Also, we use '> /dev/null 2>&1' since '&>' is not supported in older versions of fish. complete --do-complete "%[2]s " > /dev/null 2>&1 end # Remove any pre-existing completions for the program since we will be handling all of them. complete -c %[2]s -e # this will get called after the two calls below and clear the $__%[1]s_perform_completion_once_result global complete -c %[2]s -n '__%[1]s_clear_perform_completion_once_result' # The call to __%[1]s_prepare_completions will setup __%[1]s_comp_results # which provides the program's completion choices. # If this doesn't require order preservation, we don't use the -k flag complete -c %[2]s -n 'not __%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # otherwise we use the -k flag complete -k -c %[2]s -n '__%[1]s_requires_order_preservation && __%[1]s_prepare_completions' -f -a '$__%[1]s_comp_results' # powershell completion for %-36[1]s -*- shell-script -*- function __%[1]s_debug { if ($env:BASH_COMP_DEBUG_FILE) { "$args" | Out-File -Append -FilePath "$env:BASH_COMP_DEBUG_FILE" } } filter __%[1]s_escapeStringWithSpecialChars { $_ -replace '\s|#|@|\$|;|,|''|\{|\}|\(|\)|"|`|\||<|>|&','`$&' } [scriptblock]$__%[2]sCompleterBlock = { param( $WordToComplete, $CommandAst, $CursorPosition ) # Get the current command line and convert into a string $Command = $CommandAst.CommandElements $Command = "$Command" __%[1]s_debug "" __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "WordToComplete: $WordToComplete Command: $Command CursorPosition: $CursorPosition" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $CursorPosition location, so we need # to truncate the command-line ($Command) up to the $CursorPosition location. # Make sure the $Command is longer then the $CursorPosition before we truncate. # This happens because the $Command does not include the last space. if ($Command.Length -gt $CursorPosition) { $Command=$Command.Substring(0,$CursorPosition) } __%[1]s_debug "Truncated command: $Command" $ShellCompDirectiveError=%[4]d $ShellCompDirectiveNoSpace=%[5]d $ShellCompDirectiveNoFileComp=%[6]d $ShellCompDirectiveFilterFileExt=%[7]d $ShellCompDirectiveFilterDirs=%[8]d $ShellCompDirectiveKeepOrder=%[9]d # Prepare the command to request completions for the program. # Split the command at the first space to separate the program and arguments. $Program,$Arguments = $Command.Split(" ",2) $RequestComp="$Program %[3]s $Arguments" __%[1]s_debug "RequestComp: $RequestComp" # we cannot use $WordToComplete because it # has the wrong values if the cursor was moved # so use the last argument if ($WordToComplete -ne "" ) { $WordToComplete = $Arguments.Split(" ")[-1] } __%[1]s_debug "New WordToComplete: $WordToComplete" # Check for flag with equal sign $IsEqualFlag = ($WordToComplete -Like "--*=*" ) if ( $IsEqualFlag ) { __%[1]s_debug "Completing equal sign flag" # Remove the flag part $Flag,$WordToComplete = $WordToComplete.Split("=",2) } if ( $WordToComplete -eq "" -And ( -Not $IsEqualFlag )) { # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" # PowerShell 7.2+ changed the way how the arguments are passed to executables, # so for pre-7.2 or when Legacy argument passing is enabled we need to use # `"`" to pass an empty argument, a "" or '' does not work!!! if ($PSVersionTable.PsVersion -lt [version]'7.2.0' -or ($PSVersionTable.PsVersion -lt [version]'7.3.0' -and -not [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -or (($PSVersionTable.PsVersion -ge [version]'7.3.0' -or [ExperimentalFeature]::IsEnabled("PSNativeCommandArgumentPassing")) -and $PSNativeCommandArgumentPassing -eq 'Legacy')) { $RequestComp="$RequestComp" + ' `"`"' } else { $RequestComp="$RequestComp" + ' ""' } } __%[1]s_debug "Calling $RequestComp" # First disable ActiveHelp which is not supported for Powershell $env:%[10]s=0 #call the command store the output in $out and redirect stderr and stdout to null # $Out is an array contains each line per element Invoke-Expression -OutVariable out "$RequestComp" 2>&1 | Out-Null # get directive from last line [int]$Directive = $Out[-1].TrimStart(':') if ($Directive -eq "") { # There is no directive specified $Directive = 0 } __%[1]s_debug "The completion directive is: $Directive" # remove directive (last element) from out $Out = $Out | Where-Object { $_ -ne $Out[-1] } __%[1]s_debug "The completions are: $Out" if (($Directive -band $ShellCompDirectiveError) -ne 0 ) { # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return } $Longest = 0 [Array]$Values = $Out | ForEach-Object { #Split the output in name and description $Name, $Description = $_.Split("`t",2) __%[1]s_debug "Name: $Name Description: $Description" # Look for the longest completion so that we can format things nicely if ($Longest -lt $Name.Length) { $Longest = $Name.Length } # Set the description to a one space string if there is none set. # This is needed because the CompletionResult does not accept an empty string as argument if (-Not $Description) { $Description = " " } @{Name="$Name";Description="$Description"} } $Space = " " if (($Directive -band $ShellCompDirectiveNoSpace) -ne 0 ) { # remove the space here __%[1]s_debug "ShellCompDirectiveNoSpace is called" $Space = "" } if ((($Directive -band $ShellCompDirectiveFilterFileExt) -ne 0 ) -or (($Directive -band $ShellCompDirectiveFilterDirs) -ne 0 )) { __%[1]s_debug "ShellCompDirectiveFilterFileExt ShellCompDirectiveFilterDirs are not supported" # return here to prevent the completion of the extensions return } $Values = $Values | Where-Object { # filter the result $_.Name -like "$WordToComplete*" # Join the flag back if we have an equal sign flag if ( $IsEqualFlag ) { __%[1]s_debug "Join the equal sign flag back to the completion value" $_.Name = $Flag + "=" + $_.Name } } # we sort the values in ascending order by name if keep order isn't passed if (($Directive -band $ShellCompDirectiveKeepOrder) -eq 0 ) { $Values = $Values | Sort-Object -Property Name } if (($Directive -band $ShellCompDirectiveNoFileComp) -ne 0 ) { __%[1]s_debug "ShellCompDirectiveNoFileComp is called" if ($Values.Length -eq 0) { # Just print an empty string here so the # shell does not start to complete paths. # We cannot use CompletionResult here because # it does not accept an empty string as argument. "" return } } # Get the current mode $Mode = (Get-PSReadLineKeyHandler | Where-Object {$_.Key -eq "Tab" }).Function __%[1]s_debug "Mode: $Mode" $Values | ForEach-Object { # store temporary because switch will overwrite $_ $comp = $_ # PowerShell supports three different completion modes # - TabCompleteNext (default windows style - on each key press the next option is displayed) # - Complete (works like bash) # - MenuComplete (works like zsh) # You set the mode with Set-PSReadLineKeyHandler -Key Tab -Function # CompletionResult Arguments: # 1) CompletionText text to be used as the auto completion result # 2) ListItemText text to be displayed in the suggestion list # 3) ResultType type of completion result # 4) ToolTip text for the tooltip with details about the object switch ($Mode) { # bash like "Complete" { if ($Values.Length -eq 1) { __%[1]s_debug "Only one completion left" # insert space after value [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } else { # Add the proper number of spaces to align the descriptions while($comp.Name.Length -lt $Longest) { $comp.Name = $comp.Name + " " } # Check for empty description and only add parentheses if needed if ($($comp.Description) -eq " " ) { $Description = "" } else { $Description = " ($($comp.Description))" } [System.Management.Automation.CompletionResult]::new("$($comp.Name)$Description", "$($comp.Name)$Description", 'ParameterValue', "$($comp.Description)") } } # zsh like "MenuComplete" { # insert space after value # MenuComplete will automatically show the ToolTip of # the highlighted value at the bottom of the suggestions. [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars) + $Space, "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } # TabCompleteNext and in case we get something unknown Default { # Like MenuComplete but we don't want to add a space here because # the user need to press space anyway to get the completion. # Description will not be shown because that's not possible with TabCompleteNext [System.Management.Automation.CompletionResult]::new($($comp.Name | __%[1]s_escapeStringWithSpecialChars), "$($comp.Name)", 'ParameterValue', "$($comp.Description)") } } } } Register-ArgumentCompleter -CommandName '%[1]s' -ScriptBlock $__%[2]sCompleterBlock # bash completion V2 for %-36[1]s -*- shell-script -*- __%[1]s_debug() { if [[ -n ${BASH_COMP_DEBUG_FILE-} ]]; then echo "$*" >> "${BASH_COMP_DEBUG_FILE}" fi } # Macs have bash3 for which the bash-completion package doesn't include # _init_completion. This is a minimal version of that function. __%[1]s_init_completion() { COMPREPLY=() _get_comp_words_by_ref "$@" cur prev words cword } # This function calls the %[1]s program to obtain the completion # results and the directive. It fills the 'out' and 'directive' vars. __%[1]s_get_completion_results() { local requestComp lastParam lastChar args # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows to handle aliases args=("${words[@]:1}") requestComp="${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} __%[1]s_debug "lastParam ${lastParam}, lastChar ${lastChar}" if [[ -z ${cur} && ${lastChar} != = ]]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "Adding extra empty parameter" requestComp="${requestComp} ''" fi # When completing a flag with an = (e.g., %[1]s -n=) # bash focuses on the part after the =, so we need to remove # the flag part from $cur if [[ ${cur} == -*=* ]]; then cur="${cur#*=}" fi __%[1]s_debug "Calling ${requestComp}" # Use eval to handle any environment variables and such out=$(eval "${requestComp}" 2>/dev/null) # Extract the directive integer at the very end of the output following a colon (:) directive=${out##*:} # Remove the directive out=${out%%:*} if [[ ${directive} == "${out}" ]]; then # There is not directive specified directive=0 fi __%[1]s_debug "The completion directive is: ${directive}" __%[1]s_debug "The completions are: ${out}" } __%[1]s_process_completion_results() { local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local shellCompDirectiveKeepOrder=%[8]d if (((directive & shellCompDirectiveError) != 0)); then # Error code. No completion. __%[1]s_debug "Received error from custom completion go code" return else if (((directive & shellCompDirectiveNoSpace) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no space" compopt -o nospace else __%[1]s_debug "No space directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveKeepOrder) != 0)); then if [[ $(type -t compopt) == builtin ]]; then # no sort isn't supported for bash less than < 4.4 if [[ ${BASH_VERSINFO[0]} -lt 4 || ( ${BASH_VERSINFO[0]} -eq 4 && ${BASH_VERSINFO[1]} -lt 4 ) ]]; then __%[1]s_debug "No sort directive not supported in this version of bash" else __%[1]s_debug "Activating keep order" compopt -o nosort fi else __%[1]s_debug "No sort directive not supported in this version of bash" fi fi if (((directive & shellCompDirectiveNoFileComp) != 0)); then if [[ $(type -t compopt) == builtin ]]; then __%[1]s_debug "Activating no file completion" compopt +o default else __%[1]s_debug "No file completion directive not supported in this version of bash" fi fi fi # Separate activeHelp from normal completions local completions=() local activeHelp=() __%[1]s_extract_activeHelp if (((directive & shellCompDirectiveFilterFileExt) != 0)); then # File extension filtering local fullFilter filter filteringCmd # Do not use quotes around the $completions variable or else newline # characters will be kept. for filter in ${completions[*]}; do fullFilter+="$filter|" done filteringCmd="_filedir $fullFilter" __%[1]s_debug "File filtering command: $filteringCmd" $filteringCmd elif (((directive & shellCompDirectiveFilterDirs) != 0)); then # File completion for directories only local subdir subdir=${completions[0]} if [[ -n $subdir ]]; then __%[1]s_debug "Listing directories in $subdir" pushd "$subdir" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return else __%[1]s_debug "Listing directories in ." _filedir -d fi else __%[1]s_handle_completion_types fi __%[1]s_handle_special_char "$cur" : __%[1]s_handle_special_char "$cur" = # Print the activeHelp statements before we finish if ((${#activeHelp[*]} != 0)); then printf "\n"; printf "%%s\n" "${activeHelp[@]}" printf "\n" # The prompt format is only available from bash 4.4. # We test if it is available before using it. if (x=${PS1@P}) 2> /dev/null; then printf "%%s" "${PS1@P}${COMP_LINE[@]}" else # Can't print the prompt. Just print the # text the user had typed, it is workable enough. printf "%%s" "${COMP_LINE[@]}" fi fi } # Separate activeHelp lines from real completions. # Fills the $activeHelp and $completions arrays. __%[1]s_extract_activeHelp() { local activeHelpMarker="%[9]s" local endIndex=${#activeHelpMarker} while IFS='' read -r comp; do if [[ ${comp:0:endIndex} == $activeHelpMarker ]]; then comp=${comp:endIndex} __%[1]s_debug "ActiveHelp found: $comp" if [[ -n $comp ]]; then activeHelp+=("$comp") fi else # Not an activeHelp line but a normal completion completions+=("$comp") fi done <<<"${out}" } __%[1]s_handle_completion_types() { __%[1]s_debug "__%[1]s_handle_completion_types: COMP_TYPE is $COMP_TYPE" case $COMP_TYPE in 37|42) # Type: menu-complete/menu-complete-backward and insert-completions # If the user requested inserting one completion at a time, or all # completions at once on the command-line we must remove the descriptions. # https://github.com/spf13/cobra/issues/1508 local tab=$'\t' comp while IFS='' read -r comp; do [[ -z $comp ]] && continue # Strip any description comp=${comp%%%%$tab*} # Only consider the completions that match if [[ $comp == "$cur"* ]]; then COMPREPLY+=("$comp") fi done < <(printf "%%s\n" "${completions[@]}") ;; *) # Type: complete (normal completion) __%[1]s_handle_standard_completion_case ;; esac } __%[1]s_handle_standard_completion_case() { local tab=$'\t' comp # Short circuit to optimize if we don't have descriptions if [[ "${completions[*]}" != *$tab* ]]; then IFS=$'\n' read -ra COMPREPLY -d '' < <(compgen -W "${completions[*]}" -- "$cur") return 0 fi local longest=0 local compline # Look for the longest completion so that we can format things nicely while IFS='' read -r compline; do [[ -z $compline ]] && continue # Strip any description before checking the length comp=${compline%%%%$tab*} # Only consider the completions that match [[ $comp == "$cur"* ]] || continue COMPREPLY+=("$compline") if ((${#comp}>longest)); then longest=${#comp} fi done < <(printf "%%s\n" "${completions[@]}") # If there is a single completion left, remove the description text if ((${#COMPREPLY[*]} == 1)); then __%[1]s_debug "COMPREPLY[0]: ${COMPREPLY[0]}" comp="${COMPREPLY[0]%%%%$tab*}" __%[1]s_debug "Removed description from single completion, which is now: ${comp}" COMPREPLY[0]=$comp else # Format the descriptions __%[1]s_format_comp_descriptions $longest fi } __%[1]s_handle_special_char() { local comp="$1" local char=$2 if [[ "$comp" == *${char}* && "$COMP_WORDBREAKS" == *${char}* ]]; then local word=${comp%%"${comp##*${char}}"} local idx=${#COMPREPLY[*]} while ((--idx >= 0)); do COMPREPLY[idx]=${COMPREPLY[idx]#"$word"} done fi } __%[1]s_format_comp_descriptions() { local tab=$'\t' local comp desc maxdesclength local longest=$1 local i ci for ci in ${!COMPREPLY[*]}; do comp=${COMPREPLY[ci]} # Properly format the description string which follows a tab character if there is one if [[ "$comp" == *$tab* ]]; then __%[1]s_debug "Original comp: $comp" desc=${comp#*$tab} comp=${comp%%%%$tab*} # $COLUMNS stores the current shell width. # Remove an extra 4 because we add 2 spaces and 2 parentheses. maxdesclength=$(( COLUMNS - longest - 4 )) # Make sure we can fit a description of at least 8 characters # if we are to align the descriptions. if ((maxdesclength > 8)); then # Add the proper number of spaces to align the descriptions for ((i = ${#comp} ; i < longest ; i++)); do comp+=" " done else # Don't pad the descriptions so we can fit more text after the completion maxdesclength=$(( COLUMNS - ${#comp} - 4 )) fi # If there is enough space for any description text, # truncate the descriptions that are too long for the shell width if ((maxdesclength > 0)); then if ((${#desc} > maxdesclength)); then desc=${desc:0:$(( maxdesclength - 1 ))} desc+="…" fi comp+=" ($desc)" fi COMPREPLY[ci]=$comp __%[1]s_debug "Final comp: $comp" fi done } __start_%[1]s() { local cur prev words cword split COMPREPLY=() # Call _init_completion from the bash-completion package # to prepare the arguments properly if declare -F _init_completion >/dev/null 2>&1; then _init_completion -n =: || return else __%[1]s_init_completion -n =: || return fi __%[1]s_debug __%[1]s_debug "========= starting completion logic ==========" __%[1]s_debug "cur is ${cur}, words[*] is ${words[*]}, #words[@] is ${#words[@]}, cword is $cword" # The user could have moved the cursor backwards on the command-line. # We need to trigger completion from the $cword location, so we need # to truncate the command-line ($words) up to the $cword location. words=("${words[@]:0:$cword+1}") __%[1]s_debug "Truncated words[*]: ${words[*]}," local out directive __%[1]s_get_completion_results __%[1]s_process_completion_results } if [[ $(type -t compopt) = "builtin" ]]; then complete -o default -F __start_%[1]s %[1]s else complete -o default -o nospace -F __start_%[1]s %[1]s fi # ex: ts=4 sw=4 et filetype=sh __%[1]s_debug() { if [[ -n ${BASH_COMP_DEBUG_FILE:-} ]]; then echo "$*" >> "${BASH_COMP_DEBUG_FILE}" fi } # Homebrew on Macs have version 1.3 of bash-completion which doesn't include # _init_completion. This is a very minimal version of that function. __%[1]s_init_completion() { COMPREPLY=() _get_comp_words_by_ref "$@" cur prev words cword } __%[1]s_index_of_word() { local w word=$1 shift index=0 for w in "$@"; do [[ $w = "$word" ]] && return index=$((index+1)) done index=-1 } __%[1]s_contains_word() { local w word=$1; shift for w in "$@"; do [[ $w = "$word" ]] && return done return 1 } __%[1]s_handle_go_custom_completion() { __%[1]s_debug "${FUNCNAME[0]}: cur is ${cur}, words[*] is ${words[*]}, #words[@] is ${#words[@]}" local shellCompDirectiveError=%[3]d local shellCompDirectiveNoSpace=%[4]d local shellCompDirectiveNoFileComp=%[5]d local shellCompDirectiveFilterFileExt=%[6]d local shellCompDirectiveFilterDirs=%[7]d local out requestComp lastParam lastChar comp directive args # Prepare the command to request completions for the program. # Calling ${words[0]} instead of directly %[1]s allows to handle aliases args=("${words[@]:1}") # Disable ActiveHelp which is not supported for bash completion v1 requestComp="%[8]s=0 ${words[0]} %[2]s ${args[*]}" lastParam=${words[$((${#words[@]}-1))]} lastChar=${lastParam:$((${#lastParam}-1)):1} __%[1]s_debug "${FUNCNAME[0]}: lastParam ${lastParam}, lastChar ${lastChar}" if [ -z "${cur}" ] && [ "${lastChar}" != "=" ]; then # If the last parameter is complete (there is a space following it) # We add an extra empty parameter so we can indicate this to the go method. __%[1]s_debug "${FUNCNAME[0]}: Adding extra empty parameter" requestComp="${requestComp} \"\"" fi __%[1]s_debug "${FUNCNAME[0]}: calling ${requestComp}" # Use eval to handle any environment variables and such out=$(eval "${requestComp}" 2>/dev/null) # Extract the directive integer at the very end of the output following a colon (:) directive=${out##*:} # Remove the directive out=${out%%:*} if [ "${directive}" = "${out}" ]; then # There is not directive specified directive=0 fi __%[1]s_debug "${FUNCNAME[0]}: the completion directive is: ${directive}" __%[1]s_debug "${FUNCNAME[0]}: the completions are: ${out}" if [ $((directive & shellCompDirectiveError)) -ne 0 ]; then # Error code. No completion. __%[1]s_debug "${FUNCNAME[0]}: received error from custom completion go code" return else if [ $((directive & shellCompDirectiveNoSpace)) -ne 0 ]; then if [[ $(type -t compopt) = "builtin" ]]; then __%[1]s_debug "${FUNCNAME[0]}: activating no space" compopt -o nospace fi fi if [ $((directive & shellCompDirectiveNoFileComp)) -ne 0 ]; then if [[ $(type -t compopt) = "builtin" ]]; then __%[1]s_debug "${FUNCNAME[0]}: activating no file completion" compopt +o default fi fi fi if [ $((directive & shellCompDirectiveFilterFileExt)) -ne 0 ]; then # File extension filtering local fullFilter filter filteringCmd # Do not use quotes around the $out variable or else newline # characters will be kept. for filter in ${out}; do fullFilter+="$filter|" done filteringCmd="_filedir $fullFilter" __%[1]s_debug "File filtering command: $filteringCmd" $filteringCmd elif [ $((directive & shellCompDirectiveFilterDirs)) -ne 0 ]; then # File completion for directories only local subdir # Use printf to strip any trailing newline subdir=$(printf "%%s" "${out}") if [ -n "$subdir" ]; then __%[1]s_debug "Listing directories in $subdir" __%[1]s_handle_subdirs_in_dir_flag "$subdir" else __%[1]s_debug "Listing directories in ." _filedir -d fi else while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${out}" -- "$cur") fi } __%[1]s_handle_reply() { __%[1]s_debug "${FUNCNAME[0]}" local comp case $cur in -*) if [[ $(type -t compopt) = "builtin" ]]; then compopt -o nospace fi local allflags if [ ${#must_have_one_flag[@]} -ne 0 ]; then allflags=("${must_have_one_flag[@]}") else allflags=("${flags[*]} ${two_word_flags[*]}") fi while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${allflags[*]}" -- "$cur") if [[ $(type -t compopt) = "builtin" ]]; then [[ "${COMPREPLY[0]}" == *= ]] || compopt +o nospace fi # complete after --flag=abc if [[ $cur == *=* ]]; then if [[ $(type -t compopt) = "builtin" ]]; then compopt +o nospace fi local index flag flag="${cur%%=*}" __%[1]s_index_of_word "${flag}" "${flags_with_completion[@]}" COMPREPLY=() if [[ ${index} -ge 0 ]]; then PREFIX="" cur="${cur#*=}" ${flags_completion[${index}]} if [ -n "${ZSH_VERSION:-}" ]; then # zsh completion needs --flag= prefix eval "COMPREPLY=( \"\${COMPREPLY[@]/#/${flag}=}\" )" fi fi fi if [[ -z "${flag_parsing_disabled}" ]]; then # If flag parsing is enabled, we have completed the flags and can return. # If flag parsing is disabled, we may not know all (or any) of the flags, so we fallthrough # to possibly call handle_go_custom_completion. return 0; fi ;; esac # check if we are handling a flag with special work handling local index __%[1]s_index_of_word "${prev}" "${flags_with_completion[@]}" if [[ ${index} -ge 0 ]]; then ${flags_completion[${index}]} return fi # we are parsing a flag and don't have a special handler, no completion if [[ ${cur} != "${words[cword]}" ]]; then return fi local completions completions=("${commands[@]}") if [[ ${#must_have_one_noun[@]} -ne 0 ]]; then completions+=("${must_have_one_noun[@]}") elif [[ -n "${has_completion_function}" ]]; then # if a go completion function is provided, defer to that function __%[1]s_handle_go_custom_completion fi if [[ ${#must_have_one_flag[@]} -ne 0 ]]; then completions+=("${must_have_one_flag[@]}") fi while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${completions[*]}" -- "$cur") if [[ ${#COMPREPLY[@]} -eq 0 && ${#noun_aliases[@]} -gt 0 && ${#must_have_one_noun[@]} -ne 0 ]]; then while IFS='' read -r comp; do COMPREPLY+=("$comp") done < <(compgen -W "${noun_aliases[*]}" -- "$cur") fi if [[ ${#COMPREPLY[@]} -eq 0 ]]; then if declare -F __%[1]s_custom_func >/dev/null; then # try command name qualified custom func __%[1]s_custom_func else # otherwise fall back to unqualified for compatibility declare -F __custom_func >/dev/null && __custom_func fi fi # available in bash-completion >= 2, not always present on macOS if declare -F __ltrim_colon_completions >/dev/null; then __ltrim_colon_completions "$cur" fi # If there is only 1 completion and it is a flag with an = it will be completed # but we don't want a space after the = if [[ "${#COMPREPLY[@]}" -eq "1" ]] && [[ $(type -t compopt) = "builtin" ]] && [[ "${COMPREPLY[0]}" == --*= ]]; then compopt -o nospace fi } # The arguments should be in the form "ext1|ext2|extn" __%[1]s_handle_filename_extension_flag() { local ext="$1" _filedir "@(${ext})" } __%[1]s_handle_subdirs_in_dir_flag() { local dir="$1" pushd "${dir}" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1 || return } __%[1]s_handle_flag() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" # if a command required a flag, and we found it, unset must_have_one_flag() local flagname=${words[c]} local flagvalue="" # if the word contained an = if [[ ${words[c]} == *"="* ]]; then flagvalue=${flagname#*=} # take in as flagvalue after the = flagname=${flagname%%=*} # strip everything after the = flagname="${flagname}=" # but put the = back fi __%[1]s_debug "${FUNCNAME[0]}: looking for ${flagname}" if __%[1]s_contains_word "${flagname}" "${must_have_one_flag[@]}"; then must_have_one_flag=() fi # if you set a flag which only applies to this command, don't show subcommands if __%[1]s_contains_word "${flagname}" "${local_nonpersistent_flags[@]}"; then commands=() fi # keep flag value with flagname as flaghash # flaghash variable is an associative array which is only supported in bash > 3. if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; then if [ -n "${flagvalue}" ] ; then flaghash[${flagname}]=${flagvalue} elif [ -n "${words[ $((c+1)) ]}" ] ; then flaghash[${flagname}]=${words[ $((c+1)) ]} else flaghash[${flagname}]="true" # pad "true" for bool flag fi fi # skip the argument to a two word flag if [[ ${words[c]} != *"="* ]] && __%[1]s_contains_word "${words[c]}" "${two_word_flags[@]}"; then __%[1]s_debug "${FUNCNAME[0]}: found a flag ${words[c]}, skip the next argument" c=$((c+1)) # if we are looking for a flags value, don't show commands if [[ $c -eq $cword ]]; then commands=() fi fi c=$((c+1)) } __%[1]s_handle_noun() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" if __%[1]s_contains_word "${words[c]}" "${must_have_one_noun[@]}"; then must_have_one_noun=() elif __%[1]s_contains_word "${words[c]}" "${noun_aliases[@]}"; then must_have_one_noun=() fi nouns+=("${words[c]}") c=$((c+1)) } __%[1]s_handle_command() { __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" local next_command if [[ -n ${last_command} ]]; then next_command="_${last_command}_${words[c]//:/__}" else if [[ $c -eq 0 ]]; then next_command="_%[1]s_root_command" else next_command="_${words[c]//:/__}" fi fi c=$((c+1)) __%[1]s_debug "${FUNCNAME[0]}: looking for ${next_command}" declare -F "$next_command" >/dev/null && $next_command } __%[1]s_handle_word() { if [[ $c -ge $cword ]]; then __%[1]s_handle_reply return fi __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}" if [[ "${words[c]}" == -* ]]; then __%[1]s_handle_flag elif __%[1]s_contains_word "${words[c]}" "${commands[@]}"; then __%[1]s_handle_command elif [[ $c -eq 0 ]]; then __%[1]s_handle_command elif __%[1]s_contains_word "${words[c]}" "${command_aliases[@]}"; then # aliashash variable is an associative array which is only supported in bash > 3. if [[ -z "${BASH_VERSION:-}" || "${BASH_VERSINFO[0]:-}" -gt 3 ]]; then words[c]=${aliashash[${words[c]}]} __%[1]s_handle_command else __%[1]s_handle_noun fi else __%[1]s_handle_noun fi __%[1]s_handle_word } a!Y9).5q*=Y]9^}UfIi-Mu%a5sem)U !} E6m ] ueEAj1-QqAVyw%% 1:&I I  Xv3@dup||y |ݧ$  $$Xܔp<Sp$`@ੈpsZxZqZ}ZZoLlM,I M H 3  .2 ( ܍D  XQ)H) D4C4P<4$=4` .pD4@ .L.X.-:4.h.-.d.T.\383.<4$ x[,Y,*@W.`/8 %#H#|S 8{p%h'`''p$t''$'4'D'T'd'''p''4#|#$#4#D#T#d##m&%<%%'''&%S'('|'X'4' LԅDQ4pԷT^Xd(@9i4H4t:je<$D5$ H | T hX IA  Jl x d x <$x#0+X2< V@ 7 \  $ H ̌ T @ Д H 4 p З 0 X  P ؍ | ̛ X |  < d | L t ܞ  , $ ̠ ( < ď h  ԁ 0ܼ|x :D Xv $ $"| Ht 9 0 HsԿ lv $w H  t6 p4<`T9@;X;;;;І;P:L::;U:U:T:5Z.YL|[\[[`[[LsZ wZ,}ZZHZoo4oop\oop(p:& g%x$@OqLRq8Qq q ?rYuX$o`oȜpPxtKK4zZlZZrZZPZT~Zx[SZTZ`UZUZ{[x;<Ę<<H<;<d<4<k=<.=X-=t=H= ==0/= 1=2=4=2===`H=;=<=>=@=p=="=$=&=(=B=+=D=xF=P5=87= 9=p<,<_=c=e=f=i=j=Ȣ<H< XETEC+ -$FFFTFFHFG<GHH^H H+J8J$JJ)KK<)L LOMwMUM(";(NĹN@NNԹNPNNEFNHgG-G GGDSG$CG^GlGdGT6G$MGMG$E0EDEEE,EEEE\EķE,EEȹEN`F`F$>lܶT8 )mfjPd bhޙ`LZ8,=d~î,Tɩ D  g 0),z|  NOPG-H-!-BMPSHxd,7N7T78Z7`7\I7n777nkq : :9$99 90:T99̩9949P9 9999ȧ9t99$w5H:;;HL4t4,4@Z Z<5@"A7A6ADvv(vPwqvTuvuvrv|rvrvLsvsvtvtvtvއ$d1h.hUhHdԏdZifi\j̪jj,nee]̏mQmȒml8nnWn (@pBhBhBBxB44EE0DDDCpq,,D\l\\hhPii jjjXkk(l@ell`mm0nnohoo8pepqpqq@rrsxssHtftuuuPvv wwwXxxfx(yyy`zz0{{|h|f|8}}~p~~@xHgH肋P gh5duu(w,(wNT|äLXشǤ$ȤdHǤZhg(hhitjj`rrpîY\OH8X{i{_{{]C]_H_<\aPa@McNcdddd,eegelkeDcetfeHje4lede*kdltmܟmB C}CxpCCTC԰CPCCdCd D0DD MD`=D>D#DDDDD|[?p> E˗ht˗, `Zh[[|hޱ߱/>O;P\8PHQP T( T TVTqpiqvquqsqtqXlqnqpq jqxqmqoqtqqhkqq|q}qܳqqqqqqІq̇qqqȭqqqqqqqqqqq(lrLqԖqЗqDqqЛq̜qܝq؞qqqPqșqĚqqqXq|4|||̲|4|}dz~" 0 Dp| ȁு$H 젃X4hhOR_nT8Xebف\с́҂Ղ߂4tւ<ق\.01 >8ГP T{\|譅`tTԅ<х4` x@ӅxTXڅׅޅمхd$<ĶƁpxp8Ę|pO Rt_mTXdebׁρˁ҂Ԃx߂H\ւقtD.0=PK2L6C<@ l@ P 莁hp]h݁߁```PGJVfLHO]YPuHZ,Âςм,Ȃdł $*$p"TH<kn|pt 8qw{84&t(3TB),,:@6Hİ̖X411282x22$33cd4RdHYdl)}L                    GGGGGGGGGGGGGGGGGGGGGGGGGGGG                                 A         !!  + C#U   K    B  ! #   +  "0 *-*P$a*  *  n  '>>~I37$pWG@"; 4,tT (/"N$        !                            A      0   ! BB @  DD !                        ,,       !       * C!C@@@P@'     )P  00-)=!!!  3  (@  K@+% U         ' # "  II      %$!  )    +#3'! ͉a&Q!!%%#1CCAKKK  QP! #   )      !   3 $  T A1!11!   31 C  "  3  & >  * II II  II   J LH,(  U  !      C@A0     ) &   -ɵ ki  ~    ;7 %     A@A!   .  #2&        - ( ! !!     B  P P   *    0 0  WW75 S  %      N        m                     0    0       **   " $    %!    $  3# C # K@ ((   C G #) ! C  @  B) "b    k &""=?  0CA@  (!! A@A O   SQR100--, ZD  7 7 7  77 7 77 7 77    *j*  B5      ]`a`      AK @ afF I  K K K   K  @`@   O  O     ~  >  IA I '%%         e  )!"    ! C@C``a  CC@   W     W W'!cc` 7'!   A  %  CC  ! ! P P P=98  33   # u  AA@Z c   91   2B  0 **j      ) ! IHH*+   @@%  1'& c jj S    + 111cS $@      =  DH@0    C!!B  !d  ((  #   !  D@  # "+# O S akUQ D@D/ / L L 5 b b     Q    oma//# $30  !?)   ga 0  322 7 @ ?    !!UT         (  @   #!                i( AB@                  4*             &&&"  @j# @     !# 7[ #  0 !   !       )  !      0000  ##     sSQ@     +) +   ! @DH@ ++++##!! 50        $      "! ! !  %  "FF&   @Pp   3#  ?3           !1      ^wW   CC@CCBB@"" "!! !     EAA@   03 SSP@ #""           !  CC px|   $    UTT        $! CA@@ O '7 %%%!    KAA@        UUT $,   &GGGG T -%% **        ?  G@@@   02     bc~r!!! (    @  ### @`a@   SQAA 330 $  )(  TT     !!   )( a0!   - *(    @|&% ? `x` `  @CF@ !"   L    LH ! ! !@  (  F %!  1  " %!  '' '# '$0         M    -CCAA@     @  0 0 PP"%!    @AJ@H  I       @    KIKKK      "   B   b "B 0 EEEED@   0 **(  ! $ '!  A T T@ )))(( $&!     2 @  $ " #   $ " ! 0 $!C   bE3 FDDDD@B       !      I 0 0  !]]]]    %$ J  AAA@@" '"     $ BCh@ &'& $$ 7 7 7   q@ACBEJ @@AI@  -  UZ Z --   "94 RPb &4<  ED   KK        73 - IH L@     9   cCS     ?/ IH  + +  >8    ! " '# ! '#      K481 +  KI   K+   7 !  [[[XP $"!     **     UUUPP@AB@A---(-  ##!!!!! AAP  P PP  K   QP K@K@ 0 *   I    &$ I  "CAA@@  :%5= c#WSSQP  K@ Z1** **A )  @@bA`@**j*  qq   )( )( @```@    M@ PP      ) FGf    c A    ((  ** QP18<6 2         M  I '  tABJ ***  @@ !! 0          $$$ +J BB  "330 *****3300 !   PQPPAA@@@Ѐ #  @ a#3    #"  "F "#"" """?   j**aq(      ]]M    SRPPP $!SPPPP  f$ (     )    0    8 Q@PP@)   LHB ;                                $                          %$%$$$@      NL            "#:" $1(  82! () ;       L @ L L6&&&&&EGd\l  + )( 1!    @  $$$$ $$$$    aaaa    @   B@ ~xz        %!!          2  ++*"    0        AAAAAQPR  @DLBA@@DLAB@  "!$    #             /   0   %$$$ QP          ## ###     "c @,)89p| 0("      (     @B@HLA @H@DBAB%5   $ #!!^^V^           (! Q (.2205]]]]X@      IIIIA &$$   " &"#`&&&&&&           CcSI        6%=%!$<8;        0    @   >*P)((((   VUTP@! CR|C@AAAAA    c  FF H 1@AA@A@@   + +ONL       33 A   D    #    #   `    @DEM@GF    #!   ) - -    s2               WWWWWW@@S@WWWSPP@A  IH4$ 0 "*&'"   -----,@ !       DDDDDDD     0 0  008 $"   ) U    B( 0 "   BB " 0     `É !5%  10 0   0  JJ5555       UT +)+ U  --   -    " $   1d1d   5%%%      )    ``` U   - UU  TT   ? !  &&&&      @@AIMC@   # HH          Հ IH!! !! @H@LNOH$4&,-@DFFGB@    + @    CC@CCC@@A@ECGH         kk w       )))))!   ****       P  * 9((   P %%%** 0  08<>! C@@  ccK@K@(8 $4Z****"     YYYYQPP 3IA      F  c!!          8   P! TT 0       13     K  ''%%%%!   UU I ss`   TP  P $$         BFFFFFDD !     @@  " "'?073333 PZ      !  # E   B   ``    D       #!0@$6 (  ""    B )       '''''! @EaACB@ "*" 133 !   @ )((      3NNcbR       (( I'#?>><8   R(R(x x xx x x x x x x RLkRRKT TfTkTa^8|}TxA!^8}TxA!^8}TxA!^8|}TxA!^8|}TxA!^8}TxA!x{&0Y,.9xH!* +0+0+0/T:0#-T;>X >P >T 5Aa<DlFPOI@L8F@0j@0"? P  P5R0VX?t 04(W0W0W0W\0]^X 0A0 ~`q_~`xqSAHLSLS0 040oF 4p|ttmu| j<S(lz0z0zP{1|8@pkS8 @0kjC9\0WSA8SADSAPY8kh)0I0Wd1B0@%hl=i\x"q N0 k_L~_`B\ D70hd\TbbL88ұ8888SL b@xA0 <I<lI,+H HlP,f((<=pP \Tt><> <x2q01B0YLP0<0gWcHmX0} PiLzYDYT+ OP0:0:S0 0:0:0:F\PhiiH0EN{9IvNH{k<<<<<<<<<<<H8H8XI Y <>T H *s]Ts]TPT$@`GxB,0+Q0+ 0080@(X̠0c 0 0;\5l=9IXILoILo~_0("A@ Lh>Al 2qhA` X1LdH MTT+ET[mETfT0<0~DKp -T Txx 20c20c20c20Q30gk10=1L10*@*4t,g6H:+0^+0^+p^:T.+P1T1T1T1TVKQ3g2N|COt@Qp=T' 4  ĕHP6 PlA` c`A` c`xx|x|||||*@ΛTxTT6TPTlTh'HLp֓0̤d̤d0z0gA0z  0*@*@*@ѭ8zT'T'{0{0L|TZTqSTmT̬TbTv˩T{TTL?T/ZT2TEuT>TTTdT)ѷTTTT|:8\C\C\Cd.[0\ 0/ TbHbHH+XS~Hd h*@Dgc0Dgc06dEPLTT֓8DDD$[D,|ѷ HHTTC000TPtT00k|Ct@p=:ETtT`T??TTTTTT?T?TtT`T??TTTTTT?T?T +t&TqP`;D5T3!P0T̈́\]h   J*l@<~ TG^X`WWWW{f{f{f{fwwww*@? 0J0J8 8 0"@'8U0"8 m" m"x8P)0Z*)D+Dm'8U0"8'8U'U'8U0"<'U'8U'U'<U'<U' U'8U<0"8'8U'U'<U{.L0`T``փ`&%?$Q?PQ0q*D@80TicTT%T+T2׌T/T;<TC}TU8TJT'TŗTTRM<*`q\z00LK=*@r@)*@*@%T2^90ddUr)r)r)r)dTU 0DajT2^90dUT<TNTURM*@P"P"_TqT`T/ew0ahRt<<NTH`4:1T1T1T1Txg|Ct@sp=B:T|CUt@Bp==:f|Ct@]p=:r\Vr`\ 0z0zL0wL)^90|CVt@ p= ":l#|C#t@p=:NdU1%|Ci&t@'p=(:  TNTU TTTzTTTTT)T.wT T:<0<0h.h.0\@0qC>TA=T>Td>T`A=TGzMLFM%Gh S\HV0%V0LW4.W4.O[Hs[s[&Tq[]n]xd^r`T8`c0=XeT:h:Tgg00A0A.]ATtC?lm0aC U5=W U5ood>oo >q^hoxoo>p<HqNoq6oq6oq6oq6r<UkUkskt0v0av0i1wtm.]hy@y@y@yyy@y@:{0 gc0gc0}v~T[0DlaP0Â@Â@Â@ÂCjaT4qNX;\?@@[JaT4qN=>=>=>ck(ck$qNX;\?J,J,J,@@@*@'I'I'PI'Irkrkg`Hrky@$(:DnToTkxT olTFzTVzVzVzVz{T[}TVVzz}T VVzzYGwwT 0: 0:*4@<0k0TTTѷTT mP"ɼ@MM mP"*@884H3*@Xk~l788He 8|e@,@I@tX&xp*@u@*@M m" m"&xHu@<uptLtt0XTTtvTTs mP"*@R'2TRTiTTKT`lTz^TETZHTsLTT$T(TTTTsTT*@  Pl'hv'pv'xv'v,@g[*@*@m0 :JttTTT m"t<30d30d |3$dHi0+^*0`*h "\&wDiq^$XsT$<$4s4s4$4s4$Ts4s4s4$4$4s4&w$4s4s4sXs4$4$4s4s4$4s4sXs4s4*0@*X*d]W4*\@*@r0tr0t^DK_*\@T*D@&u0UXXjh/kdX |m0kndEp0kp0k^90 dUTmTTC TUv yyo m0"yoyoyoyo{010|\~<<TD<DtaDD"yt*@|TA |T=G|TQp|TXSWPh T0TLTTnnT | T>$H>H0y_<Ny m0"q800ih06hx6 :liH0T0q4D0D9{010i d8 8@li{010i06x6>:li m0"0ih887@li0i06x6:li0i m"liq^0q^q^0OuH0ih55=liƑTyTsT @0H@0Ht.|.|.g0 |.t.00|.0P0d0E03|.S000.0 0|.0@0S``sTBS0.0 0u86860 @6T;T;T;g0h0Cg0hg0hg0hg0hg0hg0hg0hg0h lm0MT~<~<~0r$%8&D%\8&Di'@TT<#D-<#D-uH<#D-2$04456|#8<#8-D2$3DH0'0'0'0'Ϝ0-Ϝ0-Ϝ0-Ϝ0-ݡ8q3DJ%T'@Ti'@TN0&N0&)O0CO0M)O0CP0`P0`'@Th7TVT.+PH+SV:U=Y|CZt@Up=V:/[[^t<uhpP !p=+8UnTgnTg_8_h/o$Qsopsop/o0Q/oQ/oQ/oQ/oQ/oQ/o,Q/oQ/oQ/oQ/oQ/oQ/oQ/oQ/oQ/oQ/oQ/oQ/oQt<*L@so<0<hy)`uT(_T_TNu\tBtT<uT&uU1wTuwTupuTHwStTxŜ8400|h\t.t..t.|T7TT3TP0I|)hxhP0ILPhI AI00ew\ad<000b8gI0d)TL1x{({L{(&&x&&|&&&&&&&&&&&&&*@T&B0$h tc4h  0+c4`+ew\aÃLS+4bT T6TT.0MTTl w50%ÃtSgc0lCDLa1L*@T- d 5 d5c c c(/c/;,'$'cT?TCTNTUT#T*HBx\V  ~hBx8VBxTV2=@iyTCTJy3hT00*@y3TT0 T=T02 =TTnnT (Dn(Tn gg*<@-TVJ-T_PP1P*l@`01DCYm7i11:0?:x9Lc2T`U@@ AuHC0X`<CdF0C0dCd^HL< G8|CdF0F0slF0CdCdCdstsF0CdF0Cd000TT(pn(`nY:\0S]0 T^0$]0 ]0 Nb0 :\SNb0 ]0 ]0 ]0 ]0 ]0 !V@X]0 h0(n]0 ]0 T^<$Nb0 Nb0 ]0 FV@]|mD"S<;&pD]0 *0@ m4"w46nyTX(*@(zP} &TqnT*0@*0@w06Y@XhY0L\*$0e=G0Y@c ++m+ǚ+b0 0H.06 `Yd<:<:<:ٟ0x1011011\`/`/101%:T*@\\:0?:d?:@?101<0!50TH±P:*0q\^*0]<'A] 8&Tq X*|4*@ m"q^7!HDTH1*@X~gc01t?c$ &Tq&Tq<0vq^q@^q^q0^0k|CKt@0p=±:qX^1T1՜Tc2`c2`X`XT4T4T7h7Tj`pjTpT1T1+T;+T;xT)͝T/T5CTXCTdBTamD mD RT gRT RT 3LT mD ?TFRT IT"+cT +T yT)mD mD mD mD mDmD3L 3L mD RT6ST;mTT$nT8T8T9T.9TBTs CT'CTMCT|CTCTmD mD mD xT sT&tq&TqT$TT)ړT)$T)ȕT)T)oT)lT*T*"TTo0TsTT6T8!T!Tf'*"T4oTI4$T$T$T=%T}&T '0P0)PI)`oX'*TZ*Tb*Tf)T2^)T@)TJ*TVt<2|t2)4{T4< m">5T`s5Td5Th4T,4T'8,8\,8\,:l:L;vT@@E)0Z*)0*@CTCT*@B CTB CTCTB CTG< m"rHTSHTWHT[HT,GT'vT:O@|)0Z*)0PXIRT6Q/IRT6IRT6IRT6Q/IRT6IRT6Q/IRT6h Z\z]Tz]Tz]Tz]Tt<&x[aX][T%bT&P\e`g3 fixzdT dT/2xi.tjw|3xx|Q y0wy0{N{N{@N{HN|{HN{NI0xx4Q@H2TkT 'h($=$=t<"L>TѠD$ԡ`w mP"0 ((HU8'a0 TTTHTjT_T {83A/A4/{03h  xYDYHYYfMYPS\k0kdk4|X|,\0t{l3P y)dy)\bP0"wwQTTXTJW0 JW0 JW0 JW0 JW0 ~<}2222t0<2iZTXTt;*\i0{L07@)KD.0/\c(1(68L@,Q0,X1\62hLqL,]Qq8,7 X1X X6 hL L, Q 8,8`p*p*x`QhFt@20%&xwPQPPPRPS@chP);$0)'0$'0$2) T. T*'TB&TxTQf Gf TG I TI H TH J TJ#!K#!TK!M!TMR!LR!TL!N!TN!O!TOwQwTQPTP|STS|RTR"tT"TTz"tVz"TVG"tUG"TU"tW"TW"pX"TXE#pZE#TZ#pY#TYy#p[y#T[#p\#T\ TB(TE*TfE2TbDQ4:QhQjVz*@,QP0P<P0P<bTp*@P0P0a0k ?QT RT8RTcRTRTRTRTST+STRSTySTSTSTSTTT?TT gTT)TT;bT% mP" rT]rTsT.PsT7sTIpwJy)JyL)yT_yTZ {T{T|T^|T |T}T?}TSR~Td~T[}T7X3>T$tT)T.T8T3T0XT0~ {P^MɸH;LcRLcLcLX87 x`ux\pXTTT`ZT\TXTp[0 R {-\" p[0  T+ul>DM;Y\s|+0r+0r+0r+0r+0r,0u# T# T# T+%  % T - w0- wwD0 L> 0- w0- w0w- w0y_?J K 0- w0w1 T ; T3B8 T7: T+\$ O H , 0>t$. . -0 L~ D& D& 0k @< I 0/ 0< / <; 4; 4 ~  *@p 0OE pf Rad0^|L O t 0. m T(|up*@&x0-0>$r4tE {L TH TV LnDC DC *@(CCc 4w Tw TC XC *@V V  T ) T T# Tw T+ T0u T T9 T T T T  T% T TQ T T x @7 @7 @7 @7 @7 @7 @7 @7" 0" 0" 0" 0" 0% @% @% @% @&  ' u' ' ) \0D* \6R& T > T> T T  T o To T T T> |> T  T o |o T  T> |> T  T o |o T  T x> 8A B X#y4ZF 0=F p=> $UJ %> D> D;W La lN 0:c 7N 4n 7N pn 7N ln *@s 03t 0it TQu h{ T6f  f 4~% 0 g PG6 XrL *&Tqs LҘ  < <)ǝ 04؞ 0:+ @=؞ :' %&Tq 0Ie 0^ 0e 0^ 0:Tg Gg DG L< Vب m 8<*@*@ x x1|z11Y<Y<:dCG4 0 0 MP pP p[ ,R~d 0k R~`d LMi LM LMN |C1 t@+ p=؞ : Z@x 0w  O |C t@ p=GO : @ZP 0XX XK Ɓ Z~ 0 w n7 V M: 4 S} | P @ A K FC 9 y qn |CF t@xG p=N :+k * +k T* [k / [k T/ p < p < &U &U o o f x f T k t9 k T9 k B k TB k tL k TL l U l TU o  o  0[ x 0[ T Hp 2 Hp T2 p 7 p T7 I T?I =A TA TB T#it Q;W TL„ „ Ӄ Ӄ it Q7N Tn Hp 02 wh.L 0t| 0 0 0{K 0 0r @s |K0y g*<@7{ <s7{ <s{ <yF@P.w m(u W(u W(u W(u W(u Wy TgCw T(u TW T~ TK@s TbTs Tf,v XR| XFv XL Ti i  T TBx\V @i TC 0{ @v{ d{ L 4d  L  o 8 k 09 k 0B k 0L l 0U f 0 0[ 0 o &@q{ d*@w\L\*@up֏ = A = x!ŵ 0{ \{ `^,0^,^,{ @ ) d:T:T F+r 0{ 0t *@ 0*@h 0 0*@ +0[ 0 f 0 ^,T 0k T T T T T Tw Tw T@ T@ T" T" T T T TF  T|C 4G ,%k 09 Tq 0</ / gcPgcP 0 8çT4gcPgcP  p $  T8 T<gcDgcDzDhW pJ' DF' ' ' ' ly)\y)\y)\y)\y)\y)\y)\y)\y)\y)\y)\@/ 8Op- T`@/ dOp- T`p- T`!d=3 9!x=' p< |D |C;E t@2 p=1 :.6 5 .6 5 .6 5 .6 5 .6 5 YHYPYYYYYgcPgcPgc<vtDV 0TTTTTVVzzgcPgcPsMq 0m0 0#p <q D#p <#p <0i m" m" )< 86< 86 #p <tL< m" 0#p <y TcՑ T~ T~ T~ TL% Ti\ T T T T* T T*- | 0$ Lr$ @rDPa$ Lr$ @r} P @n @nש XR +^+^00z00I I ճ T, h t TY T T% T/w5,P X[&Dq T$ X$X= T= T}LR))~ pB 0U*@B TU~ T Th- TZo V p=çT4 P J 0u \<F @r &x! ,'h" ,S& * J" B\ ? 6)/ 0 / 0E ,'  ,;> *m J B) ? 6VN 0 ;O 0VN T ;O T)/ T / T$ LY\gcPgcP*4@<0c 0Ti \pMj h T l 0(q Dgq g&xl T N } Q @T @T @T! 4~ d} \} \" n Tm Tm To Tp Tp TGBm Tl Tm T4~ T| TK| T)H} T,} T! T Ts} T" T TNn Tk srh rh rh rh rh  Lk @s 8 Px D. Tf <rh ewa 0+i p\ d\ d\ dz 0 0| 8F  o! ` T Ti Xpi Xprh  yL33 D 0 7 1D 0 7 1D 0 7 1D 0 7 1D 0 7 1D 0 7 1D 0 7 1D 0 7 1 TyTT-T--T.'-T+l-T,u*T!=.T/.T01T@2TA1T?p;Tk:Tg:Tf;Tl9Ta';TjM9Tb1:Te9Tc9TdckcP= T[AexaAexa= T[ m@" m"jllTbpuu0u0)n0v)n0v)npv8}8}8}8}y)`k s hk s hk $sk s4~ 4~ | K h| Kk sk sk sk $sk s} m h}  |ƹ h  ƹ h k sk sk sk $sk s} " h} "k sk $sk sk (sk s}  l}  ƹ l  ƹ l k sk $sk sk (sk s} "/ l} " zi , z zi \ z <z zi , z zi \ z <z zi ,!j< zi \ z <zn i 0n n i `n n hn i 0n n i `n n hn i 0!j@n i `n n h         x x x` ` ` ` ` ` i p0 0 0 0 0 0 0 0 0 X0 0 @Tt 0 t 0 Ty)0t 0 a0 7^y)0|((lLlTlLbp`ubp`ubp`uy)y)Lrh rh lXZP ! 0y)`ov0y)0y)0y)0}m<C}m<Cm@DmDm@DmDn@xqln! @mPD mPD@ >A A A8A F\ y)0! xzu0|T(T,N{T{TovTjTmTD)nTv@T>T}bzTmTqTnTCjTY T TTLTITvTT T܋0 ܋0 ܋T i\?2'iT?яT5RTLTC0iw4w4T-`T mX"=!=h!=!=h!=!=h! m"pG۴0.T-Tt|TTZZZ_,!*@p*(@H(s0Y.0Uz0QhDExYTYx]T] Ta TaTTeTTeTiTiTdTYg0YçT4T.Dc2T`101&c2D`gc0gc0111H1t<1811<1sdR0M11TbTXTJ TTJTJT m"0wTH0d.%!LT)%)D<aDa(PDTd8+\B m" m"t`(wdR0M<h`=F0`(0](] m\"(0](] m\"(0](] m\"sd(0](0](](d\(0](](0](dp&uUuptT<1|1(p m("50 $`#l506147]HH:DDT< #@3C0]*@0]*h@(T(]0(0](0](](](0](](0] mX" m0" m0" m0" m0" m0" m" mT" m0" m0" m0" m0" m0"#@03]0N4]0c0~]0]0]0)]0)j4#o0wF0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`F0`(0](0](0]0]0ш0Y0]ш00](0]0(0]0]Y0]Y0]t00]0]TTTTSTP20TMTW0 ݰhi<BBBq^y$&xd0n .|Logg*@k0YTTliy$ @RY4bHb07YYYYYYT?bXgXX!^TuP>0<<8 m"}LR==T==T3Ju\>d T=_dçT4$0*X@% Y0j0pt<`/XgcD+e`/l+e 6.j0 6#0;#0;`0c2`c2`X`XT4|4T7h7TP1T1+;+T;1T$\s[gcPgcPʐ4'x6 0[ @ 0[ @ Bn 0Bn çT4T4ƌT'U4'4'TVVvvTzz m0"+e0M8Qм0CLF%0sh 00\X. |R R < @T&tq&Tq@q$ dC[TçT4çT4l(l(Dat0 0L hhMhMhMggv0pL*h@pL[_[_gc0.Q[hT.Z"0` 0A LA.2\-H<0`?0AQT[TZ"T` A  >.2<,#T5T?<TUVVvvTzz}ThTs[TT.`&xdHs` ã0kT{ThTqT)Tk*p@XxXxX00`T4T6T3@tt8KpKHslLz&xdv(r0T}TwTdTm |)0f{\3aV #0 :@ CMrHfHH0s*@ *@ q@`@gLVDPaG*@*@*@ CFK@HdHH0s*@ d Md/d Md/*@ q@@e LV[DPa?G*@*@*@$.88*,@*TF!+TJP+TN+XR Cn1 15HsHs2@$B2@6`j77\{?Tq?Tqo@X$@HB@DPa&xAIA}&x2@$B2@6`j77\{OToOToPX"QHR@DPa&xAQ}&x2@$B2@6`j77\{_Tq_TqZaX$aHb@DPa&xA1b}&xHn|HnLq|Lqrl!rD-rl!&xdx<+x<+Ey<.Ey8.x8)Hx8*RM!Lr4trtDpaDpa;0;0;0;0;0;0^,ړ0&xxA0PT-}T=ssTrXtrTt,TlsTsTxTrrTtrTt,l,TlsTsTxrxTrrTtrTt,l,TlsTsTTxrxTrTATړTvTrTtrTtJT\T T'҆T-sTsTT1,TrTtrTtKKHE0pE^,00aQ$7=d|~l=4|~4|~4=4|~4=\=4|~4|~4=4|~4|~4=4|~4|~4|~d|~4=4=4~d~d/ThTD0alXg_L! 01*4@g|,Y0Y0Y0Y040*h@,@D8YPuD> 7070.09#T ;0 N=={>[?lAT =B0GCfUd pVl0WhHV8%Xxx mP"^ __i*\@[0<[0<op}t&v} zYV{}; }*\@rq  H6^ qT;xtGi0M4G4GG4GGG4GG6U666014)* @[(L  ,*@%*@DGG[0<[0<*l@i4*l@x8  !CB   (          TUt  ?          `      HD          @$             5%%%%     @            @x|[KCA                A           !#%59  $%5 .,       !10 k   *(,)9   "227'  """%"% )    "                    H@bDPBA EEEE@ADE  @S@QQAAA           ) Z Z V ZVU*b     $!!#        CCCCC@CB !   ! 13s  "   F              ee  DNO ~  ` `A   *(    7               ??              @  @@EMGBB@             F& U  @A TT                     J  I              300 @HLJI     (0 @`B     I  2#+/  $(    ``    D@BB@CG@  Q            3111  !!!   2  FGE   D4  " {             0<,>. !!      ?     !            $$ @"  @     IAAA & 2:2    + '         ####I " (   H20    n         @"*  -@     @  0 0 @  0    |<   ?@  P !$(  ""     ## !! #!*    *(         ##    Ȅ  @ "E*  @  @MIOKE@BD&D-%* 3 ' OKBkCS   IAA 0A1A!A)    !     C#   *:. )08<   ++))))( X\      /.,  #" UTT  FBFBoVO  7    TT        `  f@  -- - $ -  ]YY#-R `  @   FF&  &          oOOK   %%$   &  $`"b#2  LL  '&$$ ''''         IA R&R&%         !! ! ####   EE   n%%4  UT    h * @@ KKIH   --   T   ! u t t    @     %$$      &6> @   $,-J     ,,(         $  D       10@@`@@@@      L ,     -%  -%% $  JNKI   I$ )(((  @  D` A  BB  fFf     " ., &    ##!!      @    @              bFV^   @  ]]]4 OC  CCCCCCC    @CC@@@ CBE   Q  *" @   '"          -,,-),(((  H  #      )((  )!!!   NN b"" I                       $(         $(              PRR  ---------      `PH $                          $( D&$d,4%   $ OOOOOONHJN    $4            !a           TS Q@  ]PP]\PXXXP          A! `0 (         prRQ             0 4$!+)  @BRC #!         QP   7333        <>         @ P@  )()())))()      @           @A0PH $,4<111 ܬ1  UUU1!C1(11 @8p1 BB1D1 ,((,,l1,,l11$1B$11  $441     11IIHI1$X 1 1 11111 $111 81 1 1@@1@@118``11 $1 ))$1 $1d`1111 ' '  1   1 10(D111 1, 1 %%   1 1 :888 )   @@$%d ` 1|$11841(1@<X1$$1010101l01 M@`1 $@@1)` 10111$1 $1xx180l1 "0101 P  @$11841$1 0 P@$1@  +++++ ####  1 11 1$1 1 81 %%%! $$1 81,,1 1 8111 110,l1HDX1p1@8p1 81X11 11t1Ȭ1x11$$t1401m @` 401X1  ܬ1 |1 1($`1 1 811\1$x1X11T1111 1 1110,l1$1$1@<X1$11  $1  HH1``  1   11`TU00110@8p1PP1  YIHD1LD1x\T1 H1 T T U T 0,ȯ1$1 555555551!!$11  LLد1 H14,1 HDh1 !  1 +  [QQP[QQPYXP   "`1"%"% $11 BB @  0,l1 0,l1,1  CC1 K   ( AD1 88|1 t1t1 1(11    .t1t1t1$1 E 1t1y |1$1   11((ذ1    1 81 (00԰1<1 81   |} 5-!!    11MbLb1 @8p1c1d1d  lh1M lh1Xlh111|1   1  h1lh11lh11$1 11UUUU1 - H 1   HDL1HDL1  81 H@1Ȭ114,1  f@   1 81PP1   '!     1  $1  1 1`10111 1! ` 11  NG IHHH   1  1 1LD`1 1 1   1  1  1X1`\1  CC@CCPPPPP  1$1 1 +*(    1   8c#   sssc  s`s`D<1  1`  (1 1 $1 QHз1 IH@1Į1$1 CC  ܬ1J  1 1 ̬1 ̬1 ̬1 1    4,P11|pT1 1pl1pl1K@K@T81  0 |t1D81A 1((̰1$1 $1K@J@K@K@  1  5K@K@K@J@K@  ,(`1 H1p\1  AA@@H1 1 ` @8p1 118411@` Bc BX[4ܻ1  1   0%  11@81H1 11HDX1!   31110 1  11 $`x1pl(1xt1xh1PLl1ܬ1ܬ1 ̮1( (1841MM  T1 1 1 -%%       h$11  SSC  1 1    64(,   |1   11118(1 +))())))(()   >?  ($1($1 MM ) 1YI 1pH<(1H<(1  1@    811,1 -  B1((81((81((81D1     " :0 (2!    1   @8p10  8114,p1PLx1 D   II, 1 1 I + 1\10,ȯ1P1)00 C D1* 1 1 11VB@" 1   PLl1IEi{l`Ĵ1B  BBBB '"P@ȴ1B $ ( //,,,  1  18   441\1p111 !!!$1 1)))  LD`1 H1 1   3%!!$X1 X11,$1****!!!! 1 BBBB  #   1LD11                                            $(     +++++())()((  (   ------(-))))              L$                     $  (     +++++(++++)(  %%!!         Z:z:;        (08  G'S    (   (0$  $       $!(20   11!!!       33333330000 UUUUUU  @@  +))   eE@ 3aaAA@ R 3111     UT    40::; !! @AA6666  T (;$   0     ( (     Y %  @ttuA TTP -%%%%!! !! D"5      ED@  000      :800  @!  @@ QQAAA IHH IHH       k# ( - & (,)+*      `@ nll  srr U rrrU  ;:>    !!!!!   qqq!C!C!CC@@@H@@px      ! K@K@K@K@K@K@      7U    %$6  MM  ---%% -%%  -%% -% -%% -%% -   -     RP BFCA       T ss !!! r`P  (,- UQAA @         $%&$  Q         )@!15333'B B!C $FFF             $, &  $    !$  $>?>UUTU <>?  xy0  p  ( 00         =>  .      EJEEJ # !I&$!!C&U-R-R-R  >?   $%% $   [[[[[X@XX[    >   **  (!<#@$$  ( K@K@  (%    $@  ! y  #    (   $(!@   & @ x y <  x        I!    EEEEEEEEEEEEE  @U@B !C     KIA  F @ a3 # I UUUQU@Q   -$        UUUE   t  EE    "2 LMM       P  UUPUUSP  U IIEAEAEAEAEDD ++++*9=800 ** $,(   VRR(    ,*" (!%64   "ccY VU  - U @ @@Z  << (  %%$$        )( BA@ I  !($0 ee  #""" & PRQY]U K K  0  aaAAAA  sc  CC C C  * * * \]h ^dK@     @    @    UE       CAE  -%%% -%% -%  -%%%  10       r``  ss 0  $    AAAA@    0 0 0 0 0 0  ]$   AA SCCAA@@  @@! &"  ((VURUPUSSPRRPRRRRRPRPP RP$$QAA )( (*@  I    @                   $    (0  $           $                     $     $,  $,                        $ $    $     $,0       )  /  H )D ,  -$ M   5U -  @ @@ N O O N   " T  $ "#fj>  @BfA       * * ?xxy~  00A!A!xy     H H   @@@ (@ @  @@@@@ -- -----     IAAII !%$       $>> GFCDE  +*( KAA  6088   &&  & & scccccc @ $<>$ @TTWUUQU   CC C A A A . P- yxzK@K@K@OOLP K@K@K@K@K@  ( $% ``` PPP MIIIII@@ 6222```` 08<    F     #@`$  ---%%  -%%%%  -%%%%%FFF   :     r``` @ r```@``@  JJ  MMM  +I#IIIIDB B ""   $, (),4<  I  $(  $(,0 9 @ $, $(,08,00 C    Q4p"`"""B@BBA  H(@ @( OG @@@/   EE E E E E E FFEFEF@    $      $  $(  $(    $    $   $  $   $  $    $  $          $  $  $   $(, $  $  (0        $       $  $  $  $  $($  $,    $       $  $B(B 'B (!C   $ ##! !!         $&&&        $  K M   $  @   $     $  WV$" `  @"""" @ & 5  #@@ & & # wwww7777   `pdbbjBjbbBcB!"   $("b !(B4@@@*E$   -%%%!!! @@@@`HUU%-R (R(R &H '-R(R'-R-R-R))( """"""""" @  $  $   QP   $  @@  khh` (  $  $  $ QPPP    $ CC C CC CCCCC $,458 (014<  !@P'   $       $ ----%   $ 0 %% P @@ 0<<??<<       $  $  $  $ mmRmRmRmRmRP P PP  08<<>   $ AaA A Q "$4&* %$$#A   0 (   $ 000880000 **  $(   !@@RR@ @   "   08X  SSQQQQAA@NN  $ 8 /@  $      $       (((+)   B&IIH@@     @  H@@AI2  $ &.&.  @A ( @<     **xz x y }    $,4  $(  $  $K@K@K@K@K@AyAA  (   $      7  $  $  (35  @ $,  $"""     $@@  $  $ 0p  $  III  $ `     +++ + !+)!  A $,  $ MMMM  $  % Bbfv~ @  ``hdpb`a` $(, @    ``hdpb`a`  $  @@!}|z  $ - -$$$ $$$    $  $ $(, JJJJJJJJJJ  DEA0  $( @``aP@ a`a@@  $   $    @      $  $  $ A! @ @     $    CCCCAAAA K@K@K@K@K@K@  $( % !!! AAAAA@@ $( $,0      $ S A A A A A A A B B  $   $  $  +###   E  %@   GFB ` @QA@XP       A@       @ @     (  $(,T00 C      $ '  FCE"" "`  $  $ CCBB@  $ IIIAA@@@@@ EEE @  $ $(,  (     $ $,  $  $(  $(  $  $  $      $  $(  $ $(  $  $  $  $  $  $    $  $  $  Hh! !       !BD*    7  $5555  $ 5!#!) $   $   H  < 0 0 I"I"I"I"I"I"I"I"H"I"H"  ` 80%!  `   8  00 H*     jjj*x|}{y@ R +_   ```````````  PP $(,4  $ $4    BB`p  $         -  $  $  $(9d2 b P5%% $ "!"   (    UTT #1  $(:PPPP<> > {;98 :$$$$    @Ppp{}yxEyEpE @AEEAA@IE III  @   $ A@@@` @@@@@  `  @  $  H  b `a```@!p(pp0p  $-)-/CC@A  04  *         (((( !   `  (  $ -mmi```@`@@`   10     $   @  A!19J J            PPPPPeTeT@@   !  T T  " @ @  ?       PP  $  $  $(,+,00 C  $b  BRbCAJ   $`    PXb@ 0"00b0r0v0T0P 0@@@@@@   EEEEEEEEEEE IIIAAA@@@@@ x8WLlRt8RhLVRPT\RlTVRlAx$Ax$Ax$Ax$Ax$Ax$P&0Y&DY&6&d6(0<D(l(0<D(`}+N*U,.89L.+0*|Un-XL.\)#!><I;,5<~<70=x;h1?` W@ @ k[@0j@<"[@0j@<" `F4rF4}H SA<}H SA@9J9JJ}J}JD?KH5KdCKKhA| A L#IdNP5aM0maMhmR0[R0L U5 LSRVWRVDWY0VAfVM04U`D<WMdaM@m.PDtYDDAH _H~`0qc2Da8KDaHKfdh,0gYgDYP?0 RX[WW044XIP 4UdD04U|D04UxD`l`l04t0u0-0;@Dk@kx\`?P YXF*d@*z*z4z rrr @SN`tvND{AL SLlSN<tvN{"0IPY0IY<@"Lfl%f fP[ɔ4+ܔܔ(ܔxx{F0rt0SASAmX}"9@\F@`[@Pj@T"iiTk\dʦk_TSNtvN{n0YL0٧| LIXI[@0j@4"_(q|٧t bNpBLY0P0tƶx|YTf\[\!e 9@F@[@j@"AA ܔ$q7q7T8"pY ?X8t$Xh1X1Ed-E-RXaMmFDrFDmX}mX}htSA`htSA`hxSAdmXh}hM7o`0IPIDPhP0IYgY+0l?` 00Z8<H  _0st|$x&"XaP+|Ph-X;e 0$vNP{S0 LS0 T:S TT:xx:~a0L080gtY d|ph @|Lh SA SA|S S q@CRL@ @ kDflf`(4.$H. DI0I0Dx!e ||SA4Mt|9 TXL!e 0\|x8^<x8!<x8}<x8x<x<^ x ^x  8x 8x } x }x  x x A x Ax ! x !x Ax(Ax(*H\~&4T@1X&4T@1Xl-0-l-0-|l-0-|.+P}+ Y7|C+0^8tr+0^Xc0gc38-k1=&4T@1X3@-k1D=&4T@1X;4x4*3h-k1l=&4T@1X;4x4*3-k1T=461L&4@1TPi0"[i0.i0iQi@ ilPi0"[i0.l3)lSl4/)l8l4}lhkHkmXm@GnT)nX%nTnT%oNo0"oNo"IpXip q;rLXq<Xtpt0&uDUup&uDUuputyqvDQuLpv@Qupv@QupxH&x*@*@*@*h@7{DE{H,}d I}0͂lbj&4T@1X0 q*@*@*@*h@;404*TPLt5pBufH4i`~li`~Luw0<7dC+^8Tr+X^7XC+^8Tr+X^֓0t֓t&4T@1X38-k1<=&4T@1X+O4ua` l\C\C\C\C\C\C\C\C\C\C\C\C\CߛTdTPtT6hޙTPtTll<Σ\D@D(*x@˥˥\A\d˥d˥0z0G0zG]]ASm˥p˥TP˥A4˥;4P4*hٯ# ,TATR̤ؤTi̤H? Ix_:l:3<-k1@=&4T@1XX)0:X)0:X)0:**(H p!|t*lt*lt*=00]TP9*lt**D*x*8Tr+X^lt*t|*&4T@1X4tΛhx,8,N`La0Y0_0_\6 68Tr+X^DD:D-D|D|DA|a04!T@)\(0@)\(aaLD`aLe`,T-ѷ;404*H<7<7jjP0=x0=Pxii^ T 03v h *@* f $f X,b,g888LP"^TP-T*|@h Da*d@*$@ 4'DU 4'DUT$<[j$$%y%2w,kd0 "0 3D-k1H=&4T@1X&4T@1Xx8=>2WP=W0r\a4 Hp@̆i@sh;404*XuhC$($L(;404*HH?"t Ix_t \ ,oT U52WT=WoTopToo>O|qNOTqNO|qNOTqN 0X 0\l }l\l }l\PtDT m"0=0x<~ = l  = l T m"b b @Q&x;484*Xh HH!*@*@*4@8Tr+X^Xbp'obd>004 mh"%Kl=0T&xduTXdTylt0T m"m0 t <= l T m"ii 0L Ll0z L\HgP\\XgH\?\c\D<~<~*@*\@MFMFd 0^ 4(*P@7LC+p^8Tr+X^7TC+X^7TC+X^8Tr+X^u$ `u/ `0u/`u$x`*<@&xH0`a*@U&u0UuTU@U03@-k1=&4T@1X3D-k1=&4T@1X3@-k1=&4T@1X&uUMLUU&4T@1X&4T@1X*@U&4T@1X&4T@1X&4T@1X&4T@1X&4T@1X3X-k1=&4T@1X 0*@3D-k1=&4T@1X&4T@1XsPK=+\+d*@\*@40Y15|s8sl* *8++(u/`S\SP\*p@4sTe*@*@&4T@1X&4@@1t3T-k1X=u/`u$`m8Annn(Ix_npn3-k1T=461L&4@1T7\TN*`@&4T@1X&4T@1X"y09y"y"y"yP"y~L~X~LX;L T`}L:XLT`HnFLa`L`ɁɁ0HLQ0nT0p0bXq8@HC8Ny0D0D˒0$D˒0$D0D0D0 HD0 HDК0DК0D+0\T4q+0\T4q+0\T4q+0\T4q+0\T4q{0\uH+8\TDqMˢ0@D0@Dm0Dm0D-0HD-0HD0D0D+0\T<q0@D0@D0@D0@D<0@D<0@D0D0D0HD0HDP0DP0D0@D0@D,0D,0D0 D0 D4 q^liq^hE0DE0Dp0oo\>0 D0 D8D8DL0xDL0xD0 D0 D0D0D4iM m"uHliLM0D0D4iMliLM0D0D0D0D@0@D@0@D0@D0@D|0@D|0@D0HD0HD0@D0@Dc0Dc0D)0Z*)0Tj.<X\2<-Y10p4 0p4 0p4 0p4 Tp0 Tp0 g  454@5~Put1U`$]X0iiTV.iTV.iTV.g0hLtL;404*H7hC+^8Tr+X^`C.<Gk i7LC+x^8Tr+X^!'v!P#B<#x-#8<#D-8Tr+X^'@(`>0#PB<#8-.D}<#d-.D}<#d-.D<#d-.D<#d-+0\T4qPtt<#8-Z3\:l@'@MX +8\TLqPMh PMh @MX +0\THqݡ@qݡq+8\TLq#hB<#D-<~4<~+\Tq+\Tq+h\Tlq0@<<#x-0@<#x-&4T@1X&4T@1X3@-k1D=&4T@1X[4[ `L`pE'<UP iP\h'TU2L1 3\Bm*qsop/olQsop/o,Qsop/oQlL}l?s?s0@tzP?+| I_P?  I_vZ&uhUvT*@P ŜP۝)Ŝ8۝)Ŝ8]t~X;44*Lz%lllH}lP0t@-0V&x@d>0)DZ*)D=b<g8A(Ix_pT.Լ_ԼLԼԼԼ$ ԼBklk,dA$DFTws:0`(ts  \0&  0_8&4T@1X&4T@1Xtd?2SW$ G*@4l;404*H}t*D,8,G0D,80Tr0hr0GuDss DP<f 8^`F|ws:f lb lYPt-$k<- @=y03r|rp|Ã0Sewa~,0;,lg< @181}2'H "d 30^3J1L1430^3Jֵ0L1'fTf\101:11:P1D'Pxt<&4T@1X38-k1|=&4T@1XD<as"E:EGDG|F0^HL< 8stF0^HL< G8|JssGDG|G8|JO 038-k1<=&4T@1X3<-k1@=&4T@1X3D-k1H=&4T@1X3H-k1L=&4T@1X&4T@1X3@-k1D=&4T@1X&4T@1XX4(X(WhX[LZ8JWD Y]<n:\S]0 !5DT^0$}^3H-k1P=&4T@1XDha&x]0 ld)]0 Z-]4 jxp;404*X!50Xx(@mX@(X(38-k1=&4T@1X;404*h3D-k1=&4T@1X38-k1|=&4T@1X&4T@1X&4T@1X3<-k1=&4T@1X&4T@1X&4T@1X&4T@1X&4T@1X&4T@1Xc2H`|!| } &4T@1X&4T@1X&4T@1X&4T@1X3<-k1=&4T@1X&4T@1X&4T@1X&4T@1XXh!V,X&4T@1X&4T@1X&4T@1XIx0͒c2D`Dn<*@uTpt<0+T+)Z*)*@*4@101*t@0.,pPht0Pt+eH`/t<0<h *@1X1*$leߩ<Nߩ(Ni><+Fws:Hi><+S0:eR8Tr+X^3<-k1=&4T@1XU Y1L'`&40@1d10'H&4T@1X&4T@1X38-k1|=&4T@1XPtd>01H'8Tr+X^8Tr+X^@`A] &4T@1X&4T@1XHF*0&4T@1X38-k1|=&4T@1X*<*dJW@ YXF*@͝X/X5;404*X-0V&x8f0a#d=5P6!5@`3D-k1=&4T@1X`[&xl&4T@1X3<-k1=&4T@1X3<-k1=&4T@1X38-k1|=&4T@1X<h.&4T@1X;404*H&4T@1X&4T@1X3<-k1@=&4T@1X*@*@3<-k1=&4T@1X3@-k1=&4T@1X3<-k1=&4T@1X@ht&4T@1X3X-k1=&4T@1X&4T@1X4 j<&q1@'D3@-k1=&4T@1X38-k1|=&4T@1X3D-k1H=&4T@1XÃLSÃS38-k1|=&4T@1X&4T@1X&4T@1X0@=0JSWP?9 I_CjTbh =5TPh61T'hߛT:x.TU dYԦTԦTT1X1T1\1TTT1X1T1\1K* CdK* Cd$KT FX$KT F\VK" CdVK" CdK& CdK& CdeT|D4O(Lt0<)TN)`I)TR)`<~p<~9L: PQ| *p@Q/Q Q/Q +;: ^ ^:t8<db`/`7C+^8Tr+X^7XC+|^8Tr+X^ZO( 0C8CH>Fws:O(\1wiM@0Hr]@0Hr|]@HutowT3xzqp`{N'8('(^$=^$=ȍL,X\{4) {@PPaL/t<P T&(0_ݭL'8U0'hUL h.CT0 @x1: Xx{3{t3 m"0>&x\ fhMUhNUVL0@Xfpqh'8Uh'<Uh '<U`ootob\obp`ob0v0vpswwwxw|w@|w<xw`v w0wpwHwvbTKXtbTKXt4>@T X `2~00hp>~}+eiLuppuHFws:T(cT(c8</@tD rxstD@/XU0NU|NHXHh&X&X**10,tb3|-340t)T|)3-k1T=461L&4@1T8Tr+X^/X0"EX<-Xt2X@E_!*@d^Dt0,^yQTX/&4T@1Xtb~b~a0r`d^Ttd,^TydQrT$ m"~9  =&4T@1XVT?3\0~8XTc08-x\٬\:Ut 0 P[p3[p[L&P P[p X3[,\u,|u% \ d& @& ,- - w0w0w0wP:6 X:6 ,9 (8: < FsL|s- - w0w0yZy_- *T@*@*T@- - w0w0- - w0w0*x@p@ Q H?R  Ix_Y @Y @Y @Y P,y jpy bz tFIx Pl mIx 4P x T`V @ O L~= + D&  D&Ƨ b Ƨ `d @  TJ ,&4T@1X&4T@1X3@-k1=&4T@1X&4T@1X&4T@1X Xs] x> ' <<3T-k1=&4T@1X> ' <<ii 0L Ll0z L (*P@ePQ*&4T@1XD<aDa*x@*@*|@*@*x@*@" L T " L T @7N!  @7" A @7" A @7" A @7" A @7# / @7$ E7TC+^8Tr+^7TC+^8Tr+^7TC+^8Tr+^@ m x@ m x-0%@ t)A F L=EH F L=y`ZF 0=yDZ&4T@1X3X-k1=&4T@1X[G [G \ \ pW D 7N n T6+Xr5 0Ow|O 0EO CO 0EO C*@*@37N n > 46> h6*@*@&U Xo \ 4\ &4T@1X&4T@1X&4T@1X38-k1|=&4T@1X&4T@1X&4T@1X9 Xf si i Lsi i L[ 8yZ:6 d6 r3<-k1=&4T@1X&4T@1X3@-k1=&4T@1X3<-k1=&4T@1X3l-k1=&4T@1X&4T@1X3@-k1=&4T@1Xp@ 0Ҙ 3P-k1T=&4T@1XT+ =؞ 0:N C&4T@1X&4T@1X3P-k1T=&4T@1XB 3 4I =I =&4T@1X & <&}@7}7}7}738-k1|=&4T@1Xg LG | rp\pZ<z|}?z&4T@1X;404*`38-k1|=&4T@1X&4T@1X*4I =3<-k1=&4T@1X3D-k1=&4T@1X3<-k1=&4T@1Xx D@x pdy 3@x pX TDP R X3P  D~ p1 3~ p H?  Ix_# @# 1( \ ) <^|( }(7m X 7N \n m T 7N `n }m 7N n }m T 7N n Jm 7N n Jm T 7N n s T@3t ts T;s s T@3t ts T;s Pf  Tf  f 8~ f 8~pW T 7N n u it PQK TK X1\111k tDawPwwPwl w O(Lt<r l V| 0ٺ P ب ms L+0rq @q (u W W(u W y Tmy dgu|pu@H | p|*@*@F|ws:Pt;4@4*` 82 $V+k X* { |c2T`c2`Xc 38-k1|=&4T@1Xr Pl <Vr 0l 8V[k / { k 4 D,&4T@1Xr l VL 8 +r P7@C+l^8Tr+X^ ب m Hب <m&4T@1X&4T@1X*\@ٺ |&4T@1X&4T@1X) tt38-k1|=&4T@1X ب m ب mr l Vr l VЗ T& h A<~0o 0# 8q 08 83@-k1=&4T@1X78C+d^8Tr+X^7<C+h^8Tr+X^8Tr+X^1',2WH=W$3-k1=3<-k1=&4T@1X&4T@1X3-k1=&4T@1X3<-k1@=&4T@1X3@-k1D=&4T@1X&4T@1X&4T@1Xzy[t}qN' l' ' l' ' l' s( 08( $y)\+ ;E'U& ' :. 41 :& ' |1 P:' &4T@1X&4T@1X\5 x5 \5 x5 \5 Lx5 k= Ph.h&4T@1XDaYDaYU U dO|qNOTqNl p.m hJn n DO(h#p h<q pDq D&4T@1Xs TX$ 0u q Dq lDq D#p 0<*0@#p <<*@Jx x W2W=W$2W=W$2W=W$  \x @<  6 D< (6 0  0 2W=WJx x WJx x W T m"- 8*@DPaΥ P$$ @ru dj$ @ru dj$ Lru tj$ lru Lj 0a$ Hrx x x  8a84J T4 T' Ta Tz 0 } 0u} pu? 00? 0@ 0+@ + 0*H@l4}lhgc8p 8[ [tD<*h@*@*@*@*@*@*@ 0 u$t<XF ѷx ?|?gpw~\dgTw~`d h h&4T@1XFlws:pllB 4U0 d 0d 000d 000d 08r\ *@( H{ : <3D-k1=&4T@1X3@-k1=m :) _* o  o $ DC$ @Cs <( \/*L@ < d   0I \k&4T@1X&4T@1X&4T@1X&4T@1X&4T@1X&4T@1X3<-k1=&4T@1XsO&4T@1X&4T@1Xq' ' uK( ' u( ' ur) ' |u+ + tk. h+ |k. h + |k@ @ uA @ uB @ uC @ |uG H tk|L hH |kkM h H |kl }l\l }l\f Pf <i ti 00q gq gq gq gq gq `gq gq Tgq gq gq gq gq gq Tgq xgq gq gq gq gq gq gq g| TA } QM T4~ t T} t͂ T! tă T} t"8Tr+X^F0ws:<8Tr+X^7\C+^8Tr+X^7XC+^8Tr+X^7\C+^8Tr+X^7XC+^8Tr+X^8Tr+X^8Tr+X^8Tr+X^8Tr+X^7hC+^8Tr+X^7\C+^8Tr+X^7XC+^8Tr+X^7\C+^8Tr+X^7XC+^8Tr+X^7\C+^8Tr+X^7XC+^8Tr+X^7\C+^8Tr+X^7XC+^8Tr+X^rh rh G \Wrh | rh T̼ 0k $ k s$ pk 4srh 0rh rh rh 0 < $  f <f  h\ 0 t\ @ h\ 0 h\ 0 h1\ 0 h1\ 0 h1\ 0 h1\ 0 h1\ 0 h1\ 0 h1\ 0 h1\ 0 h\ 0 h\ 0 0\ h h\ 0 h\ 0 h\ 0 h\ 0 h\ 0 h\ 0 h\ 0;404*h. 1m S 4oi (pi 0p  di Xp;404*X;404*X;404*X;404*X;404*X;404*X;404*X;404*X;404*X;404*X;404*X;404*X;404*X;404*X9 9 o9 9 o9 9 o9 9 o9 9 o9 9 o9 9 o9 9 o&4T@1X2462d&4T@1Xu04v;4@4*dE'UI||(E'UI||(8}ycy)jhI| |((I||0(y)Dj(4~ dk ds h! hz4~ k s| HKk Hsk s| K } \k \sk s} m m  k s k s k s $k $s}  ƹ hm h } } |"k |sk s} " } k sk s}   k s $k $s k s (k (s}  ƹ l l }  } "k sk s} "/ / $ k (s} h zi ,m z} l$ k s `z} `$ k (s} h" zi , z} l"$ k s `z} `"!j< z$ k (sH} , zi \ zH} ,$ k s `zH} `,$ k (s} hn i 0 n } x$ k sn p} p$ k (s} h"n i 0/ n } x"$ k sn p} p"!jDn $ k (sH} h,n i 0t n H} x,$ k sn pH} p,$ k s$ k $s$ k s$ $k (s$ 0k \s] C] C$ k s] $C$ k s$ k $s$ $k (s |M F M PFk k s 0i pP  E'U09!8=P  0E'DUP  0'@U! q0E'DUN{{nnbp`uy)`3<-k1=&4T@1X201 3HB201 3BP y)3@-k1D=&4T@1X! z! @zP lPZ3<-k1=&4T@1X)mm0mnn|ndn0m@D m@D m@D m@D @L0L0L0L0L0l@A@A@}mDCA@}mDCl@>I|T|(jTZjh:TlhZT:y)l;404*HMMi"&ST mh"#T=x!T=x!.T=x!.-*@* @*@&4T@1X&4T@1Xi` i i` lz$``[0}qhN4"*@ 7DC+p^8Tr+X^7@C+l^8Tr+X^7@C+l^8Tr+X^7@C+l^8Tr+X^7@C+l^8Tr+X^  8Tr+X^``/Cjb  3X-k1\=&4T@1XJW@ Y3D-k1=&4T@1X38-k1|=&4T@1X&4T@1X*$0e113@-k1=&4T@1X3`-k1d=&4T@1X3D-k1=&4T@1X3@-k1=&4T@1X1<1p&4T@1X0`0`}0V ==m4%`)d X,0,&x`<`dsHsn1n1L_3s3xfx>|2Wl=W9B:F0_8X(8(4,6tC0](*@*@*8@*l@(`]*L@2W0=W(2W4=W$(0(T mX" m|"2W=W\F0`T<  m0" mx" m" m$"F0`T<x  m" mp" m0" mx" m@" m$"F0`T<d oo0(P 0 ! 0P]0)])0(P]0)])0(P0(P0(P0(P0(P0(P0(P0(P 0 0(P! 0P?4(H]?4,(H]x84Ho?4o?o?4hD94sHx84Hx84Hx84Hx84Hx84Hx84Hx84Hx84Ho?4o?x84HD94sHӍ05Y@]0TudpZ0T&upU0Tt<g ئ.`2@2&xئ,.T2;<;3@-k1H=&4T@1X3<-k1D=&4T@1X38-k1=&4T@1XkYb>Y 7DC+p^8Tr+X^7HC+t^8Tr+X^kYPb>Y\ պSq^PܽPX.YYL4"^8g| 0&4T@1Xpy>,k0k0k0<k@kLd1YY&4T@1X&4T@1X&4T@1X&4T@1X&4T@1X3`-k1=&4T@1X3<-k1=&4T@1Xt V J&4T@1X&4T@1X3D-k1=&4T@1X&4T@1X&4T@1X3`-k1=&4T@1XrG8&4T@1X&4T@1X&4T@1X_L! h.0h.$3@-k1D=&4T@1X38-k1<=&4T@1X&4T@1X10';404*H&uUzt<+e;404*XXchgchԦԦT1T1T1\1T1T1T1\1@OXPd3P-k1=&4T@1X&4T@1X3\-k1=&4T@1X&4T@1X3L-k1=&4T@1XƌX'-ƌX'-8 0e 8^4|0[ , &4T@1X0 Bn 7<C+h^8Tr+X^pTh.0h.Tޣh.T[|}qN[T}qN10'FdrFdrFdrFdrWWm|7F0rTs s $ dCls0O| 81[O[HD|aDaD|aDaX2W=W8Tr+X^7@C+l^8Tr+X^8Tr+X^8Tr+X^8Tr+X^ m0"g0[X}qdNs[0j<U dU 2WP=Wh0 8>R*|+lcC0El >0w hAR*|+|lq^y[|}qN[T}qN*@`D<aã3 m"Hhslz0h0ڝt T&x˷Lti|iD&i|&iD08`Hs0hi0t (GdD<aA m"BTU&xXV 3VlV\8C@ PQh XMHs("D 0$H{03(M X# (QX ("D 0$H{03(M X# (QX WX85(*|D)$O8a}TQ`XgH`bLVG*@7L*@*@5L5`|>$7Lã}PQ`\gPVq0h?Pbh XMHs("D 0$H{03(M X#(bX ("D 0$H{03(M X#(bX CU65(*|D)$O8aTQXe`b LV?G*@L*@*@T5TP5v>lrLPQ\e PVm0d&@Akhuktu&AP&DM&:(`:(:(`394-k6#5 XMHs,1(n1D AIA(}-@@io@`$,1(n1D RQ(}P@iP`",1(n1D tb1b(}a@iZa`$Dڝ iD {]0$]TLDrt)rl!rH1r0-rL1r0-rH1r0-Drt)rl!rD-rT-y8-|!X!^,^,Ot$(h0;4ob0ob0^T,^T,0;\v4AA0D(aT"rhtT"r\tT"r`tT;T;T;ڎT;nT;T"r\tT"r`tRT;T"r\tT"r`t@H@Hd 0Bd 0FQdq0Jdؾ0Nf dDK U*H@201 3tB (*P@7LC+p^8Tr+X^7TC+X^7TC+X^8Tr+X^*<@&xH>0Yq||~8|~l$&@<A9Z+e0zDasz0D a1016 8Tr+X^$$ P?  I_x@*@Y*@Y,*@Y*@Y*@Y*@<~P<~Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0Y0g%l^g%^*@ ,*@*`@1'/X"EX-YP/Y0Y0/X"EX@- 01 1/X"EX0-Np̈́\]`C*@`C*@N0̈́`],UM[U ,UDM[UH ,UM[U THGVR#<~Z  Z [P<[<^T9 m"ɼ|@v <ɼ@v <sf05iD[<Da[<Da&x *X@*@*(@$h_R#<~wP@0=xwP@0=xtoLohto4o<;404*Hrlq*@;404*Hrdqp0tHtLtxt|;404*H@wlq*@ttvLezwwvLezww@wTq@w`qyL zhYy` zhY;404*Hp|lq*@;404*Hp|dqz0L;h x; ;404*Hpq*@;404*Hhq0Tq`q`՛ ՛X՛Tii*|@h &x*@*|@h &x*@*|@h &x*@60^bw\dhv\d\D0xxͩH60^ʫ6|^ʫ6\^\T\1\@P[pK*@ *@8 *@ɸ *@ *@p *@p *@rp *@p *@l *@l *@rl *@l *@*4@;404*H;404*H|U4k4U8k m"*@4tlG<GzL[<zL[<DGGhGG&x*@x<L8|l8lɁD *@+g[&x*<@  $  $     (, (,$$@@@%(  $  $    $    $&    $  $  !  $  $""  $  (,  $(  $  $  $    $!````&$%J@% !% %@ %    $$    $% $L$  $# ('$    $  $  $  $  $  $( !1!##3   @`BJCPPB@ D@ B B0@0A0a @H @@  @ $,  $  $  $( $(,  $(  $(, 24 ! ! !  "" HL  $  $   $  $  $(  @@@DDDDDDDDD  $          $ -!!! s``bbbbb    $(,0   %%%%%%%%!    (0  $   ))))))))))))))))))))))))(       $  $  f  @@@/@`@` P        $  $  $  $  $  $  &!$'&A$$ $$$$  F C'   $  $ #))")) )B9B9F8F9@8( @@ $  $   5!!#!)  @@@@@@@@ $ $ (,    *  000  $(0  $ +//  $ 0$6450      A0&L1d   $  $  $  $  !  $     D ,)8   AB`PD  08( 0U0 "4  $,0 K@K@   K@ K@   $(, @@fff  @  @KPKDKAKHK`KbK  (  G`     @$(,0$(08     !!@aa KHHH@H b b  $  $  $  @@ IIIIIIII  L  $    ```$1@8p111 11 81 8111  $112 !C 1 81$1$111 11111111 1 1111111,, 1ܬ1111111,, 11DD11 1 11111$11  $1111111 1 1 111|@8H11  !#((11@8p1@8p111,, 1ܬ111hh`1 t111110,100,1111111 E11d010,l1  @ 11$11 |1 1$1$1$1$11 11111 @@a!@B  RJ1@8p111111 1 811 1111 81$1th`1 t1 1 1 !!#!#$1 111\1111$1$1$1$1@@P11 H111@8p1\11@8p1111  ,  ,  111 111PP111@8p111 11 $1$188111111@ 11LLد111 011p1111@8p111@8p11111111  $(,11 0`($ " !  $(,$$(1$$$(1 <11 @ @8p1111 1@8p1$11111 811D11X11X1X1t11t1T1t11p11111$11$1t1Ȱ1111111D1111 11t1t11D111t1<<< 1111P 11@8p1 111`1111 (1 1` ` ` 1@8p111 811Ȭ11  00AA1 1\1181 t11 1( Ь1<<<111,$811 1D111  $  $ 1111011xD@D1D@D1D11 1 111R0,ȯ11 11t11  $114lh11 !C T1D11 D@@1  $  $PLl1 111@11D1@1  $@ @*@@@@%```@tT` 81101D1011  $111D1 @ @ @ @ @@ 1111116-RV-R 811111D1  $1`1 $,Ȭ1Ȭ1 \111@8p1j *$Ȱ1D1  $11 811 \1X1X1\1 111 1 1D111 33330003 h1 1 11$1$1LD`11 @ 0h\ر1h\ر1 1 1 1 1 |11 1 1,\Xб1 1\Xб18\Xб1  ` 1111111 10,l11 81 11@8p1p\T11111$11L11@8p1$111111 sbbbbbsss``1D11 H1 ss``bbrr ss``bbrr1D1 h``p``p0`H@D11((ذ110011001188ܰ11<$11 $114з11$ (1TT<11$1xh`1 t1X1``\1  $(@8p11XT1 <81XT1<811( 111XT1<81111<811<8111 8111H11111 11HHIJ1 81 H11QP111 111@811 111111 11@  11D1T11111ܬ1@8p11@8p11HDX11ܬ1$1$1L$ H$ $ $ UUUU1D11$11 1 1 1 11 1 1$11 1@8p1 -%%%%%%    -   1 1xh`11p11p11 11111111 11 !@  11 1 1111 81 101 11D111 111 sssscccccc11  $ $ 11111 H111 111 1T1\ 1D11hH<(11$H<(1lH<(1 1 1D11ph`1 t1,,D1,,D1 # 1 1,,D1 ,,D11$ (1$ (1111$111((81"  1 1111PP1D11$1801$1801 11 11 11 5 11 ز11ز11  $(,11 1 11$1$11  200 C1 1 1@8p1 111 1  $  $  $11111111 111111 0,l1111 1 111 caC 4I"4I"4I"4I"4I"4I"LLMLX1@8p1hLD`1LD`1X1D1X1@8p1 11X1@8p1X1111D1 H1111111 II         $  $  $  $  $  (,  $(,0  $(  $//'//$'''''' (,0  $  $(B    L 0`D`D2"184 @@@@@ E   08       1  @    ---)))))))$  F^fFF @@     @   W  H2H"H"0%  !     @ @@b`   0000#@D &0 A-pB )     &  Z ZZ ZZ%    & U UU!0 )-R-R(R  $ '''''''' !!!! 240    $! )I$$$/$@0%H  @  $" @      !!1399'73 B',(,,((((((((((#1.`D`D&# *+ p@@ @P``@@ @  H@ @    @@   '  *!````  ! @B@D @@2r@ $,  $  $(,0$(08   $( !C     %% @@<< ,   UEEAAAA @   @  @(q(q(q(q(q(qAu@t    //////<Du)Du!Du?@(@ jjjjjbbb@@j "              @-RT-R:   ` OKKK     A!             ssc``bbrr:%  (, "DHBCC $(BBB !  !    # C @@  "H"H H H H"H"H H H               8  c! 0(     )))))  @|\@ @@   UUUUUUUUUU @@000P0D0B0H0A0 H@     @@@TPpP P UTT B@  @@" 08   !11"* `@$$  333033 "    @@@$&" U    ! !  D !B!CBB!C!C!BB!C& #" 3 !!I&SI&SI&SI&SI&S%W#'PUQU QU,PU^U$(!C!C"$!C"$5( 8`D`D5 * & "  IHHH@ dDfDfDdD`DhDhD`DaDaD  B` PPDT@P P2X VUUVUUTUUPUU (*<+<.< ``` H@+_2_2_2 * @@ @@`A@0@ @ 5(( DFFDD 0 ( J   @** cccccccCI  @@@@@)U@U @@@`@ @!@@ UUTUPU@UUE  ) @ !  "      #### @DDD@G    ssscs`ccccccccc  K@,*AAAAAAAAAA0HHHHY%% J@K@0@ K@K@K@K@K@K@K@K@K@K@K@   PJQ AAAAAA  @@@  (  P       (     &800 PPPPPEbX,Z    H 0   , ]    ?/@_@@@ 0<````   HJHH"0   -mmeeeddD@@DDD@@@@@  GGG G    $&  $(,0 08<>?????  ==== ==0@ A    ! @&' Q Q0  ----   TT * PRVVVPEPPX   1 00 ('&@$  `ph $eb @`d` b`*  @     II  ZH` mmmm   $$$   (,01   8  TPPPR$%@X@!C^@\@L( B  @@ $ "@&  @@ @    5((5((   ''    @ @ @ @@@@@@ bU@b@b@bQ`P``@ ;@  "***%!!a  @  & ( @*@*"# uuqqqqqqqqqqqqqq!"$$$$$$ 0000 AAaA@( Aap         @@ ` P  I@@  1P8Rx$<qVRh$Tq|VRw!%!p1!w!%!`1!w!%!P1!w!%!P1!x&x6&6&6+<}+N*U+<}+N*U,.914B18B5@$4-P;AlAX 1B|0IpIIlWW0WHSAHd*III8BI0I|IB|LAA L#IPR [R8XRPSx{? YZ<pYp[@0j@4"HPlLP0IL#I49@0F@8ZddrT%txhPWY\^d_DY\0҃aMm2MSAu|"aMmr҃|҃Lh#IdA ghYPSl|4dr "[@Xj@d"YXYd’t*%LfKKTPSA`} SA@ja`K[@tj@x""9@F@_0rSA|XYXYX`ʥSNtʥ\SNhtlSN<tvN{vN{PLtvN{XMBPb`1?SAl=0oF t7ʥ0SNHtA\AH 1Bhj=,&4X0dDDK?P HKLSxSAFrPb/j<LS,4WH*<pbmX}<p^Dbpoopoo@WcH՞FLrʦ00N0:08:gLY0LA0 Ax Sl0444g$Zx{0)3~_\"P+lsx!e |KFdrFrF0r YlSALx8WdA<x8X~}<x8` hVx!$:TM^lxhYTU!lxh}T]}lxh3<-k1=*4,4,4,3H-k1L=4,5=5h=5=+0^&4@1=X:>>>:|;0,H"@d:PiT"[iT.[i.Pi0"[i0.i4PiT"[iT.i _k_kk`kk|k4)lD mD"*D@)lD mD"*D@8nnmGnwXtHptpt4&u<UuTpupyw w\ wix|xx,}x F<PI};404*\-|Pltk4[w`Öl Ֆ=R|f0v6\CC<\CCLT|llѦE*x@*@AT˥Xܥ $˥|ܥ@˥ܥXx˥˥A˥A˥A0\˥P˥X];44*d8f8 *@T˥AT˥wTBzG:;:;:\;B0*B`*B*;404*H|t**P@px*7LC+x^4glt*Tlt*lt*3px*U8lt*lt*_lt*lt*99 G;1T848A.+4P}+PYc L0`6pso0{D*@ |%Dl-D*@5D<d .r*@PsOaP\CB\pCh-Tl-h-Tl-tW0^*@3p3 3 =  f l = | f L*@*@*@<0~<H~f |;nPB;nPBh "++h *@*h@h *@*(@xPx !N5@D"XYxXp5@D"XYxX\|x8pI>I>Iֵ`0;<2,P0RHM{]$]lLRHMR\Md^\lz*@*@*@q*@,HIQ`*|@xxIu*@2dfˈuLt* @;nBTPkX*\?cDcD^Fg[*@^Fg[*@0ZUim0 !*p@@DS0:_;;$;Il*I*I*hI|IIW;W;W$;wt*w*w(*lIII u/`h*.+4P}+TY*P03q@aqas"L5d*@Q.h*0@*@F4&ulUR)$lss$U# \t43i_TZ_|I_I_XZ_I_I*d@¦7<; n4B*p@}k%*@nnnn=n=nL=3D-k1H=ww#by Sl/)l2'D "h y)`ÃSÃS<ÃSewTadT\TBxVT Tewa}Y}TYby Sl/)lby Sl/)lHF˒L$DHF˒L$DHLDHLDL/P dDL/P dD¥L1P\D¥L1P\DTL--PdDTL--PdD7L-P\D7L-P\DɱL1P\DɱL1P\DaL1<P\DaL1<P\DL-PdDL-PdDL1P\DL1P\DH7L DH7L Dq^q^UC;HSL D;HSL DL;PPDL;PPDrH)LLDrH)LLDdL1@P\DdL1@P\DL1P\DL1P\DL1|P\DL1|P\DDL1PdDDL1PdDL1P\DL1P\DSDX-lP t@S-S-STh-N0p )Qz`4v0pD 0b0q0iHLTLp` g40pD 40pD \.\S\h0'hUE<'8UPEg0h )Z)Z*)E'Uy)xD'HUEDG;G<#D-.\}<#h-<#D-.\<#h-<#D-.\<#h-<#D-0\<#h-<#D-0\<<#h-<#D-0\J<#h-<#8-#\B<#D-<#|-w5#B+@\TXq`N<#d-3<&uU&uUuH#lB<#D-(l38-k1<=*b$Abl "l `x`c<'8U'U E@H)Z*)Sn\Sn<\Sn\_0s0soE'<Uy)+8Ul y)@0@uh(ń;ń;ń\;/4*/p*/**;*;*\;0*l**vDvhQuppvTjvdQulphuTauhp&uU@$(V<V<pV@V.==L=byX Sl/)l+,;4`4*xaPEgc@&xx*@*@*|@1L#gc0;W@8`W}H*h>@2SW      BxtVBxVBx|Vj@_0E8&E8&09.g|Z0kkDf08y`3 =&u0UuHp*@&u<Ut<u0p*h@*@uppuHu<py83y3y3, 0J;444*L, 0J;444*L, 0J;444*LÃSDa*@ewxa*<@*@*@*h@*@+0c+c+c<g|-Tmg &q*&,qCg, q^>8UkPL98H=5P60˥A38-k1|=?hF<C|d&G G8|1IUID*@G|1IlGDGl|1I Rh] m4"*4@3H-k1L=V$}3<-k1@=V(}]0 c +c +]0 S`TNb0 ;44*]0 ex:\S]0 I Cd]0 Z-Z-]0 `@I:\S]0 ll <˥Ax˥Ax˥ApP4nh*h@]< |q0-`Ix;404*X3<-k1=| 0˥AwP63-k1=38-k1|=d!u0pt,< =x4;484*\3\-k1=.hawX63-k1=uXpt<Q)x8)͝/,5o{11'<k<p i><+x0,i>+]'@=īī   ÃS(nޭxK30-k1t=~z0T&4X@1T&4X@1l&4p@1T&4X@1*Ow$@Ow\*L3-k1=3<-k1=*|1'@5!\uTt`*F*0c2D`JW Y<sl&x&xL m<"gg3@-k1=gc\ֵ`13L-k1=~Ã@S Y<`y g3@-k1= MHO(nP(0nTMO;;\;0*l**P|ttM >ov*D@ >ov*,@A B2O(B :CLev*$@Lev* @nP0P$/O(4Q/8h,Q$ +Zdw\wCGdCGD9b`%b/t`<+e0d0b`/t e\*@&e$*@*T@%ht* ep*L@%hH*xx0Qرhxx0QPtHxx0QPHthH@uH\Rh=Qh<1hAEt <w\|wl|_.#_.\,\1PR=PR=4t ѠP$Ѡ$Ѡ$'UHE@ ʨ<˩0'd(dFws:8 @H)Z*)XRd=XRd=E'<U T&PFws:kH`PtfMXx-V&xy)$V3'U$ElobbbhPobjPt0|+bvp w@|wxPwdwPwdwHswwgl|l|`0ww0(TwTG hx1:TG hx1:0jPt d>9`9:d+%,K.K.+%,K .hT4T0:*@*@7C+^',d^,t,d^ht0,B&hPtUP<(_|83@-k1D=*P@} R}RFPa0EjtJr`D_T~d^ttd,~@'-!D0s3D-k1H=G0˥A4,4ݼ$:U80'@X0aE[pp{ &4E[ppkT` dl @xU0SH+8S,`u,u,u& T&% - - - w0w0wb3 p1w0w0y0Zy0Zw(X8 /B8 78 ;< XFN< 2N< 2< 0F*|@:6 w0w0y0Zw0w4w4*P@*@shR ;R ;R \;GS 0*GS `*GS *Y DY Y l mIx ,PD D dD [ lD.. 0  ro ,A| 3̠   F ( <G-0P p5P 53V?3 L `P 5U PƧ  U HƧ  (U 0U U 38-k1|= hs;nB j,/ | m  ?{ 2l-Ll-. d "  \  < " Lo ( =7W.+ P}+$Y7W.+ P}+$Y7W.+ P}+$Y? d*@? C 0k D `t)A DA A 0&x[G 7N  n ,,L. | g  > 6 g  g  g  >g M~[}Sl q 2,q |ap@ > p6vj pQ> 6byH Sl/)l| \S}  * @1 03~ Lw x?5 Ow[ 8yZg ,GL h><$t<)3@-k1=*@38-k1<=p@ `LsI L=3T-k1X=y_~|[}S}dS~|[}S}TS~|[}S}TSbyD Sl/)lby0 Sl/)l*@*4@ yz}?`3p-k1=*@*T**@ ; ; \; 0* * X*% 0% (% * 0* ,* (D|ak D0a]t 0t <t @fr D.r 3r 3*@r 3r 3z 0dz 0z 0=}R| :{ y}R| :{ y}xRFPt.z 0J z      09 .g| !ښ &U c2` M H M{ wwwCjb  1d11'} (.w m{ (x }x }x @} 7 :b| $7 (:b| @r 0l 8VK r 0l 8V| 38-k1|= tgPPtr "3H-k1L= @3H-k1L= @s( 8( $' +8UX'DU+8UX'DU+8UX'DU+8UX'DUy)\) ( $+8UX'DUy)\) ( $+8UX'DU+8UX'DU+8UX'DU+8UX'DU+8UX'DU+8UX'DU+8UX'DU+8UX'DU+8UX'DU+8UX'DU+8UX'DU8'<U:. h'<U:. h '<U:. 0T':. , 6'U4E@/ 8O& 8' <@E'lU:. ,:. H'U201*H@ 3B2'dd0 "0 0E'dU:. $DaD aY$gVy>j 4Bj \:j 4>0H|-O(t p P*N N Jx x W , Jx x WQ Jx x W %.+XP ` `Lztr\ 0Xճ 0,0zX0 0V = gc<_ t<*L@*@U@6U6j\6j\6c0_0c8_^0_0^8_Px)D.; -o o ; -o Po F hr)mOK 0Co ds* p xd:! Y* p xd:! Y- " Bh" D p xd YE p xd YK  B  ( t{ : 8o o To q gq gq gq gq gq gq gq dgq gq gq 0gq g7p Thup Th7hC+^rh . H=g LH . @=g H T| A } Q | Lb R D . |rh ̼ @k @ dP 8b Rb Rrk k |k xsrk k k s7p 0< h\ 0z h h\ 0 h7p 0<i 0p  0F , i Tp! | A } |Q! 4| hA } Q 8 \i xp 0i 8pQ  0y Ty y7p 07p 07p 0 .dUrh 2'd " 2'd " 2'd\ "\ nn! 2<13-k1=2<1262k Tk k (s s$0m$D)n0v$ 0k ds)n0v)nvy\c{0N{P{T{N{{8}$ Pk s{4N{D{H{N{{ t k Ps$ dk ls4~ $k $s4~ k s| K| Kk 4s$ k sk s} } ƹ tƹ  k s } \ \k \s k s} k Ps$ dk lsk ,s} ,"} "k ls$ k sk Ds} D} ƹ t(ƹ @ (k (s }  k s k s} k ls$ k sk Ds} D"} "i h<i ti li | tA } Q` ` | tA } QpE'Ua0 Q!id!<t2012@62X201y) 3tB7p 0201y)( 3 BP   ' U,Ef *4/+U9!=y)p2'dd0 "0 9!=m`D`E'UmPD'Um@D'U9!=m`D`E'UmPD'Um@D'UmPDE'UmDDE'UmdD,E'dUmDD<E'UmPDE'U04}mTC04}mXC04}mXC04}mXC04}mXC04}mXC04}mTC04}mTC04}mTCA@}mDClpA@}mDClp{TN{t{x43g 2Wd=WLw@mOm<O*@3@-k1= =ͽ0pi i< lz ` `D88887HC+t^*|@38-k1|=&q$WTd`d`<u*@9i?q^2W=WPHtDd`~8'-`~8'-0~\' -D~x'-2W=W*@2W=W*@0˥N0( mT" mx" m" mx" m" mD" m" m" m" m0" mx" m" m0" mx" m" m0" mx" m" m" m" m," m0" mx" m" mT" mx" m" mT" mx" m" 0])](]0)])]) 0  4 0  4 0  4o?4o?o?o?4o?o?o?4o?o?F0`d_lF0`d_lF0`d_lF0`p_|F0`_F0`d_lF0`d_lF0`_8bDQ:T<:L;4 4*$0˥A/XD"EX-BպTSP`tdY2Y :0+x4^.Y/X"EX-g` }k%g| 0-0k4k0kX˥AZXcL1hpkhktPHtHYt <3-k1=D3@-k1D=Km; Y@3@-k1D=K3@-k1D=K b+eT1'+e1@'Hp3`-k1= 3P-k1=x0o{رPTf3D-k1="<{0˥AO*p@@F#0;1';404*X9%t00h.<'F4rXsh s s` uC10CCL˥Ag 0M7@C+l^7C+^p7C+^p7C+^ps[4]6q^02W=W 0> \A<\#R*l|+l >cCl0ElH>  A<# @Nd *@4;dnBHXsipiT&i&i@&i%.a X:04 }7 04T44;dnBHp *@v&`A&xL 8<W/0H{3w @,3@w @,3@i 5, @[}TQ`Xg.ãh0[}\Q``gH0b\V0q-0H{3w @,3@w @,3@ d0fi 5, @Q[TQXe.dQ0[\Q`e0b \V0m ` K&8$XI&dAku$TI&lAku4&94-5C5p94-521,1n1 3 D3,94@-B=-@`io@$21,1n1 3 D3,94@-"S=P`iP"21,1n1 3 D3,94@-c=a`iZa$Lx+L+Kl x11co4 x;404*H4;dnBsP=r01r4-sL=r01r4-ysx9Dr@)rp!4;dnB}0&*@*@}0&*@*,@}0&*@*8@}X&*@* @}P&*<@*@}|&*d@*@'x ;404*HT^t,^t,;8nB`4T;A0NAxړ0ƕ}ړlH;xnB*h@y7~;n BP@-}=*(@ \HZ ;;\;4*p**~-*@%%\ 1by Sl/)lY0/X"EX`-Y4Y4 [4Y4Y4Y4 01 1 X1Q  Q\ Q@ ^&x*t@&x*\@ a =   b =  pL6;nBCuL6;nBszL6;nBP6;nBp0p00pX0qkp6*@Jr0wJr|wJrwu(0uH0up0 wkCu6*@zw0wzwwzwwnBzw`wzwwz0z00zX09|ksz6*@|0w||w|w000X0ik6*@ځ0wځ|wځwW&xx*@*4@*@*@՛xii՛0i i*4@*@*@ܢ0*@h 4*4@*@*@ܢ0*@h 4ܢ0*@h 4ͩH60^*@\d\#1*P@MD0xx0Gʫ6^4G9tilM4G9tilM+e/ UTnӞT0c\GP;1 mh"*h@< m\"*\@*@[D< m"*@[D< m"*@X,&x* @0MD8x|0MD8x|[@<[ K[@<[ Kx8LL[<[(<[D<[<[P<[l<$(08<2B  - $ $ $4 B 22 2.`@*@BH`DP @ I!  &"")1 00b08b0I&BI&I&I&SI&*ZZ%            IIIIIIIIIIIII@@@AAA@$@    !  (@@08 0 @(80(0 B@ 8 ``P$4 @B@%   /eAiqc5@@xxBU@UU%@7T3  $0a aaaaa A@@QQ@@@@@@@P@@@@@@@%%%%%%%%  @@(o@1 H1@@P1HDh181 t1111 d111 1 11111ص111 $   1 1 1 1ܬ11,, 111 1 1 1 1 1 1111 |1 |1 |1111 10(41 1 1Ȭ1 1l,, 11ܬ1111111p1خ1$1T111 |11 1$1$1$1$1$1$111@8p1 1 1111 811 1 1 811p1111$1$1($1111111 1111 11111 11 1P1 t1@8p1P 1p 1@8p111111@8p1111 |111 81 811 1 811 811001 <111$11$$(11111 1 111@8p1111111pPLl1 1 11D11$1$1$1 81 81 8111 H1D11 111111111`1111111 H1((ذ11111 yxAx @`   <><!<> 1@8p1 1@8p11D1$11@8p1 xP`x$x,x111$1Ȭ11Ȭ111111|L1 t1 1l<<<111,D111<4(11401 1 1$411 11((810,ȯ11111<$1x11 811 811111111 t1D1x(11D111D1 8111x88P11D@\1 1PPh111D111D11$11111111 111 111 1t 1 1@8p1  """"    H 1 1 1l  11h\ر11d`̱11\Xб1\810,l1111D111D1111 H11 1 1111 111111@8p181D11D1 H1111D111 11 H111 H1111 H11 111D11111 A*IA*AA*AA*AA*AA*AA*AA*AA*AA*A1X11 1 111D1111 111 111001 118481@8p11101D1Lз1 1XT1<81xd@14pl1XT1l 1`\11p`F`Bh@dd&`"h bb` ha`h``@@@XPH1XT1<811111111<811111<81,XT1@8p1@@p1PXT1<811111XT1@@p1l<81XT1<811t1H1 <@1H11($`111$111|\1@8p1 1 1\1@8p1 11101 t1111@8p111@8p11111@811 1 1 1|1\\11x1 H1@8p1 BBB0$10,1 1 110,l1(10XT$1xt1 1 1X1$11111( 111и1 1DDس11,, 11 1 1 1 1 1 1 1 @H11 101 1 11111$11 11 1 P@ 1 111 11 DDD]]E1111@8p111111D11`1h11 1 1 111 1 1 11 11з1 11 1D1 1 1ܬ1ܬ10,110,1 1$ط1,,D1,,D1$1$11((8111t((81$11((ذ1001 H1 11D1 81 81((t111((t1,D 11X,X1$1$1$111t11 t1@8p18111 BB BB1111 1 1111111111111111111HDT1 t11111\111 8Q9;;8XX1tX1@8p111 1XX1X1@8p1 11 11D11  ( FFFFFFFFFIHHHH@@@@ (@H(  $B@ @ B !I&SI&SI&SI&SI&SI&S@ "H@!C FU( 4U( U( U( $0   @   G `H PPTP  PP ( *UUUUUUUUU #@`px|~ 8($##Q     ,D %   @@@@`pP 5XXXXXXXXXXXPPPPPPPPXXX ssssssb`ccccccccc?B *2  @     @, 6 2 7 6` >` T ** 0 ccccccccc;I&I&I&<BH1d  ))))))))))))))) (   ()),b36 .  ( (( @`xQUUUQSR/  N"N"N2N2NHIR)@ @ @ @@+-RT-R-R-R-R. 08<>?   @" @@EU@@@=]\00 C      ((5W69V6@@ @6cL&cL&L&L&8bccb3!C$$744D% % % 1  2  $ B@ @ B %B<B> & (,<,-(KUU %S)II " @ $ @@H@`PD@BB @m``p````@ ` 0 0844tD 082044455%%%@DD@WWVvv^T@!      @@@ AA  $ (*@++(+ )( Goknm       ---)                 @ @ @ @ @ @@@@@@@ (hjz*X*@+   @@ @@@@@@      @      $ $ $      @ZZ@Z @ @bgPPE***JI )HHHHAFFFF -------%%% $$$ * *Y<9<< ) T@ -00B400 )"""E"""""""" , &@(f&>d>?>K@K@K@K@K@K@K@K@K@K@K@K@K@K@K@K@F%  /@`hl|~ ) Nn~ {{j```k`cccccccc```ccccc   @@@ . 0   ( +@`  $U!@BB! $  (  !DD@ "   **@j &@PH`!Cd`@@!CSBATBATBAT "PPPTSp !@@"""""""""7***|{y$y@HxZxHzz``````Y`x`<DuDuDuDuDu=LL&L&L&L&L&: B1@ D?  +(((((( A* A* 6%$I$%$I$%$I$%$I$@P 57A scccccccccccccccccccc3@@@G@$$,(PPT&pAx(j(R0w!%!t1!1!&0Y&DY&(6&6!* $t$C*T,.l91t1 BL.$s:s:p:s:`==&=&=&9@8F@<[@pj@t"$SA_A3@D[@Xj@\"0A l"F "F7FK7FKH844444L@A`AT RLo2M0aMmMMR8V? 7R QRRXLSRYS@`@LkS< S? T:LS,LS0RPXSl LSSN{ U 5 LS$4TzWDXk@`k.Pt3043Xk@xk.Pt? 04Y0Y0Z0p9@0F@4[@|j@"Y0Y4SNXtvN{SN<tvN{XIPd1nfdh,0d1n04e0eq-;SXlSlSlSl9@0F@8[@Tj@X"9@0F@8[@\j@`"YL|44vhY\W;BWG9@PF@T[@j@"   \ 9@0F@4[@hj@l"9@0F@4[@j@"[@pj@t"9@F@4z4z4`z4z9@|F@[@j@"|p4drdr "9@XF@dYtYLja|K[@j@"9@0F@4[@j@"30439@F@[@j@"BPbXW7"{H L"*xzb {, 0"*\z9@0F@4[@tj@x"gdYX[@lj@p"i B@i0'it04UhD-;-;9@0F@4[@j@"0  4;d  L14?SAX1?SAܔ+DG$DSA?bXbbbLNh{N{SAPLTN{N{SAl9@0F@8[@Xj@\"A| 9@F@9@0F@4[@j@"9@0F@@[@tj@x"9@0F@@[@j@"+0l?0USlx{iP|t Xg Y$x&$$t9@8F@X[@tj@x"9@XF@\[@j@" W t |9@8F@P[@j@"9@@F@D[@xj@|"9@@F@D[@tj@x"4)HAxTHELSLSDLSPLS9@8F@<[@xj@|"SN<tgTYLvN{`Y00|^8Y0^tY$0$|?Y< LNp{N{? tmX|}$,px|A0 s2qlp|t|DXAxdLLLxLxLTEAlxh~Te}lxhg60:g6x:'7C5=30-k14=+^+^|;0,H;=X=p%|;<,TB\B=[i.Pi"iX8i, Slp/)lSl`/)lnOnw8nnmGq BqXqXqTqdrrqqXqLBxVewPaew`a@yixSy8xy8>ix|yEx30-k1@=&4`@1d;404*Xx:h}201R\= 3B3<-k1@=3 s3s(i|~$i|Տ+~#|:kD vɘ@ؘ4n<~=x|U8=|k=x|U8=|kzdg,XA˥h˥AA˥h˥AA˥˥A(A(˥h˥hAhAh0zy0E{hdS0m*d@˥A(E:Ep:2 2TK@sTdܥ˥$cTZܥ˥UTTܥ˥իT˥AT˥AT˥Alt*TH$lt*hH &lt*hHr1lt*`Hylt*`Hqt|*B  t|*H|Xpx*4L[x\=R`)=R}3*44L[\(.86LNxhZTZB\@C =  f f D Pp d= H =  0 ++*|@|<h_0 ox_0 ox "| w,kaLLxLxL281262 " 5&H)'5&N!*[ *`*[ *0"8t|xPxtxttE'UD"XY00@{.D00{. $DPXAxd%L2T$<[R " 000{.D00{.N/T'hUj$Hj$HwKdkKkKkK0kMsq8KkK0kMsq8Kk2'd " L4oQPQ*@QMsqP;Rx;RQ*$@jTjTjTjTD{VLcV``{VcV`xXD:YN)YCxX:30-k14=&4@130-k14=&4@130-k14=&4@130-k14=&4@1^\H:k\T\P\X{]$]0L][]8P^_]4[]T8^_0P^_][]8_0P^_][]8]0L`b`  q(;_$P^x_][]8aPaaa]T8^0][]8]h8^`0][]8]p8^0]8]$8]\8^0]h[]8]08htb^0]L_]L_,eDF]L8eDF]x8]h8^80]t[]8]H8^0e8F]X8{]$]TLD4a`5a"aD5a4"a88888(88888(?PQ``^(4Ҏ|$Ҏ_ o<xX`șTN)X&*@*H@<*`t`X^#;$nBdT0;n$BTC;n$BN{]t$]|L*@@@` `n8AH$?H$?u8~p' -0,H=p%<,T@B=z00z+ 4u L:i0 L0 ] 4&i T+ uP ^9x^9550D*)l0L&*d=Axx& T Yr\VT3.)3-k1=&4@13-k1=&4,@10h.<3-k1$=h.hOG P)G]XlptX:{HU{klkX kl opoo`>z : :D `g(+a\g-xpN;404*HX>=(>=>=>=> 4p  = l 0=x<~ = l 0=x<~ Lb4 b *@*@*L@*@*T@*@*@;4<4*T7|C+^k\o\>?cDuo{0iq^ ?5^\4\&xh&x94m)l&*@*4@94m)l&*@*4@ll\lxK<=94m)x&*@*@@94m)x&*@*@@94m)x&*@*@@D55?u`dhlml  HsHsHsHs<0UoD6\g\<0UoD6\g\A^<xX`A^<xX`*@#<*@*,@*u$`\lX38-k1<=&4@1H*0Hu/``H*0V*<@tT<U0v$Z&u<U3@-k1=JJ,"0*L,$s"85P$94m)h&*@*0@98m)&*@*P@94m)h&*@*0@94m)h&*@*0@94m)h&*@*0@90m)h&*@*0@90m)h&*@*0@9m)&*@*@9Lm)|&*@*D@5KT5KP94m)l&*@*4@94m)h&*@*0@àdS)\&*@*d@9@m)t&*@*<@94m)l&*@*4@94m)l&*@*4@à`S)X&*@*`@94m)h&*@*0@94m)l&*@*4@94m)h&*@*0@àdS)\&*@*d@94m)x&*@*@@àdS)\&*@*d@àdS)\&*@*d@àdS)\&*@*d@94m)h&*@*0@94m)h&*@*0@94m)h&*@*0@94m)h&*@*0@94m)h&*@*0@94m)x&*@*@@94m)l&*@*4@94m)h&*@*0@94m)h&*@*0@94m)h&*@*0@à4S)8&*@*0@94m)h&*@*0@à4S)8&*@*0@94m)h&*@*0@à4S)8&*@*0@94m)l&*@*4@94m)x&*@*@@94m)h&*@*0@94m)h&*@*0@94m)h&*@*0@94m)x&*@*@@$\"*94m)h&*@*0@94m)h&*@*0@94m)l&*@*4@àdS)\&*@*d@àdS)\&*@*d@94m)h&*@*0@94m)h&*@*0@94m)h&*@*0@F4hZZ,u[8`\Da\*@k_h_Z_I_Ik_$h_Z_I_I*8*@*h@*@94m)x&*@*@@94m)h&*@*0@94m)l&*@*4@94m)h&*@*0@30d0˥\Da*@*@nnnnHPxtp>4 by Sl(/)l<0Jby Sl/)lJby Sl/)lliby Sl/)lPlt0ˢ 0p4 DpH pP_  pPt_x  +C] c+ lgd]g( |t]E3E3p'tU  V0._X ox$#B<#-#4B<#-7<C+D^#B<#-)0'dG**:l@'+t\TqP0tDPLt +8\TLq+8\Tq+8\TTq+8\Tqd>> +0\THq+\T,qi+\Tqi#PB<#8-#|B<#d-hUh`U=USH+S`0`Lca _ opxE'<U 'tHBr`O^sW?s04PŜ\Ŝ`ܡc< x~(lltltl1U830=ϬϬxϬXϬ`0w ̮@IDW#_wH/C_0 oHx`hyyP8cYt(rb-0V&x8.&x-0V&x8.&xzL^l;W  }\$ < =up_'m],@t_~f |b |Y H   X&u@Uu`p*@-#h#$/#X#X$$ %P*@iq^Pt30^1'3JD$a F\'FF*P@G8|1Ip1IJpChd&G K4 sxQt- V&xewxa3<-k1@=&4@13<-k1@=&4@13<-k1@=&4@1]0 ]n:\dS:\S]0 H$ Cd^H<< ]0 R :\S:\HS]8 !VX.ha!V@X<˥AoI3L-k1P=&4@13<-k1=%J F3-k1=&4 @130-k1@=&44@183L-k1=H$ Cd3L-k1=H$ CdR {(xT(Z-3-k1=Z-ÉlJ'30-k1@=&4H@1L-#Dj$$$)qP^q`^2i>+4i>+HDXcOw}xRFPPt-˥d7LC+x^g  30-k1@=&4t@1x,:2 :10'P<gc&qIDII8Z0Z0*$e*$ e=5dPh6;444*\q|^Jl230-k1<=&4@1-#h#/##38-k1|=h.x23-k1=&4@13d-k1t=&4@130-k1@=&4@1&@q`< l30-k1@=&4p@1t1>l2SW30-k1<=&4@130-k1<=&4@13p-k1|=&4@130-k1<=&4@130-k1x=&4@180ZZ<Lk*ia0t*4j*8u.+a09+4u+8D70C+`^8r+^p=`}=4s=s=xs=0s >ov*@V@0 >Pov*@B 8,C,C;@CG CGp9QL`L4LL0L0Lev*@N0Lev*L@Q/Q ::;@CG CGp9L'HU'UP  'U:4:::_ __ t8<l]kklt t<xxQPk|kt<ς\Pi0lp_ ohx˩$H'(\ 'U`ʨ4|'UX 'U0 _ ox_ ox'UE  Nk`P$t _ ox'UE +8UH'LUt X0<lpld|llt(|HlH||d|iXR'U^FDws:xر@'<U|X{|1jPt3@DoPo(4o`5:wwq8|l<wv|X/<p0˥A0˥A0˥A30-k14=&4@130-k14=&4@1kl]Pp(?kZ_8 _To'd^htl,HL(xT~t'-pq3̪)P'0Xɸɸ4٤x\|~Xx{\t&&by0 Sl/)lx.,Tu,tu,u,u& 0& &% ` x. . / / 0 X. XS:0 $- - - - w0w0ww- - N< 2*@- - - - ww,w,w,Y DY Y Y TY DY Y Y DY DY Y Y DY DY Y HY Y DY Y HY Y DY Y HY Y DY Y HY Y DY Y tY Y DY Y HY Y DY Y HY  06+8r| Ԁ 03p҃ @҃ P@L3tL)3H L~% mK Ƨ 70C+\^8r+^ 6+r@ s3@-k1= s] <x3<-k1= E I3@-k1=3*D@30-k1<=&4@1`dhl# U l   HsHsHsHs j < Ae$Yy Ht H+> pHZ % }y0_. 0rPtrt43t4){<*l@= \p *l@ < 2W8=W`2W=W9A #= lB= uY> `M 3t)>$I =[ D8yZ\ g  g  g  >g MI =I =I =I =N 0:n Ln CN 4:Z P<[ 8\ yZs D@3t hs @3t 38-k1<=dy 3@x 3-k1=&4D@1H30-k14=&4`@1d30-k1@=&4<@1@30-k14=&4@1(g GÆ @?si ,i `g $G 06[ 8yZg G 6[ 8yZ֐ t s&q*30-k1@=&4`@1d3<-k1= u3 h`30-k14=&4@1  0p@  <K XK K K $30-k14=&4@13h-k1l=&4@1c &x< 0N &U H l&U 8o \ :6 I =6 trI |=30-k1<=&4@130-k1<=&4@130-k1<=&4@130-k1<=&4@130-k1<=&4@130-k1<=&4@130-k1<=&4@1   |  \ 2W=W3<-k1H=&4@130-k1@=&4@130-k1@=&4@130-k1@=&4@138-k1\=&4@1 $[ <[ 0[ h ?i hi Hp 2 s Dfr t.r t3fr .fr 0.r 3r l3uu @tr D3r h3fr 8.K(u W(u TWix 81L,tt<=r )y X<y <y <y < u (u Wx30-k1@=&40@14i>pig0 |Ptg 0PDt,Y8/X"EX-0˥ALksktcLYxbtr]f~('-T#X``0(T  0T"D2SWs",2Wl=W\ m" m"3#2!2!2!(8(<x8x8(?8(]?x,(]l< m " m "P tp P t` !3 <;nBX˥(X mH" m|" m"VG mD" mx" m"VG m" m" m" m," mX" m|" m"Wn0(P  h0(P  h! 0P(0(P  h0(P  h0(P  h 0 4(80(P  h0(P  h0(P  h! 0P  tx84Ho?8o?x84Ho?8o?D94sHx8xx84Ho?8o?x84Ho?8o?x84Ho?8o?o?4o?x8<x84Ho?8o?x84H?(]x84Hx8`x84Ho?8o?x84Ho?8o?D94sHo?Po?e(](]CGT>2SHW0˥A0><0>/X"EXt-kYb>Y ld.h0xXY2Yg H3-k1=kYb>Y /X"EX4-3D-k1H=&4@1YkYb>Y YYY30-k1@=&4@13P-k1T=&4P@1T34-k18=&4@130-k14=&4@13-k1=&4P@1T3-k1=&4 @11\'3J_ !˥,A,ul>UTܥ`d˥ o{| po{tX po{tX po{tX3-k1=0[ | 0[  70C+`^8r+8^)2W=W,o8 UP5+tB2W=W I Z+tB,o U(5IZ70C+\^8r+^70C+\^8r+^ m0"g0Cjb &u0UvDvXQu`p70C+`^8r+^310I.L2Z2[3P310I.L2Z2[3PKL0INL2O[QPD1H3h m"(T418&xHTb;n$B@:Dx *@˷l˷{i|iiiGT5`d44yT^;n$B p3lFpws:tFHws:L`0[}\Q``gH&xXHI b<h `Q0[\Q`eBHU&xXH[2P1`K2\1KX*4C*@* @}4 K4,&94@-5@C@@s@l-@io@$}4 K4,&94@-5@CAQ@sQlPiP"}4 K4,&94@-5@Ca@salaiZa$11n0 o 9sp5rX!5a"a('| ;404*Hw|yOt$(h(DaTRAN AT_ړƕ}ړ88888(^,8IH>3tNQ3ggA]|-I~Lm}|&*@*D@RK!TRK!PI~4m}l&*@*4@I~4m}h&*@*0@}dS}\&*@*d@I~4m}h&*@*0@I~4m}h&*@*0@I~4m}h&*@*0@I~4m}h&*@*0@I~4m}h&*@*0@I~4m}h&*@*0@I~4m}h&*@*0@}dS}\&*@*d@I~4m}x&*@*@@I~4m}h&*@*0@}dS}\&*@*d@}dS}\&*@*d@I~4m}h&*@*0@I~4m}h&*@*0@}dS}\&*@*d@I~4m}x&*@*@@I~4m}l&*@*4@I~4m}h&*@*0@I~4m}h&*@*0@}4S}8&*@*0@I~4m}h&*@*0@}4S}8&*@*0@I~4m}h&*@*0@}4S}8&*@*0@I~4m}h&*@*0@I~4m}x&*@*@@I~4m}h&*@*0@I~4m}x&*@*@@I~4m}l&*@*4@I~4m}h&*@*0@I~4m}h&*@*0@O/Da*@*@0*@hI~4m}l&*@*4@78C+d^1'] *@*l@*X@Y,Y,*4@*@YXYX*@*@d>0d> Z X4> [ Z<Y@/X@"EX-Y<Y@/X@"EX-Y<Y@/X@"EX-Y<YD/XD"EX-YY4Y4/X4"EX-Y4Y4TY4Y4 =   =  WHxXHD&xH*|@[K[0K&xT*@[0< =  _[0< =  _wP`0=8xwPh0=<x$h0_@UhlGUhG$h_;nB$h_x$h_P,<bJR,@gR0#<~RH#<~wPh0=txwP0= xɼ@oLo*@p06pp6;n$Br8GrGrGrGCu06Cup6;n$Bw8GwGwGwGsz06szp6;n$B46t6;n(Bqkqkpd6p06qkqkpd6p6 wk wkCu`6Cu,6 wk wkCu`6Cu6/uT0ut0u09|k9|kszd6sz069|k9|kszd6sz6ikikd606ikikd66F0Fp;n$B<HMD0x|eTPlpb*@v4R8Gʫp6|^[K[K[$K[KG<G9<iDMG<G9<iDMG<G9<iDMG<G9<iDMӞPӞHӞ< m"*@ m"*@ m"*@ m"*@ewa[<*P@&x[K[K[K[K[K[K8l8l8l8l^F4&x*@[xK[0K[K[K[xK[0K[K[Kccccccccc@""777771117@ 0 8 < !19-R         00 @@@@  ;   11 811 . 0 ) ) !1 . 0    !1 &  1111 1111d 1p1TTܭ1 1111 81A>>>H>><@ >P>6>D>.?: 1 11 1 1 11 1@(  @@@ @``` @@@@@ @,, 1 1 1111111111Y $1401p 11(@@111`1$1$1$1$1$1$1$1$1Ȯ11111111hdL18 t1Xԭ1 t11111I@@@`1p 1 1@8p1HH11 H11111 1"""""""""1111$1111tHDh11 8114t1L 1X1`111 8111111111 |11111$4uPePeeEGGCCCBMM1111h1xLLد11 H1 !@B ` 1lh`1 t111 111 11 811x$1X1 1$1X111 1Ȭ11111111p1 t181 t11@8p111T1$ 0111T4011111$ 0111P4011111P111 "PTT "<&L<&L<&L$1hh14 t1@8p11011111 8111111D1 t111 81D1@8p11tD1((ذ18411h1D1 H1841d4(ذ1111x0,ȯ1111@1l |1 |1@8p11111tt10,ȯ1,14@8p1 1 1 1 1111111111111 08@(1018p1 t1L H1l H1 H1 H1X ܱ1xHDT1 t11 1 1D1 1 1(\T1@8p11111111 11111001 H1ط1l1|ط1$1$11$1$1$11$1 1 11t1((̰11 11<81`<81XT1<81d1$1XT1<8111 1  1 +1111X<811XT1<81d@1x1|t1 $1x1$1XT1<811((̰111T,(`11<81,(`11h<81XT1<81p1t1H1111@8p11!F@0000000000 0x1@8p1 1 1 111H11111$1 111 $$dd$$11 1 81h$$1011 81   @  111 1 &  1111      P  1 1 11 1 1 111111l1 1,$811p1x@8p1 110hh1 t1@8p11 1LD`111 $)- -   MM111111D1111T11$111111111111@ @  !  @  |1 |1 811  ]@q@@h 1t 1 1 1$1$1$11$خ1111 خ11114(ı111 11111!!!!!!!!!!!!!!!|1PHD1 11 )))                    6-RV0-R-R-R-R-R 5@ 1 1@ 08<>? 3  !AA@ 40A00 08!042100 00 0000IIIIIIIIIIII CC3s@ C 0Y Q q a! @(!  :   }% (@A{ '     I %//  '@`t`a` `K`@`@` '@`@ )!!T!T` 0 LNML^nQ  -    nllll|l`@`@BBLbLRBLr@LrBLRLR@LrPLQLALDL@LHLRFVPPf``@NIIX4 I&I&I&I&I&I&I&I&I&I&I&I&I&I&I&I&"     @ @ %@@`P @ 1AAA(B** ( #p(0(P" 0  7 @ I P$ `& 3UUUUPP!@ O @(      @̆LJ$  0 0 p S  k'@  @&n /    D D"DD@@D@@ @ @ @&$@@$  R R R R R  R R R R DZB$IZB$IZB$IA  :000 .-RT-R-R-R-R-R-R-R-RB ,@ $<qVRlVR*U*]*Y*x]*Y+0}+N*U.88)Dn-)0M)x;1;1;1;1<IASAAA 1B G0G0 G'G G_G;mGG,_G;_G;9@0F@49Ip[@j@"2MpEMaMTmEMPR[R LR<VRXRxS LSLSSS49@8F@<t[@j@"NtQOx(WfV$M? 9@@F@D[@j@"49@DF@H[@xj@|"<433P4eleye qU,D9@0F@4ht[@j@"ghZx{{jSl444`0xI`h`jaK[@j@"Rrrdr drP%tlXP@ @ kSdxp{?d 9@XF@\Mh[@j@"9@0F@4ht[@j@"18?SAHSA`Dd-D-dT  Xct9 pFrmX}jaK[@j@"OPtPvN{OHP8P|vN{OHP8P|vN{HFrtYxtM@h9@F@[@j@"OlP\PvN{OHP8PvN{S0 AX _lq704T444UD9@0F@4;5[@j@"ڼ4\xD{3LPjD@HkSxx{K9@0F@pK[@j@"9@\F@K[@j@"[@Dj@H"9@xF@KF@<4b[@j@"9@0F@T[@hj@"1B<LPdP9@8F@<*Tz[@pj@t"f9@F@[@,j@0"0P#tYFprmX<}\XXmX8}mXl}g@Yxg4YP"Y,x{Frth:A ,$$`x{3P8K@!e DK`!e daM@mTxl{ |h/|/t D@xt@DtDY0F@`Y[@j@"(<Ml|M|  Ax,j,R4}<x8R~4061HL}+Y&4@1>:>:>$:>P:EP=>x:>:>:>:E=[i.Pi"i`8i4 i o`oNo"o4 "o\ "|Ux|]P|Mx|L]*|HXq`Fws:Fws:zg,,AhSm0zy0hE{dX L˥P˥PAPAP@hh@˥A*t|*4L`g[X\t|*4L`g[X\t|*4L`g[`\x*4L` g[\x*4L`g[\x*4L`g[\ *H`gX,D\S.+P}+Y,0,HL?8CEa`.d: da0n4<8,aTC|llC7`2PT@wP 'U'|U| !=! =!$! " N5@"T'U"xp5@"T'U"x $ PAx,j,R4w,kx(|xd0"8"Hkoxdko"00"d %#|L "| "00"d|x|x'8U`*`[ *D"YxPg'%6g'%68'<UkoTTP '@U'UP D"YD"\Y\X'lUT$<[1dLR "d T 'U F@%wJ`gwpJgJgL<o KkL$oKk30-k14=EX&4@1 _l]8{VcVH`^0`Tb][]8g` q\;e(F]8]8]8^d 0h i, i,i^ 0eF]8][]8%f^0^0^0^0h.pp4p 4p$4p(pp4p 4p$4p(pp4p 4p$4p(pp4p 4p$4p(^D,^^$^^{]0$]<L`5a4"a7WP_  .<lPHt@PtҎ$ @|mh !΂  *T@mh 3!΂  *T@mh c!΂  *T@mh !΂  *T@*t@**@OD*@*@ m"^<x8xx|::: : =H:l:::=`z j  XzP R C+ u + hu xoj j 0*4@*@*8@*@ 0zK 0 u TBzz+ u3-k1=&4l@1p&q3-k1=:&4@1@ q˥A.] 3P-k1T= lkk( x   T T]td]`dsXMv0e{< tHyp;404*Hy`hyvHIlII3-k1= o o o  oj<7     ;lO0#t4k~@7h*@*@*@\*t@*@*@*@T*@ˈ|*@L!*@*@*@0@Zti$Z,Is*@#*@]P9,m)X&*@* @4tˈt*@8t*l@ˈDu/`*@*@201 U 3pB ,U3[P3qLaq(a*pl|x D a*@\&x@*@**  *LsHàS)&*P@*@ș4N)8&*@*(@sà4S)8&*@*8@sșLN)T&*@<K=șLN)T&*@<K=șLN)T&*@<K=à@S)D&*@*D@sșLN)T&*@<K=ș4N)8&*@*(@sșLN)T&*@<K=șLN)T&*@<K=ș4N)8&*@*,@șLN)T&*@<K=$TNC;NPșLN)T&*@<K=à@S)D&*@*D@s333@&uUR),Y B'<rt\Gp*@wl%w)w0;44*ww#3-k1=w%wl%ÃLS  7 W 7W .2' " ho{`@>2SW'bP}u8H@(= - = -0XtS%xc\_ oxH0g<h@'<U@ 10'4U0  8&H+\Tq#B<#4-r$<~`<~#B<#-+L\TdqhIN(N<#8- :Ϝ->TuxpMD |M8 @M #B<#h-ݡq8&DPtPxt;Pt\ii!0=h!X=h(ht0BiLTiHT'Ut0BiLTihT 'UE'HU4 i\E'DUy)0 i\=v&@%BxXVBx VBx<VҦ0Ҧ.U'B\83=p_ m"yt{D1{1 m"<HT\z/lYQ1P{/YQ1\{P'8U m"y)0<'8U<'lU ÃS (0l(dl( l;444*L2t12121PLxP+e\\6s>2S8W=JSWh>@2SWDa\Z`Z(p;404*H&uU&uUflgpgg0gj$0$4$P,tg4 @o{3-k1=<>\&4@13\-k1x=<>,&4@1GDG|xLt1ITVLG0G|VLdG1I<3P-k1=uDpt8<)3P-k1=a !a(w863-k1=&4@1uXp4 m"t<Q\)Q :QT_h#(/#<#<al!a!aQ<+cL +Q+I"+Q+P8ZZ]0']0']`']L'}p>`Pd_h p 1@1*@Xc8kh*@101118Z Z 74C+d^SX8Xr+^ _st0Cjlb 30-k1<=*&4@17HC+t^g X,4*@þ]'*h@*@a;444*\ Z>a͝`/͝`/x)x)3<-k1=,F*::4?fa!5 `@wxwdXcj$<$H$`(``d1?Ljh ÃSL\3-k1X=&4@1=hJS W>2S0WI*T^k*ia`+dj*hu+Tk.+a`o.du+hDB C:D:d:_ ox _4 o@xDL +;0:T+;0:40'\H :T4:t<o{H8g X7HC+l^8Xr+L^eT T&8T&0uYP +U y)xOֺ0"jX|^=,*_ o<xX` <oobto$xvvwvwLw0dhw_X o@xDLX `@>2SW<U0N)X)y3xUlN)4h)<U0N)X)> ˥A Sm/X"EX4-/X"EX->Y y0Zyd_d~'(- v`K(Hh D [0hhE[{L&_E&0P$3([0hahE[w0w(p@ wp@ (Y DY Y Y Y Y DY Y PY Y | } 4| U~ `a~ h+8 <2 .  >h$t lc t)  ?*t ?^| |  x*|  \tsON< 42N< 2*,@*@T*@@ Pm  @ m@ m@ m@ m x2W=W  ,^ A_ d: + ; 3B8 X73\-k1`=d &4@1<3si <. PG i d Ts5 |=w,* @3<-k1@=@x x D@x 3-k1=: $l&4@130-k14=: l&4H@1L30-k14=: l&4H@1L30-k14=&4@1Ҙ 30-k14=&4@1Ҙ  `a `ap@ Pp@ p@ 30-k14=&4@1 30-k14=&4@1 4t)3t) HLs< 0F3-k1=&4<@1@11by Sl/)l11%m l w8(r d3r 3fr .fr <.KD(u Wx \8l}lfr .(u W(u W Wi t\up I t F , i pQ  F , i lpQ 00X| XA } QpgAe4ag {LN{D{H$ Lk xsH}{DN{L{Pytc{4N{D{H$ k Ls k s} $ k |s k s}  $} $ k s} $ k |s `k `s} ` @} @P'<U  N{P  'U! z\ 4~ d_d oxP 'Um  } \_\ otxxP 'U  } \_\ o|xP  'U  } \"_\ otxxP  'U/ 0 } \"_\ o|xP X'U  H} \,_\ oxP X'Ut  H} \,_\ o|xP 'U  | HK_H o`xdlnrh LnX! @xqd_0 oHxLTy)0bpu_ opxbpu_ opx_ oxiy)`'UE <}js0ov4s0mPDE'U 8 AD}mHCll- AD}mHCl@A.<-KhRKsL#3P-k1`=&4@1hE<C %=5<P@6j$$P$=5P61`1W8$p1d1HXeXq`^`qV#D mD"z#0 m0"(T(l(D\ps 3#2!2!2!4x'3#2!2!2!4t'x8Xx8<<]h(d`(x8lo?o?0mO(`]*L@2W=W*\@ m" m" m" m<" mp"3#2!2!2!4'0(P(  0 4(8 0(P(]x84Hx8do?o?4o?x88o?dx84Hx8`h YtYY/X"EX8-YtYY/X"EX8-պ@Sc2`Yh/X"EX-Yp/X"EXh-ç4ç43-k1=&4@1&q>X>Yo{|g 3D-k1=1L'X+eL˥A@qx}jtpO(`/*<@3`-k1=l}lu>3`-k1=l}lu>AADAAADr,H,R 2Wp=W\,oL U57LC+|^Q[8r+^70C+`^T8r+^|.~*@~:N 2 L+L+|F|pF44׾׾&AA&TA&A m"X" VR :,@ 3R :,@ 3HHb;HnBX" VR :,@ 3R :,@ 3yH^;HnBr:\3}4K4&94-5Cr:d3}4K4&94<-5<CK\1}4K4&94-5CKd1}4K4&94<-5<Cr[\3}4K4&94-5Cr[d3}4K4&94<-5<CLP+Lx+L+k k 4N| ;nB*@*@*@@*@*@|~H}S}&*,@*@}4N}8&*@*(@|~}4S}8&*@*8@|~Pht0q^xddH0(HP?Hp?1 <(G(Y4YYYX\>TY@YTYYXY|TY@YTYYXY|*@*@*@@*@*@iPj `= @ =  ihQjH X= < =  ;@1&i<;D1U0n0%FӞ0\L\T\P\XD#ͩH60^xx*0@hGGxG6x^bwTGʫ6^`y)4)U\n+ +0U@n*l@\G\Gad1D1L)nB*\@*l@*@*D@ 4 MD*@x8x8L LL,L(0|^&x&x*@*@h*@*@"@@  !08<<88&@`Aq ( (uTUUUUUUUUUUUUUq  ! ! 81ܬ111111 t1D1111X11 111 111 1 1 1 11` 1l 1xh`1 t1 1 1 1 1 11111D1 1$1$1,$1Tl`11 18$1L$1`$1 111h`1 t1$1x 1 1 1 1p1 11 1 81 81hh1H t1hX1xhh1 t11 81`1 8111 81P1 8111 81p1111 81P1 8111 81`1 81111 811111 81T111 1111\LLP1 t1LLP1 1hdĭ11 1$$1 11P((̰1x11001 81h111@8p1 81\ 1h1th`1 t1 1 1111 1P1`((а11@8p1 1111,$8111((ذ1D1111 t111 1%!J@%!JV R R R R R   R R  @@@ @@111D11  @@@@@ 1 1 1 1 1 1 1 1 1 1\1d1lh`1 t11P 1p 81| 1 1@8p111D1 181 1 1 H11 1 1 1P1 t1@8p1 1 1P1 t1@8p111,(41 11 1@8p1XT1 1<81 @ @ @ @ @ @ @ @ @ @ @ @@@p1<81X((̰1@@p1@@p11<81<1DXT1<811d@1d@1|t1@@p1 1 1p11H1t1Ȯ11@8p11P 1\1dܲ1111010111CSQ%JJH$1$1$1$1$11 1 11111 111@HHHx x||~^^NNLD 1 1 1 1 1$1,141xh`1 t11 H1 11111111X111 |11$111D1($1$118 t1XP1 t11111 1X 1x 1@<X111$llh140d1111 1 111111D1 1 14(ı1P1phh1 t11111111111D1@$1X$1x( 1 t1@8p1(1\ H1|PHD1 11V=-% /xx@  80800' 32 .    !!!! !  +  d +Kb' scccccccc *aaaaaaaaaaaaaaaa ;P0 PP  PP  &      # !00((  = @   08<$ %}EE N`00  {    TT T T UU U U ]] ] ] _[[ 7@ TTT 6Q13  1@Y)**DDDDDD+@D@\L&L& L&L&``dem}{zjhhhh``` ```K@K@J@K@K@K@K@K@K@K@K@K@K@K@K@K@K@ 1 @@ 8kkk kkFkFkk-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R-R 60 p ` @ P h aZ%cZ%h [H``.PPPPPPPPP 7 @ B @@ @ B@  @ @ B("  eXe, 8 9 #0x xxp0xxxx#@   'UEUE`UE UE0UE"UUEUEUEPUEP PUEdt(((+ pp``@@ ooooooOOOIIIIIIIIII   @ ;I$I$M$I$K$I$I$I$I$I$ I$I$H$I$H$I$ >@` TIIHII@I8<<<9*:88828 X`;!|>)#)8#))n-.);)#!>1Xtn-L.10B#44M4\1LB. )97})#97}9@HF@`ASA[@j@"? mT 1T:?8 mT81TP:R$XR$? SASASA@\XF4rmX}\XDFrmXp}9Idf@N{f@N{fx9I9I HgYSlA h4A S Sl4- ;-;-\;-;-;r8rP8r8r8r 8r\8aMmrrPraMm.PtaMTmaM8maMm`4`4`49@0F@4[@j@"SNtvN{9@0F@4[@hj@l"SNtvN,{9@0F@4[@hj@l"SNtvN{9@0F@4[@j@"[@j@"4˂44˂drdr؇Yx9@@F@T[@j@"؇lY09@F@[@j@"14?SAX1?SAt0H(fd"TT9@\F@`[@j@"@'ihdB'i(BBA SASA$Ap 7FK7FK0tp8tp.p.0tp8tp.p.3@\[@j@"[@j@"F$rmXd}mX}FtrF$rmX$}Dp^LbFdFrFtt $mX}mXH}9@8F@<[@j@"[@j@"30P3 e t9@F@  [@j@"t09@4F@8| [@j@"t9@F@ [@j@"t09@4F@8 [@j@"}<x81t\Rt~x^x08 tV8R*0t~A^xX=t%E=X=%B(=B\=B=|;0,H"@:=:G C>L:Sl /)l$l3)lSl/)lSl,/)l0l3)lSl/)ll3)ll 3)l)lhSl$/y\`E{h\DȨdy\T\E{`X0zy0E{\XHȨHx̤̤̤$̤ ˥LOܥtOܥ|*  *=hRj?\d*R, L *H` gX( x*H`ghX x*H`ghX *Ht`lgX *HL`HgX *HL`HgXpx*B`gX x*H``HgPXt|*4L|`g[\XLa0r4N8<<qa0W4ig8Havo>b0na4qs `-C94n '@U_ ox4'@U_ ox'U_ ox$8'DU_x ox'U_ o x$,5@N5TkpoxxN5%y%2a%$%,6 "$ 'p'pxpxp'p'p8Y Y@ YD Y Y8 '8Uxptaw,k *8 *<,PtdgL gL  o o o  o ojp<~gg g,gLgbIbILPbIPb$I*@*<@q*p@*@*@{]h$]L5a4"ad*@udll42Wp=Wl|u@ 9@m)p&*@*8@*T@¦7HC0HY|2mH030-k1l=**@*@3@-k1=**|@*@*<@,XP;X*x@nBș<N)@&*@*(@Kd$\"*N8C;N@,XP;X*x@nBP!3<;*,@n|B(`G8P',*@*@U3P-k1=&u$Utp<˥PAP@dqj<@o0,n8@o,n@o,n `Ld>P2SpWM`x>2SWM0`P0tPtlS`-S(<-0p4 ,p8 Xp\ P_ P_ P_ H|pP_  (.|t]|X\X]SxX\SX\404n<~D4n<~80x'tU  80 'U,~T 4G7HC+x^! '8t r+ ^:`0'+t\Tq+\Tq#B<#X-rG8#B<#-GC#B<#X-pH*#B<#-HE'`Uy)0tB i\t0BiTiT'Uipppp p p0,8,, D<a4dC;404*H|\.\}],P'm~,],D'm~<'] ,P0{h| q\\ Pj D^F Xu , tV   4V \y3lyh3y3y3"{"$){"$)"{"){")101j$:?:$$0UlTܥ˥1l'PtP<C<%*\@(30-k1@=&4 @1&4@1Cld&G CLdK8 s&G >\>(>]0 f_|M`$I!VXRX6l.Ptg Dg8{(x({ (x8({(x(3T-k1`=&4@138-k1l=3@-k1L=&4@13(-k1\=)2)É4J'K& Cd*@ÉJ'KH& CPdOh 0N 0x<;4@4*d{(x(XLh3-k1=&4,@10&4@1IP CDd3d-k1=3-k1=01411|'1']4@]']`@]@]@]@=5PPT61'1h'l%  % %;44*F*dz͝p/2:x),:*@ mp"*p@Da*@*,@͒h;4\|49H9Hc2h`,I˥pAp3\-k1=y0yP$yGa0(4I8<<[T&+;d:+;d:4d'u0w\(<~<~\^h=^=R=01LA01HA|XD^P=R=pp A .PtR=R=ʱ0H.l(۲T Գ.,S<Գ@.ʱ0.l(X'\U_x oxp'tU_ ox'U0ET +Uy)(0lvTP@|\gP|lll<oob$o$0ooo$Po<'8U` X`x>2SWMkDkklkkk0KX.<)y3D]tl/<U0N)X)))<U0N)X)Ci <U0N)X)))<U0N)X)))U0NUN8˥(A8=UKYU[sUbU8tUl*U> zTcyZy_~'|-'X c 'XT:U@v,e00P3M Z2M 4ZD2M <ZL2 6+Lr.! ;+\rr! @+r- - - ?J p@ *D@r(\a(4a04N< h2Y DY Y HY Y `Y Y DY Y Y Y Y Y DY Y Y <Y Y <Y DY Y Y <Y Y 8Y DY Y HY Y LY Y DY Y HY Y TY Y DY Y HY Y HY Y DY Y HY Y HY Y DY Y HY Y HY Y DY Y HY Y HY \3y >h$hz Zpy b J LJ  (J ,3,3,.33.t) D K d 3> $3*@3 ~M X ~ DS K \c]   H 0 HY7 2# HU 03D-k1H=yZy _t|<t<d˥ A?/u2W=W8,oL U52WL=WI p=I =I =I @=I =I x=x: s" T{,\uE 0<e Dp f ~s \;s s X;s s T;s 3D-k1X=&4@1&4@13<-k1@=3-k1=Ɓ ,Z (039 Hf  l6+pr>l$30-k1@=&4@1&4 @1H L4w 3P-k1`=&4@1 t |     t |    70C+`^8r+^8 r+H^10'41,'\1T'} .w \m} @.w Hm>~ K~ ssdܥ`O˥d D  X  |  D  H  H  D  H  H  D  H  H z @z  Zz  ,Zz  q\\ Pjؔ D^ Xu ,E tە e E 4ە \1'*L@*@*0@*@3L-k1P=ܰ 4&uU&u(Ut< d.Ptg hg\@ *@@  4 |a*@ S L_? p te3 Y70C+`^8r+^_  Pq^@2W=Wl,o U5(2W0=WT2W|=W,o U5+e( U5MY G+eLMY 0G m8"2W0=WT2W|=W,o U5Jx x W ,;y dMq m;y Jx x W ;y ,Mq m;y Jx x W ;y Mq m;y ( { : d0 ճ , 0 hX `V = 5  8ש XR Xa$ r% x/3D-k1={$ש Rl $FCF4Pp (p( .l \ ~ dz( { h: d*@r\: @l F ]g ש HRש DR 1g xo  H1g o W 7(P(($W <7(T3<-k1=3-k1= B Pxtp` ,` *<@l<`><b ,b q gq 0gq gq gq gq 4 gq gq 0gq gq Tgq gq D gq gq 0gq gq gq gq gq gq <gq gq xgq gq X gQ!id!xtLo{ 7hC+^t: xLrh xJ J J J J J o  xup p<p pF , ,i p( `8h p> DH}{DN{L{P$ xk sP  9n 'U] PC| A } PQ_ oxmPD,E'U, ,E'|Um`D,E'U, ,E'xUmPDE'U E'hUmhD'UE'$UmDDE'UE'pU8 04}mXC;ر0>\g ܫIܫ@ܫܫ*@۴۴|""("|"030-k1@=&4D@1H&4@1qxmqxmYk\YkuH;44* RMbKPNf8see: ,((@~d'-,(4sXOU4Tܥ˥ 0 4(8  0(P((o?4o?x88o?do?xx84Hx8`x8(4>x2SW99CG$q^PX>$>x 4.;44*' ;4p4*+e,KXc  XcQ!id!tQ!id!ttH3 J3xHi3D-k1=up>+eL1'3P-k1= o{$_T!>4uH30-k1@=&4@1&4(@1,74C+d^8r+^n h. 4|Ts4 s sP s sP s Rs }t-s AsL F vm v(m & v\ m,<52W=W,<52W=WL˥AP˥A2W`=WL ml"gl m"g`ggֵp70C+\^8r+^ >7LC+x^8r+^w A%0.a@D %8.adh w0`w@|wPtW*@*@*l@``}07@D }07dh 0`@|P* &*( *  `)X`)<hZpZ?p\X;\nBV&uN&x;n\BAlBtoPp\X;\nBV&uN&x;n\BURlRt`p\X;\nBV&uN&x;n\Bblbt4:8 ;nB;404*H<;44*izpB*d@izBizBzDTa}XS}L&*@=T=0F*`@rt"+e*X@!4uT`Y<uL>Y * @Y@Y@/X@"EX-YYY@Y@/X@"EX-YYY@Y@/X@"EX-YYY@Y@/X@"EX-YYY@Y@/X@"EX-YYY@Y@/X@"EX-YYYDYD/XD"EX-YYq^q^*@*|@*<@*T@* @*@*@*8@*@*X@/Xt"EX-/X"EXP-/X"EX`-/Xt"EX-/X"EXP-/X"EX`-]S*S80S80S8:S80S:PPb`3`L`L`X$h_$h`_d$h_}8G}G}G}G}@G}xGr@qqTkqt_q_kqeq_@w@q wTkvt_v_vev_p|@q9|Tk|t_|_{e|_@qiTk2t_2_e2_0G9iMMDx,4Gʫx6l^#`y)DGʫ6|^ʫ6^..P. .   GLGGLG*H@*@GLGGLG*H@*@GLGGLG*H@*@GLGGLG*H@*@e0/h eH/ e`/ e$/P e,/p e4/ e$/L el/p e0/ /4$&x*@)[X<lMDtx&x}$X%K;4 Kx L@ * IIIII ""22"#@@@@@ 0 @B@@@ @0! L&L&L&L&L&L&L&L&L&L&L&L&L&L&L&L&L&@@)   @   ! $@@H @@   s@@@@ 40       p111111 1 1 11 1H@1 1 1 1 1 1 t1 1 1 1 1 1 1 1 1Ȭ1 11 1 1 1 111D8$1 1 1 1 1 1 1$1$111111 811`1 811. 111 1t11D1111D1t1X1 111111 1,88ܰ1dD1|X11 11111 18$1X$1lh11| t1@8p101@D1X841111111111111111 1111th`1 t1 1 1 1 1 11 P@4 t t 454h$1$11$11$1|$1$1$1$11$141 t1D11|11|1 <11 1 1111111 1111 t1@8p11 08  @ $      $ ($" D 111111@@@@@DDDE @%---/# @@'@@H@L@N@O@@U@U`PU`PUp@U @U(@U,@U@U   %$4`V``PP " !!)   ``a p'@@L@H@j@X@H@H@@H@@@@@@H``@`@ : $ $  d@ d@ d $0 555555555 50  @,@ @!@! ;B 0 ,  @     A      * IIIII I""222YHhx1@PU-/1`! '`J'`J' `B' `B'9`' ` ` S@HB 2dH F @ @0( $ B 2$ D 0 00 G@@@@@@@@@@@ F@ 0 T   P Y P & $ K! LH@(D"  @P,#   @ K*``hl   @`` ><&1BB!C!C2$ ; J 8( H >08T    @  ;    0 @_G;mGXG,_G;mGG_G;9@HF@L[@xj@"[@j@"M[OOPP@vNl{.Pt.Pht.PtRXRR8XLS8R8S<xD{9@F@[@j@"Xl@L@8k? S x {S x{O\PLWPvN0{|W9@0F@8\BxB[@j@"^P_0YHp44f-;9@0F@4B{D__{6[@j@"_{6Rs\mRs`m5r`5r`5r`u5r`Rs8ms\xrt5r`Rr$rdrsx܋L*dr<D|܋*dI|III|IItIYD9@LF@PY|[@j@"9@0F@8[@j@"p4|SAp|SN<tSH 9@pF@vN{[@j@"SNtS vN({9@F@[@j@"SN tvN0{vN{gYvN{vNT{gHY<_gYgYSNtS$ 9@<F@TvN{[@xj@|"SNptS vN|{9@lF@p[@j@ "!H1   pgHY09@PF@TH|*[@j@"O$Px{٧| x{+sA Yq_\٧ 79@0F@4A\ A|Ah [@j@"P""T"Y(d",t $Flt x7@79@F@[@ j@<"1BHWc՞BPB՞,mX$}F8r$x&gYA 7$l$$P$$ $SNtf<`fvN{f0 |gY9@0F@43LP*lz[@j@"j=\&dTj"=T&9@F@[@j@"[@j@"HE@(@kSxx{? 7RPQR8F@07L2AA Z[@hj@l"R!hllR!$h8R8%^9D.$-l--9/l-0-X.:7l-.:87-9/k18=,Ax;(=X=%,ewa&x(&xHew|a:ewda&x,4p@ pp  P. |ADpX 8PH_L @.p P_ hp t.p P_ hp t.$i|Տh+~h~8CC C*@*@kl t|*4LBx`$g[\lx*4L=|TE[\=@|da$CH<C C@3l37jL3iLQ hp X= < =  p;nB<x< % (% x%0"8D"`Yx`koN52T1*@h k18=,Ax=%,00z  X  D:N`U::NU&=:jHD7HI9*J$ZJJ02ZJ I9*JH$ZJ$J2ZJ`QIG ˥|A|@q[[[ sq^2W=Wa4+aPa.b)Cb9b^buhhCj,j$(jl$jl$jl(UT8,Cj8j$j$j8(j@(;4<4*`u~R3-k1=&44@1838-k1=&q$I<˥AqNMCCj(j0$j0( *@X>,<`0Ӷ3PPthgP ˈ&xT&xˈ$4&xo{iTiHYmdHCD|2U<0UoD6BE\g\1<0UoD6BM\g\P' 48g[g[g[r8t*d@*@r\trtrtrtr trLtr|t?`;n@BpH'X*@UUT3,-k1h=U)0*H**@{]$]L*@3d@3@dP@$Xs"5"$= #DP$))4DDaD\S|S*@*,@{],$]LL*@T`j*@3d@_X oxL'HUx Pt2P$t#PB<#8-#B<#-r$PtE'`Uy)0uttB, i,\<'8U<Ey)tB@ i@\<'8Uy)x9n E so/oQp`/o0Qp/oQ/oQE'<U',UE'xUy)hU'B83L=B@|)4kkkPkkkk, kkx kk kk kPDcYt$rDiC2$1b*$Le$iF`ws:hj$4$$4˥Ac2@`@q | @pq81}!5,=5P61''FF*@'FF*p@Cd'F@F*@]0 K@& CHdK* CdhhY]@ K& CdO` 0N |0P$tQ!id!|tX!5 T38-k1H=&4p@1t(z{\(x(l~՜8q^:?=5 P,6*@3d-k1h=&4@13T-k1X=*@3d-k1h=&4$@1(w ,w 3@-k1=F@^l-8l˥4fafafta;4)  fahXcf`aU Y% 2'0 "\ _ oxy)@,D:x\2:82<:3D-k1T=&4@13-k1=H h>o@6<Uo6\@gD\_0 o@x\d'U*@by| Sl/)l_  o(x,4.t`juosstxtpb.tjtbvp@HHvSuo)wdssuo01EA01pt4AE">x^=R=ʨ4 _ݭ@_ݭ08'<UXO_ ox `0t(,|vllX | (oo@ob$pok`Ptk`Pt{3\v\|v|p vqw_ ox'UE_ ox'UE<U0N)X))8H);lO0#t43-k1=&4t@1x@)K.)p)K.$)y3by0 Sl/)lxK.veк . lwl. lwl/ pwwsl*@N< 2N< l2= B= uY> `. X0 XXp@ . 0  Y DY |~P'-Y |Y } | } 8x ,y jpy bD X ~ S S HK  4K 8 T~ 0+r 6+r>$ S30-k1@= E&4@15  I HY# U d H D7 2a U / / +E EAeY&x&xyd_y_˥Au2W<=Wl  H^ P<TX@ m x,o U5 ; \72W=W3D-k1=P R 3P > $K> <$BI )Z <I p=0[  ^[ @ 3> 6I =^|D P 3-k1=d $&4(@1,3<-k1@=~ &4@13 -k1T= 6[ 8yZg GÆ ?si 0 i 30-k14= Ҙ X: l&4@1p@ ?J 8p@  ?J K K 3H-k1L= a&4@1&4x@1|34-k1@=&4@1< r l V34-k1@=&4@1< r l V09 |FS} 99 hM9   O \ ` ` 4q_ oxx'UEt  u (u <W<HM` p` ~e DP\e :lze @xe 8xf aq gq @gq gq gtr q  gq g (֮ 7. =g H i dpQ <<rh Aeai  ti T dU= [E'UE'dUs@0m@D@ E'UE'U sp0mpD @ss0$ k syc sy0c'U ` dE'HUa 241y) 3BT&T&PtAD}mHCllllltxkxkkdkkkQ@˥Al@3{[l7Y@NJYY@JY@YY`L```` ` ` 3P_T <..3.P_\ tp P_ |.P0_|p P_ D .@p\ pP_  p.0(P(])])]x)MQ!id!Pt(Q!Lid!t>~ mp"gp mX"gXU\Tܥ˥TkYb>Y Z~1'@18'D3J_8!_!3`-k1=Lo{PD1_$!_< oLxhp'UE1Cjdb Cjb Cjb mD7 94$]02] ,4rr(rPrxrF4rXFLrTFxr$1 >2SXWÃSD aO(70C+`^8r+^  A<#LH`%X.a| wHsHsHPsHsH0sHsHslzl`zlzlzlhzlzlz6Lc`}X7| qhi5 ~ " qhi5 _|"$ %aH|sHLslzlzH,sHs*@*'4P*' *'$dn;4`^h,;;-$*@*X@*@*H @* @*<@[<K[KRt#<x~[KN8̈́(]ɼ@ P&x@ HJ&x4*@*@to`okqDep`6p}*@*@t`tvDeCu`6&v}*@*(@y` zY{Desz`6V{}*@*8@`; De`6}*@* @Gʫ6^  Mzo@Hk@k+++vRGʫP6X^ MDxT4MD<xG*@(G*<@P}WHWH$%$%KK61K$%K;  K,%XPxWHWHt 9  9 i(H|Ɂ L(<;< Ki|}WxHWH;n BuN$@`@ @ P TTT@BH@\3```hP``a`a` & &00000 00840@00@0@J2@3000@2@@2u@0 H0 111111111,,x1011 1$1`hh1 t1hh1P t1p@8p1@8p1X1TLD`11111111 1 1111 11111111111111 81L$11X1 8111$1) @  %540/@B@`@pH@ @BB@H@@HD C-RT-R-R-R-R-R-R-R-R-R11 111111 1 1P1 t11@8p11h`1( t1H1Xh`1 t1 t1L 1X@8p111D110 H1 1 100181Hp1\\1H1` 1l 11H111p1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\1h1t1 1 11((1,TUTU ( ( D    $Ȭ1` 1PL1 1 111&  !        00  (,(Л(Л Л( U@(_R@ T0I$I%I0I$I%I $I$I%I8I$I%I(I$I%I"I$I%I@ I$I%I<L&L&L&L&L&L&L&L&L&L&L&L&L& !""""""""""L*""""""V|p`+``T`TT``T`T9 ]] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] Y Y Y Y      ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ,x(8H H@@@H'   "B G@  B*(@@)0 eH3{{,@2 "$$$$$$$$$$$B $B$ ^ [       :PH $0 $0,  $ $ 00 $0 d PB ! &L$&LB$&LB$&L! &L!<L&L&L&L&L&L&L&L&L&L&L&L&L&L&-@@@P@lPPpP@PP @@=                  N` `$@`$@ b$@ R$@ $@ Z*<*<*<*<*<*<*<*<*<*<*< < < 00000         PPP6x1LBn-.);)#!>========SN<tdN@N{N{NQN? vN{Y`n9@0F@PZp"[@j@"B@BLZl9@F@Y[@j@"SH {jh8x{S@lSlTx{LS\kx7R<?, QR,GkP; UX5 LSTfRsmesss4RrrYs\x9@0F@4_{L6[@lj@p"_{6[@j@"}Hs`xRsPm5r `N ajC5r`dr04mX}SASA8DSAtSAHA 9@hF@x{3ZHxD{79@F@A [@j@ " +s9@LF@P[@j@"[@j@"9@0F@4dx`{3lp[@j@"O@P0PvN {PvND{9@0F@4dx{3[@j@"B9@dF@h c9cWc[@j@"~hT4ttXtƶ|0  <U`  d,9 @  D9@8F@P[@`j@d"b[@j@"0779@F@[@j@")vN{THfdE762d[@<j@@"9@hF@9@F@[@j@"$LqVR|$q\R`VRh9@0F@4Lflfd[@j@"S@ OPP|vN{P^A`^Hxdlx!$R"@0:AlMk1h=*8=:1T=:>4:CrP QrCr QrHCr QrHCr q}LR|`Ux|@]P|tMx|]}:S~C*|H<puf0pl D p h.@3!3!3!3 !3`!J.3d!a x*HBL`gtXh:kC3-k1=|ZZ7dC+^,. r*@*@*@\xGaIl <$L8x8'L'LL|x\L|x'8U|x\xX|x4xX+U'8UlxZ-@o@xxD"Y<'@ULTo KkK@kKkLo{V@cVT`V(7j(VV`iQV`dH$Xb'obxd,d,d,d,d,h.e`F]$8] []48eF]8^0h\.j+7{E{j0+7{4E{8j`blP3{[t7YPN]L][]8 q ;{]d$]L{]$]L5a"a*$@*t@șXN)\&*@9Dm)l&*L@*@*4@Da*,@ߨ^,^X^^,^,``^t,^t,^^^,^,T[&x-V&x[&xh_`0:lMk1h=*@=$:1\=:@:0zXzz i0zXzz i 0i 05 0i 05 i 5 i 5:y:*h:y`==3l-k1|=h.&4@1h.&4@1qNHPNJ N i$OG(GGM%X2W=W2W=WZ9ZZ</Z7Z7Z8/Z7Z7]XptX0:BftEc,Ec ` +ateT AC.][\C C.]< ;444*L0=txMMɽɽxݽMM~47~X7*@**@**\@Dx>Lgx Ptg XˈˈltˈˈDL-|V&x8r+0^-V&xp\Dpa9hm)&*@*@$s$s !3<;nB*@333tà8S)<&*@*h@$ s$sș@N)D&*@*0@șN)&*p@*@SL SSS8SSL*`@&xp&x&x&x&x&x&x&xX1i1|o&u<UR)`}`S S YPB<,DIx\{] $]$ Lr t* @<UUU<UUUdUd L'bP}uxHxo{}DlPt Tx -PtLS-dp `pT xpt p PL_P PL_` P_ p |t]2|-X]YX1PS,]g4htghdq_ o, x0 8 q< \'4U\\\  201Oe. 3Be9;44*2862X<'8U<Ey)uTtB i\'P P\_` P_L T.2,(dLuHTt <t <( ?&ux U 7dkk =7k :)y 3y3y3y3px*G0G |3L VL3Lh xL1IVL]0 Rh1Z-Zf<`] _(MYqL|q-q^n0=5P6=50Pp630-k1<=&4@1&4(@1,{p(x(7HC+t^ެެPtPt&xT%t><L>*@3r3r3r3r3r3rBxVBxVF4ws:8iP<t4Q!id!(t@'<UP xE'U( 'U%m/Gmhem%mh/lh]himhGmh2'd0 "0 _ olx G1ܔ7L(Gϖ{(L1{<11P 1<'8U(x HXPE8'H'LU)\t  !oh!x&x&x&x&xwwv|0 @T_8 oHxdl'UEekD`PtkL`PTt ds<Osddܥ ˥T  s OHU@N)p)))f )<U0N)X)))d)@)10d^t,1`1^yQd^t,zL]-\\ɸɸ@D٬\Y DY Y HY Y DY dY Y hY DY Y Y Y Y ,Y Y 0Y DY Y LY Y TY Y Y Y DY Y HY Y LY Y Y Y DY Y HY Y HY Y Y Y DY Y HY Y HY Y Y Y DY Y HY H~l-Y HY Y DY Y HY H~l-Y HY } \| 0 p0+tro p*+r| p} T8@  Ї  Ї  d Ї (2W@=W\,oD U52WD=W((7\C+^8r+^7C+^8r+@^  (  (    " L7\C+^8r+^> d> -( I 4=yZ pT< FI D?< 0F= = K> x $I H=I =I =\ I =\ |I =I | =I == \uY> d`I =] JI (== uY> `34-k1D=XX &4|@1I =&4@130-k14=&4@1 p@ $&4@1y4ZI =*|@j b Dc-Xy(Zj b70C+`^8r+^8r+^8r+^2'd| "| _ ox`h'(u Wx 88(u Wx 88Y4YYU8Tܥ˥`kYb>Y$ Z~ܽ7hC+^8r+ ^7C+^8 r+L^2W=W2W=W*\@*@q^02W,=WD(2W8=W,,o` Uh5^D,{]$]LP^4_]L[]l8^,d^(l \L+L+ (G|8F (Gdh l i d/kV$&u(NZV&uN&* 0*@ * `g&A-$* 4*D * e&A*@*@'8s's'Ts -|V&x8r+0^-V&xOp/Dpa}8S}<&*@*\@=|~=|~I~<m}x&*@I~m}&*4@*@*\@x8DMM` ` $~;;x'$V^y'N''Q;T`H3^1'1'3J_@!Y@Y@Y@/X@"EX,-YpYpYpY@Y@TY@/X@"EX,-YpYpTYp >L L ~ zR#<H~_ciiR#<~4DtodoD-p0p0p0nB tdth/u0u0u0nB7 t$t(77 hyd zYph-z0z0z@0nBi<d; Γ<-000nB7'<77'<77 '<$77P'<T7Kx)er  eɸ  &x\&x\*,@GXGG<GLG*@*@*@GXGG<GLG*@*@*@GXGG<GLG*@*@*@GXGG<GLG*@*@*@e0/p eH/ e`/ eh/ e0/h eH/ X5 e`/ e/ e/ e/ e</@ e$/X e,/x e4/ eH/ e$/T et/x e0/ eD/ 5 5 5 D5H 4:0Pt :L:t61K; D=K<1Kt UL55p5 R02dH0 2dH0 dH2dH1111111L1` 1l 1x 1 1 1 1$1,, 1 1 1 1 1 1 1 1 t1 1 1 1 1 1 1 1 1<,, 1p111@@1111X 1d 1p 1| 1 1 1<<1 1 1 1 1 11111H1`$1t$111111P@8p111111 11| 11 1181 1((̰1114$1H 1T$1((ذ111 1> 1111110,l1$11111 1 1 1 1D1X1l111111"  .   x@xx8    )@@D D DDTTD  @@ E@@D: @@BJH$I"JH$I" JH$I" I R) R) R) R) R) R) R) R) R) R) R) R)&LL L  888    @(((,,.>**))>x>nnNnjJhh.  (8(P((($D@$ .$ttTdlt Y ` `@@ R``P40 Q% %%% %% @%% % -   x!@`@@@ 3@@@@@ @@`P   & 0 8 LAxXSADHEIoHEIoHEaSN<tdNN|{NQONd? O vN{SN<tPZ YmZ0vN{Y$dW3htH*9@F@[@\j@`"9@xF@|[@ j@"0IIPSlLISxlSNtvNt{S,lfdh,033TXdl1npjD@HkR[? YSRV? ? j^H_0YTOPPvN0{I]'SNt? 9@xF@YF[@\j@`"vN{<Nd{aMm X H\* H*9@F@ H*[@j@",,,`lpOXPH7P0vN\{SN<t٧x 9@F@b [@Xj@\"vNt{vN{i8+sçYYI"ٰBBٰBBxlhTBtBBhPBBlB9@0F@4]pp]p[@j@"<\~;5]ppo1< 03,8=<L;P764289 86 2 Wc8XgY "F rmX4 }"gTYDOix{PgYiix{ 9@F@A \48[@Lj@P" @9@<F@D7\[@j@"oNt,f,f,xL{X  \!1 T:At LD$P$$;#0Y800a$+|$h\$$$$$L$ 9@LF@\$$\G[@j@" $$0,$$x$G lOHP8#`Yha+|hP(LvNx{SN`t9@hF@t[@j@"vN{[@$j@("vNL{SN<tvN`{fvN{]'\fvN{vN{vN{Q4iY$<<|*z*zY0F@`Y[@j@"[@j@"[@j@"xX <@@@k `$LqVR| f$qVR`VRh>:D;>:E=>:D;> :E=E=>x:D;>(:E8=>:D;>x:E=E=XOܥ`˥T3E{E{v$3`3E{E{v$LqVR| f$qVR`VRhx HlRxxt1Rxx HlRxxt1RxRSp$>:p@':p':X(':'#L*HmVXV:VM.+PFHPV@3-k1=vWx?va,a5& 5& T&h!D=  (0;VV VX  m"p ߧ "ߧ"DpH p +`+;pX|vuDf;pԭjh$,8 "8 h$ " 3]$z]h "h  y) 'U'Uy)*t@_0 oDx\d'U+U*@*@uX<'@UL  XE0ODa4VxHdC(@\@\@<\A`\A\A\A\@\9A0\uH&uUhuaup&uUF<F@FFj$0$4$ >hij$$$p{(x$({(xd((É J'{(x ( (c2D`D3-k1=&4@1˥ A DTL6X-#\*@`/&u8UtL<zt*0*T3-k1=*&4X@1\*8*D3P-k1T=,~˥<A<<  ,lcDY81trQ!did!\t8t(rsHst`x.tpj_tit@H.tjr4]tpb{w|1ϖh{`wT|1$\<'8UP\ċ\,R=$Z _, ox_\ oxH'LU $ ('$U{3y){3{3{3{3_ ox'U9(n 'U9n Pt~d2;OT#tX~7~7sO`s(OPUP(PlPx QD@PXZ\`JcJcJcJ\cy4Zy|Z|y`Zy_ydZy$_ydZy ZY DY Y HY qf H7Y HY Y Y Y DY Y HY qf H7Y HY Y Y &i&i&i  ii(lzlz7\C+^8r+^7C+^8r+@^ m" < UJ (%}J J J $3K /XK   GM "_ _ !>l$.` ,_ ox g 0G g  3-k1=P &4@1g 4H P330-k14=w &4@13-k1=&4<@1@[ 8yZ 6[ x 8yH Zg GÆ 4?si i n  \?b3 1b3 1wwwtwtn 3H-k1L= a&4@1 hp@ p&48@1< Ls  lLs Ls$>$3t) dy dy y y yO  D D9yH1H'd1h'l1H'x1@'z \/  `Cjb 1` 'h    Dc2`N  | "c2X`c2`c2t`c2`k 4dl 8Z_l el 4.m Jk xdl |Zum em 3-k1 =r  j%  r 'j%  #p p<'s  @q DJx x W ;y ,Mq m;y ty CMq `m;y  xU tQn0% Qn% T< L29 L7@ L/ DY Da6 ] (= B Yz S _z(\ L P    <    x x=v\ & %  ` `< Pw}m<Cm|mDmDG <Wrh )nvG Wrh P T 'U4' 4M F M F}m<Cm`mDmD)nvm4\mXDmdD3T-k1X=tqxz&4@1 J |?3D-k1H=Y(6(J(HhP9(LPdTqPtg o{x8$x8\D9sx8hf9PP_T P,_D 3fp P_ 0˥|sOU|Tܥ˥h3-k1=&4p@1tT3-k1=&4@1kY4b>Y YXY}kYpb>Y YYkYb>Y X>Y,Yt Z Z ZH ZLPtg d>4PdtLCIg  g  $>Pt ZY Z(/X$"EX-Y,kYxb>Y Yl3`-k1=Lo{PD1>_!D`434^1'$mXmX<'8U(x 4Xy) E;4H4*p`/,3Jc2`c2`c2``& qc2$ `30-k1@=&4@1*@&4@1&4\@1`˥xAx@qtD )`2W\=WL+ڝ Pڝ N N ;4T4*l' ;44*<;44*P<-x\4bR]P$-*@@*@*@& 0(*@.D6*T@&.D@6by0 Sl/)l7C+^8$r+L^1l'b (z( z(z(,zby, Sl/)lh(z(&PM&@{&&&'&)!'4!'4!'4YtYYY\/X"EX|-YYX@>&i&i&i(&i8rGi iii&i&i&i(&i8wGiiii 8GGGG@GxGGG G wk wk w k wLk wk wk wk@w@qu0KD)@eer eɸ &x&x*p@0HMD8xMDpx|h 0HMD8xtMD@xdh 0HMD8xtMD@xdh 0HMD8xtMD@xdh 4)e/ e/ F%F&i&i&i(&i8AGi i,iiX&i&i &i&iAGiiii4)D;)11zz@\@DD8161K01KK)P00,2P20000000  PP* 0 0101212161410 `0<`0<`0< h0<`>`0<`0<`8<d0<b0< `8<(0N0 $08 $8 $00 $002$00@000 $1 t1$t1<1L 1p |118 t1X1 @P1 t1P1p t1P1 t18h`1 t1@8p1 T$1h1l 1 11p111 1  1818181h`1H t1<8111 \ H1|D11111111 H@ \ I / @ ` ``````@`@ `0@8< <<  8 8 8 9   8 8 8 x 8 6 WGxG`GdGbGbGb$Gb Gb$OxGx)  -(  D F D!D(   D)J  PPLPPPHH H @H rH rH HH HIIHH 9J$I$J$I$ J$I$IJ$I$ K$I$ I$I$ H$I$)H$I$ =B    B   H,<,<B,i,?)p;,l1,t9)#!>9@0F@4[@pj@t"9@F@[@j@"[@tj@x"Ll#Ix4LRLHoLHRLo4LLLLSN<tdNaMmaMmaMmaMmvN4{N ?l vN{SN<tdNt? vN{OSN`tldNvN{@T@@k9ISx{? S0 SDS9I|"49@LF@l"[@j@"B(B4Z|BSNtbSN8tbDSP A| A\ vN{b-\;4-;44-T;44-;ovP?BWGvYW;v Cov$?vHCovL?ovd?ov?Vxwx,*Gk ; U(5 x?t WWTWxzx9@F@[@j@ "9@`F@d[@j@"? O8OXPHPvN{9@F@$[@Tj@X"SN<th4BTZtSNt9@F@vN{BTBh؇LY09@xF@|9@F@[@j@"[@j@"gHY0@p YtSNtl vNP{k Gk\; Ud5 LS`Wk? k@kR[OOBBBBfLfH՞|t 0$|ttHtXmXh}@gYWcp_pgYgpYT9@F@[@8j@<"[@j@"[@j@"[@8j@<"S8 7h4Sdl¬xЬ%bB |9@F@7,\[@j@"o9@XF@\J4J  [@|j@"3\` |9@@F@\[@j@"*ze [@j@"#Y00a@+|@hh$:A @t$$$$A^<xX`CxDR38-k1=&4@17PC+|^8r+^3-k1=_ oLxhp_ ox    94n '@U_ ox _ oHxLT21> PtP`tX`>tPTt@PtT>d','3408J<#p->d&14DZ3Z3t E'HUP jt<B i\ i\@8vvL@vv) _ ox  'XUEy)'2T(Pxt@'*@*8@2h(*l@*@[&xP[&xpt[&x|-V&x-V&xT], hE],PE9lkxx *@*@*T@$!Q!id!tl$!c2`34-k1D=c2`&4\@1`&4@1&48@1<"ph#</#x#xPtQd  ="L:Q_FV0]3-k1=l&4@13 -k1$=&4@10%+<<ll`t ```,*4@*@ P m" ( m"*(@ d m"_ ox _, oPxT\, puH~un@|Hssudoupr ]sst8btbWtR='sW&xs&x8 WtR='sW&xts&x tW`R=s$'j^=&xhT 'Ud 9`n '|UYTud dT T'UT T +TU E T9!= _ ohxlt_\ ox\L _ ox {3{39Tn '<U:>pk`P|th{3{L3|8  4  |  x( i7 i`_ oxE<DK.)y03]/%%p%a|xUTܥ˥b ~ ]+r,u+r,u+r,u+r,,u+@r,TuN< 2N< h2N< 2* @*p @*T@*@*@_M *@ \~$ *@0 L. l hS1 ?/   2 0 \T< h ^ <P*@*p@*@30-k14=&4@1 a&4@1 &4@1 l*`@*@*@*@3-k1=&4@1&4@13P-k1T=&4@14˥A˥xAHsOSmc2` dto l c2$`* pOc2`L d $ l*P@4>l2SW11Pht`MÃ,SD\aO(3D-k1H=k= h.\5 x5 \5 xx5 h.= 22'td@ "@ 2'd " 3B 3B>3NQ3g 6>d n ik<;O#t) *@T) <*T@XX *@ 4 LRo  R to  o  > > 3<-k1=˥c P# u ˥p /7p Tx\ </7p    ,L'8U  $ k s tss0$ k s'U ` dE'HUa s0s0ov@bZb@ZbZbhZbZ@ b Zb Zb ZbPZP p @+U 9!L=y)8|m0mXDmD)nvm 4lmhDmtDmmD2'dT "T y) .p 2'HdT "T l Zm\D8E'U8 8E'U'UE4@'<U E X=5\P61'1'1'1'8J/X"EXP-Y8YdJ/X"EX|-YdY4P_ PH_ P_P 3`f`p . 0  4 ! DH!  ! ! @! ! hl! ,0! o?4o?o?o?0D9shD9sHD9s(D9s@D9sD9hsD9HsD9(sƌx'X''p'0[  t'4'-0[  0[ }L7\` }T7 RM/<Mh/$*4 -$* * 5L555555555r\trtrtrtr trLtr|t ``prtP/X"EX\-F/X("EX-/Xl"EX -p9 Y4YYY 7/XP"EX-Y4Y|X>pppwPt0=,x&i(wPH0=x&iwP0=xwP0=x[[[[[H[H[H[[[wP0=hxwPX0=lxi\i`Rd#<p~R#<~7{dE{\phv\hv\hv\hv0HlMD8xPMDxh 0G0HlMD8xPMDxth 4G0HlMD8xPMDxth 4G0HlMD8xPMDxth 4G*@`::t&x*@*h@ m"*@yLk[<[$<8MD@xHMDx85  @`N`` .` `  Q !! !!B BB!B! < 1\1d 81p 1111 81@8p11 `  ɐ@ `1p11 1111111 _pppppppxxxpp   $&  $&  $& : -  ߐ 9(`!?(`!@=(`!`?(`!`>(`!`?(`a@?(`!@8(`!(`!8` (`O(`O(`F (`F(`K(`IL cT"b  '&&&$$*22G @ P@@HLP*@*D@d``B`@`.  QAAAA@A@.00@0@000 0 000000000000000@0000W-)aTJ% -)aTJ% -)aTJ% -)aTJ% -)aTJ% -)aTJ%-)aTJ%-)aTJ% s@@FD -V V V V P P P P P P P P        jA0A0A0A0A0A0A00$ a@aMLmMLh@k@kM[Mb@k2MMP@|k@kSN<tdNLN{N{NQON?( POSAvN{SNt9@F@aMmvN{DQ[@j@ "aM m[@Tj@X"Y0^Y^Y^_TYXSNtYvN{k_0~_k_;`4B~_A _L~_$lxh{~_b_bobe9@$F@( c@9cDWc\[@j@"be04e8UDeySLl:fSllcfSl:fSlk Gk0; UP5 7R?@ QR@kLS8? k@k-h;I-;I-;IOP P`vN{9@hF@lZ9@F@^0_Y(ZD[@j@"WYDlS,x{Tw`Y(wwSNdt? 9@PF@YLF\~? @k[@j@ "vN@{SNdt? 9@PF@YFBYl? @pk[@j@"vN({aM8m.Ppt*fRsm*zRsmdrH5r|`M [M@ba0Y4x9@F@9@F@[@j@"[@,j@0"fQiY   XSNPt9@F@vN,{YPx0{[@j@"p8YF@Y "[@Hj@\"D#[@\j@`"B7$&Wchit \$uhmX}mX}u@34x37j43iQP3iQ0"8'HUHkoko||D"Yx xh21*l @q^ *D@_ o x<D2' 'Ud\ "\ *@;44*' ;4l4*|<;44*,{]$]L *@&xT*@ **@* @* \&x)*l@*@*0@*@*@*P@' *@*@Pu/`*@(u/,`*|@*|@*(@'P*@*@*@rt38d8 ˥p48pT8*,*))*@p'sO30d\T$j3|d*@h*YTBTxu/|`u/`*(@*(@_Z_I_Its$etsett43tt4L3!S,.&i,.tiPtghgh_ ox_T oxx|g0htgh_ ox_T otxx_ o<xX`2''UE_dx "x dX'<U[i.Pi"t@BiTiTi {Ll7{1 i\2'ld< "< _ ox@'<U@Ey)2'd " _H ox l'XUy)_ o|x _ ox y)$_ o<xX` 'U  x x Pt262<2t623-k1=21262P]xH0Ch;xxHF     \   ,  D   ]0 FFe!VXgg@HgHqFzCxde*@l3x-k1=l&4D@1H3-k1=͋8͋_ o@x\d _4 oXx\d  P_ p P_ p . >$ov*`@=s >ov*@>x >ov*@n2'<Mo,%o2'qp8uo_ ox?h?9D9D|wXw4whT <))\1SPN_ o,xHP'UEG L%o @K<. ) 0U<NKD.K$.h)K.K.D f ,`)U N U(NK0.$)Xh)- - - D*x@- - d -  . P -  -  - w. www/ w0wwwDwsX 8X BsX 8{L7sX 8sX 8sX 8sX 8sX 8sX 8sX 8Y DY Y Y HY $Y Y 4Y Y <Y Y 8Y DY Y Y HY $Y Y 4Y Y <Y Y 8 ~-\-M ,= 0&k lD p&Ƨ  L &- <S t_|3 Sp i 6+r.! ;+r3d3.N 8N(N N&4l@1p34-k18=K HK L3-k1= a&4,@10 p@ &4@13-k1= pc-t&4|@10I&4@1  o \ HA< HFI =K> h$< F34-k1p=I |=K> $L {I =E e    \E E E ,E E D E  @H@LH1 `)1 )a  2W8=WX ,a  2W=Wh1p111 03lJ1'1'1p'| D D9 N xyr\ r\! } `q gq Dgq gq 4gq gq  gq gq 0 gq gq gq gq gq Tgq gq Dgq gq $ gq gq $ gq gq gq g_4 o|xdl #% %% (% d)% *% -%H} ,H} ,4~ ٸ Srh } "| \A } Q| K ,} m\mmk k (k s .mdmP,t$PtP(t <>q^(  > 2I2_j2282 #2l!2l!2l!3'I2_(N(`(d(( (jx8dx8,x8t$x8<x8xY, Z Z/X\"EX- ZY Z Z Y( Z 7DC+t^8r+^7C+,^(8r+^i i :  :$( L1;H;P;nTBnBnB `(lG;H;P;nTBnBnB `(lGH`sii i$i(iiiiil(zDa0- :>2SWg DaDT ag ޣ0h.800h.$0lh.l-l-p@h.4\too4too p-ph0p0p0*4@ \y zY y( zDYp-z0z0z0*x@i\; i; Γ`-X000*$@*l@; 1X;1;01x;1;P14Gͩ|6l^t#y)`y)\hhdv\L\yLk[<[4<MD*@xpMDxLM@``  `*"L0""00 0  P1`1p1111111110   @qqDq q @qqqq>     @  0    x! x! P @  @T @ @ $ $$? wu@ue EEA@@@@@@`@@ @@@  w@H2dH@HB 2dHd2 dHd22dHd2D@h@@`b0p0` lh``m> @ ` @(@,@"@   0    P P @  P 9@0F@4[@tj@x"BWcg9@F@g[@lj@p"9@0F@8[@4j@8"A| 2qZA0 9@TF@X[@j@"G\ G'G G  G\uG8 G'G G G8uS0xH{? k@k? x}dM|h? 9@0F@4[@hj@l"SN`tRh[vN{9@ F@$MPh[@tj@x"9@\F@`[@j@"*zSNXtvN{9@F@Mh[@<j@@"4Y 9@F@4Y 4Y 4Y [@<j@@"[@j@"[@j@"RspmRstmsxxs|x5r`5r\`ЁL^5r`\ 65r$`\xX{3lp3L#Iff[f$fP[T$T&"D"[@j@"@"9@HF@L9@dF@hwMBbA 8YHY̠c^Y4OHP8Sh PvN{¬PxЬD%bT\Bd[@<j@@"BXBX9@F@BWcBBBB9@4F@< c9cWc[@ j@$"[@0j@4"[@Tj@X"Vg0Yd627o1(8 3"$4\SA(tttD(;1SA$tP8\fhf:A ]8  PD5D$SNt9@F@7[@j@"vN@{[@|j@"vN{*@L)*@*@*@* @* @*` @*0 @* @*@^9x8],'@$@@k^9Z3YXZpY8gDw~Hd6TP\ltLP<^9x\]8'@0@@k^9Z3YdZpYD'8UdxPko,|xx,|x4T$\[%H2%6R):1RS*RP;R;R;R;R;R;R;RPdPQ*@{V@cVT`VV<7j<ViQVXiXQV`V`V``bedF]l8e|FeF]8]L.]]8 q ;Xb'obdx;404*H' ;44*<T;4X4*h'8D^d,^d,{]8$](L{]8$]L5a"a*@*@5ap"a΂h x*@0*@@p,ShS*(@*@H ?H ?H$?H$?4H?H?H ?H ?0,8Hp?Hp?\,dH?H?,H?H?zDl}lLl}lz` \ ~ TzH:apU::<:yp==*(=*:2W@=WX2W@=W,o@ U52W@=W2W@=W,o@ U5Tu+uu:.]u<uu.],o U 5   u ~q<NMj0(j$j$j(jp$j $j $j ( Cjp(*@ggbDg@btgpbbҿc0=<x*@t`{]$]`L*D@*@@tt*@*@*@@*@x;404*H;44*'T ;4X4*h<;44*Da_ ox (2'h'lUd@ "@ *h@DaN{]$]L;44*'8 ;4H4*X<;44*tD3-k1==z'zMLz&uUt4<M\L&uU&x0/{0k* @*l@*@*0@!1`'*T@*@*@$ #$s"P5 # #hU#=d=tX` *\@*@* @*x @* @*X @* @* @*X @* @ș0N)4&à0S)4&*@*@@*@*(@àS) &*@* @^9xd]@'@8@@k^9Z3YlZpYqL<'8U  +U @' U !=!=y)4_< o@x\d'UEut'xU  |p 4+P_ p P_ hpl p.2<;2`;2;2 62H262<3-k1P=2X622L1-V&xD-'-0V&x-V&xMx-8'-4V&x`p)Pt3pAb#b# -)3A)3A:0?j$:,?;,Q!id! tQ!id!t\$$4]4 [:\S=[Xv_M_M:\ S` I<`] :\S:\Sc2H`|!#prQp|(!!|!|0 ! ! |!D !3-k1=&4@1f $3-k1=x8;4D4*h&4@1 md" m"Q!id!xtP+e4)fa՜,f|aw|4IHÃSB&xÃDSBD&xj<ʻ1'1$'(ջ 0g  g( h._( oxt|( ( D.y)$͝/5Y8'4U_D oXx\dH'DU_T ohxltpuH~t`xslsu oQvdVrL]tdxtbtTbtb.tTju|+@bww |8w,v,|pv`?94 D !w'wiOYn Tw/P(SW#M-Gk$k<U0N)X))(I{L7l)(I{L07)D)<U0N)X)Pi("K.[iH.KP.[ih.Kp.(XI{Ld7h)H)))<))))$)K.P)l)0˥Aq, Q$G2Ly p;7 H1y ;7 1+Pr,u,@u 6+r.! ;+r,u,u,$u,uY DY J` HHY HY @Y Y HY Y L^  Y Y Y DY Y LY Y HY J` DHY DY ^  Y Y Y DY Y HY Y PY Y Y Y Y Y Y  ( | \} 2 H} } 8} 8o `*2 +drx dt} p8H >$D ;W L @6+trpW  7N dn pW  7N n pW h 7N n 34-k1D=XX &4@13-k1=R ,3P $&4@1P P p)Ptx pA # #ɓ -P ) x AP )x Ac2H`H M M{  L' 1\ 7M  0*x@ xUTܥ ˥h1'11 `7 d:b| |=5,P86 m"ښ \ m,"P<t4&uU&uUt< t&utU6 4i30-k1@=&4@1&4D@1H&4@13t-k1x=&4x@1|VDyTzVzĕTT\>4Vxx  ׊ sL׊ xs 4P   ׊ sL׊ xs 4P  B$ 5h 1 h9 )X 9 ) 9 D)38-k1|=c # (ul˥(T˥ <? HByc l.tpp3P_  yc P P_  'U ` dE'HUa '_ ox2' " 2'Hd` "` y)9!=up Dy)B$.D8.DZZ.D&.D.D.`D. D1L'xg93JYYLXEXE Z8 Z@11gcJYYJYYJYY| JY Y@ 0(P((L(P((x8x8 x8Hx8x8@x8|0(P !  l! ! T(X0(P !  l! ! T(X! ! @D((t(x(x84HD9o?<o?sD9sD9sx8dx84HD9o?<o?sD9sD9sx8dD9,sD9 shx8Hx8x8dx8\o{|o{o{o{3P-k1T=&4 @1$/X"EX-3-k1=&4<@1@&4@1BYYYY Y8 /X "EX - BY B4BYLY/Xl"EX -Y /X"EXX-X>Y Y\Y3-k1=&4(@1,3x-k1|=K|:+x^h.|Z2W@=WX2W@=W,o@ U52W@=W2W@=W,o@ U5HLsHsHsHsHsHsHsHslzlzl4zlhz0xaH Pڝ ڝ h 0xH iP i h }0N}4&}0S}4&*@*@@*@*(@}S} &*@* @/X"EX-F/Xh"EX-/X"EXd-/X"EX-X> [TϠ 4Ϡ\ 4Ϡ$ 4Ϡ( 4Ϡ, 4՛,՛0 Ϡ4Ϡ4Ϡ4Ϡ4Ϡ( 4՛p՛-@`!!!@I@@@  00RX0RX ),0 RX0 RX L1X1` 1l 1x 111811111 L,, 1x,, 1 1111111111 *PP%̅̅PąPąā^x  $&! Aiiiiii'% ``p`@``@ `@ ao@@@xxyxxyxyVxyfxyFxyHxy4 DPPPPSN<tSL dx|{3  $vN({Y@YYdW8WY[QSNt3"vN{[lZSNpt3"vN{9@0F@4hBBBIBX[@`j@d"Z[@j@"AT qmhIImp&I<YWcOPPLtvN{l)vN{_gYgYl_g$YgYYYAH A A |A SlA A A, BXٰBBٰBB9@F@ g$gt[@j@"o<1D@< \3X x3t=:;c<uB xD{<P4tbb$.(bizic4<mXl}Fr+LS +LSSADFrFtrFrHIPPxP{ t9@xF@|7\D@[@Xj@x"oAp YX9@\F@`Yll(0[@@j@D"o\PH[@dj@h"x|{ 9@F@\[@j@"o<|;D,\"@:k1=*l=\:1=,:BB=DT;BD=B<=kSl/)lpSl/kl3)l@l3)lXSl /)lSl /)l 0a48ZZ #a2ZtZ 2`1 mD"):g'4%86'8Uh *lD"Yx*[ *D"Yx*l[ *pD"Y'@UE(l <XX '<Ukollk$o|xhx$|$x2'd " _X ox08D.Ty)_ o x  ^<0^0h.of@9^| 0^0h.^0^x0^0^0^ 0^ 0΂L *@0@*H@S;S@*@S*@D,\`:k1=*\=L:1=:pB=<;B4=B=0zXz i Ti Ti i iz ol}ll}l*@l}l(*@zlp}l*p@#m0.pp83P@_D mt P_  8'<Ux 21 262 t 21262P *@*@&xH*$@,*@*@2,4q&x*H@*@*@* @T,*@*x@z28o/*@*@*$@*@*d@*@* @30-k14=&4@1w%x4&4@13L-k1P=,x&4@10}$- -S-$S-$45&iPupu<]DbqiT 9tn '\U9n 'UtPBiTiTtBt`B9`n 'U iD\P @E'Ua _8 oHxdl 'U'U<4uwd<Lш;lpp  p  p  .* @P{h ],d a'`mH&8*hr&6@-#<*@*@,˥A7,*@m7*@*h@7j$$$x<j$$<Pj$x$8$$$6-#:?d˥A:$1`1:`(T˥(˥P;404*X3|-k1=&4@1 3-k1=H&4@183-k1=XD 3 M,DlP yt ` y y +DL6-#``P@tt:? tгl  `p'lU E'Ua _ o x    ' U8'<UhE a \H^T=_HRa8 dR =oooooP h o $`&xp$p( i7iX_ oxE ))1SN4y)l'8U 9tn @ XE$Ex4<|X|d<Xx(TXxPT Y DY Y tY Y Y Y Y Y Y Y Y hY Y DY Y HY Y HY Y Y ^  Y Y 0Y Y 8N d:f  > $67N n > 67N n f 8pW  7N  n g d  >g $ Mg H  3Uh 0N g  > 6g HH d3> 6> 73-k1=P &4|@1Uh $N|38j |_si . vj Qvj Q3j Dsi G . ,i 0i 2W|=W2W=Wr\a4 ,o Ud5a4 X|2W=Wp2WH=Wpa4 p,oH U5r\a4 xt d u (u LWl1'1' 1wPP0=(xwP$0=,xmtEntLm\Em\ECn\RR#<L~Rt#<~i0iHiXih&iD&iH&iL&iP&iTrXGrdGrpGrGi0iHiXih&i4&i8&i<&i@&iDwHGwTGw`GwtG&i&i&i(&i8&iH&iX}Giiiiii*l@wP0=xwPx0=txwP0=x&iwPh0=dx&i&ip&ix+GnB t$t(IttnB+G+<Gi; Γ-i; l000ip;  y zYp- y zYz0z0z0 y zY4too-4toopt0p0p04Ptooi0iHiXih&i&i&i&i&iAGAGAGAGvRGʫ6^1vR0Gʫd6l^ 9*@*8@ q;;x K;H K; K( ; K 1@DeDe DeDDH@@ @@`@`DHPDHpDH@@!de@ @@ D,, 1p,, 1 11111111111 8 |1X1\1 t1$ 1014h`1 t1h`1$ t1D1x@8p1@8p1 |11111111111 811 P ", @ @ @ D@@@A@@@@@H@@@ @H@ @ H@@@D@@@A@@@@@H@@@ @H@ @ H@@@E$* $* $* 4$* $* $* $* $* $* $* $* $* $* @$* $$* $$* _$$* $* $*  $*  $* @H@H@H@H@H<L&L&L&L&L&L&L&L&L& L&L&L&L&L&L&L&L&L&  PRJJ : @     @TR $ $0$0$@@@@ @`@`@ )$U@H@H@H  @H dH@H@HH dHHH@H*(@ @ O/N-----)()))))))))))2L|p`i OTO , , @,@ @@A!! -)aTJ% -)aTJ%D @ P@ *,<,<B,i,?)t;,p1,x9;D)#!>G-n-0PPPPPPP8P4 Ph4~al4O|PlPvN{P4h4p44O4P$PhvN{g<Y0SN`tOPP0vN\{vN{_gYgYS0 Iox{« ݪt Wcl« S4 9@8F@@OpP`P<vNh{A P$vNP{[@xj@|"D#8AXA\ |#H"AA F@8Z#p"[@j@"Q`i<Y0PhhQHiY 8PPdph ppD   p .hp`p l zDG R$g,A ̤d R̤<ؤDi̤0Gؤ0i̤X*@ܥ8<˥,˥8ܥ|˥ܥD|˥*X@*@KHkMsqDLo2'd\ "\ KkLoL4oL KLkLoK\kNKLkL oKkLo_h oxNLoLoKlkLo^\:k\7{pE{\thv\hv7{E{\\\\^D,^D,^,^,{]$]L{]$]0L5a"a*X@*@5a"ad*@\\bD\@bt\pb\bbX0=lx*@xD h D24fˈq^p0 3.p83@pD 8 *@XZZZZZ ZZZZZZ*@@"*s"5(s"5"*0"= #"= #h h à8S)<&*@*\@$àS)&*,@*@șdN)&s*@*@;N`NC;N #s"5P #"*<NC;N #H"= # p p<~t @3@pP HpL p "y0 0 .4bXqL4bXq$ XAŋewpaewp a $`p p P_ p j p$ Dj\p` T 'U+U 5&_ ox P P (  U<Tܥhl˥VX]V]V ]Vp ]V]Vh]V],AhV]uw0PTtuw'2(uwP0tu\wdZEZ JeZZ, Zx-Z-Z>Pp"E:E[ =[ v:E 11=5,P864n  m"1H14n|UTܥ˥tWnt1@ 1n$ 8 , ^T&LM.9 Vf9 c_ oHxLT8h,8<,T&ttiO(0Jg siid >l d CT >\ ,>,C>|k`PtDdPtرPh t P tP PX t Ptt<<'8U``'|U'hUt t 'U(X(X'TUY DY Y PY ^ | Y |Y PY xY Y Y Y Y Y *@ XZZZZZ ZZZZZZ*@@y4Z zdcyZy_~'-4< -`< << - , <  < < ,o L*l-$l-4l-Dl-Tl-dl-t+Tr 0+r 6+r.! ;+r34-k1D=3 -k1= I (wlwl4 d wx &4, @10 &4 @1 u (u DW D ,J,,rh \rh |rh |\rh \kPkPklklkkdkkkkkkQQ JY Z@ ^@ Y Zd Z Zd  JY Z ZY(3f7W p  P_70W Pp_t  70W` D ./X("EX- ZL ZTZT~Z,~Z~/Xd"EX- Z ZZ~Zp ~& qYhZ~ZP~YBY< Z ~Y Y@/X "EX-BY, Blhml 4 4 a $ڝ( HڝL }8S}<&*@*\@=}S}&*,@*@}dN}&|~*@*@,`nB,5!P7*!<nB,Hj<  *@*@*L@*@* +*D @* @L+?*4@+H*@*@/X"EX-F/X\"EX-/X"EXX-/X"EX-YY/Xt"EX(-[K[K[8K[pK[XK[K[K[K[(K[`K[8K[K[K[hK[K[K[8K[pK[XK[K[K[K[(K[`K[8K[K[K[hK5 e/, UnӞ+Lp+<D1eH/ *,@*|@yLk[<\MDxL;tnBnpB@?t?,?nBnBv4R<Gʫt6|^vRGʫ<6D^vxRGʫ6^h  h d1l1t1|111111111144@1 %!J%!J%!J %!J@ %!J@%!J@%!JD%!J@%!J  1 1 10 1@1H 1X1` 1p1x1 1 1 1 1g@@0&L``9&LB@0&L@ &L@ &L B@ &L@@p@ @ @ B@@=  @@@ @ @ 12323333s3332232s29s2s2 32Ys233s@sXs@sFC@b 2dbb@b 2dbbH(             " N0@0  (, (, @0 0 K0@@x L@@ @@x@x."@@ `  ((((  @@@@@@ @@@A@A BABCJCJC BA  *  !0    $$  @PP @,<,<B,i,?)`,\1,d9)#--,`1,h9G-)d)#,<,<B,i,?)p,l1,t9)#--,t1,|9G-)x)#,<,<B,i,?)`,\1,d9)#--,\1,d9G-)`)#k2@2@2|1,B-D-d);,1,9)p#,!|>G-n-UXUUU,UUU4U<UlUUDUdUUU`4Y9@0F@PZpYT"Bh"[@j@"BB[@$j@("9@4F@8[@j@"9@8F@[@j@"9@F@[@j@"s]t kX Gk@; UL5 LSHkxGk; U5 LSWk?  k@$kR[j(444III44(4~al@4l-;l-;|x? RVRD[RDLx@Ds} ? ? k@kXf9@0F@H*pz|YfY[@0j@4"9@HF@P[@tj@x"9@0F@4[@hj@l"[@j@"9@F@9@F@L [@0j@L"LTOPP@P(vNT{¬xЬ%bBOLP<PvN,{9@F@[@j@"9@hF@ x{3(,Z@9@F@[@j@"SNHtvN{mX8}YXmX}mXD}SNtL0#IPvN{YF<rmX}mX}vN{SNdt? 9@PF@YF9@F@[@j@"\~,?@ @0k[@j@"vN{pf9@LF@`ff*z*(z*Pz|tYfY[@j@"|;0,HB B=B=11$1BC)k1,=*1B=1\=:|;0,HB Bt=B=111BC)k1,=*1B=1\=:':@:8: :\','@'''`9: ' :;Rd;Rd;Rd;R;R<;R<;R<;R;R;R;Rx;R|;R;RX;R0,HBp=B=111)k1=*1Bd=18=:0,HBT=Bp=111)k1 =*1Bh=1<=:u*@*4@ucD[,`[`6,,8'\u*@*<3-k1=*(34-k1p=**4*@T}3-k1=&4P@1T*,IX   * * @ u/ `*@**l@u/`*x@(G\ ?cDu/`*(@*t@*4 @* @SDX-S-S-S|-S-g0h?lC_ ox_ ox_D ohxlt#4#pB<#X-#B<#- T1#$B<# - 1#B<#- L 1# B<# -  1]\`$\0 "0 \$ ] " 3]0$z] " ]$ ^h "h Y^$^ " sOsOsOshOsOsOsOQ4 shO @sO  sp O2' "P `/2' "H m/j$h$l$<Dj$x*@$$j$$$h*@*@*P@*@Ou"O$ O(uPzX*@mD<&uUu$pYY@YTYP *@*@x;44*4x!x(c2H`x(c2`x,;404*Tx(xx(j$=5P6=5P6$$j$$=5P6Cjb $<$5t:w5:wv | w+0 b vP v Y DY Y LY Y vh yY Y @Y Y HY Y DY Y Y  Lb \b tM P 5M  0z>8$33.P3t3P3P.; t0;44*;44*tzlZZ; 0*@*@g ( G)  q (q   O   O   O   y y Dy Dy Dy $Dy Dy 8y DDy Dy Dy `y ,y dy 8 Dy / x*@* O^  Q!id!xtP^   c2` H=z  / L  L L'@UTET 3-k1=P- G, 86@/ O0 P+0 0 4+p- l`*|@ r0\ h d 5V = d |5V |= Xd $5(V $= \M 4~ M 4~ ă } "ă } " }  }   RM&?L d &d .d, .\ @sO,&/&kYlb>Yx kYb>Y kYb>Y Y,/X"EXx-ܽkY b>Y /X "EX -jp3JXc311k`x@8 *t@7TC+x^8r+^8xr+p^7C+^Qh78r+^Q7O/DaQ7*@@*@*@*@%< *@*x@*@(*@*@*t@* @vRDGʫ|6^1MD*@*H@xMDx*@*@h`@  $_@U```@`@ @AL|%HxUHU@U@U@@UrAQI @ @ @ @@ @ @ 0@@ @@ @(@$@$@A @ @ @ @@`@ @$ @$ @$(S         A@@@@@@  !" HH`H`He e e,<,<B,i,?)h,d1,l9G-)<#n-X-X-x,1,$9) )#_G;mGG\_G;mGGSASAXmGPGmGXG`SApSA_G;_G;SNxt? 9@dF@YFBY? @k[@0j@4"vNT{9@F@Mh[@j@"WY8`OP[@8j@<"PpvN{9@F@[@$j@("9@xF@|SNdt? 9@PF@YFBYt? @xk[@ j@"vN0{9@dF@hMh[@j@"YdYl[@Pj@T"(`7٧ [@j@"[@ j@$"[@j@"[@j@"A0 9@xF@|YxxT{xxP{[@@ j@D "S [@ j@ "0 9@pF@t9@TF@7`\[@j@"[@j@"toH|;H,`"@:GCk1D=*=:1=:BGCD8;B0=B =>p:>:Y Y XR`1 umRHumCZCtZ'8U"`"'U|xx0|x "t|x "P "P _ o`x|'UEKkL 6KPkMsq\KkKkKkLoL`oMPsVS qPxQ*@VSDMhsqlVSpMpsqPP$PhP^_][]8P^_][]8P^_`b q;P^_][]8]\[]8Xb'ob`hbpa7pa7pa7pa87^^ ^HP^t_]l[]8^P^t_]4[]T8 q;D,\`:Ck1=*=:1=t:C;B=B= ::55TATATAAAP_ P_ P|_ P _D  .Lt^,^,^,^,^,^,^L,*@*@$tt*,@*|@^,*@_ o@x\d'Upy)_l ox08'|UHy)&xd@˥A*@2f( 2 f ˈ8 D ˈ  ˈ  *@U8Tܥdh˥UTܥ˥XUTܥ˥$uuud d d d d d d d d dd d d dd d$5K5K$7U#"= #5K #|s"X5 #$U#0 #s"P5 # # # #"= #s" 5$s"5*(@sO3dd'TTj3Hd)P!3< ;< * @* @( V}l nB_0 oxx`h'U_ ox,'(U\ \   _P o8x<D$ " @$, " h$x "x $L " _0 o@x\d_ ox'UHH'U9n 'U9n 74^p _ ox'U   P   +hU DPa,ZxsHO`((Da^ET(Da ^|E, (Da D (FXws:0FXws:tt0pxp?<?<pp??1*P@11 \111'4!4 ;4 1 ^4D P^4$P˥TATc2P`P *@dh*@b,Pd98H11j$ ( Y1` $$Pj$0$4$ ><(Cɵ<%@1j$L1j$$T$$$) {dxG1{h|G1= {w |81 { w | 1_0 o@x\d'UE'UE_T o8x<D\@\@@'<U) 'UD ,^<,<~ _4 Ra   T 4 xE'p UP `k`Pt9n 'U9 n  aP 9n  [0` P[haTE[aE[3[3[Y D Y @Y Y  :Y  Y ,Y Y  :Y Y  P~. . r! @+r P6+Xr.! P;+trK  6r! @+ r>$>h $                  ] 4] 44^ T@4^ @4^ @4^ L@4^ L@PL_@ P _$ P_ P` _  . t / x! z M F] D @C |  dm  | A } PQ&x M F֮ |7. =g HH  |E i p ] %֮ 7. 0=Q g H `Ptˈtˈt|tt   ˈ  P`_ .PT_X P_ P|_ hp Tpp 3fp 3\-k1`=&4@13-k1=&4h@1l3 -k1$=&4@13-k1<=&4@1kYb>Y ZL ZTY/X"EXd-kYb>Y Zt Z| qkY b>Y Z Z g ?g`(3(^1'3xJ1$ 11 1* @Xc HHsH0sH4sH8sHsH<sH@sHDslHzllzlzlzl zl`zlzlzH0sHsHsHsiiii&i&i&i&ilzl zl0zldzihl  i i   i@D dh ohpl    i48 iX\ P$bP(bP ,bP0bJRx|gJRgJRgJRgP$bP(bP ,bP0bJR|gJRgJRgJRg[D<G[<8GGGG9iLMvRGʫ6^9iMpGj$I$ $I$ $I$ $I$ $I$ $I$ $I$ $I$ $I$ $I$I$I$I$I$I$I$$I$ $I$ $I$ i @ ` p x | |"|!|(|,|4~0 @ 1L 1X 1d 1p 1| 1 1 1 1 1 1 1 1 1 1 1G@@0800&. ĖǖI@** 0 0  (      PPPP"!P*P*k20202p1B,d,dB,n-22i,H?);,1,9)P#!\>k20202p1B,d,dB,n-22i,H?);,1,9)L#!X>+0}+N*Uk222(1B,,B,n-@2@2i,?) ,1,$9+0}+N*Uk222(1B,,B,(n-T2T2i,?)4,01,89AA 9@DF@ADv[@j@"ASA[@dj@h"[@j@"A8h3i8h@D49@F@Sli'ihB(B4BDh4Sl[@<j@@"~aLI4IIII444III4jaL K[@` j@d "g0YDgYYYAx NpA A At _gYgYgHY0BBBٰ4B@BTٰtBB9@F@gg[@lj@p"Lt.t.D~|h4Yƶ|ƶ(|.0xxl{x{ 9@F@\[@4j@8" l9@pF@t7\\X[@pj@t"9@0F@@|fYYO@fXOf,[@j@" ,"|!LTN{Nd{LNP{N{L^LpN{N {$LNT{N{SA Lx8xxA-R`ssaHssa__eF]8][]88%fT]8][]t8go^\:k\ehF],8^0 q ;;4D4*\;44*'t ;44*<;4 4*0*@Q tpweS;4D4*\;44*'t ;44*<;4 4*0*@Q tpweS-??(MM*8@M8M??YMM*@*@M Md ;4@4*X;44*'p ;4|4*<;44*,*@*p@*d@*X@*@7TC+x^8r+^8hr+T^8r+^7C+^3d8r+D^3dL\DLa3dg x*@*@g T$ <&x$ *\ @* @* @*4 @*d @* @*< @*@*@'U a_\ oxx| a`@,T~  3X-k1h=&4@1(z3-k1=!V|X&4d@1h!VX3P-k1T=&4@1z[!*@3T-k1`=&4@1Tt1111T1'T01'~l  ~  ~|  74C+`^8r+^T&i2'*X @* @* @* @ 9! =* @*(@*@yZy4_yPZ  L  :   L  :yX Zy_yZy_yZy_ DM D *@*@Daэ (  hi 11=5P6=5 P 6  M X'TU, y)E'U\'lUl XE9n y)y)pl}l t / ! z! z! Tz! z M F]  C  @ m  h rh ] %֮ $7. T=g H F ,  ] %֮ 07. `=g H i p d  Q (PT&iT& 9!= 9! =2' d " T&  iy)4˥AUTܥ8<˥˥,UdTܥ˥d0˥u4,C  Cl 0Ch-u$C?Lv,PR  1 1 1 1 101@ 1P 1 1 1 1 1 1h`1\ t1|L@<1181 1 181( 1H 1<81hdĭ1L t1lhdĭ1 t11| t1@8p11 11$,, 1P,, 1| 111111111111111Ȭ1X 1x1PL111PL1T1111|x01L1`($11($1<81B @ @ ` @ @ @ P P @ H @ @ H @ D @ @ @ @HH@U@@U@@U@@U@U D @%!J%!J*AT D*P%!J*A%!J%!J*AtAA 9@4F@HAvp[@j@"Ath3ADSAL[@j@"[@j@"9@hF@prd5rH`RrXr5r`[@j@"9@F@dr5r `}r$f5r`[@j@"[@j@"&0m@4f3V" SA_  YYҌ2 I*`zˎ@-D;SN<t9@XF@\vN{L[@j@ "+Hs[@tj@x"9@F@vN{[@Lj@P"vNt{٧ x${9@0F@49@LF@P9@F@h,BPB\Bl[@j@"[@j@"g<Y0¬xЬ%bBOPPhvN{F$r_gYgYSNdtSt gY3 7vN{lIPOPWP0vN\{\ 9@F@9@F@7Ih\,$[@<j@@"t[@j@"SN<t9@F@ 9@F@(Ip\@(ld[@Pj@T"[@j@"vN{#0Y@008ah+|hh#Y0ta,+|,h\Axh`AxlHEHERRX kX k11HRRB\\v\B\d\H\B\pv( \x \ \ B h HT|˥A8˥A_8 H˥PAP ˥A _ e,\xXxRumu,m * *X\ * * *w, *p , @N{]$]HL$0*,@`nBp??n,BnDB4,W\ ?Px_ <d.P_ p P_ l.ш;P_ p$ *H@*$@*@;4H4*`' ;44*<;44*`$\`* @* @șLN)T&*@àXS)L&*@*(@àS)&*<@*@șLN)P&*@* @ssK\=&xT3d)(3dsO'')d3ldls4 Or`t) P' *x])|t]S]i]j% c  i ]z |qX  'UE\ 'U  !=+U _ o@xDL_0 o@x\d'U9n _ o$x@H'Uh9n vuX|v0u8X|v u Xt |v u Xl |v u X|vLuT    T 'UEE'U9n 'tU 0',Uy)+y)0 l'hU0+_ o@x\d 'U 'U a `  'U$  Sj;2SWoj0S* @xWM x@j0uHupj* m< "u` Hu pfi( xu Hup30-k14= DaK K p@ $ p@ &4@1&4@1&4d@1h K XK p@ =50P46=5pPt6=5P6=5P6=50P46=5pPt6=5P6=5P6=50P46b6 |$6 L "L '7 $p7 " 7 4$8  " q8 $8 ` "` '7 $p7  " 09 H$9  " 3D-k1=˥c d# u4˥c # u`˥`˥3D-k1=˥c @# xu˥`c `# u@˥D˥F ,  |M pF֮ $7. (=g H L $E i p ] d %֮ 7. =Q 8g ( H ! z t ] C M Frh rh rh _ o x  _` o x  /7p (x0D 0p  w Gy)  Gy) /D 07p p l Zi iiiii i$i(i,iiiiilzl zl0zl\zXH\xH|lm ڝ lm 4  4$ <ڝ@ `ڝd KO/ oKO/  oKOT/ oKO/ oKOL/ oKO/ oKOD/ xoKO/ oO3jR#<~JRgJRgJR gJR0@gJRTdgJRxgJRgJRgO3j8O3j Op3jOD3jO3jO3j\O3j0O3j O 3jH R#<$~R#< ~R0#<h~R#<~R#< ~RD#<|~R#<~R #<D~Rh#<~ d \hHv  6`^M\hvM86^zt \( hX vz 6p ^\( hP v6^<<1 1 1L 1X 1d 1p 1| 1 1 1 1 1 1 1 1 1 1 1( 14 1@ 1L 1X 1d 1p 1| 1 1 1 1 1 1 1 1 1 1 1W@@@B@@ ل@P@`@@@BBB B!C ɄB@BB@0) 1W            0    e(5r`RrrRr rr,r@$r˂$ r  dr@RsmRsmsxsx5r`}rf5r``}r`fRsm5r`sxNajC5r``kЁ^5r`}rf0\9@F@LI[@j@"Sl9@0F@4[@j@"9@ F@$[@pj@t"@9@0F@4+<s[@j@"<<[@j@"OPPvN{PLpvN{9@F@Pi"Pi"!j!j\[i4.i [i.[i.[i..j0ih idiQ7jiiH @j0 ]@j ]}i\ 7{PE{TPtLPDtP8t@PtP8t p lpX3l.x ,.0"8"Hk@o"h'U"ko"kok oS@T-Sdx-S-<S-hSTh-S  -0  9 n ' U_ oH xL T _t o< x@ H gT hF d y)y)Ft y)_T o@x\dT 'Uu'U 8 X9n  ( ( _\ oDxHP_ ox   E'UE'dUy)_ o`xxrl(G*'pm],Lh| ], ' mLG'mPaHGa'maӲ; BfpYlг HfE-# fh# /# # @ff<'@UpE \ ^= 'U ,|^,~l4R@=l'pUaH a|  a| 0E'Uk<`P<t4y)  ' U ' Uy){3| tK| A } Q| A } LQ&xH} ,H} ,} RPi "Pi "Pi"Pi"} "} "} } 4~ 4~ 4'\U||'U  'U  'TUHXHX'U9Hn 9Hn 'xU#, m"T&<|i ' UL ' U 'P UT&4T&pT&T&0D 0p T&y)`2'd " 3 -k1$=&4@1kYHb>YT Z~X>kYb>Y &q\ &48 @1< X >Y kY` b>Yl Z ~ L+4 ڝ a  ,0 N ( N %,.a04 L+/XL"EX-tF/X"EX-/X"EX-/Xl"EX -XD> [Y/X "EXx - Y  Y i0iHiXihixi&iT&iX&i\&i`&id&ih&il}pG}|G}G}G}G}G&i0&iH&iX&ih&ix&i&i&i&iGiiiiiiiii,, 1,, 1`1x111111111111111111 11 81(10181P1X1``1t1X111((̰1 81 81 81Y   @      `  @ 0   (2@ #@ #@ #@ #@ "@ "PPPP@X`    l@  H  H  @d  @  @@@"  H  H  L@  Ni` i`pU @((` (((((( BATU( BATU( U( U( [@`@@ @@@ @`@@@@DBAHP[*S*@*@@@@@*@`@x@`@eHeLeBeeeBeB*eBeBIH@\@x@dk]'R0[R0LR0V|SR$\A\Ax]1R8aMmaMmSN@tSH 9@PF@d[@j@"O|PlP8\vN{PvNH{9@dF@h[@j@"vN{OHP87PvNH{Px{9@F@[@j@"0D ".9@0F@49@LF@P[@tj@x"[@j@"x{9@ F@348B\Bh[@j@"[@j@"HaMm9@LF@P_{h6[@j@"?, O8O\PLPvN{9@F@[@j@ "@KdK7 t7\|[@j@"([@j@"9@F@7[@`j@d"9@F@oXN*8@XtNxN|*@NXPNXX@XN*@Xh NXX*t @* @XXXXXXXXT˥Dܥ˥ ܥ@ t ˥  XXXXXXtXX,˥ܥx˥ܥ L ˥  KkL6K4kLt oOleKkOeLp 6K kK k2' dh "h K kLoK|kLoO_KkO _^4P^D_]\[]x8^P^_][]8P^|_][]8^ P^_P^8_][]8]P []p 8a a;4h4*wy;44*wy'` ;4(4*8w`y<;44*wyQtw0eS;4l4*wy;44*wy'd ;4,4*<wdy<;44*wyQtwe,S;4T4*lwy;44*wy'L ;44*$wLy<;4p4*wyQtw4eST0.*@*@g <Pt<>pPtPt8P(t*@*(@ˈ4DˈPtt&xˈPˈ4&xˈ ˈˈ(0ˈ ˈ0Lˈ;44*ˈ`h;44*ˈ$,' ;4P4*h<P;44* @'<U|2<2D L2'2' ';0=[[XRT  ', ^| m>4am>am>aqam>a>xam>am>aaam>$ a>\ aq am> a?am>ha?a @am>8am>pag@h68'U46< E` t  _ oL xP X _h ohxlt_T o@x\dT 'Uu'U \ X9n 4 _T T _T o@x\dT 'Uu'U t X9n L _@ @ _ o@x\d 'U y) y)'UXd$H m"y)+]4 N 0N 00N 0N  0N 0NT 1P1 0Cj b 1x'|K\ & Cd1D13-k1=&4x@1|d4!U$Z-,ZX&4@1 *$eׂl&)&$ q ,) ,) ,) n!\$ 9:\ ;t <9:9:9: \T T4( \ T4l :4 44 ,44 'T4 @'<U ċ,_ ox E  a@ 'U+U$ _Ra ċ|,h  L)U,NUhNU0NUNUNU\NxQD LUpNUN))Xhf () )K .Y DY ^ \ Y \Y H^  Y Y ^ ( Y (Y ^  Y Y \Y Y Y Y Y $ Y Y DY Y HY Y LY x\~'(-Y \Y PY Y Xx~'|-Y Y  8 P^ d<hl  ^ <  ^ <  (^ D<HL: 8 P^ d<hl:  ^ <:  ^ <:  ^ <<@Dh3N >$M $3t)>$$$.|3|.3.t3t.N NN |NN N 3H-k1L= aK K &40@14 a aK DK H p@ &4@1 ap@  ta&4@1@3t@)yZ T< FI =< 0F PLs= B= uY> `I =I =I = 6I =I , =I =I X =I =_ 0*@*@g <Pt<>pPtPt8P(t*@*(@q gq Tgq gq 4gq gq  gq gq gq h gq gq hgq gq Hgq gq (gq gq gq gq gq g_ ox_ odxLT@  E'U9!@=   X X9!d=kY\b>Yh X>YY(kY|b>Y X>YYD Z Z Z Z kY b>Y YTkYb>Y Y4H ! o{ o{ 3^CjPb Cjb 3J33  o{D *D@ݹ"*p@,4tx |i   H:L }7 `46Xc\6xc|op i op   (, 0iLP ipt *@*@*@] p l;4X4*p' ;44*<;44*<&d*@g AX *$ @/X"EX-F/Xh"EX-/X"EX-Y| Q@JQJQ JQ$ JQp JQ JQJQTJ/X,"EX-4PtopoP-p0p0p(0p0p0tookq`ep6JrwpH0p0topot*@*T@( tptt(/u0u0u0ut0u0ttvPeCu6zwwu<0u0thtl*@*T@ typ zYpt-z0z$0zL0z0z0y zY{esz6|wz0zL0y zY*0@*@iHp; ΓH-00 000; e6ځwh040; *,@*@;1;1;1;1;1&i;1&i;1&i;1&ivR4Gʫl6x^vRGʫ6^ 9 qX; d9 q;G|1DL*@x<`*@*8@ 1 1 1 1 1,1< 1H 1T 1`1p 1| 1 1 1 1 1 1 1 1 t1 1 1 1 1 1 1 1 1 1( 14 1D 1P 1\ 1h 1 1 1 1 1p1 PPUPUPUPUT`@  +0}+N*Uk22.88241B,,B,Ln-t2t2i,?)x;,t1,|9!>+0}+N*Uk22.88241B,,B,\n-22i,?);,1,9!>9@tF@BBAvAA |BBA8vAPA< 8[@|j@"1BBB[@j@"RsTmRsmRsm5r`sLxLr .PXt (5r`sx\r Rr<r.P<t $sx'xJ>id4|z 09@PF@T l2 [@j@" =` 9@F@=` H X2 \2 l[@|j@"[@j@"AA L #I,ALvAdvA hAh 3  I sI0 s`ASAA|SAg!g!OpOPPvN${j@kSx{9@tF@x[@j@"? 9@F@[@j@"dKdRl *umx *(1tR(um * *t,P *p w,x Y X>YXY/X "EXX -Y kYP b>Y\ X >Y$ Yl 3-k1=&4t@1x&Dq &4`@1dT3-k1=&4@1YTT3-k1=&44@18 d H0sHsHsHsHsHsHsHsiiiii<iiiilzlzlzlHzH0sHsHsHsHsHsHsHs&i&i&i&i&iL&i&i&i&ilzlzl(zlXzHPsHsHsHsHsHsHsHdsHsHsHsHsHsHslzlzl zlD zl zl zl zQ;AB2r:3}4K4&Q;HAB2X&60;H,1n1( r:43}4PK4X&;dM94t-5tCk6#594X-5XCK?B2K1}4K4&KH?B2X&60.LF,1n1( K41}4PK4X&qLdK94<-5<Ck6#594 -5 CN\AB2r[3}4K4&N\HAB2X&60\H,1n1, r[83}4TK4\&\hM94|-5|Ck6 #594`-5`CS IH II H IH IH IH0INH0IHIH4IH4IH@4IH`< @< @8 @@8 @< H@< L@n-P-P-p);,1,9)#!>n-}+N1B*Uk22,)pG-2H,B,-\-`,1,9.i,?)l,h1,p9)#)#}+N1<B*Uk222H,,B,- -,l1,p9.ti,?),1, 9)<#)p)#G-}+N1B* Uk22,)G-2X,B,0-t-x,1,9.i,?),1,9)#)#9@@F@Dcpt-;-;*$z[@<j@@"cXQ9@F@[@j@"9@F@[@4j@8"ataYH04SNtOPvN{PvN@{fpW9@F@-\;[@4j@"OPP vNL{_ o x(0_ /'UoHx`h_< olx_ /<'Uoxtˈt,t*@*0@ˈ*@ˈ@t*@ˈ dt=$*@ t,t * @ ZZZZZ Z$Z(Z,Z0Z4Z8Z*@*@```\`X``T`P`L`wiiiiiRi iwwHsiHsii@i0H@sH0swww0d'`U0'U 88 8` ` l Xl X94 n 94 n   999W1d'9,9{$1':L 1L ' 1 ' 1 11'T:,1<'`Daw6x(~zX0Z-b,P>2SxW"E:E:Ez a=[ v>  z a=[ vz(Zz`[!*d@3H-k1=5D#&4@13-k1=3-k1=ix#3-k1=&4@@1D&4`@1d=G 3l -k1p =&4 @1 =G Et&4@1&4@10&4@1H&4L@1PL&4P@1T&4@1&4@10 5xp) <F* *0L=:?0 =޴, B*8 8 F*X p 4,  qո X<\ __ ^_9:(9:9:0t <Q_|9 :$ 9 :0 9 :, : 4 ,4 '@'<U ċ,_ ox EaD '_, ox 4 _Ra ċ|,h  'U'U'UE'U'UE'TU9n 'U9n 'U*)X)Z)Z*)0*)*)<PttlP0t(PtPt|P4t,<aW @bCxW `tW gCiiW d D iW  0b @b Xb p3 >$b 3 >$33.P3 $>$$33. >$ ZZZZZ Z$Z(Z,Z0Z4Z8Z*@*@```\`X``T`P`L` wiiiii i i w wHsiHsii@i0H@sH0s w w w2'_T ohxlt_ ox_P opxt| P P P_0 ox$ P P_ h9 4 ` = a4 \B% \Xa\4o p# l t 8l F( { |:( { d: *@ d/7p 4 4/7p ; Kz  L ; LKz $ XL 0? E; 0Kz  (L ? $E}m@CmD)nvmDmDDmm@Dm4mDm DmHDmDn nnn! nn xq H4sHsH$sHsH,sHsHsHsHxsi8i<i@iDiiiiilzlD zl zl zT$1h`14 t1Th`1 t1h`1D t1dh`1 t1h`1T t1th`1 t1h`1d t1h`1 t1 h`1t t111@8p126@`(@!0 @ @       @ @   (    (H0 0 0$0$0 0 @0 0 0 00800 0 2rr000000I0I0H0@@@@0%@0%@ !@ @$@$@+0#4lM4)|}+N*8Uk2(2(2d1\B,t,tB,2D2Hi,p?),1,9n7<b7@i7XU7h\+0#4lM4)|}+N*8Uk2(2(2d1dB,|,|B,2L2Pi,x?),1,9n7Pb7Ti7lU7|\+0#4lM4)|}+N*DUk24242p1hB,,B,2T2Xi,?),1,9n7Tb7Xi7pU7\+0#4lM4)|}+N*DUk24242p1pB,,B,2\2`i,?),1, 9n7hb7li7U7\}+N1B*(Uk22)G-2`,,B,8n-d-d-,1,9.i,?),1,9)#)#gLY4ghYXOi$XxT{PtgtY|iitizg Yii`.iKj/j<gYgY_L o@x\dL 'Uu'U|  X{1 ||y)94n | y)_ o@x\d 'U 'UE9n LE'Uy) mh " +l'HUDPL6-#*@F8ws:dFws:*@* @*@Fws: Fws:xYkxzl*l @* @*@* @*4@4k`PtX$jP@t8iR jPP tH  f ;4><{$3{3{3qd^V3Y DY Y HY Y LY Y Y yZY Y ( z$cyZy_~X'-Y $Y  ~-Y Y ." Lvo *+pro *+r 6+r (6+,r \0+hr 0+r.! ;+r.! @;+Dr D  , t ` ph'dUhE@/ OdE'U 2X1+ ;0 +0 (0 |0, 61 5P- Gp- `' ' < & '  & ' @ ; P\5 x5 \5 (x5 l\5 x5 \5 dx5 \5 x5 @\5 x5 < Hc(< |5\5 ` x5 * @B< 5 \5 \ x5 ]< _l ox_ o4x8@y)_  ox_ ox _L oDx,4L L~X'-~'-1P~t' -H~l'-L"^~'H-*@~'-3PD_ _3s3@pD Pl_P_   3P@_ X3p 3fp  3H3h.4'lUE^$ y)^y)(^˥T^D˥A˥AT&4H`siii i$i(i,i0i4i8i<i@iDiHiLiPiXi`ihipixilzP5l e/ e/ 5 e/$ eH/| 5 e/ Une|/ Ӟ|e/$ @@@@@H @H@@@@@@@@@@@@D@"Q      @  T TT8 P&P&k20202p1B,d,dB,n-22i,H?);,1,9|;) #!>G-n-l2l2G-R0VOPPvN{VAWOPP0vN\{YlW0;BWGfVMOP PT|vN{bW8&0m@4pf&m4JrUDd3VL" PSA@_h  lm< m "2 Ҍ2 I9@0F@@|fY[@(j@,"|fY[@j@ "Xd"YhOf<YpOfD9@0F@@A |fY[@j@"Y 0tO[@0j@4""POf$xfE TZlC3$-k1(=E&4@14E T E   (  C(  CE  3 -k1 =&4 @1 1+01e/ e@/D d5h 5 e/ $5( d5h e/ e/ el/p Frt;44*wy\;4$4*4w\y' ;44*wy<;44*wyQH*@t0wePS*@*L@P_ 6^DF@pD 7W8 7W P_ 70W 7W bTKRTM p Rx Mc 7h Wl .s"t5s"5"*s"(5@"= # #$s"5s"\5t" *4 U# # s" 5  #( _ o<xX` 'U'U4E E'U , ^P ,^E'U8 'Ux 'U1\*@11l111,ֵL11'˥A``/Y 1 *4 @1d * @ ˥` A` ˥A*0@DTa*@ m"*@q^ 2W =W *d @D8 a m0"*0@*@*@ m"*@DaD a,oX U5*@ X^ l<pt ^ <,o U$52W=W0,oh U52Wh=W ^ t<x| ^ <$(p$@ "@ ? P$O?  "  ? $?  " @ $i@  " @ $@ X "X ]$ ^ " ]\X$\( "( JA $rB  " PP_T Pl_ P(_ P4_8 2WP=Wp  P_ oo m" p, .dph 0p\ [<*@vRGʫ068^9i@MvRXGʫ6^4MD x$G6^G*8@9| i M*L @* @111111111111111111111111+AA! @D@DDD@D@D@D@@DD@D@D@DD@DD@DD@D@DD^@DD@DD>@DD@DD@DDDDDDDk@`   ! 0 0 $ @ H( ( "  ` b hf[@j@"9@F@fV" )2 3SAҌ2 *z[@j@8"`3VH" LSA@_d  h42 SN<tçdYL"9@F@3<@txp{3|[@j@"S ٧ A\ |OPPDlvN{vN{x:$:E:::::::t::ծb$ EP : X :Xh :i E : dhE:x8x\A-|RT'}%2%@y%D2g'%(6%%T6aT'}%2%8y%<2T'x}%2g'% 6%%H6aRMb$ " X$ ( "( 0$N " q($ " $` "` w$ " R`$t0 "0 $ " *@o/ ;*@nB*t@Lu/ `*d @'  38d8sO/d{0pk*@0=(Gh\?cD*@*l@;4H4*pc2`1(1v `D$L64-#81P1,*|@1*@1$*t@c2`͒( 1 181 113D-k1H=3 p@ ( p@ H?J L3.N |NlN N&4@133$ -k1| =3 -k1 = $ p@ , HPs[<[@[[8[[`[ [ [ [ [p [t [ [ [ [ [ [h [ [[[[X[\@&*d O a,*< * X5*|)i5( i4qDpww@&A3 VvR4Gʫl6x^GvR\Gʫ6^PGvRGʫ6^vR18GʫD6t^ Gv RhGʫ6^*\ @SNHtvN{vN0{k_k_Lk_OPP0XvN{~_Y84A _l"__qSNLtAd _d~_HvNt{^~_ˣ0<ˣ@<*pzU @(p8P{`,<pv (9@hF@lA P0oF[@lj@p"tls",5 #`àS)|&sh*@*@U#*@¦7*d@¦7s`s"l5àS)&*|@*@* @¦<7*@¦7*\ @¦ 7NbL fP\tT*4@PturCurCurCur$Cur@Cur\C|q<-rPrPr Pr PrPrPrPrPrPrPrPrPY D Y 0Y Y  :Y  Y Y Y p :Y Y  zcy<Zyl_l~'4-Y Y Y L Y 4 7C+^qkYb>Y /X"EXl-8 r+< ^kY b>Y /X "EXT - ˥ A kY b>Y q BkY|b>Y kYb>Y /X"EX-X\t4x 4 4 4 a,0 aPT atx ڝ ڝ ڝ ڝ a ڝ  ڝ$ DڝH ahl a ڝ  0ڝ4 TڝX i  i i $ iDH hl  i  i04 iTX  =  ciic ciidctixi|cii.d4Ud4 ci icD ciic k20202x1<B,,B,n---,x1,|9.i,?)`G-p;,\1,d95)#!>)X;)X#!d>n-@'<U'U'U'U  X 9n 9n   44X<<< 7L^7 ^^p,*@&x*P@* @*, @*| @* @*8@*@*@*D@*@* @*@*@*L@*@*@*<@*@*@*,@*|@*@*\@*@D<&x!xF(bhT[ &   f4 2(&xwTM%TIj&x&x@ f f%I#I#%Jx x W ;y , |% (1.$. z< r \    ~   z zrD\   P~P (zl: Jf ?f ?H4sHsHsHsiiiiiiiiiiiiiiiii` id ih il ip it ix @@@x@x@x( x"x$ x`x x xxxs BU0CCB@@@OHP8glY`$P<vNh{¬xЬ%bB9@F@@hBBB[@8j@<"_gYgtYX047OxPh47P<vNh{¬xЬ%bB9@F@LxH{3TX@hBBB[@j@" @r l VM  DLar Tl \VM T э l( @r Xl lV x} 4p0[  T @ L d { L @ jT p  ب  m @ F- q1p'HHsH sH sH sH sH sH sH$sH sH sH$ sH( sH, sH0 sl4 zlh zl zl zl zlX zl zl zl zlT zl zl zl zl\zi4iLi\ili|iiii&i&i&i&i&i&i&i&i&i&iGGGG(G4G@GLGXG&]@@@``@ @@@@@@@ @`@@@@@S8 }h9@tF@[@j@":}tq9@F@[@pj@t"[@j@ "xIgxZ\xt{4 4A |A SlO4OTPDPvN{OPxPvN{9@`F@dA| 3O,PA  P|vN{A A4 [@xj@|"|A x{9@F@9@F@*R*R_X oxL'HUd'U | x  t PL Q*@, Q,*@` Q`*@QT*@Q8*@#|B<#p-#B<#-#(B<#-r$H  >`&>`%pg # B<# -% r$ 7$ C+, ^8 r+ ^P(tPtDPtN 0NP *@*h@0K& Cd[8)za=[` v* @K( & C0 dK & C< d1 1ur Cr$Pr$P=5P6=5P6Պ ) L=Y*|@-$* `Oa* * (4X2 @5\*|p)x |i5  q uw@f @ d0f&A3( |V*@OsOxsPptbOsPbOsPbOsP bOHsP@DbO|sPtxbOsPbPDbJPowP|0=x*@u40@wq wk@wq wk@wDq@wPq w|k@wq@wq wk@wq wHk@whq wk@wq@wq wk@w$q wpk@w|q wk@wq w k@w,q wxk@wq wku0PGGGG$GXGGGG(G\GGGG,Gʫ6^ͩ6^G98i0M ` #y ) `y` )*U`@@````@h@hPhHhHhXhؐhHhLhLh̐Bl̐hL  R R@ P P@ P h`&1`&1 &1 !&1!&1!&1@ &1 &1@  @}+N1B*Uk22,1,92H,,B,n-D2D2--,1,9i,H?)G-;,1,9T5!>);!\>n-gZ x${h484h`d4ISlOxPhPvN0{^OPP@PvN{OtPdPvN{OPP vN< {T 'U9 n  Q9hn ސhG9n [9n 4  $x'y)y)/y) y) :@ k5& 'tU'T&lX@T&r"p"C"{"){"){"H){"H)"{"){")"4{"`){"`)"{"){")"L{"x){"x)"{"){")"p{"){")"{"4 ){"4 )F0 ws:< PTtx /2Wx=W<y P o o;y @2W=W\,oh U5;y Mq Lm2W=W,o  UL5;y Mq \mMq m;y x Mq p m;y p Mq l m;y ty CMq xm;y } ,k ,s} "k s} k s4~ k s$ k s# rk `k hk ds$ k s} "k s| XA } Q$ Xk Ts| Kk s} T Tk Ts} P Pk PskY0b>Y< X>Y(?7pC+^8,r+$^( iXX>kY| b>Y X >Y Y/X`"EX-X>kYb>Y  X>YYYDYZ{>Y [yX>7C+^kYHb>YT /X0"EX-kY|b>Y kY b>Y /X "EX -Y8 8Hr+x^UTܥ˥kYb>Y ZL~kYb>Y /Xp"EX-kYb>Y /X"EXD-X\tx |  (, 0LP pt  i i i  YPY wP0=xYwP|0=xYwP0=xYtwPl0=pxYwP0=xYdwP\0=`xYwP0=xwP0=LxY|wP0=x*H@*@*@,S@$$$$$$$$@$@$$$`8$`8$h8$h$hB$h$hH$H$H$@$$@JJ@J$8$8$($($($@ $ $@$$@DD@30Q1B#4M4 n-4242t1B--v4n4z1B--i,(?n-,,$1,49G-0i,8?)<\;,41,@9k2221LB-,-P8 ˈ  * @*H @* @*, @* @* @*@@*@*@*$@*@* @ˈˈ(0*@*@*@*@*@*@*@@*@àDS)H&*@*D@sàpS)t&*@*p@sàS)&* @*@àS)&*@*|@àS)&*@*| @s$ à S) &à S) &*0 @* @* @* @àDS)H&*@*D@à0S)4&*@*$@à(S),&*@*$@àS)&*t@*@àS)&*h@*@sà( S), &* @*$ @s àT S)X &* @*P @s $xŜ$`ŜB Ŝ BD ŜB ŜtbH ŜP b< ŜH  4B ŜHBl ŜB Ŝ$`Ŝp< T`TLxPp   q^ֵ45xD)j<*@@4hAh2SWY:P< *p!@*!@1%'%y)4|,A  +U 9!=D  y), ` '\ U    XPi "3={L7{L7XPi@"3={L 7{L(7EE 9n k|`Ptx8'PU8Ey)_ ox+HUt `_ oxT'U _h o( x@ H  A( / A$ / Xp Vd_ 9 N yr\ a4 LrX\% LHaL4o T# P X 8l F( { `:( { H: X*p@ *$ @ * @l DF  a$ rש XR a$ rl Fש <R xU( t=S t_z Yz x9 |)  (T 0(< H(L 0@ + 0Yש hRp40rqqkrqq,krhqrtqqkrqrqq4kr@qqlkrqrqqkrqr(qqTkrqrqqkrqrqq<krxqrqqkrqqkpP0 a ('DUa$!p=Ea a_ ox`\`p`a\ aP  a!=aa'U<E,L^p `  aH`o{dHO(!o{$  o{$ o{x3^Cj(b| Cjb 3J3t 3  ! o{L  o{< ,    8<x|     04 iX\ i i @D04 $pt`dPTlm lm ڝ ڝ lm w8<w`d4 4 ڝ 4 4  a$( dhڝ ڝ +siPx{Nffx0{<  @5$(9@hF@lx{iHddI[@j@"[@0j@4"[@tj@x"A [@j@"OhPXPvN{A8 9@,F@0[@dj@h"H<*S OP$$PhvN{OPPvN {9@F@[@L j@P "+ s D bp ٧x 6 x8xhxxxdxx|'xP|xdxP|xPP|x|P|x|x|x|' |xx x'xD'Dx *@*0@\DaP\DPa* \ \D a'\ ( |L(@ ? c Dtu/|`(GX\?cD*\@*@*@*@*@*@*@*@(*@*@*@))T*@*t@\Da*@*D@pT*0@*)'*@* @(4 G \? c D0 V rV M*h@*@*@@*@*H@*8@z2*@'T y)8 T&M_ ox,H^y)Py)d +p++_@ oxxy)@+y)h "'"U"'`"U"'"UT&""i#'#U&+4ixi, -GQ!\id!t< o{@ 0 Q!$ id! tx  o{ 4   -GQ!<id!to{ Q!id!|tXo{ D  \  t $  L   @   h    d  0    0   |     <   \   = a4 `B `  a`4 \: <: Yz :h (S _z8 5? 0 :F $(D L: L*@ Yzh ( S _z F $( l DF  a$ rש XR a$ rl Fש <R p9(|N yr\  dV = Y 5! }  @( T h(t ( 0@ +ש RTpX P_ p p p P_ p P_ p3<>p   P _ L pp PH _L  p  .i t i (  / m i \/ i  L  !  z] Cٸ Srh   T M P F PM LF M F  i m i  xƹ m ƹ  H} ,n H} , z} } X"} } P"n P} ," ,z4~ Xٸ <Srh \ P@ P! ! k t } P "| A } Q` | K} $ $z} Pn P}  } T Trh Q;AB2,<X*3tD3<X*3tD3=:2$;H,1n1 3,D3094<-2|$|7,1n1 ,1n1  r:L3}4hK4t&}4K4&94-5C94-5C94|-94-K?B2,YMX(3tD3YMX(3tD3M82$.LF,1n1 3,D3094<-2|$|7,1n1 ,1n1  KL1}4hK4t&}4K4&94-5C94-5C94|-94-N\AB2,]X*3tD3]\*3xD3 ^:2$\H,1n1 30D3494@-2$|7,1n1 ,1 n1 r[P3}4lK4x&}4K4&94-5C94-5C94-94-40qikqqi(kdqpqikqqikLqXqikqqikqiTk`qikqikqi k@qi|kqikqi kT0#u@`@PP@HDB T& ZXi8 ('$U|^  'U^ 'U  y) ' U ED  ^|^^^T&p0u0Hiiiiiii<iiiiii i$i(iiiLi,i0i, i0 i4 ii&i8 &i< &i@ &iD &iH wL GwX Gwd Gwx Gp|q9|kp|q9|kp|$qp|0q9|\kp|q9|kp|q9|kp|4qp|@q9|kp|q9|kp|q9|kp|<qp|Hq9|tkp|qp|q9|kp|$qp|0q9||kp|q9|kp|q9|,kp|8q9|kp|qi4i8i<iLiiiii iDi$i(iii ilii0iii i i iL il&i &i &i &i &i A GA GA GA0 G@L2  @L22! @L2@L2@L2I&SL2 &LI& I&SH2!I&SH!I&SHI&@L2  @L22! @L2@L2 ! @H ! @HB 2! @H@  < < d2= d2= d2=d2=B d2= d2= < < < d2= d2= $)$)B$)    d2`  5p*U1Bn-.) ;) #!>1@Bn-#4M4 6DD36(K,1,9)$0;i,(?,|1,9i, ?)#!>, 1, 9n-P .P )\ x ;)0 #!\ >) #! >ֵp P_ |p p p P_ xp P_  pl3<>p  P _ 8 p\ P4 _8  p  .2lf2f2f2fu20fu2fu2 f2D f2 fKL=2fuhˈDHˈˈˈ ˈˈˈˈ\`ˈˈY DY Y HY % T Y Y hY Y Y 8Y Y XY Y Y ,Y Y L Y Y Y ( Y Y T Y Y h Y Y Y Y Y Y Y Y TY Y \Y N Dyr4\ DaD4   r\La4 : :! }p (:h ((` $ P 5? @ 0 p:F p$( : *8@! 0 }` h ( (,  ` F  $($ H4sH$sH(sH,sH0sH4sH8sHHsH<sH@sHDsHHsHLsHPsi, i0 i4 i8 i< i@ iD iX i\ i` ih ip i| i iiiiiii   8<}X7\`      @D ihl i i T D,~+87T*@y)7,'(U*~T@*H@_ ox$8|  5&#_P% o%x%%T&T'r)_* o*x**r$,c2t`B$.D*@.D*$e1P'\1<'H1'(=50P<6=5xP6=5P6=5 P 61 'x 1 ' c2`jp3-k1=&4@1.D4&Cjb CjbH op op i i op  <@dh  i  $( ,HL i i  5!7*!Hl5!v6, 7*!T7(*!*@nB,* @*@* @, *H @, *P @* @v 6 * @RK!P*`@*@*(@*x@n,B,*8@  I I I I I I I I I H$  H$  I 'U44 4 (( (    8  h            +   ]    ' U xHxP88||lll|l|$$$|xP$|x||w ,w ,kkxLxRRT1t \ 1D R R ˈˈ$&xH*@^,*l@*@*@*h@*@ˈ*@*@*l@ˈ*4@*@ˈ ( , y Eh $ * @* @* @* @^t,^t,^,^,*@* @*t@Y DY Y PY Y <Y i hDY hY y4ZY 4yZY  zcyZy_~X'-Y  y ZY yX ZY  z cy4 Zyd _d ~ '4 -Y x | Y Y Y Y  Y M 3t)>$N N87N n jN x8T3l.tT)l3N M l03t0)tN :GO :O d EO CGO $ :& qO EO LCO EO CO 8EO CO EO 0CO EO lCiiiiiiiiiiiiiiiiiiiiiiiiiiiiiilzlzlHzlzlzlzl8 z$!5!C!v`6d(5!7*!H85!pv(60$h5!8D 5! 5! H 5! jT <d v 6 j < j < r4qrpqrqqkq0_qLkq_qkkqeq_qP_kqpeq_qkqkq_q_q4kkq\ekq|eq_q_q_q_kqeq<kq\_q|kq_qkkqeqkq(_qD_p`0p0p0@w|q@wq@w4q wkv _ w<kvx_ wkvev_v4_vTevx_ wk wkv_v_ wkv@ev`ev_v_v_v_ve w kv@_ w`kv_ wkve wkv_v _up0u0uH0p|4qp|pqp|q9|k|0_9|Lk|_9|k{e|_|P_{pe|_9|k9|k|_|_9|4k{\e{|e|_|_|_|_{e9|<k|\_9||k|_9|k{e9|k|(_|D_z`0z0z04qpqqik20_iLk2_ike2_2P_pe2_ikik2_2_i4k\e|e2_2_2_2_ei<k2\_i|k2_ikeik2(_2D_`000B8OXPHWctP@vNl{9@F@ c 9cWc([@xj@|"h Bi'iB<BPi\S 9@pF@t c9cWc[@j@"i49@XF@\ ct9cxWc[@j@"s" 5"*Hs"D5$7U#;N"*,"**h@NC;N*@*@*$@*t@*0 @;N *0 @;N *8 @* @$ 7U# 5h K *@s"5*@*@NC;N*@z40p|q9|kp|(q9|@kp|qp|q9|kp|qp|q9|,kp|hqp|tq9|kp|q9|kp|q9|4kp|Xq9|tkp|qp|q9|kp|$qp|0q9|\kp|qp|q9|kp|q9|Hkp|Tq9|kp|q9|kp|q9|0kzx0;444*LrqqkrqqkrDqrPqq|krqqkrqqkrPqr\qqkrqrqqkr(qqTkrqrqqkrqq kr@qqtkqktookqeJrlwqlkqkJrwp\0rq@'<U|88( @ @8pXp-X8--$!$?AbCP"XXG-  K8` A`   "  -, ^8 $s"5T$`7U#ds"(5"*H #s"85 #p$L7U#T # #LU#s"5ds"p 5s" 5 s" 5 " = # " = # $T 7U#\ =  "= #T  P  T&,'U'U'4U'U'LU_\ otxx  al  D  ' Uy) T _ o x  x P + UF\F`(ÉJ'3x-k1=g&44@18ll&4<@1@qFzÉJ'3-k1=&4@1Cd(ÉJ'(ÉJ'38-k1H=&4@1ep 3, -k10 =&4H @1L l 3 -k1 =&44 @18  (t'pU_ o _ o_ o_ o(x,4_ o_` o|_H o\x`h_0 oDxHP_ o$ 0  _| o    H4sHsHsHsHsHsHsHsiiiiiiiiiiiiii i i i i i i i i iiiiiiiiiii&i&i&i&iiiiii i i i i i i i i i i i i i iH iL iP iT iX &i&il &ip &it &ii iiii }PS}X&*@}hN}l&*@*,@}N}&*$@*@}S}(&*@*@=~},N}0&*@*@}N}&*@*T@}N}&*P @* @}L N}P &* @* @9` x ~ ~L=@= wk wkzww w4kv_v_ wPkvp_vev_ wkv4_ wTkvev_v_vev<_ w\kv_v_vevev _v@_v`_v_ve wk wk wkv,_ wLkvle wk wkv_zw4wzwhw11*@tGʫt6^itMiMGʫ6`^ 1G6^G6^41dG6d^G6^*@ @ 1D 1D 1 1* *  1 1* *,*X*X41**( *, *P _$ p P _ p TPX_\ (pH P0_4 p  P _  p  P _$  p P _  p p .Pt_x 0.. J @RR@@@@@ @R @R @pR(%,*%`B*%`B*%`J*%`J*%bZ*%bZ*%bB*%R@*%R*%R*%R(%R*%a(%R*%b*%R9@F@Mh[@ j@"9@F@MDh[@j@h"*z9@F@Mh[@j@"9@0F@4M`h[@j@"9@F@Mh[@<j@$"9@hF@lMh[@j@"9@F@M h[@Hj@0"9@lF@pMh[@j@"k_4`fk_SN(t`*`zvN{OPP0XvN{OPP8`vN{~_9@F@ ~_L[@j@"#Y|hSNtPvN{k_( k_ ;` B~_ k_ SN t~_ vNL {;VA@@@@@@@@@@@@@@@ @@@@@@@@@@@ @xxx @x @x @xx@@@(@(@ (@'@@@)`)21p 0p 0@ 21p p 0p21p(21p(21p (21p (21p(21p D@@@@0 @ p21x(21x2qx21x)`2`2`)r `@2\\\\\\ \( \0 \8 \@ \H \P\X\`\h\p\x\\\\\\\\\x\|\\!\"\#\$\%\&\'\(\)\*\,\ -\.\/xTxH8||l8xXl8x|l|l||||x|xt|t|w,w,kk  T   R R l 1  \ l 1 R R8 t m"p p p 7@Wl @p\ 0p4 7W 7W 7W  p  p t p x p  p <p@ Tpp DpH p 7W .H4sH sH sH sH sH sH sH sH sH sH sH sH sH si i i i i i i i i i i i i i$ i( i, i0 i4 i8 i< i@ lD zll zl zl zl zlP zl zH4sH sH sH sH sH sH sH sH sH sH sH sH sH s&i &i &i &i &i$ &i( &i, &i0 &i4 &i8 &i< &i@ &iD &iH &iL &iP &iT &iX &i\ &i` &id lh zl zl zl zl8 zlt zl ziiiiiii(iiiiiiiiiiiiiiiiiLiii ip it ix i| i iX&i &i &i &i &i r Gr Gr Gr G)@@@`@`@Hp@Hx@`(```````@```I@I@H`@HD`@H`@H@Hp@@Hp@@HxàPS)X&*@șhN)l&*@*,@șN)&*$@*@àS)(&*@*@$ș,N)0&*@*@șN)&*@*T@șN)&*P @* @șL N)P &* @* @wf` K  L$à,S)0&*@*@K=0'|U0'U'U  'Ud'pUd '0U Hp x '| U y)l y)l  ' U 94 n '@ U94 n 0 '@U0 X'UX     64-#@p p p 6p TpX p4 Y 7PpT U( TܥT X ˥ 7( W0  p 7 W(  p  p p p p p p .ekH`PtX_ ox_   +,Uy)4H'DU`  /T x /x  / /X/dx/p//,ox`h_8 ox8 8 A</{3 0 @0@@ B@ B@ B@ B@ $ B@ R@B )R@ $ B@ B@  $ @  $ $ BPPT ,T^_ o,xD x'tU 'U 'U( \'XU_ ox0 a _ ox, _ ox P _L oP xT \  a _4 oH xL T  _44A SNtOPP 4vN`{`A _DPdPP9@F@[@ j@"a`tadYhWDY;`H BDa4 KI$I$IHI44TaXjalK[@j@"9@F@[@<j@@"~a~_~_vN4{9@0F@4[@hj@"[@j@"A@ Txx{T9@F@x{3[@j@"9@F@3[@j@"9@$F@(A@ IçYY"Yx4{9@@F@D3\`BB[@j@"*Hzz*@U*D@UD&uUU86t<{Etl<U{EtT <U{ EtD <U { Et< <U vZ&u U&uUU@UUPUUU(UU&udUDU8UUtUzUxUU0UUUP2q4kqkqkq_q`_qkq_kqeq _q8_qkq_kqeq_q_qXkqx_kqeqkkqeq(_qH_kqheq_qkq_q_kqekq4eqT_qt_q_q_kqeqkqkq<kq`_qkkqeqkqkq_p$0pX0p0 wk wk w4kv_vL_ wkv_vev_v_ wLkvl_vev_v_ wkv0_vTe wtkvev_v_v evD_ wdkv_v_vevev _v,_vL_vl_ve wk wk wkv_ w8kvXe wxk wkv_u0u<0u09|4k9|k9|k|_|`_9|k|_{e| _|8_9|k|_{e|_|_9|Xk|x_{e9|k{e|(_|H_{he|_9|k|_|_{e{4e|T_|t_|_|_{e9|k9|k9|<k|`_9|k{e9|k9|k|_z$0zX0z0i4kikik2_2`_ik2_e2 _28_ik2_e2_2_iXk2x_eike2(_2H_he2_ik2_2_e4e2T_2t_2_2_eikiki<k2`_ikeikik2_$0X00 4 ;y <.)x /2W%=W@rl\Mq m.)x 8/2W%=Wr<\Mq m;y Mq m;y  Mq T m;y Mq (m;y Mq m;y Mq m;y TMq m;y (Mq m;y Mq Tm;y Mq m;y Mq lm;y lMq tm;y Mq Dm;y Mq m;y X!Mq `"m;y "Mq #m;y x$de,xSX'UPP RH$RR %#L "  <X<4 "P * Rum 1$  RL  u mx *  *xw,l)x:).)>):). Ax -!R!T'"}%"2^!"!g'"%#6)"'),#>)<#:),#.)d#>)t#:)d#.T'$}%$2^!%!g'%%(%6)H%')X%>)d%:)%.)%>)%:)%.%P'y%8'2)t'.%'y%'2^!'!%'%'6)'' @@@@@ @ @ @ @x @ @ @ @@@@  x@@@x@ @xx xxx@x@@@ @ @@@x@ @ @ @ @ x x  @x@@@e@@e@@pe@@p@@@ @@`@@@@@@@pe@txp{ST Px{i9@F@ɪ'i[@Pj@T"ݪ YWci9@$F@([@pj@t"çYYIe,B0`.l79@F@x{[@j@"i Y 0T .` 7 [@ j@ "[@ j@ "p 79@x F@| i [@ j@ "0, .< 7h ç$ Y $ Y, -$ aç0Y  I@ PA AH dPPB9@F@[@j@ "B\0p.7O4P$PvN{0T.d7OPP8`vN{[@j@ "i00d.t7BWc "OdPTPvN${|"[@j@"i$WctOPP,vNX{BWc "OPP@PvN{iX1`G GGGGGDG8G>G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?GGGGGGGG(*G(ZG(*G(*G(G(*G(*G(*G( *GXHX>Xl2XpEXH)Yp#X2XE(Y(g>Y TYkYb>Y YpYX2X EYY, v>Y Y Y XD 2XH E Zh Z( 6Z MZ$ X 2X EcZ| i}Zl>Yh ZH Zp ZtX2XEX>Z~Z:>Y Z{>Y ZpZI>Y< Y$#[y [7[7P[1X,2X0Eh[[YXT2XXE[q>Y@ [l9[ X>Y\ [Y $ .\%D\(% [,%X%2X%EY\p&[&yX'2X 'Er\h(N>Y( \(D\) [)\*\*X +2X$+E\l,0>Y , \,Z-~X-2X-EP[h.1\L/oXt/2Xx/EcZ/i]T1%>Y0 ]1 [1Xl22Xp2EYh35]$4h[L4X42X4EMZ5N]6S>Yl6 e]t7 TY7X82X 8E}]8 Z 9X|92X9E]:]>Yh: ];>YX; ]<?>Y\< ]=>YL= Y8>]d?5>Y? X?E^@>YA EXPB-%^0CTiiiiidihilipitixi|iiiiii i$ i( i, i0 i4 i8 i< i@ iD iii i$i(i,i0i4i8i<i@i iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii!i!i!i!i!i!i!i!i!i!i!iti<%i@%iD%iH%iL%iP%iT%iX%i\%i`%i4*i8*i<*i@*iD*iH*iL*iP*iT*iX*i\*i(%i-i-i-i-i.i.i.i .i.i.i<4i@4iD4iH4iL4iP4iT4iX4i\4i`4id4i-&ih4&il4&ip4&it4&ix4&i|4&i4}4G}4G}4G}4G}4G}4Giiiiiiiiiiiiiiiiii i i i i i i i i i i i iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iiiii!i!i!i"i"i"i "i"i"i"i"i "i'i'i'i'i 'i$'i('i,'i0'i4'i8'i<'i,i,i,i ,i$,i(,i,,i0,i4,i8,i<,i@,i01i41i81i<1i@1iD1iH1iL1iP1iT1iX1i\1i46i86i<6i@6iD6iH6iL6iP6iT6iX6i\6i`6i<i<i<i<i<i<i<i<i<i<i<i<&i<&i<&i<&i<&i<&i<&i<}<G}<G}=G}=G} =G},=Giiiiiiiiiiiiiiiiii i i i i i i i i i i i iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii ii!i!i!i!i!i!i"i"i"i "i"i"i'i'i 'i'i'i'i'i 'i$'i('i,'i0'i,i ,i,i,i,i,i ,i$,i(,i,,i0,i4,i$1i(1i,1i01i41i81i<1i@1iD1iH1iL1iP1i(6i,6i06i46i86i<6i@6iD6iH6iL6iP6iT6i<i<i<i<i<i<i<i<i<i<i<i<&i<&i<&i<&i<&i<&i<&i<}<G}<G}<G}=G}=G} =G U UUUUU5ED"P*Tضmmmm۶UU$II$ :/,f.00!!C!C!* RU0DH1I)I $H$!!E8H$$Ij1)%IF&~<b$@F # A I $ATUUUA$U@H>`+(i' Thl۶۶mUU XUU=X53333H%ADDDDUUUv IA*2%LCMS*:$#; Z9@ $I% $b``Ubb bEIDH2{mj0|`PU [_R I)d @ y7Ke,Jj*2 tKDu1d$ UI )I1d U)rEJUb" RU<UUUZ S*# jj.K@Ob&IIae'H  0eL3UUU0)e24Jeb6Jes `  AA$EHTd`L$%!r  I@u*A* U]W(+IkZZaa$EJAJAA A!D!HjUUUUUM 'I$ $ U)U& IUJ*UU% U >Ud J*UUU eUU<) (U )Ib$%IHL$H$$= UIU@Bk +  ITS$II"G! @ %Z@@@I&" $a!8E 2 R?  B 4I& Ab U0D`O8 $$ V#L(T&T&    |HUMI~kk-kH&*rTUUURJ)RJ)!C !C D"H$?)\0HHB!B! """ $ H$A$0 $0qJRT*RT*Jp 3 TPdfffc11cUUUUZkZkTTB_&)Q)?&zN. @((((dYeYYeYex"GpxaTTTTTTTTbҡ_PU 1d eYeYeYeY!C 2$!C 2dH.&LbɴU( A%!JUI$I$ZkkZUUUUUUeL UUUUU$I$I%$I$M &@ @ @P( P( BP HaZkVr,C    mD?)@k8  P(A?   X$ dAdAd 1-lmͫ7d<>[cU ]@V``x|z XZN"Y{}PTT`@/XhxT`¹`¹  @ @ @=@=(8HTs"@21@U`` @ 'P@@x(8HXhx>linuxv2.7.0ZE9E9c m3@%e'%-$!I2JM\cn?J[<L:n?n?*.@@@@@``U ` ";8k 'g'w(4$@V`````````~́t w(f  ``Voa55>`$@V xV&|37 3t-- Te O) u [@#B%I( 8| *)v g W&,}e -IA,7+0z(#0Y2$~1b+m,߉)2$12$X&j'N1) #X&\*Z)X&x|TTҕ J7N:Kc="< A h c=04 i DZ E_ *t^- DDw : ҆ @.NM۹`?@/E%-.5 3`>88=E%Tݳ/c{(7  /47-*6P){(x0t.4$ˋ))!#dF% ',E .>5=,̥S,c>uez>[Cj>!BMu@0s5"Pvdz.%-X sT`¹`¹`¹`¹ `¹(`¹`¹`¹`¹`¹GӔE"kC/YO:Cj "*O1NI6$W0k ͗ :k ڗ  :ފe)%"ƞ6$)ڝGU;G6714@XA X `  @X xɮ 0 X @ @ P@ X@ `@ p :  @: 0 `: P@ @ @ :@ `% % % %@ x @  8 X@ @512P:,65 3H%v@Fs I9U;~67*SE7$C}(H%x@867}S.@8I9C_2?m'H% !i"#Sa"j>Y 11*}(27$QH"*nV;)AP:5V^<)F>@;I%0 vq?PWq?``p&`xɮ&&V;`/p`/5 /-"²(ws Bw}(L*7$?$!Wm##@dSYd-I%E!rd }(=+/vw````````Y Y %9 Y F.h6 q-wk 9 ?RY @8_z [)-,67C ~(Y,,6 v*t. A8M)!d"y"h+5n-.#77"EiNvSHw@\~A*;k> Z )J%J%K/J%[~(+z/X0ʝ*+~(w~(}*/?d=-J%-7$^<[&W;!ZW; !"fU^<[&yk>#"E"~(~(5,Z.G15.2//HD g"##Tsn)n'(V,!A8$3 p!Gdস! 4!H.l Ɖ 8$*!*L%ͽͽͽͽͽͽͽͽ3 +Y 5,,ڶu]&y KlM%W; X;f{  0yQo.f4f*SD*S l G[  { ] BSZSJyb K2R2!m NȸOO)M/)/?/x1-6S Mx@k/oFqETB8!!5@A%D> X;p2ݽ2ݽ2ݽ2ݽ2ݽ2ݽ2ݽ2ݽ822<1 1 k[ d m Z @9@4zNzjU* [ )0.0-0{U! Sr?L&#>I:\ D@Up`p``p```p`p`p`3 } :Dm\ II=/6{1|LZVh'# V|k"5۷+P%`/ظw} 9h B VN n n y@W Q:(#)# =$e=Ѿ, }yF!]qJWpZ} T! =$a&?!SN? w w w w w w w wC*#2WM ] b&yl@xx@xA-m>i2ةĽӽb  J D8~`OP`(@Ѹ`j`ѸkC !M`!#0(`¹`p`@2`&Xh@ ( 8H Xh@ @r x`$ L $ l $ @@ `$@ x$ % % @%@  ( H h@ , Nɩx,@`/`dLM`/M`/| ``h` BTস ?9 ͽ0ͽͽ2ݽ2ݽH2ݽ`;@1ڿ`;@-@ڿ;@0ڿ:,ڿ`=(1`/ w w w on`nи Ѹ ` l,c#7w޷6@ixJyh-JжLO-@reN@,r9c@,`n*kL@,`:V4AP4ȜJ:4 H=4kQ94`-2# M)3A{w&:P밎#`~qVF l#`C3 #`gz^Gq51Z@,]+\F@5@"9@5 ~Z. D  ǽD3#>bwLE/#>gFT7/#p(].#`p4# &6@?ޭ.# .Cłhv4# [?s$i.5`V<.@(@`` U @#E$#@wTk,# >7X>#Fg#@w\kL|y6 :nU5 =Kg L#8(# "鼸 #"{w 6:i ?5~KH4$Qwihs$R!r#@`> #@T?] B61Z#`UF;6`V<.h#G/Z6@=fT#`:}\Z#.Z`< d݀xY< d݀lY`<`cXc€S<`cXc|S`<c"ƌU<c"ƈU`<c;R<c:R`<YpR<YlR`< _MyS< _MS`<pl+ ;P<pl+l:P65' 6\%@&A Hx\'_l[@)W)E[':"\@)4TY\#@f#4x\ ((7Y|{[#"%&T2q5JC0[(<@ @# z#g}vz#@{wz# =V^-k#x鍨C^##J٨k#@x\6d l#CY٣`\5 l#3\#`CB \&@i*@~p# ZL( jT=';Y̬Z`'`myש[5':Z5@zsT#5#`XJo##m3`x=# nD-Js<#n~`s<# LL~4t<#n;#@o`x;`@V```@5 >q,䴾H,`v3!M<0O,vWؓtL, w>L,*yO,`*XHO6TεO6ON6`V<.P6`W-QM6>rxM#xBp_M5@լ~E5>`(O6`yA+H#M6@?O6?oIxM@,z7xL@,G~BcL@,*-zpPO# ?O#|m=K-A=NJ#@m&6HO# ~vsO# Z`O-@ F8O-@~Nd%I->7-I5~&V EF5] 6?2 #g=7;I# A򢏼O#^7&ږxO#d#kh(6A Н@O# G ^-E6 h% 6 C6jDjE#|سG#^`Ok`¹`¹P`¹T`¹ ȾT52~חMK55 = Ȗ5`+l;l #{d)#{L)#@ -b!#n<]#`U_n# R=z/K^#~ZC>f1PC85`f';1\``' >ۢ8e'n^@, %Ú#f@5礯kY 67@w --Ȧ w #@BgA]'#Bg9&#C>b#@6d# cu#@/Cz}>՝#9D6 9f`60sE`-6{!E >4D!@5` #!6 1X9 5`f #\*)`9DnN`9@)#@}MF)#1#su,6fo F@XJpX`/`dLL̋` l0Ӯ@`5@BP #@Ea4#`Sb(oxh`  #">v0## f^-y`#X##@ITq#3ܴ{#>f :#? N5#a,^A#,P(ͽ#J!Z#@F_U <^.@<Y@<%4 A</@<`>h A<t@< #A<@<ɔA<@ƹiA<TN"0A<6%|A<`bA; A<OA< ;A<5t A<@g?y A =lv = Ux =Jx#f!us@> @> #@V`=sCи=c8=`c֬=`[9= Od= "#`KU ԇ`K8X\͇`K@Ї`Ko;,ɇ`KŨŇ`K`nl@>@H!@>/3!`K$؇K@DL ]@8`V<.# D{MH\ @@#z$RtVe>t|i#$Pg# 8ލ6Hj> {!i#`ЍsRh F[9V0? {!h#w?DP0H^#)DK^# X=AŠK^#-DK^# e# VvL^>Ih#Bg}gXH2ݽ6@o6NXo# rXn@8<n6<8n@8@=f#@N@n5?qrĜo67rn#(Vn6t|i6Ih@@n@9@>5 HC6`Fh԰C6@Y(B6uC6 UTC5FYLTC7@=f71Z{71ZD#@~xB#?p4rB6`./ `B#k@0E#YVpD#>yL+`D`B?PYE`BGVOԙE`B⋎ԟE`B 5)E#_4#^@#G0} #@IFn#`@85#a-3xQ%K9WF4&"pye"P"vG_GVH`έ|̒ i fWZvkThN#[3n6`Z ( O#4vxC#Lm݈C#fy7x3#@:4v>-@Tۘɗ`NJ-\h#͠p`{`{. 6I<=c#`D)S5q`K>2H6@ZDC#^d:`K_.0MU@dU gx0dU&7odULsdUy$dUr$r{TdU@odUJ(dUL<%πdUMy=dUM>!dU@'hdUN_dUN|dU`r(UpdUr?$dU`&yLdU s"p`d@5Jǃ6!5@D ǟ@5`LT! :\,-2d `?Tj-8"`-O_<,`-p`-`@!#`- ҝ8 L`- YP@x `-aaY -h$2$*&  %@hryJۧݧ%h׿ԧ֧%irͧϧ$`ibȧLʧ`$iDħŧ " ( fq'q'!$IӋ. Hhik. Ũ5. mVZD..Pq`l-{p^2f2ldPN2R2 mxw 22mi|-2$92(w=g11`{\u)1`+1mW1`1@ng2h2nJLV&2$*2o7B2I2oVo$A2$B2 p"hzS2X2pVk`K2# 86ȕ# |/^#e@D# tOTP'1Z8`'@\ԱE[X['@ʈ[['}h[[' lRȨ[p[9tqzz@&Xxpyp@>?"ܶ ((:[#H" (`ԘVt #" (I'""0`Z (O O0`W-QMM0-饻}MxqMM8M0 K tKK057$AK >K@) pZJZJ@)q`J`J0]WgOO0IJt J0`xZTKJIJ(@|OX~O(]Y08OO( ܥcOeO(`}( 0  1TExtE,rE0@_;[lOO`3_L,TOДO Ⱦ`¹`¹" Ⱦ`¹`¹11Zz/b*8`w T.?+kX|-$Ԥ. XOW.YH. ̝;l՜֜.`2%g0̜X̜.I6ʜ˜R@`h @h @h @h@ @h @h @h @h@ @Jx8 ̋H 0ӮX h@ `P@3%P.x3ڒP`3 Vh|3 8 ML̋0 ` `d`` l0Ӯ@ xɮ֮@P `,3<`Mx`/` 4"g۬ 4` J 4=+ ,  44)  4ҎWx 4u` 44|{8@ 4񠢴 h  4@5_a 2>؆2@ixJyHkDl2@=fU@VU@TUTU@UUUVVVTVUVUVVVV@8@G@4(4@8!}N44@8 "NТ44@8"љ44@8 # 4D4@8#qh&p44@8 $#帙44@8$$4D4@8S]4Ԗ4@8!9Ā44@8FHPD4p48v+AA8 c$AA8NmAA9 )DwwT@> `9'Av0Hv*VnvvC`4Q&<%D"]\<g,g<XShWhHFYU fa ga Fh`^e^ Fpݝ^p^ F`0Y_\_ F yʜ^^ F@sz<8_ :_ Fep._/_HH2*lua@va FnJ@1_2_F@]gDgFe@ԧkPk F Z/_,1_ Fhp^|^H RC$a8aH?bkalaHRsataHGUS$ra8sa FAf_ _HIPia`ja F{8__ F ^d__ F`Y,^^ FW4$O_TP_ Fae5i_(k_ F`$K_@I_ FI8,_-_ Fy}G`#_4'_ F@໭ݐ?_@_ F ^X^H`'gahaH:ϼ@maTnaHFnaoaH>aaF $hhF9@hPhFـhh@;I(hh@;t|iti; {!Dii;t|iLiF@#lh|h: 8ڲT]8 ]HG>{paqaFKP|h`|hF`*i-iF i$i0 6HDpDpHGxmmH@gm m0nHn=k$D]ngnHKęmmHJR Pm4m0 >ldUnDTn@> r5`o0|@>/>(ܤ@I55?`Y;.\de @@`E@r5@7?ܥD01ZDz11ZDJ`K}pP!`K`GsP!`KOBG4oP!`KcqP!`K u,rP!`K@ҪLeP!K@>XshsK !sРsK Es؎s Cքۤtt C`>DtXt C 1`ttt C 'x.\sps CJ@)Att CS!tt C@3ss Cs[Eztt C>=tt C`tt C~tt C #0Ptdt Czhtt C%=lss C@`2>LX>>i 'At r;p;$;kpΣ\\\k1ZD8V%C"q$qh$qu#FzzXzml,pppm 5> p,p(pm1.spmp sp j>O$N OsBG(GGxȉ,OOxOxX@OؖO\O`r`EHHHV !8OdOL`r /xK,)L|K@y_IPOO `oG G,GDO̥`rAedOPHQ`r^Q!L0NXFYw4yrs,5<*+ ,}d  $jR\Nx ` ֮ <@ ` |\?)C)l?) ٔ---:"ߜd7OPH7H7H7 ya#`379797mP%7)7(7 Y٘777| 777hTi6T787^9-a@666 6T{76666rڄ666 F ľ6P66@ryΐ6,66 66l6`UR#r6466 ;.sВ6t6X6 z耂6 66ɡ|6|}6`}6 d@w6w6w6pyOq6pr6Tr6 11k6k6hl6mvTXX6[6Z6DPR6R6R6|јA6TD68D6 6bP;6<6;6`c~U)5X5<5Xrn5H5,5 t~xĮ5z75$;5y75 ]455l5.8{5<5 5 q$555V !]@rrU@ @ *@# @@`[8fܯff@6^.{!eܥe@7gш!̥ee@`-!Hk k`W KȰkXkܱk`r+%v7oX?o8o@ 3@y1i2i82i/>(ܤ@ h.DX Oxyd誑` T!!`!! h7X43R3R5R k^XrYDYY`Ƿ rss赍HuDvv:F^|x`yy}S&lGcJc$Ic~SipFcGcLEc@zۼc dtc jCXCܤCԥC CCpC @T'?0&?l'?` 1N!!`<D!!` FMb`!!`Y8!!` Ul!!`+#|ԛ!!`!Iڛ!!` ;jT!!`(y!!   4ObPH@fhF@$E`*%bͣṬˣŗ}X䱣YsUPq<Ьح YDN)|=|| Y ""в,x@] 4*T|W|,R| _.l @|Uۧwyy Y@-,hgh`$ڻ7488 168 99]e#48."$ @/>uhXje/.쮢4@ wL@ )%@`trHx[0udP| [ φ [XMqȫ`\E[}#4#X##XdT03$v33T3` TAmdpmmX@s0x4x4y4Pz4`tp8ikHiXi` 3Я"-#-"-"- a`[s a"R Ϳþ `7@Y G%sa6ggdgh\ ݨT(tV(W(& $ $`ҿa@|T4^EP@/@/\[ϠC###\"\I'#"""\D1_##L##\(:[\"###\ F|P####\;qg|#8#L#x#`]@zW@ @ @ @ U*d49pkii`id`[`gTggg`f_'7Lf`^SLCNCOC0QCf1ZDz{x] ȾT@ƿ ȾT g@T)$$+'g jĘǘŘhɘgapS!!!!g ;!!!!` DDQ.c0/c(.c8.cn-TaaaPaozL d d8 d,d`\.PcRcPcQc`o s۱@llX lL!l p qN @ p 1xPl pBGУϣѣ8ϣ p@{`춣 p ?c,otm(pXm`iKմ0l W;SigvH4`l`Fz?8$d m!HFL8@k!|lhpkUb\Hj+!t!`!$#j` <'&&h(sr/<(sjT԰,s̪Lxs Dħs@D ƐΟ˟ğǟ p "%޵ ( # pKfeie p. 謢T쯢U 4*s|LԱ \ X沬}| @ @ @ @@@]@@@h@@@t@,@@@ 񋭒, (BX@CE y$ԉT ԷP̺ @ N@ęXƙÙ Dș͙ʙϙ̙ 5 XљP֙ҙיԙ Ghڙۙݙ`懱HŤ ƤXŤǤ|Ƥ 2]x켤  ĹXԹH8*yittttt <~4IuhGu@EuTGu88E8?89|878,787 7<888L8<8P8d8^78787D7@t78878878 88Ⱦ78|787$7?988`:88|:8:8@g58T8h8X8l88` i|7@87d877 ~1=888888` *)Ty|`<.d|kkDiĹkhi`i|?yuk k.j k,=j?j`|hDhhhh@h2`ȸ`ȸ`ȸ`ȸ1ǸǸǸǸdկ<4ީLd 8ɩȩɩP̩ɩM'88&8&8'80&8@x`Q`Q`Q`Q`e.+  |`.+p4 !`4-6;,>@AdO,|, k-xhʄƄD˄0̄ "($<܄ބ݄߄|ڄp"ݜuӄׄՄׄЄل`#7X8|ع`$qpL\}x$%6|TԆ0\@%'0pPЌ,X%VtL̒(T&wȈh蘄Dp ']9L<D'ܩؤXpॄ`(ѨRx, )2M l찄Hૄt):^,8`uBtd`v0.57.2-0.20260111184307-eec8233061788@](](`}'P^(^(_(L'8Fk` d8`ߪ}P@NN@8 Bx[([(%H\(\(\(%8Icbʈ_(_(t'X`(`(a(h' ++ `O`O?tyyyy(yyTy4^bP@/@/@/@/@/8 Qmp8:4D<x>@6<ld l`lT ll@ l l?S)r,,h,\,,,d,?R9)l,,,,\, ,,@s@T @HXhpx@jH@`Qr\pxppppDppp %*`)q+q%q$,qh-q.q@0q1qVeMup`vpDtp|vpvpPwp xpxup@kk?U:LOhOOO$OOOOh8@Hk`¹Xxhx l@ 'G!dǐ O! @`"SLX/!4ݐ\!M@`16U! ߏ!@ , eG! !@W2А;!t!_i\klW !T#$$&`ߔ`th@ c*躐Î!8<!@`sUԺŽ4!x;!P`0 pxm@,`@ P@- X n`স5(` 8@HP oͽ`X ݸ:s=s>s?s@sEsGsJsoo`o))y)y)y@h $hXkxhHhhhhh; bb b,bbbbb8@ p2ݽ ]22@222`](113111 oTo@oood,!H̐_!@@` x !̐`!@ UƎ!H͐a!L@BŤ-XP!͐c!@&NX!xΐe! @ P 6ȼ8!؟i!$ @YYܼߎ !ϐ4k!"@$h!Аn!@'@!o!(@`7h؎!ѐs!,@ U{,(!TҐt!.@#@!Ґpv!1@HTXɎ !hӐx!`3@`[MGh!!Ӑ~!:@ p|8"!Ԑ!x<@{ڐ4#!|Ր!T=@?9 x$!H֐l!0>@`.KG[%!א<! ?@ R%̽&!א !?@ pཐ(!ؐ\!xA@!)!ِ,!TB@` ңt8 *!ڐ솏!HD@ ң+!pې !pI@ o0 ,!ېȌ!@K@!gD,-!ܐ!,L@ #Rl0!ސ,!M@# @ӎ1!Վ!N@3!\4!`P@$& 5!ސ!W@`%]˼ 7!Xߐ![@ &A о,8!D̛!]@&1q侐 :!ߐ!^@'uY L<!!`@`(aT Ŏ=!P!\a@ )\H0@@!(@!d@)I%\\A!P!h@m< pЎB!!Pj@*Ʉ|D!0!s@n \E!ԯ!u@Dè|F!T! @,Xr¡ԿH!D!@-Y运XJ!T !@`.<h܎K!ď!$@`UL!Ə!̑@ /e%$|َ(O!ȏ!|@/6 8\ێDP!d ̏!L@04KL|Q!tT͏!ܙ@}%`S!Xԏ!࢐@`+atf4T!\׏!h@ 2r\W!ߏ!ذ@2fP X!D!,@3Y!!@`4VeZ!!@ 5 u[!!춐@`j4|*oe$cPcc4cclc|cc d@,(B)' 4QQdSTU8VxWXE`X M>&&>@f`4P5LhgTgDO`OtOO\~PPQQ~G8(dDH\?jHAeAMbP?@@=rI0 h 0 p ` !`?@ @[|jso{Ll|uHq~xDO`OtOO~\~PPQx~Q '}i3#Q:de#ET)g{:BD2%PP+X>>+++#cq (>tNBL9G8<`V(TD@J s@ETaataaTaapaa aaaa s PaaaaaaaxaaLaaa suY2aaaDaaaaataataa nROKJJJKLK8KQPM`j)!D~XYY ~(Y~0ZLZZܛ~Z nJ lLHtdT nbߞߞߞ84,x ntP@ L<lظ\hP(!!!! !@@ !@ !@@@ !@ NN N NNN N$$$$ #   #  #    # #++#+#+++#+ & & & &%%%% %`O`O %`O %`O`O`O %`OU1d P P P P|P(PPdPPPPPPP@$ n`@@nn```%`n @@ooccc@1ZD\yz{X:4;x80@`1(T ^ ^ ^`^P^p^^^l^^^ ^X ^@+X|]]z]~]~]}]]$}]d{]D}]T}]y]hz]NXoo,o.p,oooo/p0px2pt3po Xӈt`X0 Jad X h *$,4- /,1T2284`566(8;,> .+p`p 8lp4cT z4QPQD~dQxQ~RRR4~~0~S؆~(,ZZt~[~~[~~ \<\X~H~\ .Mklmmn oo8pp8qqHrr\s ~6v)%t&'%l+* @} eTokHlmej@ele\e|ee|qp `TܱDīԫ䫢ԷQ @t@s@s@s@st@st@`* -t````t`t*-h,@"ڿ,@"ڿ,,ڿ@",@"ڿpi``@-t"@ڿ@-t"@ڿ@-@-@ڿ"@-"@ڿt l݆ԆT߆<܆PֆlՆ׆<ن $Նhu qm*bbȐbإbbbb|b`Ab/bpb0b1bbbxbt>2Hz<{{|<}}~$h̃t_`p,ddd$@ P@ܹ y P P P y P y P y P@ܹ@ܹ y P y@@@Pܹ cPPP cP cP cPܹܹ cP cQܹmQQQmQmQmQܹܹmQm@.QHHSHPQ ]^Ib\Xfd$LDU`NZh .+|p`p 8lp4 #%'*$,4- /,1T2284`566(8;,> zBhBBCE`FGHILJ$KHLNNO8PSTcontainermaxprocs=0,decoratemappings=0,tlssha1=1,updatemaxprocs=0,x509sha256skid=0`W0`[Xa[b[c[|g[Hf[h[4l[k[i[`m[n[p[t[Xs[$r[u[v[@+eŇZLZ[\[[|[L[ [[Zl[Z[[([Z[<[9݋`_cecccПcDcc cXcc|cc {cfcrccTacac@@<0(bbPcchddleffgg hhTiiLjjtk1$~l~p~~T~~H~~~|~D~(~`~Ą~~~~d~H@n~Ď~4~~d~$S@SP~TS܏~hS~~pTTT$~~~~TH80zzP{{x| }}~~̀`xx w MwPi  T{`W[[0`[Xa[b[c[e[|g[Hf[h[4l[k[i[`m[@][ _[n[o[p[t[Xs[$r[u[v[{@+eŇhZZLZ[\[Z[|[L[ [[Zl[ZLZZ$Z[[([Z[<[)GGG)) *,,, ) ) ) * *,,4d \"pd\L <TDT4D D `+|F[H[J[I[$L[M[[N[M[O[Q[(Q[PP[R[lG[Z[S[[4U[W[V[V[|X[4Y[Z[@+eŇZZZ?A4BPCdDpE|FGHIJKLMNOQR4SPTlUVWXYZ\],^4^5^P@/@/@/@/@/@/@/@/ڹ@/@/@/@/@/@/@/ٿ@/ٿ@/@/@/>`*q<=>?A$04BPCdDpE|FGHIJKLMNOQR4SPTlUVWXYZ\],^0 `4L|@{xL̍`|<\,T`yt|}Ą8Ȕ|ԗ0x,{Xz! G0]t(hb藘xnd^|vd$jZ의`lrhzdXx~fhx|`Ll8p*"<;%>1'0+lmf 7A-$ijk #h 8/23 =) 9.5c!,@:4edg?@K~ L @(,718\-t5"p$<:(*/ d3 lp&l `b `b7j` `b $X>> > $X>> # >++> $+  $ # +hhNNDDNNNN NNDDNN DDNN NNNDD NDD```````O`ODD`O`O`O`O %`O`ODD`O`O %DD`O`O %`O`O`ODD %`ODD` -& -&` -& -& - -& -& -& -&` -& -&``. pï6ŧܑ %JM~% J8ni}60`````````` - -& -& - -& - -& -&`` -&lɖ di .m wg^ Szu2p֖ -| E8m b }H8| uj |2 d cʹn z 980۵FTJ$7i bDz =  [ 7z z 9Z  BZ Ck    X̬Pį̬`,```,``NN``N`` ys" y>s@"" y>s@"" ys" y ys ys@"" @" @ y"@" y@ @ @ @"4^Eb@ڹ@ڹ@ڹ@ڹv@/@ڹ@ڹv@/v@/@ڹ@ڹٿ@/@ڹvvvvٿٿٿ@/@@@M@@@@@@@@@@@@M@MSS;`@;`@;عع`@;;;;@;@;;@@;@@@@`;@;@;@`;`@;`@;`@@;`@@;@;@;@;@;;@`;;@`00NNNWW="@="@=@"@""@====@=@==@@=@@@"=@=@=@"="@="@="@@="@@=@=@=@=@==@"==@"=  TQ \Q++9+dQxs qAKvxA@j &/ -/4/ al W {k.Hș Hՙ HH  22C| qLm gnm o !"#$%&'()*+,-./0123456789:;<=a l b0O W {k.Hș ՙ HH  22C| qLm gI/nm oʷ  !"#$%&'()*+,-./0123456789:;<=`0`a`ah0`ahaa8a8`a``a`0@@@˿@D@@D !@NN@N@D@@D !@NNN@D !@N@D !@N@@D !@N@ !@@ @@@@@@N@ @b @b` @b@b @b @b @b @b`@ҿ%`O`O`O%`O`O`O%`O%`O%`O%   `O̮ TI$3u         \I$(   "$& ( ,m 0m ?9*4, .dI6<80<@DlI֭3$ž W2 rY-r > `d,P}*r *r hl **R@b **p*r t*r Y@b `@*4Pg@n@!*"3= a" )"*"fj"i"i"*"h"h""8k"8"8j"8 " p*8K"8N"8O"8m*8P"8B"8g"8g"8~*8~*8f"8f"8}*8}*8"8"8* "8*8*83)8!8*8*8" *8*8*8" *8M" e" > d" < " " <" ="1*"""*"*" " *"*"@j &/&/  px -/-/W 4/4/u4/x4/{4/~4/4/  al W {k.Hș Hՙ HH  22C| qLm gnm o  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0w tApath github.com/apernet/hysteria/app/v2 mod github.com/apernet/hysteria/app/v2 (devel) dep github.com/andybalholm/brotli v1.1.0 h1:eLKJA0d02Lf0mVpIDgYnqXcUn0GqVmEFny3VuID1U3M= dep github.com/apernet/go-tproxy v0.0.0-20230809025308-8f4723fd742f h1:uVh0qpEslrWjgzx9vOcyCqsOY3c9kofDZ1n+qaw35ZY= dep github.com/apernet/hysteria/core/v2 (devel) dep github.com/apernet/hysteria/extras/v2 (devel) dep github.com/apernet/quic-go v0.57.2-0.20260111184307-eec823306178 h1:bSq8n+gX4oO/qnM3MKf4kroW75n+phO9Qp6nigJKZ1E= dep github.com/apernet/sing-tun v0.2.6-0.20250920121535-299f04629986 h1:w62V0oOO2Do0vXeZkx7mgZ2YFuUaRcO6rNZewI3xzuE= dep github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE= dep github.com/cloudflare/circl v1.3.9 h1:QFrlgFYf2Qpi8bSpVPK1HBvWpx16v/1TZivyo7pGuBE= dep github.com/database64128/netx-go v0.0.0-20240905055117-62795b8b054a h1:t4SDi0pmNkryzKdM4QF3o5vqSP4GRjeZD/6j3nyxNP0= dep github.com/database64128/tfo-go/v2 v2.2.2 h1:BxynF4qGF5ct3DpPLEG62uyJZ3LQhqaf0Ken+kyy7PM= dep github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= dep github.com/fsnotify/fsnotify v1.7.0 h1:8JEhPFa5W2WU7YfeZzPNqzMP6Lwt7L2715Ggo0nosvA= dep github.com/google/go-querystring v1.1.0 h1:AnCroh3fv4ZBgVIf1Iwtovgjaw/GiKJo8M8yD/fhyJ8= dep github.com/hashicorp/go-cleanhttp v0.5.2 h1:035FKYIWjmULyFRBKPs8TBQoi0x6d9G4xc9neXJWAZQ= dep github.com/hashicorp/go-retryablehttp v0.7.6 h1:TwRYfx2z2C4cLbXmT8I5PgP/xmuqASDyiVuGYfs9GZM= dep github.com/hashicorp/golang-lru/v2 v2.0.5 h1:wW7h1TG88eUIJ2i69gaE3uNVtEPIagzhGvHgwfx2Vm4= dep github.com/hashicorp/hcl v1.0.0 h1:0Anlzjpi4vEasTeNFn2mLJgTSwt0+6sfsiTG8qcWGx4= dep github.com/klauspost/compress v1.17.9 h1:6KIumPrER1LHsvBVuDa0r5xaG0Es51mhhB9BQB2qeMA= dep github.com/klauspost/cpuid/v2 v2.1.1 h1:t0wUqjowdm8ezddV5k0tLWVklVuvLJpoHeb4WBdydm0= dep github.com/libdns/cloudflare v0.1.1 h1:FVPfWwP8zZCqj268LZjmkDleXlHPlFU9KC4OJ3yn054= dep github.com/libdns/duckdns v0.2.0 h1:vd3pE09G2qTx1Zh1o3LmrivWSByD3Z5FbL7csX5vDgE= dep github.com/libdns/gandi v1.0.3 h1:FIvipWOg/O4zi75fPRmtcolRKqI6MgrbpFy2p5KYdUk= dep github.com/libdns/godaddy v1.0.3 h1:PX1FOYDQ1HGQzz8mVOmtwm3aa6Sv5MwCkNzivUUTA44= dep github.com/libdns/libdns v0.2.2 h1:O6ws7bAfRPaBsgAYt8MDe2HcNBGC29hkZ9MX2eUSX3s= dep github.com/libdns/namedotcom v0.3.3 h1:R10C7+IqQGVeC4opHHMiFNBxdNBg1bi65ZwqLESl+jE= dep github.com/libdns/vultr v1.0.0 h1:W8B4+k2bm9ro3bZLSZV9hMOQI+uO6Svu+GmD+Olz7ZI= dep github.com/magiconair/properties v1.8.7 h1:IeQXZAiQcpL9mgcAe1Nu6cX9LLw6ExEHKjN0VQdvPDY= dep github.com/mdp/qrterminal/v3 v3.1.1 h1:cIPwg3QU0OIm9+ce/lRfWXhPwEjOSKwk3HBwL3HBTyc= dep github.com/mholt/acmez v1.0.4 h1:N3cE4Pek+dSolbsofIkAYz6H1d3pE+2G0os7QHslf80= dep github.com/miekg/dns v1.1.59 h1:C9EXc/UToRwKLhK5wKU/I4QVsBUc8kE6MkHBkeypWZs= dep github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= dep github.com/patrickmn/go-cache v2.1.0+incompatible h1:HRMgzkcYKYpi3C8ajMPV8OFXaaRUnok+kx1WdO15EQc= dep github.com/pelletier/go-toml/v2 v2.0.6 h1:nrzqCb7j9cDFj2coyLNLaZuJTLjWjlaz6nvTvIwycIU= dep github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= dep github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= dep github.com/quic-go/qpack v0.6.0 h1:g7W+BMYynC1LbYLSqRt8PBg5Tgwxn214ZZR34VIOjz8= dep github.com/refraction-networking/utls v1.6.6 h1:igFsYBUJPYM8Rno9xUuDoM5GQrVEqY4llzEXOkL43Ig= dep github.com/sagernet/netlink v0.0.0-20220905062125-8043b4a9aa97 h1:iL5gZI3uFp0X6EslacyapiRz7LLSJyr4RajF/BhMVyE= dep github.com/sagernet/sing v0.3.2 h1:CwWcxUBPkMvwgfe2/zUgY5oHG9qOL8Aob/evIFYK9jo= dep github.com/spf13/afero v1.9.3 h1:41FoI0fD7OR7mGcKE/aOiLkGreyf8ifIOQmJANWogMk= dep github.com/spf13/cast v1.5.0 h1:rj3WzYc11XZaIZMPKmwP96zkFEnnAmV8s6XbB2aY32w= dep github.com/spf13/cobra v1.7.0 h1:hyqWnYt1ZQShIddO5kBpj3vu05/++x6tJ6dg8EC572I= dep github.com/spf13/jwalterweatherman v1.1.0 h1:ue6voC5bR5F8YxI5S67j9i582FU4Qvo2bmqnqMYADFk= dep github.com/spf13/pflag v1.0.5 h1:iy+VFUOCP1a+8yFto/drg2CJ5u0yRoB7fZw3DKv/JXA= dep github.com/spf13/viper v1.15.0 h1:js3yy885G8xwJa6iOISGFwd+qlUo5AvyXb7CiihdtiU= dep github.com/stretchr/objx v0.5.2 h1:xuMeJ0Sdp5ZMRXx/aWO6RZxdr3beISkG5/G/aIRr3pY= dep github.com/stretchr/testify v1.11.1 h1:7s2iGBzp5EwR7/aIZr8ao5+dra3wiQyKjjFuvgVKu7U= dep github.com/subosito/gotenv v1.4.2 h1:X1TuBLAMDFbaTAChgCBLu3DU3UPyELpnF2jjJ2cz/S8= dep github.com/txthinking/runnergroup v0.0.0-20210608031112-152c7c4432bf h1:7PflaKRtU4np/epFxRXlFhlzLXZzKFrH5/I4so5Ove0= dep github.com/txthinking/socks5 v0.0.0-20230325130024-4230056ae301 h1:d/Wr/Vl/wiJHc3AHYbYs5I3PucJvRuw3SvbmlIRf+oM= dep github.com/vishvananda/netns v0.0.0-20211101163701-50045581ed74 h1:gga7acRE695APm9hlsSMoOoE65U4/TcqNj90mc69Rlg= dep github.com/vultr/govultr/v3 v3.6.4 h1:unvY9eXlBw667ECQZDbBDOIaWB8wkk6Bx+yB0IMKXJ4= dep go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE= dep go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= dep go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60= dep go4.org/netipx v0.0.0-20231129151722-fdeea329fbba h1:0b9z3AuHCjxk0x/opv64kcgZLBseWJUpBw5I82+2U4M= dep golang.org/x/crypto v0.41.0 h1:WKYxWedPGCTVVl5+WHSSrOBT0O8lx32+zxmHxijgXp4= dep golang.org/x/exp v0.0.0-20240506185415-9bf2ced13842 h1:vr/HnozRka3pE4EsMEg1lgkXJkTFJCVUX+S/ZT6wYzM= dep golang.org/x/net v0.43.0 h1:lat02VYK2j4aLzMzecihNvTlJNQUq316m2Mr9rnM6YE= dep golang.org/x/oauth2 v0.20.0 h1:4mQdhULixXKP1rwYBW0vAijoXnkTG0BLCDRzfe1idMo= dep golang.org/x/sys v0.35.0 h1:vz1N37gP5bs89s7He8XuIYXpyY0+QlsKmzipCbUtyxI= dep golang.org/x/text v0.28.0 h1:rhazDwis8INMIwQ4tpjLDzUhx6RlXqZNPEM0huQojng= dep google.golang.org/protobuf v1.34.1 h1:9ddQBjfCyZPOHPUiPxpYESBLc+T8P3E+Vo4IbKZgFWg= dep gopkg.in/ini.v1 v1.67.0 h1:Dgnx+6+nfE+IfzjUEISNeydPJh9AXNNsWbGP9KzCsOA= dep gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= dep rsc.io/qr v0.2.0 h1:6vBLea5/NRMVTz8V66gipeLycZMl/+UlFmk8DvqQ6WY= build -buildmode=exe build -compiler=gc build -trimpath=true build DefaultGODEBUG=containermaxprocs=0,decoratemappings=0,tlssha1=1,updatemaxprocs=0,x509sha256skid=0 build CGO_ENABLED=0 build GOARCH=mipsle build GOOS=linux build GOMIPS=softfloat build vcs=git build vcs.revision=44a5643535bf63760659b2a8c76fde6330792ab8 build vcs.time=2026-01-11T19:07:25Z build vcs.modified=false 2C1 rBA&S*8a T""*#5",!9,!N"'"E!-! 0" -!""""2"  7"t*a"/"."!"3"/*"M"E!)! !*"`"F!; P"/"!!!*'''!"!!%"!)!P)^)!V)_)!W)"!!J-"%%<u*B"!0!s*"G!$ %%="1!1!>"  ">e""g"*w"~*s"k"*^$ ! ! !% !&N"O"20!!*H!!,"+""c b .@!(4 A% 6B <9'!!=;'!!!#'a)!Y) #!N)"!Z)")"Q)`)!X)!R)!!"f"v"*}*r""!?''''''C!!!!Aj")_ 3!"D3! CGE k"j" ` !*b"m"&" "`""o"q"y"u"""n"p"x"t""" """""""""A"D"G"I"$"RPLF  T*7*> ###" !!*z"*|"~"3 "7"""!)T'!)XV ! "!o)!'!!! #'])!U) #"![)")"O)\)!T)!S)!!p)!!!))(,Z*`^\!!!!!"J"%""""""""""{"*}"" """""""! & db"4" <"C"E"H"K f!I)l#pj_###""rL!)!!n)"!!!!!nh"*"*"  #"|X'@" M"t"NO/.v+Pxy}{ (!$!>"?"0a 5!5!?*&'"U*\*X*Z* ") "!"))))))))"")""|#RH"p*o*J"K"'H"J"*H"M"3"**L"5 ="""####L"1 5"5"),!6!l""%"****&%%*"" ))%%%%%#$%%%%#S"""W%T%V%S%P%f%i%d%g%]%Z%\%Y%Q%l%c%`%k%b%_%)U%R%% %%e%h%,%4%"""[%X%%%%j%a%^%<%$%%5 O =""\)'" " N"*O"O")"D*I*K*G*@*A M*  L*P* ) G''%)W"!!$"""W"**)c&c&:T"T",@"""!E"m*."T"!!'****"8)5)""!=)*"H*F*J*"E*!<)""""!!""2"1"-#!e) 8!! ")4F!! !w*))!!!""f&f&"""R# #$UP"Q"8"""#!!!!)# #U)"%%!o))_'w*Q"n*V"U"MG!R""****#!**"""   K V")q*V"U"B"**=_"a"x*)S"q)/!P"B" !"0!G!R"D@&#m&%W""* *S!U!Y![!T!V!W!\!X!Z!]!^!D "#g"**3!e""e"g"~*~******$k""7!Sw"***i"****i""X` !s"**>*z*")|**x)""*w"s"! !J!H)!!%e&e&& "%%)&)!;"!!Y !'C  c 85!&H! *-"))!3+!!!1""!")1+""$!"*<*Q/Z<*""""""b )V59'7[XT7:(8E\\!!))f"*b):)!')'*!!))!!9)s)!*)* )r'{[)))><#{;6)  g)K)!d"!!!!!!!!!""d"f"}*}*******""*v"r"|) #)v"*!!j)%Yj"!#k)%@##h"****h""'!'''''!!)]-*4*"_%%)()!#!m) "9 !r"**[  B<*y*"""v){*)%"%J)f):"B& ' '!!!!!%)*< !"*'!#"**""8"***& ""^">"""!!!"""DI"II"n&n&!C*HFG"B*= `"!$)!!b"()""+q"q"u"o"o"!!* """ "Z!!% p"!!p"n"t"n"""$"_ " """ " """&"&"*"""!!!""""$"&"A"D"D"$"&""""""""""y"x"""""#! ")")))!#)!!')$"">"Q8*")S),))."!))> )M)"`))"("!]*4!4!"V*W*[*4!""6*=#%"%"**"?%.0 "1 -3!&"!!!+#*""*"%*r*&*'**az"**|"*z"*|"***"~"2 !**"".###""~"" . *bW  !*?_""!!))d)U")'))'!u)! )3))!!E)t)!!)6"! )s'}])))YW #}@7)i)  !!!!!%}) #/!!l)!!!!!!!!"S"!! ##*'!')c.*5*))*!: !]  ""%"%)h)![ {"**a}"*_]**"*"A""f*!%)!!;))""6'0"#o&IH#"%"<"j*C"C"****F"$*r)!"3*)#"##**L/)?#d`&`&%"""""""""""%%%%!"##"&&"**"***"*y)""*"****{"*}"***"""j&"***"*'*{)**"*""*"****!&)!!*)##ecB #14"4"H"<" H"<""1*0*-"()"6#*e*))4 "!%%%"\"%"%\":*9*);*#F[gl"!!!c)!^mC!qn)~)2!!%###%ksf!!!!"!###o%"i%%!)!**")""!""2"(""Z""||3"g"")u_*'"Y"!4h!@"@""%"%5'''''"*i**''**%""OwK6WjNz~7|(!76!k &><"&><"b5i5 p5   o tw5~5yp ~5L$ ! 55a#L55' $L,Lp p j / v l4- 5p 5p 3 5 _ 59 5? !H4L«5_ 4p v#Ыl#0ޫ$6p c p H?Z:Mq @Hq dinl6s6z6D4#dLHlLsL Rq #| ._ \q  gw#tL  45#H ʎ 57_ 2@/x6 6 P6T6  |L} $>666Lfq ֎ @_ X\`pq NI_ \j L & dh l6666pM$tx x3  R_ \  k @ | 66666 zM  6 Z 2 6 [_ d_ m_ ̬6   7 7zq q   q 77v_ "7 )707 _  g !q !L * ڬ! L6 L!77!#!>7E7B t D L7)!/!"',S75!16;@Z7a7EżJOTh7o7;!A!G!v7LM!S!Y!_!}7Y_ ^ce!7_ _ _ _ _ _ _ _ k!L_ 7q!Lw!h7mr7_ }!w!L7|_ !_ N q Lq 77_ ` !!7LL!7L7L7L` q ` L!` 7*` 7 Z Vh1!!!!!77!!!!!!!!!!!"" """"%"7+"1"7"="C"I"O"U"3` M<` ["a"g"m"s"y"""""7"7"""E` 8"" 888N` 8%8,8"""38:8"" M"Mq "q  A8W` ``  f r i` H8M"r` "O8$M"V8]8 q ,Md8k8r8""# ##4M$:$C$M:; ;;M; ;H$$';.;$MM5;<;%MR%C;MJa Wr JX'z.\Sa  %J;N\a Q;, Nr 7 NNX;_;%%f;%a%%ea m;+%t;{;B fna k1%7%=%C%I%fDM =tLO%p;$N;;,Nuz;U%wa [%;a%;g%m%s%;;y%%;;;4N;%%a b ' >'>>">''b dO)>'0>'7>''>>b ' '''E>'lOL>"b 'S>'Z>+b 'a>h>o>#'('-((tO|O (v>4b 2(7}><>A>`r F((%(>=b +(>Fb >>K1(P>>>U7( =(Z>_OOC(I(OO>Ob jr tr >>>dƀ  > Xb ab Oinsx}>OOOOOOO(U(O>jb ~r r р >? ?[(?a(O?g(?%?,?3?:?r m(sb A? |b H?s(O?y(((V?b ]?d?k?Or?(b r y?b O(Ob (?(f?(?((?(??(((?b ?(((P& ȭ(( P܀ ?b ?(((?()P ))? b ?)r ?b b w)?!)??')-)3)P9)??)?@ @E) K)Q)W)"])c)i)@@o)u)!@(@{)"/@6@'),16;@=@D@EK@JO$PTY^c%)h)m))()r))w)))|))) +))))).))) *1 ***4$*#*)*;/*5*;*(,A*0TG*M*S*48Y*_*<@e*D7H:LPTk*q*=Xw*@\  !$'),1 D $%,-29;? "%*-4799 %*/0 !#$% & /7>EHPUX[_cem {          !(03: IOOOQW dinn x|     !(-0 : F U\ h s }              #$+0 9 F P `elor |       !( 6 @FM X ekpv}        #(:U i         $%%%&+08 B C H H L Q R T Y _  n  |                   ) 1  B  N T  c h q                   0   R  h  r                      "'+.4999?BG TTUW]e ns }            - G "#%&'(((ppsx         + 6 BFILSY_ jov{}      %+.//14 CKOOPSV a t        ( 149 BHIPW`dikpxz}         * : J X o     !"  #)/179@EJOPT[^^fgn z      + 8=EN Z f rtv        $ 4 %+e !#&),  #&    $ 0 ;BJNU _ceipv}   % .0167: MRTZ c s }         "#%%%%,37=BH UY]adiorssvwz{}       %'(+-.145:<=?@ADJMQZ e qy        ). A JQ Z`  #%        + 9 R ^ o            ' BKOQW b l w    )8-#))*++,-.00]demqvwx{      " 2: J Y giou{                 ! & ) - 3  < @ B  L Q Y  c k  w ~                            !!!!! !!"!%!)!-!-!2!7! R!\! e!j! t! !! !!!!!!!! ! !! ! ! ! !"""" " " """""""" ""(" 1"9"?"?"B"D"G"M" V"Y"\"f"l"u" " " """" " """""" """""# # #####!#(# ;#@#E#N# X#[#_#c# z# # ## ########### ########$ $ $ %$,$ 7$ A$ J$ U$Z$a$d$ r$ $ $$$ $$ $$$$$$$$$$ $$$%%%% *%-%2%8% C% O%S%U%[%]% f%n%p%r%v%y%%% % % %%% % %%%%%% && & && %&(&.&2&:&@& K& V&\&_&b&b&b&i& r&r&w& &&&& && & &&&&&&&&&&& &&'' ''' '','3'6'6';' I'L'T' a'd' o' ''' ' '''' ' ' ' ( 5( S( h( ( ( ( ( ( ( )  )&),)4)=) I) X)])d) m)r)v)x) ) ))))) ))))))) ) ))))))) )* * ***** *(*-*.* 9* C*I* V* g* t*|**** ****************** ******++ ++++++%+(+++1+ A+H+N+R+W+Z+Z+]+]+_+c+h+m+o+r+ {+++++++++++++++++++++++++++++++++++++++++, , , , (,/,7,>,>,A,D,K, W, a, v, !, , , , ,, ,, , ,,- ---$- 3- D- R- `- n- - - - - -  .. ..... ). 8.@.I. Z. o.s. . . .. . . . ./ / / 1/6/;/C/I/K/ X/ p/ }/ / / / //// ////// 0 0 0 0 00&0.040;0;0=0>0@0D0J0O0 _0_0c0f0l0n0r0x0~0000000000000000 0 0 0 0 1 1 1 41<1 H1O1W1^1a1c1e1i1l1m1 w1}1 1 1 11 11111 111111 22 2%2,202 <2 G2 Q2Z2 g2k2s2y22 2 2 2 2 22 2 2 22 3 03  $%'''''W3 c3c3f3l3 |333 3333333333333333333 3 333344 444!4)4 54547484;4?4A4E4I4 R4V4[4 g4p4w4~4 4 444444 4 4444 444 4  5 5 &5,545 ?5B5H5 R5W5 a5h5o5 y5 5 5 555 55 5 5555 6 06  R6 i6 ~6 6 6 666 6 6666667 7 77"7'7)7*7075767:7 K7 W7^7b7b7f7 u7}7~7~777777777 77 7 777 77777788 88 8 (8086878>8 G8 S8 d8g8 s8y88 8 8 888 8 8 8 9 999 ,9 79 E9 N9 b9 q9 ~999 9 9 9 99999999 :: ::: 2: >:D:J:P:W:^:f: p:r:v:w: : : : :: ::: ::::  !"#$'((; <;?;?;?;?;C;E;K;O;T;[;^;`;d; n;w;|;};;; ;;;;;;;;;;;;;; ; ;; ; ; ; < < %< 4< G<M<P<X<_<c< v< <<<<<<<< < <<<<<<<<<< < <========== =!=$=*= 4= ==C=H=O= `= x= = = == ======= == = >>>>>>> >>>>>>>>#>*> ;> S> l> }> >>>> >>>> >>> >>>>>>>>>>>>> ? ? ?????????$?'?+?-?2? "%&(*_? #'(+? !%%%%&'???????????????? ?  @ @ $@$@ 6@ H@ V@ g@z@ !)034568:;;@ %'-/67:@ A .A ;A?ACAEAIAJAKASA ]AcA oAtA~A A A AA A AAAA AA AA BB B$B,B5BFAFDF TFWF]FdFmF wF{FF F F FF F FFFF F FF GG GGGG G(G,G0G ;G IGLGMGPGRGSGUG\G hGpGuG GGGGG G  "%G GGGGGG GH HHHHH"H$H(H*H,H >H NH aH tH HHHHHHHHHHHHHHHHHHH HH H I III'I 8I;IBIII SI[IcI rIvI{IIIIII IIIIIIIIIIII IJ JJJJJ!.;aJ  !J J J J J J J J J K K -K >K ]K ~KKKKK KKKKKKKKK KKKKKKKKKKKKKKKLL LLL *L.L/L1L1L4L5L6L6L;LALFLHLILKLKLLLNLPLYL cL mLqLxL L L L L LLLLLLLLLLLLLL LM MM!M +M3M5M;M=M@MGMOM \MaMaMcM mMsM|M}MM M M MMMMM MMMMNNN N(N/N0N :NCNJNQNYNaNiNqNzNNNNN N NNN N N N NN N O O O&O /O 8O BOIOOO ZO cO pO O O O OOOOOOOOOOO OO P PPP P&P+P3P >PGPPPYP cPkP uP PPPPPPPP PPP PP P P Q Q 6Q JQNQPQSQUQWQ cQgQiQkQrQ Q QQQQQQQQQQQ QQQ Q Q Q R RR *R.R/R5RXDX NXRXTXZXcXfXiXpXuX ~XXXXXXX X XXXXXXXX XXXXXY YYYY#Y*Y0Y :Y@YIY UY\Y^Y`YcYcYgYoY {YYYYYYYYYYYYYYYYYYYYYYYYY!"#$%&'()*+, 憖06eb˝ j'^"^z  G2[Yݯ8|A10Z~25+= 7:\1c\e %)+/5;=CGIOSYaegkmq %379=KQ[]agou{  #-39;AKQWY_eikw)+57;=GUY[_mqsw %'-?CEIOU]ci  ')/QW]ew #+/=AGIMSAgnu  r@  X`XXX Y`OOTT U`UUU V`VVV W`WWW88@8`@ C656@66955@C@d`@  }`|@: }`@  ````` `  @ @  `@  ` ` ``t `@` @` ``P PP QOR >u OP`Q`R ` Q R  z ` Qz  @ `    `  `   L `  ` `  ` C   `    `` ` `@`@  k` `f` d`, ''`+  "" %`  &!% ! ( * @#$ #e       `  `  @`GI`  ,@,`-G 8`II+ I H )`)) +,H@@3-H`H  `gd '`@@8 )`)  ``  D ` `@@`@`  `1 J  F'`I o2 p@>`V@$"$ #%"~ ~} Y~``} }|`||}`~ ` |@ @ `   ` D ` `   ` @ b`ah aba`b b @i c `: !  `!! ! `  j`)g`" `: )@' %$`$$% &%`((( )##` `%`&`'& '&' $ (@ "i #@h"i`#`i"h@ \[[`[U `U ` ~   ` @%``|=`C C`N~M N`OG N N O`@*`iih`i@ i  j``__ ` `h   l `  ` `  ` `   @ o ` ``  @@ ` `    ` ` `  `  !`" ##$`% &&W'`(K` ))m@*n ,,-`.`` @  ` //0`+`1 223`4 5D`N       @  ` `e  `   e` e(`` )`   @ @  ' & & ` 3c ) 1` '` jj`@@.@+@,@-  `` ? @  @ ``C R`r   `98 9@@Z`  "`" ^ii j`jE t `w uctt `t  ` x`s`u!`F ww@n vu`v``us@'@e`vv``  sw`x  x "`  @7 ` %! " $$" ! ## ` ^ _ v` ^CC`SR S 9`9 8989 @p8 G  :`8C r s` >`^^@` `@@@ @  ``  ``2&@ @*@ Z`` `  `++@`@` @$` @ @ ``nn  o nmm`ml@ nl`  `o m  @ `4, ` ` ` @  `` 5  `` `` q `    ```  ``   `` ``   ` `6   ` `    ` `  ``  . `@ ` ``  `` ````  ```   ``7` ` @ ``     `     `  8 `  `  `    `    `    ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `    !`!!! @ S U T`TTT@ U| >S}~U`Uz`  -C ( V  B B  ]`] ]  h`\P @$@ `_{@u `{` ^vvwpnz @w x|   r  o to`T@r w`x@x y `y ` x x y`u@@`| `y ~ yy w   z @{ uov `t`v|   t m s  } `` n m`s `n v@t @`l} q  s `y ` z} t `q ` `wp @  @r q`@`z``r @u n u@~ q@m `m`@@ ` s``ov w s    ``s` z `pt z tsz p @ r { { @ w `  x  u k@`@v  `l  <  `  >  ;+@ N@   @ `` ``{      @ `|` G@( `~} @ $){`{`#| x`z!`z ''$@%z$| }`}" " )$ ~  } {`#@ @{ y `( |%& y}y z`y -` @6- .`.`- `B@`AA`@D`aa  @ @2     )@*` a`@)@* C      `````  `Z  A@@#`@ `Zx@#@ xy xx`  @o `j m n jn n q r @s k`j`kkp k`p q @r lq p `ll`  @ `h hgg  .  @/ @/ ` ``@%@@$=;`&` u`  0  K` L`@`  `M M5 J0    @ ` @ `:  ;;F @E q| s v: ;`<`>`;  <J@ @ |IW  <><u|v u`F =v`uD D D = G F `t@t@G `=:E )@'= >`LY@">@H G @  < @ ` ` @`9 @9@`<`<@  `:; `;:@ =: <`=n @ ` ` ` ;  ;   ` :=  `e `  @  o@& @@ :B@ @`` `_ `` @ R `c ``^ ` ``  sr`rr1@w@` ?I H `I (& J I  `?@ ` `    @ ` ` `    K@  <@9**@  ;   ` ` ` +`+ @     `  `  ` @       f`f @   `` @u  @@p qp`pg.`@ .  /@!s`Ku `@ J K Kt J- uo q`A`G@@ ?`D GDDA`FF @`E F EA a B q`??`?`@`BF`C C@ DEE A BBCC r@yD 4qq r`q` p `wL  Lx x  V X  Y`VV ` `\ V W`WW@ W` X`X` @ `  ` @``YX @YY Z\ \ r b`b` .``  3`&2` 1   t `` ` `76 `   4`` & @   8@  `,@- @@0@1` `4` /@`` @  h`  `  ` ```J @ @- `'` ?` #  `_ _ `   `  ` ``4@,.  @ @\Q`@ `  c`c`Cc edb d`dbd c@ PPQ `` 'O S E P x}D`x `S`FJ y G`GKG@}Nw REKL  POyJM @@K HO`H {| M `OF`KM{`L `I @ O z MLS`PPO N `Fy IL `L} | `E`NN`J~J x  F| S`~HJP@zIGI@N  Q`Q J`O M HE LK #L`MQMQ R`RR ` N`{ K`   @ ` `   b`0 i@`i) ` `gf gf? ``Z`[` A[ [2` [ \ H+ . `@ ,% `g _` @  ] ^`~ @@@~  T `TP P @Q }`<C`C`> @^` s@`i   @ @ `@ `ON`( (  @ @``@ `   aZ Z `XXXS Y`VVV`ZU V`U UU X W`Y@TR S R Q `R `WYYW`~WT@|`kk+  + ,`,,`  ``  @ ` [`Z@@T @T | U S Z [^? @< jp 0`= j `#*= ``= ; "` > +" #`$ $_` ; ) *0 > *# ; @ < # %+l@? /%`/nm p mo`l@ `0`{`o.%`` ,`- -> ,-mq l@  ./@q`%.$+`,@k @nk `.$ ,`*/@ p `@o `+-@    ``(  `/ h@/ 0`/`X _  ` @%`l  @@/``  *`g ` ) ` i  c>%)s`>B AA B@B`  $+@ &` `   ``  `` ` ` ` @ @ @  `D *`* `^` k`   h ` h %   v`L@ LK` t a``=`` @  ` V V \\`\V `a@   @ ` y  M  M@@``@"`M@`A B `@ 1@ @ 20@`1 A r@B A 12 3`334 5`55175 6`66`7`267`4 7 234 4 ` @`000  1 `1`@1j1@8`8 257`2 72 83 5 l 3266 6`6` `74`3354`4`5 47 G ] ^`]@e d d @c X @f ]a b ^ _ @` ^ a @W f W ]  @] \ Y @Z [ X [ `e e@l j dg dk f`g`d`egk +l de gf`f f c h`j j m `h @h @` k ` !`WW@ `nn ` o @`>>`  `   `o    @ `$ s     `@     `&%r   ``q@@ `&@" `~`@g6@e ```v@` t`** ``@ `l 4 \`  `  `  }   $`#q#`` @p``s@_ $@ @1 !@f@@ @\ ``   ` &s "``` `G`  @ ```@  ``` `_ `!   @q lk` `#```)@.e e #"``&  `%``f%`@@sO`"`y;@cbb@"`@@ @@ @ @ @|:@@@@@ ` Y@&@! __^@`a 9@14.@@5A ` @@ `@\  (' '`('`3@4@0 f`   /`A `!@}```.1@xyw`&`` `@b@`@) *`**`, -``zv@#   @``v@v~`== >`>= `B `` ` @~~``Y@d +@F`K G RGIO J`JJ K`LKK LLL M P I H`H N`MI`I`PPP QN ONG`QQJQM`N`RRM SR`SSS TH`TH z@|:@@9`;c````@@@@`z@@`` ``l`` r lk`__^q~B <;@`  `4/@y@@. t`t0822^1@  A B A@``  `  ``{@4`@ `i<@e ?@@ %|;@@`ut(  { o` # jz`"!ll m`mmm n`nnn 00@//7@@33`@@r  ` ``@`t@`21@@jke` `@ @9c@`[  `j@@d`` \ `  `>`? ( `:`ooo p`ppp q`qq@a {```G a?`j k `@c ! ? @`@@b`w @27`@@&]@@  @@Z@[`[[]\`Z `@]]\de`    ` e@ 7@3 w ` igfh ig h`hh`g g`ff`@L@ X`X`%!`" "!`#`$#$"@* +*`` I O`N`IL6 Y` ?$W@5 $`l@ @+`@mm@n@oQT ` 9 <<S`    ` @@@ f9atJ @ mPR` ` c ` K %~R` ` 88 6 @ `} ```z!  ( ([)@ @ @@@@@@`;`D E@]@`;@> `S ST UR`U`^/[\@\\`,\ ~ `@`(% @PO@P@z`))`.=.= @7@@@@`b`@__: `HGN 3U]`/ ^,`y@o`  ` [@>@- ` a@sA@u`` `! ;2 @6@= @  C@CBDCY`Z *`* 0"`c<2w] @{0ED`E`F]P`2@@qF + TRSS`R {/U: ;`    `-5@{ M N@` `& &`@@ uv3uu`3``}||`( `AK `@@`{@:_^0 H`MtJ st`rrre@i@AjAjBmjfnnm@k@lkihd@mp@ppBlgo@gdilkf@n@hhgemv`KJ KH@`111 2 4~@|y x`w`x yw@@z @ r ZZ`@6`'+C@B` }  @@}` f i j p n o l r h v g @ 6@S e `` M @M p`tD @a K s a ` ` @ @  g ? > a@ +@+ ` @    @ ` a ` n o@ X@  @  ` @9 9zj @ k @ `     # ` @S @V V @`` W #%A@ &  q @ h m n o @p @ ) j`    @        @ @  @  /@rq> `7@7.=`s r s ` m @ k @l @ ` @ @ @ `@ @   @ ` @` 9 `0` @  `J } @>@ @V @  ? N  3 ` `    ` s   `   ` ``   @ ~@ i ( @ Y | | j K @K k @k K J j ``[ v @ t u @ u v   `  ' `^_@ @  ~ H J ` `L  ` F  `T@Q@  2x ``3`2 3@77 Y Z@ @   u`T@ wx  x`~ P , `  ` ` ` ` ` @J @I H _ @H I ] @G ` `u@`pp `h i@ @ J I I @_ ` G G `` x @ ` @ M M L @L L  J `E @  @M o ` L s @ b @ @ X O N ` ` H J `|  ` ~ ` ` @s ] H  D ` {   ` ` = = GW ` _ jj ` _ `_  DFE  F  ` ` F V `?@ ` y`q K G` @ ` q ` @ @ ` S@ ] @ Y X @ ^ _ @ @ Z @Z @g Z [ d @\ @a b [ c c @[ e f g f f d g h h h i @i i i  @      ` ` `{ ` Y Y Z `[ [ `] @Q @ Q @ z [ * \ 7@ @f V R `R @ @ _ @ @ @ @ @  @ @  @ K L @_ ` @ \ K K `X Z X @ @K @ b Z @ \ \ @ @` ] @] ] _ ` a ] ` [ a @ @b e c @ @ @ @d @c @h @ M W @ X Z b `Y \ ^ @^ ^ a e @e d g @ [ @ P @j j @ @U `Z m`  @ `@x ` `  z`H  @X`I@@:9 QV7` G @?@oe@x `y` `k @5 - .` ` W&@@_ %[ ` O@ `PQ@P` Q R ` @@QQPQ @@ ` `   `  ` `  ` @  ` ``   *  @VK@@@@@z`wwx|`t v` +@` `c ` c d `d e d d @b O c @  ``  T @   ! `   @ u ` `@N  r` B    E @ D  0 @ y y @ `   @,GW @ @O @ w  ` @ `o  @ M{ @   @    @  @   ` C @C C UT ``T5U z 6` `  ` ? @y @ y @ `  c     ` w 5@f@   @ V ` | ` I @W { M@  ```~ @ } t ` @ @ @ n I  :;`;:`?` ` @i@@j   `    n h` @   @e@@ l``f@k@   ogp @` @@ `+Gv`  `O  w  `x  KL y@w w zw P `|z@@ )g`^ ` @ @ ` ` ` ` x ` ` ` U ` @ ` @,` 21S@b/@//.  y@/0@0@ ` ,` 2f i j p @n @o l @q h @v `B@ @ @g B @f B C@`C@i C @j `  W @WYCa N P @m Dm n `D@ o Dp @r r @s @k k l @ ` E  ` @ @ @ @q @  @ @ @ @ @W g q  J  @h DN E t `E @t Et E @u ^ Fu `FV ` ` `  H )R@ '`'`  '`'`( H @  `D ` `@   `@   `  @ P VrT h U @OO `h u`i`} `  `$@@ @ ` @ V`== ><`s@t,- L n n `n F 3A 5@ @S ` 4F`3 `1A@ @   @ @  @  @  @    @ @   @ @ @ @ @    @  @    @    @ @ @ @    @ @   @             @          @   @  @ @ @  @  @ @  @ @  @ @ @  @ @ @ @ @ @  @ @ @ @  @ @  @ @  @ @  @ @ @     @ @ @  @ @ @  @ @ 2 Q @W `@) `U @@O @N k  Q S u@q `\\ ++ ,,`# -# /`.yTT B| -`m 25@2`3@[/3@0 o o p `p p p q .q `.`4 $4DTVdt$6f8L`taC(<CCPdx0aXaDDLdLg6$4,@TDh|0DTdt0L6LDLhDDLD(VLVpVDDLM@P`pV4 VlE0@P`phE 0aa77hhi PYtYYYYZ(ZLZpZZZZ[$[H[l[[[[[ \D\0 @ `P t)))))))**(*<*p  0 P*d*x*@ P ` p (>Lo@chc G* ** 0@P`p* 0*>++,+@\\PG\`@+T+h+|+>>p++++++,,0,D,NX,l,,O,,,,,, - -4-H-\-p----ocG----.$.8. 0L.`.>t....o>pP `.?.(?.p//(/!!^ y   ' !PS!>ZZZ ~Z/oOZe ~BhE+a ' gx  6 x y  V"k  P # 9 !5  X  %  / (   3j  / SM : xYbeve  f { 9  * H Q v x ; M y N b : B P ?O#1E\tZ21F111-xY1^:-"""?"."Q""#&#9#"v""!!"t'$|(+g--$-N-m1O3t('k38:2[22j3>1 1 2(2v23S01*30a < 2;2 3~%%$1M%()f(.(HD)('x))I*j)'''g)(+E&&8--%b##f&-L'!z-K/,|,@<2"0N$6$.u ( &'0$;n0:j00Mp"!O,*50,2&4.g,e/>&.&V~"gx k   :  y P # 9 6 x  !5  ' X  %  /? 0/756I6~#N8|666u87:7m7 (lZ'''^.&''E+V~"gx k   :  y P # 9 6 x  !5  ' X  %  /?>O!Z-!.;:d;x:43`44445*5Z5555 666[66666*7P7{7(7778@8n8888.9T9|9999'|;;q<<<<@<-``^`..-"/S/t(:--"""?"."Q""#&#9#"v""!"t'$+g--$-N-11la.a_1a_s_bbabk38^; fJe5rhJ-JD C)I*j)JC@JUJQKC32K b/BcnD)>'bsa! >==.!!E+ u!u xYb{J=JJS011m1[2221:2(2*30v2a < 2;2 3L()f(.(H('x)'''g)(=Y-g1C<#'JT !/\`kn-$-?K%Xj"2`MP#d6@7kG0^/]#M~p+Y%)+)v C ')y0hw"++33qbb ^ba]] \:R)r+ִ_Uۯs+`'\B3).Zg->z-^3g,,--$-$:--xN-"""?"."Q""#&#9#"v""!!"t'|(+-$~%%L'&&8-8=-%b##a < u$!,&f&M%u ( -,D)'''NK,w?e`'gw$!E+ .!u! xYb|,7X555~#756I6N8|666u87:7m7:ZE+Z>/E+OZ^rZZ^ (8H+EZZ%>%"""?"."Q""x#&#9#"v""!!"b##a < -M%%$|$%&^.&+EV~"gx k   :  y P # 9 6 x  !5  ' X  %  /?:~%M7X5558756I6N8|666u87:7m7"0L9r929$6$3/N$( ~#lZh ^?=>jKy0v C| 'wxVP b8?`N@*=Mt"" pY;IcE+V~"gx k  :  y P # 9 6 x  !5  ' X  %  /?OZx> ^ZZZ$0>JZZgZ|>3gZ-xZc>PZuZ>xcugP!Z^yE+  Z^3ZN3,Kuaxs^cgP!>Z0G0x0n0"0>/OZZ|1W1##11n0>"01/OZZ?& ^j C"8Uc>bZ|>^3jC" Z>0Z=|>IZ>Z^Z j %;_^Z^j"> "6v C|'  P;[z;8 E+V~"gx k   ZT('''(f('|t(.(H^(D)('x))(I*j)g)(3>()v C ')y0hw=Kx"++)("(8*("^+ t*R)r+*+%)+4)))*))**#*&`*****:***+4+I+++ ?[/pY!S!Z<^y0v C|j 'hw=Kx\_/ZZ>/$OZxZ:Z&>+4T4|40,2444*5n0"031l/3OZ>e0,2&4x:O+4M*5z1lZZx-Z( x< a -756I6N8|666u87:7m7u 8>:8"03/Ml !Z!!E+ .!u!u xYb!pYZ! ^!E+ .!u!u xYb "!x>!gy0v C|j 'hw=Kp"!|!Z."Q"?"^3e"$Zv"!""""?"."Q""x#&#9#"!"> ^O!ZaJ0K#Zb#~#7X555#"""?"."Q""x#&#9#"v""!!"756I6N8|666u87:7m7^>Z8 9>n0OZ##1x1#-Z$Z6$xN$-Zw$Z$"""?"."Q""x#&#9#"v""!!".!!E+ u!u xYb|$$!>!g>pY$w$NZKJ+-JxDt(| C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJ'QKC3>^3shJ{JJk38JJS0r11m1[2221:2(2*30v2a < 2;2 3LIEIsI =H&Y3>c(g,Z$Z%"""?"."Q""x#&#9#"v""!!"M%$|$~%!E+ .!u!u xYb>Z>&x3R&"""?"."Q""#&#9#"v""!!":>Zf&-x&9-:&^.&+EV~"gx k   :  y P # 9 6 x  !5  ' X  %  /?9 8a::>M>&lZ&"""?"."Q""x#&#9#"v""!!"^3>&-&8':$R&:!M$;&##1N$3lZ2'xOZL'x>p2'"!Z`'Zt'$|"""?"."Q""x#&#9#"v""!!"$`'Z''EZ'>|r^EZ'Z.(H^Z+N!>'''0,u,p"!!Z,0,2ZS,^g,:>OZ|,x,O:>-Z>,y=|,jK0v C 'h^wxp"!gZ,x -,:O>-Z.xM$:Z.:>Z..>x^!E+ .!ZH.~..>...ZI//..MlZ/> 0//I/H...~..ZS0Zj0^0Z0a x< -u ,/>O>&0$Z000 11p!"EZ3^'|3jZ3>!x.!!E+ u!u xYb!pY3||3Ny0v Cj 'h^w=KZ3>3xgNZ 4>3x#4gPZ:4>x3`44445*5Z5555 666[66666*7P7{7(7778@8n8888.9T9|9999!y0v C|j 'h^w=K 43a!#4s.!!E+ u!u xYb|002'`'3Z:::V:Nh!!!|P!gZs:!E+ .!u!u xYb>!::V:::N:8^x;=|0,K!+gP!Z::;::4d;x3`44445*5Z5555 666[66666*7P7{7(7778@8n8888.9T9|9999'|;;q<<<<@<8^7;!0!y0v Cj 'hw=K:V:::N:!E+ .!u!u xYbs:;,/PZ=Z=x^y0v C|j 'hw=K !yZ"=W==x^y0v C|j 'hw=K=Z=.!!E+ u!u xYb=x= ^ >==#>cgpY3!P!!2'!3w$|>>Z9>^H>sZt>>cW>>>>^NPg00>Z?!?>?>x ^>>>gP!t>cp"!NZ2?H?.!!E+ u!u xYb!a?^3!?>?>?xy?=?!?Z?>?|=!.!!E+ u!u xYb3H?!|Z@6@j@QAAd@?@-@AA^|A0 ..BZZFBB!E+ .!u!u xYbB>!0|=3!|(ZBZ#C> C3x^;Ct(|(!NZVC>2'wCjCCNxC^+Ey0v C|j 'hw=K3!p"!P!,u,gZC3x!ZC>^3CCsx3 C#C!>&,u,p"!C!y0v C|j 'hw=K/?wC,Z>XDD}Dx9D^3ZDD^xOZD>..|}DxXDD!D3ZD'|t( C)(I*j)11:--x"""?"."Q""#&#9#"v""!!"t'$+g--$-N-!EZD)ES0gZ_E>EDZ'GEEeFFFxF0F^g..ZGGG]G_E+HGDFeFFxE!gF0FZVHHD)G#CZI>H ^xHEIsIZI>^+'|H#C;C!!0IDt( C)(I*j)11:--x"""?"."Q""#&#9#"v""!"t'$g--$-N-ZI>x3!ZI+(GGGD)!'''>Z()'''t(R)j)%)+)I*|)v C ')'y0h^w=Kx"++(r+hJ-JD C11:--"""?"."Q""#&#9#"v""!!"t'$+g--$-N-JC@JUJQKC3Z0LZZLLZL>?y=|x ML,j{J8^0L!?>?>?!Lc>P!K0!=00v C Z0MM8^lMZM!?>?>?x!3y=,0v C|j 'h^wK!0aZNON?xMZN>gZNN|N!ZQ Rx2ONNO!aO0QZ2ONNaO!ZOxNN!P!y0v C|j 'h^w=K!?>?>?>ZO>ONOxN2O!ZhP1PNN!Z Q>P2ONNPx1PhP!ZPx1PhPNN!P!y0v C|j 'h^w=K>ZAQ.!!E+ u!u xYb2ONlQQO Q!gPNO!0|3>ZQx!gZDRAQ=2ONQx RZ SxRR!?>?>?RRc.!!E+ u!u xYb|2SSS8^sSSS3!!P==?>|3Ky0v Cj 'hwZSRT?SS Sx8^sSS|R!E+ .!u!u xYbZT=UWTT3x#U!?>?>?!E+ .!u!u xYbTSU!!gh@J-JDt(| C)(I*j)11:--"""?"."Q""#&#9#"v""!"t'$+g--$-N-JC'QKUJC3K=?|0ZUTWTT3x#U!?>?>?V?0ZQVZVZVWZXWWXW?>?x[=[Z[^[[[\6\8^[>!!!P2'|g0ZY\ZZ\:4x3`44445*5Z5555 666[66666*7P7{7(7778@8n8888.9T9|9999\\Ly=|SRlM8^0MBs]0v Cj 'hwK?!.!!E+ u!u xYb 43aFB M,?!>L>!H=Y\QVWZDRUTWTT#U!?>?>?NcW=?Z?] ^x!e]/Z]] ^|3Z]] ^]ZD^rh^ ^Zs_|^ ^_`_^`1ax_]]_C_`>^J`aD^h^3?] >]!!E+ .!u!u xYb!g2'= z`>!3Zaa>``|^x`_]] ^^C_ baaa_1as_bbb ^bhJ-JDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$+g--$-N-JC@JUJ'QKC3ay=0v C 'hwK*byE+  Pbqba8= c?]!] >==.!! u!u xYb3D^h^0,(ZBcZwcxc!..Zd>hfxd1dNeJe^ f..>&!`'ZfZ!gAifZhAif|i!gig hdhght(!%)('''+j)3?"xy0v C 'h^w=KZ6dJehf;t('|xx'''e5Qf'jup]pNAk^=1-1:-"""?"."Q""#&#9#"v""!!"t'$(+g--$-N-k38ڊo]odH fZrkquwvcj3kܞswݠs%swؓ~js,jܔ8nd1RlsmAi.lpnkbyzm[t!i!ghiig hdhgZiAif|!g3!Z'j3x^~jj3ke!>&..y0v C|j 'hw=K=Zkkt(hf!21ZRl>ne]olosmNhfpd1 mm8nndd'j]r fJeBqqnrr%sss[tupptu ^qukuCvvwsww'''Bx>&..!c!xpYk/0Z|xy0v Cj 'h^w=Kx !N!p"!Zxx!ZyZryxxyhf'''|kk_zdNdzd1JeeRlsmmnBqr%s fss[tupptquuvsww mq'!y=?=0v Cj 'h^wKy3`'Zzf|r{eN{j^{|yxxA|Airy!Zef|NAiv}r fJehf]d1xx'j ^~j`}Rlsm}@~uv88jyryp~r{{{z|A|m>!_zddkk!Z ef|j^'j fJekk!>Z;>..pZ Є..MlZG>υЄ ..;pZx.>ZNed11:--x"""?"."Q""#&#9#"v""!!"t'$|(+g--$-N-fdd1we fJe''''t(k38^1m1[2221:2(2*30v2a < 2;2 3hfjx'jɇA>y^/xڊA%)+j)!$,>&c../kkryG;υ3Zjދ ^ƌߍt())v C| ')'y0hw=Kx"+)+R)r+%)('''+)I*>8(*RPn..&96@d@?@AZ\Za>*(Sߍnt((*\ 6_ڏ|8^ۑ))v Cj ')'y0hw=Kx"+)+I*ܐ5)'''R)%)+..!R@AZ>(ߍnt((*\|8^)'''R)j)%)+)I*..!)v C ')'y0hw=Kx"++R@AZҕdkket(f|'''^'j fJe]hfZr';kquwvxx5QuppNA=1-1:-"""?"."Q""#&#9#"v""!!"t'$(+g--$-N-k38ڊo]odHcj3kܞswݠs%swؓ~js,jܔ8nd1RlsmAi.lpnkbyzm[t~e%)+j)ry>)v C ')y0hw=K"++ڏߍ ן2!D)@QA..6@n5ܐ(*\*ۑ3"?/.>&=tCvnr_zrnuBq.!!E+ u!u xYbBx cpYAu`'Zt(|:--x"""?"."Q""#&#9#"v""!!"t'$(+g--$-N-11'dJehf;x'''e5Qf'jup]pNAk^=k38ڊo]odH fZrkquwvcj3kܞswݠs%swؓ~js,jܔ8nd1RlsmAi.lpnkbyzm[t-Qr vI!Bc%)+j))v C ')y0hw=K"++/Zw-JxDt(| C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$+g--$-N-..cBcwc3#CZ5r|rc fJef]hfeZZZӢ ^'| /xH=[yE+  N!gP.!! u!u xYb >3=>!Ztxx; fJeɣZ\>S ^xZ>3ޤxSZcS0gZɥ>cZ%QɥzcxL!gZҦD)%#CZ3>xk'|c fJef]hfeZr;quwvj3k}dt(x'''5Q'juppNAk^=1-1:-"""?"."Q""#&#9#"v""!!"t'$(+g--$-N-k38ڊo]odHܞswݠs%swؓ~js,jܔ8nd1RlsmAi.lpnkbyzm[tHӢ 35$J-JD C)I*j)C@JUJQKC3ɣӧKkhJ%)+wcbD}D ̨!/J3)v C ')y0hw=K"++KKKKD)f(Oc-t%;CL.((('x)g)(Ҧ#CK\?ޤZ.!!E+ u!u xYbx!ZI!?>?>?xvZZxJ+-JDt(| C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJ'QKC3ĭk38^hJ11m1[2221:2(2*30v2a < 2;2 3=JHK3(NJ3z-S0rLy0v C 'hw=K;CLVHu,KKaZZ ZQcZ_t(|r8^xZۯt(|KJ+-JxD C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJ'QKC3LD)JJS0rk38^11m1[2221:2(2*30v2a < 2;2 3L2'#CZ>Ut(|!)('''R)j)xZѰt(|)('''R)j))v C ')'y0h^w=Kx"++r+..>(:*Z\t(|%))v Cj ')'y0h^w=Kx"+)+('''+6@!Ad@@!:*Z>q.!x\!E+ u!u xYbD ^.r!-y0v C|j 'hw=Kgc!3$..Z>t()('''R)j)%)+|)v C ')'y0h^w=Kx"++r+ܲ+8..D)=!=(Zst(|x+%))v Cj ')'y0h^w=K"+)+('''+..ܲD)Z..t(|))v Cj ')'y0h^w=Kx"+)+R)r+('''H%)+!"!)(?:*Zt(|)('''R)j)ִ%)+)v C ')'y0h^w=KxZ'|..xRZZ'|,t(R/Zg Z(..y0v C|j 'h^w=Kxd@&Kֻ>!!=6@A A?@Z(>) y0v C|j 'h^w=Kxd@&x*(gŹ@+x'''Z..!t(!)R))ֻK="Z=`'A6@Z ^Fxt(|޽{R,>&>ZxZEF^xt(|''')(I*j))R)%)+RD)..Z>'''m&U(..Z'|''')(t(I*j))R)%)+(f(.(H^D)('x)g)(YFxR,(>Z=^,6@j" ?d@(*t(''')(I*))R)%)+YA>ZyF^xt(|''')(I*j))R)%)+Z>^3xy0v C|j 'hw=K?8V',% /N,Zt(|F^x''')(I*j))R)%)+FQA)v C ')'y0hw=K"++r+4)+d@A@AR/..޽?Z8'''(..0!yE+  N!x0>Zjua'|xF^t(''')(I*))R)%)+8y]mU[y0v C 'hw=K1*(@x+iŹ R0..!>,6@"?-d@AF/?Vx?"޽80))"++r+(=D)Z|a_^`|1ax_`s_bba't(''')(I*j))R)%)+F^96@A(*u]1[!aRA{ZN!>00!Z$`y0v C|j 'h^w=Kxq..Z>$ZZJT!>!ZJ/T\"a!.!!E+ u!u xYbZJTZ0JT!xy0v C|j 'h^w=K8ZuZJTZ JTGZ!!E+ .!u!u xYbJT$Z9x}g$w$!|ZVJT!Z"d0JTc!^! V!E+ .!u!u xYb/\0Z/JT09}\!G gZ.!!E+ u!u xYbJTV"d0c!^!Z)Jg.!!E+ u!u xYbT/\0n !'`k"d[^\a0"dc!!JD|}Dx0a..D=g$0 ZJ.!!E+ u!u xYbd0T"c^!!' !/\`kn0g[Z#.!!E+ u!u xYbJT' !/\`kni^Zg'(!?>?>?x#'.!!E+ u!u xYbJT !/\`kn!>0%>Z>ZZ!Zx>ZZ#'.!!E+ u!u xYbJT !/\`knC11t(|x-:-"""?"."Q""#&#9#"v""!!"t'$(+g--$-N-'k38^).KJ-JD C)I*j)C@JUJQKC3JJS0r11m1[2221:2(2*30v2a < 2;2 3L! >==y0v C 'hw=KD)3z->i?Z;>xj-..Zlt(|3?"."Q"!%))v Cj ')'y0h^w=Kx"+)+('''+;:*ZZ(t(|8^ >%)'''+j))v C ')'y0hw=Kx"++?"/D))I*ZV>xapIJt(|+-JD C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJ'QKC3K=^hJH;Cu,KJB!wK/wCJD)S0rk3811m1[2221:2(2*30v2a < 2;2 3LZ| ^x!?>?>?!2 >-'KJ+-JDt( C)(I*j)11:-"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3a_^`1a_`s_bba`"2'&%b##a < %>&=./ bZMxy0v C|j 'h^w=K*'2"`N-:--"""?"."Q""#&#9#"v""!!"t'$(+g--$- >KJ-JDt( C)I*)11C@JUJQKC3a_^`1a_s_bba`%k38XjPhJb]] ^`qb2!?>?>?Hm # bs0(=!11m1[2221:2(2*30v2a < 2;2 3x3JKKKKz-L'D),?=>Z)f(.(('x)'''g)(-q&&8--%b##f&-/JS0rL==.!!E+ u!u xYb>&0Pb%0,C_756I6~#QZx$PKJ+-JxDt(| C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'g--$-N-C@JUJ'QKC3a_^`1a_`s_bba2 >`"$%b##a < >&-R&L'30 b/!0%Q^Z$-x:-t'"""?"."Q""#&#9#"v""!!"|(+g--$-N->!$>&z-&%b##a < ^7X555~#756I6N8|666u87:7m7Z-3!ZfZ-x"""?"."Q""#&#9#"v""!!" Emft(8^|%))v Cj ')'y0hw=K"+)+('''+11:-t'$+g--$-N-k3 H5*&%b##a < f& NAfZ()f(.(D)('x))I*g)(&8}Nnߍ(*\5ܐڏۑ..`'.,6$>0!33a2'6@0,!E+ .!u!u xYb0>&34)+&%|?N$756I6~#N8|666,A(MlZ#'|!!Zd#'|6J+-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3 >!K==.!!E+ u!u xYb=#CZ#'|+!J-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3K=f(.(H^(D)('x)'''g)()Z#'|J+-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3K >==.!!E+ u!u xYb!=Z@#'|=J+-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3K=!==Zm!/x0Z#'|KJ+-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3!?>?>?m >!==.!!E+ u!u xYbZ&"""?"."Q""x#&#9#"v""!!"-&8J|r+J-JDt( C)(I*j)11:-t'$g--$-N-C@JUJ'QKC3xK=!wC=>aZ'|+JrJ-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3Kx^J=>2'>&a!=ZH.!!E+ u!u xYb|+!ZZ=x^y0v C|j 'hw=K!?>?>?KJ+-JDt( C)(I*)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJ'QKC3./>!JaZG'|@J-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$+g--$-N-JCQKUJC3K^k0^/]#M~p+YHJJS0rk3811m1[2221:2(2*30v2a < 2;2 3L()f(.(HD)('x)'''g)(!=> >Z7#'|KJ+-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3^kG0^/]#M~p+YJrZb(|t()f('.(H^D)('x))(I*j)'''g)(>1-1:-x"""?"."Q""#&#9#"v""!!"t'$+g--$-N-k38; fJe5rhJ-JD CJC@JUJQKC3%))v C ')y0hw=K"+++ vIdAxkef=5'jhfQup]pNZrkquwvcj3kܞswݠs%swؓ~js,jܔ8nd1RlsmAiڊo]od.lpnkbyzm[tQr!/w6HӢ }35$ɣBc(:*Z1bt(gKJ+-JxD| C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJ'QKC3>JJS0rk38^11m1[2221:2(2*30v2a < 2;2 3L==y0v C 'hw=K?VZhJ-JxDt(| CZ=ZpKJ+-JxDt(| C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJ'QKC3=>!aZ^8|(*t(X6@?Z>|3^()'t(('''R)j))v C ')y0hw=Kx"++r+f(.(HD)('x))I*g)(A|6@?d@8(*/A)A@Znt(|x>&!*..Z<>kt(|()f('.(H^D)('x))(I*j)'''g)()v C ')y0hw=Kx"++R)r+A|8b'b#'.!!E+ u!u xYbJT !/\`knpKJ+-JD C11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3=Zk3m - vIs%)++ܲ..2'11m1[2221:2(2*30v2a < 2;2 33(*JJS0rLP'(:*Z"""?"."Q""x#&#9#"v""!!"NZ"""?"."Q""x#&#9#"v""!!"Z%[..>ZK%-x$"""?"."Q""#&#9#"v""!!"M..6$!>&>l[N$Ze+..>Z>!"Z?QM..>"""?"."Q""x#&#9#"v""!!"+elZ8 xr ..Z -x$ Q?8 !>&>MlZN o  "  Z    ; h KZ  Z  d   " N   Cx8 ..>&M o lZd   " N   C-x>Za-x$d   " N   C8 >&>MlZ  " N  :x8 ..>&M o lZ` " N  :-x>Z-x$ ` " N  :8 >&>MlZ)Zd-xt'$$L'>)Z8 x ..Z>&x]..-Zx8 ] Z F..ZbF8 xZZ0bFx>&8 MlZpF8 xZEpZEpFx>&8 MlZ FR8 xZZ FRx>&8 MlZ%L..M[lZh...M+elZb#"""?"."Q""x#&#9#"v""!!"# >D0M>&8 ^756I6~#lZz"""?"."Q""x#&#9#"v""!!"|$!E+ .!u!u xYb>Z KQ1\2 x  !]!!!E"""3#~##$a$Z$"""?"."Q""x#&#9#"v""!!"b##$^N8|666~#Z*> %x++%%-b#"""?"."Q""#&#9#"v""!!"#%P%Mz$|$$>&..!,Gυ^756I6~#u87:7m7lZ>& ^xN&hJ-JDt(| C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$+g--$-N-JC@JUJ'QKC3..Z>{&Z ^x&>.''H|&Z'c'x'('..>-Z+|(()-x(^:-"""?"."Q""#&#9#"v""!!"t'$|(+g--$-N->(t('**)[+8*\) > N*+)a < zS0()f(.(HD)('x))I*j)'''g)(* %++(+E=!~#!$\R&>&..c'0.6$y0v C 'hw=Kd&&8--%b##f&-L'z-/,|,u ( &'M =3&.'&,.g,eG υ756I6~#N8|666u87:7m7(l'Z, ,xO,,0c!>-z"""?"."Q""#&#9#"v""!!"|$,G;..Z$-b|; fJe vI+k',[+()\)D)xJ-JDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$g--$-N-C@JUJQKC3ZY-b|; fJe5r^hJ-JxDt( C)(I*j)11:--"""?"."Q""#&#9#"v""!!"t'$+g--$-N-JC@JUJ'QKC38 >==.!!E+ u!u xYbpY!=3(Z/Z///"0>Zl1)1n0OZP21N$x2n0"0>/OZ~22x>"0N$#1/Z;2x2;n0"0/>OZ2/2xn0/OZ0,23C3zg33n01"0/>OZ3 ^40,23x"0/<n0/>1OZX55556I6|6667:7m7>lZ7X555^7756I68N8|666u87:7m7>ln0OZ< 8/756I6>7X555N8|666u87:7m7n0^OZ 8 ln0>OZ%7X5558^756I68N8|666u87:7m7L9/92xN$r9>Z9 8a:9-::^ln0> OZ:/&9-:9 8a:>N$x"0Z:>;&9;/8x&"0l3N$#1/^Z];/x;2>Z;;2"0#1#1l>3/n0OZ<@</x2>"0internal/abi/abi.gointernal/abi/escape.gointernal/abi/map_swiss.gointernal/abi/type.gointernal/cpu/cpu.gointernal/runtime/atomic/types.gointernal/runtime/atomic/atomic_mipsx.gointernal/runtime/atomic/unaligned.gointernal/runtime/atomic/atomic_mipsx.sinternal/runtime/math/math.gointernal/bytealg/compare_mipsx.sinternal/bytealg/equal_mipsx.sinternal/bytealg/indexbyte_mipsx.sinternal/runtime/strconv/atoi.gointernal/runtime/syscall/syscall_linux.gointernal/runtime/syscall/asm_linux_mipsx.sinternal/runtime/cgroup/cgroup_linux.gointernal/runtime/cgroup/line_reader.gointernal/runtime/maps/group.gointernal/runtime/maps/map.gointernal/runtime/maps/runtime_fast32_swiss.gointernal/runtime/maps/runtime_fast64_swiss.gointernal/runtime/maps/runtime_faststr_swiss.gointernal/runtime/maps/table.gointernal/runtime/sys/intrinsics.gointernal/runtime/maps/table_debug.gointernal/runtime/maps/runtime_swiss.gointernal/stringslite/strings.gointernal/bytealg/index_generic.gointernal/bytealg/bytealg.gointernal/runtime/exithook/hooks.gointernal/chacha8rand/chacha8.gointernal/byteorder/byteorder.gointernal/chacha8rand/chacha8_generic.gointernal/chacha8rand/chacha8_stub.sruntime/float.goruntime/iface.goruntime/netpoll.goruntime/signal_unix.goruntime/os_linux_mipsx.goruntime/select.goruntime/alg.goruntime/typekind.goruntime/arena.goruntime/mheap.goruntime/lockrank_off.goruntime/lock_spinbit.goruntime/cgocall.goruntime/cgroup_linux.goruntime/chan.goruntime/stubs.goruntime/time_nofake.goruntime/proc.goruntime/runtime2.goruntime/cpuprof.goruntime/debug.goruntime/env_posix.goruntime/error.goruntime/symtab.goruntime/traceback.goruntime/extern.goruntime/fds_unix.goruntime/hash32.goruntime/histogram.goruntime/metrics.goruntime/atomic_pointer.goruntime/type.goruntime/rand.goruntime/lfstack.goruntime/tagptr_32bit.goruntime/lock_futex.goruntime/msize.goruntime/mprof.goruntime/lockrank.goruntime/malloc.goruntime/mem.goruntime/mem_linux.goruntime/mfixalloc.goruntime/mcache.goruntime/runtime1.goruntime/mbitmap.goruntime/traceruntime.goruntime/fastlog2.goruntime/map_swiss.goruntime/mbarrier.goruntime/mwbbuf.goruntime/mcentral.goruntime/mgcsweep.goruntime/mcheckmark.goruntime/mgcmark.goruntime/mcleanup.goruntime/os_linux.goruntime/mfinal.goruntime/mgc.goruntime/mstats.goruntime/sema.goruntime/mgcwork.goruntime/mgcmark_nogreenteagc.goruntime/print.goruntime/mgcpacer.goruntime/mgclimit.goruntime/stack.goruntime/mgcstack.goruntime/mgcscavenge.goruntime/time.goruntime/mranges.goruntime/mpagealloc.goruntime/mpallocbits.goruntime/mpagecache.goruntime/minmax.goruntime/mpagealloc_32bit.goruntime/mspanset.goruntime/netpoll_epoll.goruntime/defs_linux_mipsx.goruntime/sigaction.goruntime/panic.goruntime/panic32.goruntime/pinner.goruntime/preempt.goruntime/symtabinl.goruntime/write_err.goruntime/runtime.goruntime/stubs2.goruntime/string.goruntime/rwmutex.goruntime/security_unix.goruntime/trace.goruntime/profbuf.goruntime/retry.goruntime/set_vma_name_linux.goruntime/signal_linux_mipsx.goruntime/signal_mipsx.goruntime/sigqueue.goruntime/slice.goruntime/softfloat64.goruntime/sys_mipsx.goruntime/stkframe.goruntime/synctest.goruntime/tracebuf.goruntime/tracestatus.goruntime/traceallocfree.goruntime/traceevent.goruntime/tracetime.goruntime/tracecpu.goruntime/tracemap.goruntime/traceregion.goruntime/tracestack.goruntime/tracestring.goruntime/tracetype.goruntime/unsafe.goruntime/utf8.goruntime/vlrt.goruntime/timestub.goruntime/vgetrandom_unsupported.goruntime/asm.sruntime/asm_mipsx.sruntime/memclr_mipsx.sruntime/memmove_mipsx.sruntime/preempt_mipsx.sruntime/rt0_linux_mipsx.sruntime/sys_linux_mipsx.sruntime/tls_mipsx.sinternal/reflectlite/swapper.gointernal/reflectlite/value.gointernal/reflectlite/type.goerrors/wrap.goerrors/errors.goerrors/join.gosync/atomic/type.gosync/atomic/value.gosync/atomic/asm.sinternal/sync/mutex.gosync/cond.gosync/hashtriemap.gointernal/sync/hashtriemap.gosync/mutex.gosync/once.gosync/pool.gosync/poolqueue.gosync/runtime.gosync/rwmutex.gosync/waitgroup.gointernal/synctest/synctest.goio/io.goio/multi.goio/pipe.gomath/bits/bits.gomath/bits.gomath/cbrt.gomath/exp.gomath/ldexp.gomath/floor.gomath/modf.gomath/abs.gomath/frexp.gomath/copysign.gomath/log.gomath/log10.gomath/pow.gomath/signbit.gomath/sqrt.gounicode/utf8/utf8.gostrconv/atof.gostrconv/atoi.gostrconv/quote.gostrconv/itoa.gostrconv/decimal.gostrconv/eisel_lemire.gomath/unsafe.gostrconv/ftoa.gostrconv/ftoaryu.gostrconv/bytealg.gocrypto/crypto.gounicode/tables.gounicode/graphic.gounicode/letter.goiter/iter.gobytes/buffer.gobytes/bytes.gointernal/bytealg/count_generic.gointernal/bytealg/lastindexbyte_generic.gobytes/reader.gointernal/bisect/bisect.gointernal/godebug/godebug.gointernal/godebugs/table.gostrings/builder.gostrings/reader.gostrings/replace.gostrings/strings.gostrings/search.gocrypto/internal/fips140deps/cpu/cpu.gointernal/itoa/itoa.gosyscall/env_unix.gosync/oncefunc.gosyscall/syscall_linux.gosyscall/netlink_linux.gosyscall/exec_linux.gosyscall/forkpipe2.gosyscall/syscall_unix.gosyscall/exec_unix.gosyscall/syscall.gosyscall/flock_linux_32bit.gosyscall/rlimit.gosyscall/sockcmsg_unix.gosyscall/sockcmsg_unix_other.goslices/slices.gosyscall/zsyscall_linux_mipsle.gosyscall/syscall_linux_mipsx.gosyscall/asm_linux_mipsx.stime/format.gotime/time.gotime/format_rfc3339.gotime/sleep.gotime/sys_unix.gotime/tick.gotime/zoneinfo.gotime/zoneinfo_read.gotime/zoneinfo_goroot.gotime/zoneinfo_unix.gopath/path.goio/fs/fs.goio/fs/format.goslices/zsortanyfunc.goslices/sort.gointernal/filepathlite/path.gointernal/filepathlite/path_unix.gointernal/testlog/exit.gointernal/testlog/log.gointernal/syscall/unix/at.gointernal/syscall/unix/copy_file_range_unix.gointernal/syscall/unix/fcntl_unix.gointernal/syscall/unix/getrandom.gointernal/syscall/unix/kernel_version_linux.gointernal/syscall/unix/pidfd_linux.gointernal/syscall/unix/waitid_linux.gointernal/poll/copy_file_range_linux.gointernal/poll/fd.gointernal/poll/sendfile.gointernal/poll/copy_file_range_unix.gointernal/poll/fd_mutex.gointernal/poll/fd_posix.gointernal/poll/fd_fsync_posix.gointernal/poll/errno_unix.gointernal/poll/fd_poll_runtime.gointernal/poll/fd_unix.gointernal/poll/fd_unixjs.gointernal/poll/fd_writev_unix.gointernal/poll/sendfile_unix.gointernal/poll/sock_cloexec.gointernal/poll/sockopt.gointernal/poll/sockopt_linux.gointernal/poll/sockopt_unix.gointernal/poll/sockoptip.gointernal/poll/splice_linux.gointernal/poll/writev.goos/error.goos/file.goos/pidfd_linux.goos/dir_unix.goos/dir.goos/file_posix.goos/dirent_linux.goos/env.goos/exec.goos/exec_linux.goos/exec_posix.goos/exec_unix.gointernal/syscall/execenv/execenv_default.goos/executable_procfs.goos/file_unix.goos/rawconn.goos/file_open_unix.gosyscall/timestruct.goos/types.goos/types_unix.gointernal/syscall/unix/nonblocking_unix.goos/getwd.goos/path.goos/path_unix.gointernal/syscall/unix/siginfo_linux.goos/pipe2_unix.goos/proc.goos/removeall_at.goos/root_unix.goos/removeall_unix.goos/eloop_other.goos/root_openat.goos/stat.goos/stat_linux.goos/stat_unix.goos/sys.goos/sys_linux.goos/tempfile.goos/wait_waitid.goos/zero_copy_linux.goos/zero_copy_posix.gointernal/bytealg/compare_native.gocrypto/internal/sysrand/rand.gocrypto/internal/sysrand/rand_getrandom.gocrypto/internal/entropy/entropy.gomath/rand/v2/chacha8.gomath/rand/v2/exp.gomath/rand/v2/rand.gomath/rand/v2/normal.gomath/rand/v2/pcg.gocrypto/internal/randutil/randutil.gocrypto/internal/fips140only/fips140only.gocrypto/cipher/cbc.gocrypto/internal/fips140/aes/cbc.gocrypto/internal/fips140/alias/alias.gocrypto/subtle/xor.gocrypto/cipher/ctr.gocrypto/internal/fips140/aes/ctr.gocrypto/cipher/gcm.gocrypto/internal/fips140/aes/gcm/gcm.gocrypto/subtle/constant_time.gocrypto/internal/fips140/subtle/constant_time.gocrypto/internal/boring/sig/sig_other.scrypto/internal/boring/notboring.gocrypto/sha256/sha256.gocrypto/internal/fips140/sha256/sha256.gocrypto/ecdh/nist.gocrypto/internal/fips140/ecdh/ecdh.gocrypto/ecdh/ecdh.gocrypto/ecdh/x25519.gocrypto/internal/fips140/edwards25519/field/fe.gocrypto/internal/fips140/edwards25519/field/fe_amd64_noasm.goreflect/map_swiss.goreflect/value.goreflect/abi.goreflect/type.goreflect/deepequal.gointernal/bytealg/equal_generic.goreflect/iter.goreflect/makefunc.gounicode/digit.goreflect/asm_mipsx.sinternal/fmtsort/sort.gocmp/cmp.gofmt/print.gofmt/scan.gofmt/errors.gofmt/format.goslices/zsortordered.gomath/rand/exp.gomath/rand/rand.gomath/rand/normal.gomath/rand/rng.gomath/big/accuracy_string.gomath/big/arith.gomath/big/float.gomath/big/nat.gomath/big/int.gomath/big/intconv.gomath/big/natconv.gomath/big/intmarsh.gomath/big/natdiv.gomath/big/natmul.gomath/big/prime.gomath/big/arith_mipsx.scrypto/elliptic/elliptic.gocrypto/elliptic/nistec.gocrypto/elliptic/params.gocrypto/sha3/sha3.gocrypto/internal/fips140/sha3/sha3.gocrypto/internal/fips140/sha3/hashes.gocrypto/internal/fips140hash/hash.gocrypto/sha512/sha512.gocrypto/internal/fips140/sha512/sha512.gounicode/utf16/utf16.goencoding/asn1/asn1.gointernal/saferio/io.goencoding/asn1/common.goencoding/asn1/marshal.govendor/golang.org/x/crypto/cryptobyte/asn1/asn1.govendor/golang.org/x/crypto/cryptobyte/asn1.govendor/golang.org/x/crypto/cryptobyte/builder.govendor/golang.org/x/crypto/cryptobyte/string.gocrypto/ecdsa/ecdsa_legacy.gocrypto/ecdsa/ecdsa.gocrypto/internal/fips140/ecdsa/ecdsa.gocrypto/internal/fips140cache/cache.goweak/pointer.gocrypto/rand/rand.gocrypto/rand/util.gocrypto/ed25519/ed25519.gocrypto/internal/fips140/ed25519/ed25519.gocrypto/rsa/rsa.gocrypto/rsa/fips.gocrypto/internal/fips140/rsa/rsa.gocrypto/internal/fips140/rsa/pkcs1v22.gocrypto/rsa/pkcs1v15.goencoding/base64/base64.goencoding/pem/pem.goencoding/hex/hex.gocrypto/x509/pkix/pkix.gounique/clone.gonet/netip/netip.gounique/handle.gonet/netip/uint128.gounique/canonmap.gocontext/context.govendor/golang.org/x/net/dns/dnsmessage/message.gointernal/singleflight/singleflight.gonet/addrselect.gonet/lookup.gonet/net.gonet/dnsclient_unix.gonet/ip.gonet/lookup_unix.gonet/interface.gonet/hook.gonet/hook_unix.gonet/parse.gonet/conf.gonet/dial.gonet/iprawsock.gonet/tcpsock.gonet/udpsock.gonet/unixsock.gonet/ipsock.gonet/tcpsock_posix.gonet/dnsclient.gonet/dnsconfig.gonet/dnsconfig_unix.gonet/fd_posix.gonet/error_posix.gonet/fd_unix.gonet/sockaddr_posix.gonet/file.gonet/file_posix.gonet/file_unix.gonet/hosts.gonet/interface_linux.gonet/rawconn.gonet/iprawsock_posix.gonet/ipsock_posix.gonet/cgo_stub.gonet/mac.gonet/mptcpsock_linux.gonet/error_unix.gonet/nss.gonet/pipe.gonet/port.gonet/port_unix.gonet/sendfile.gonet/sock_cloexec.gonet/sock_linux.gonet/sock_posix.gonet/sockopt_linux.gonet/sockopt_posix.gonet/splice_linux.gonet/tcpsock_unix.gonet/tcpsockopt_posix.gonet/tcpsockopt_unix.gonet/udpsock_posix.gonet/unixsock_posix.gonet/writev_unix.gonet/url/url.gomaps/iter.goslices/iter.gocrypto/aes/aes.gocrypto/internal/fips140/aes/aes.gocrypto/des/block.gocrypto/des/cipher.gocrypto/md5/md5.gocrypto/md5/md5block.gopath/filepath/path.gopath/filepath/path_unix.gocrypto/sha1/sha1.gocrypto/sha1/sha1block_generic.gocrypto/sha1/sha1block.gocrypto/x509/verify.gocrypto/x509/x509.gocrypto/x509/cert_pool.gocrypto/x509/oid.gocrypto/x509/parser.gocrypto/x509/pkcs1.gocrypto/x509/pkcs8.gocrypto/x509/root.gocrypto/x509/root_unix.gocrypto/x509/sec1.gomaps/maps.gocrypto/hmac/hmac.gocrypto/rc4/rc4.goencoding/binary/binary.govendor/golang.org/x/crypto/chacha20/chacha_generic.govendor/golang.org/x/crypto/chacha20/chacha_noasm.govendor/golang.org/x/crypto/internal/alias/alias.govendor/golang.org/x/crypto/chacha20/xor.govendor/golang.org/x/crypto/internal/poly1305/poly1305.govendor/golang.org/x/crypto/internal/poly1305/sum_generic.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305_noasm.govendor/golang.org/x/crypto/chacha20poly1305/chacha20poly1305_generic.gocontainer/list/list.gocrypto/tls/internal/fips140tls/fipstls.gocrypto/fips140/fips140.gocrypto/internal/hpke/hpke.gocrypto/hkdf/hkdf.gosort/search.gosort/slice.gosort/sort.gosort/zsortfunc.gosort/zsortinterface.gocrypto/tls/alert.gocrypto/tls/auth.gocrypto/tls/cache.gocrypto/tls/cipher_suites.gocrypto/tls/conn.gocrypto/tls/common.gocrypto/tls/defaults.gocrypto/tls/common_string.gocrypto/tls/quic.gocrypto/tls/prf.gocrypto/tls/defaults_fips140.gocrypto/tls/ech.gocrypto/tls/handshake_messages.gocrypto/tls/key_schedule.gocrypto/tls/handshake_client.gocrypto/internal/fips140/mlkem/mlkem768.gocrypto/internal/fips140/tls13/tls13.gocrypto/tls/handshake_client_tls13.gocrypto/tls/handshake_server.gocrypto/tls/handshake_server_tls13.gocrypto/tls/key_agreement.gocrypto/tls/ticket.gocrypto/tls/tls.goos/signal/signal.goos/signal/signal_unix.goflag/flag.gostrconv/atob.gostrings/compare.gobufio/bufio.gobufio/scan.goencoding/csv/reader.goencoding/csv/writer.gogithub.com/spf13/pflag@v1.0.5/flag.gogithub.com/spf13/pflag@v1.0.5/bool.gogithub.com/spf13/pflag@v1.0.5/bool_slice.gogithub.com/spf13/pflag@v1.0.5/bytes.gogithub.com/spf13/pflag@v1.0.5/count.gogithub.com/spf13/pflag@v1.0.5/duration.gogithub.com/spf13/pflag@v1.0.5/duration_slice.gogithub.com/spf13/pflag@v1.0.5/float32.gogithub.com/spf13/pflag@v1.0.5/float32_slice.gogithub.com/spf13/pflag@v1.0.5/float64.gogithub.com/spf13/pflag@v1.0.5/float64_slice.gogithub.com/spf13/pflag@v1.0.5/golangflag.gogithub.com/spf13/pflag@v1.0.5/int.gogithub.com/spf13/pflag@v1.0.5/int16.gogithub.com/spf13/pflag@v1.0.5/int32.gogithub.com/spf13/pflag@v1.0.5/int32_slice.gogithub.com/spf13/pflag@v1.0.5/int64.gogithub.com/spf13/pflag@v1.0.5/int64_slice.gogithub.com/spf13/pflag@v1.0.5/int8.gogithub.com/spf13/pflag@v1.0.5/int_slice.gogithub.com/spf13/pflag@v1.0.5/ip.gogithub.com/spf13/pflag@v1.0.5/ip_slice.gogithub.com/spf13/pflag@v1.0.5/ipmask.gogithub.com/spf13/pflag@v1.0.5/ipnet.gogithub.com/spf13/pflag@v1.0.5/string.gogithub.com/spf13/pflag@v1.0.5/string_array.gogithub.com/spf13/pflag@v1.0.5/string_slice.gogithub.com/spf13/pflag@v1.0.5/string_to_int.gogithub.com/spf13/pflag@v1.0.5/string_to_int64.gogithub.com/spf13/pflag@v1.0.5/string_to_string.gogithub.com/spf13/pflag@v1.0.5/uint.gogithub.com/spf13/pflag@v1.0.5/uint16.gogithub.com/spf13/pflag@v1.0.5/uint32.gogithub.com/spf13/pflag@v1.0.5/uint64.gogithub.com/spf13/pflag@v1.0.5/uint8.gogithub.com/spf13/pflag@v1.0.5/uint_slice.gotext/template/parse/lex.gotext/template/parse/node.gotext/template/parse/parse.gotext/template/exec.gotext/template/template.gotext/template/funcs.gogithub.com/spf13/cobra@v1.7.0/cobra.gogithub.com/spf13/cobra@v1.7.0/completions.gogithub.com/spf13/cobra@v1.7.0/command.gogithub.com/spf13/cobra@v1.7.0/active_help.gogithub.com/spf13/cobra@v1.7.0/args.gogithub.com/spf13/cobra@v1.7.0/bash_completions.gogithub.com/spf13/cobra@v1.7.0/bash_completionsV2.gotext/template/helper.gogithub.com/spf13/cobra@v1.7.0/powershell_completions.gogithub.com/spf13/cobra@v1.7.0/zsh_completions.gogithub.com/spf13/cobra@v1.7.0/fish_completions.gogithub.com/spf13/cobra@v1.7.0/flag_groups.gogithub.com/spf13/cobra@v1.7.0/shell_completions.goio/ioutil/ioutil.golog/log.gogithub.com/spf13/jwalterweatherman@v1.1.0/notepad.gogithub.com/spf13/jwalterweatherman@v1.1.0/default_notepad.goencoding/json/decode.goencoding/json/encode.goencoding/json/scanner.goencoding/json/fold.goencoding/json/indent.goencoding/json/stream.goencoding/json/tags.gohtml/entity.gohtml/escape.goregexp/syntax/perl_groups.goregexp/syntax/compile.goregexp/syntax/parse.goregexp/syntax/prog.goregexp/syntax/regexp.goregexp/syntax/simplify.goregexp/backtrack.goregexp/exec.goregexp/onepass.goregexp/regexp.gohtml/template/attr.gohtml/template/content.gohtml/template/escape.gohtml/template/js.gohtml/template/template.gohtml/template/transition.gogithub.com/spf13/cast@v1.5.0/caste.gogithub.com/spf13/cast@v1.5.0/cast.gogolang.org/x/sys@v0.35.0/unix/mremap.gogolang.org/x/sys@v0.35.0/unix/syscall_unix.gogolang.org/x/sys@v0.35.0/unix/syscall_linux.gogolang.org/x/sys@v0.35.0/unix/fcntl.gogolang.org/x/sys@v0.35.0/unix/fcntl_linux_32bit.gogolang.org/x/sys@v0.35.0/unix/sockcmsg_unix.gogolang.org/x/sys@v0.35.0/unix/sockcmsg_unix_other.gogolang.org/x/sys@v0.35.0/unix/syscall_linux_mipsx.gogolang.org/x/sys@v0.35.0/unix/syscall.gogolang.org/x/sys@v0.35.0/unix/zsyscall_linux.gogolang.org/x/sys@v0.35.0/unix/zsyscall_linux_mipsle.gogolang.org/x/sys@v0.35.0/unix/asm_linux_mipsx.sgithub.com/mitchellh/mapstructure@v1.5.0/decode_hooks.gogithub.com/mitchellh/mapstructure@v1.5.0/error.gogithub.com/mitchellh/mapstructure@v1.5.0/mapstructure.gonet/http/internal/ascii/print.gonet/textproto/header.gonet/textproto/reader.gonet/textproto/textproto.gomime/encodedword.gomime/type.gomime/mediatype.gomime/grammar.gomime/type_unix.gomime/quotedprintable/reader.gomime/multipart/multipart.gomime/multipart/writer.gomime/multipart/formdata.gocompress/flate/huffman_code.gocompress/flate/dict_decoder.gocompress/flate/huffman_bit_writer.gocompress/flate/inflate.gohash/crc32/crc32.gohash/crc32/crc32_generic.gocompress/gzip/gunzip.gonet/http/httptrace/trace.govendor/golang.org/x/text/unicode/bidi/prop.govendor/golang.org/x/text/unicode/bidi/tables15.0.0.govendor/golang.org/x/text/secure/bidirule/bidirule.govendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.govendor/golang.org/x/text/unicode/norm/trie.govendor/golang.org/x/text/unicode/norm/transform.govendor/golang.org/x/text/unicode/norm/composition.govendor/golang.org/x/text/unicode/norm/forminfo.govendor/golang.org/x/text/unicode/norm/input.govendor/golang.org/x/text/unicode/norm/iter.govendor/golang.org/x/text/unicode/norm/normalize.govendor/golang.org/x/text/unicode/norm/tables15.0.0.govendor/golang.org/x/net/idna/trie.govendor/golang.org/x/net/idna/idna10.0.0.govendor/golang.org/x/net/idna/trieval.govendor/golang.org/x/net/idna/punycode.govendor/golang.org/x/net/idna/tables15.0.0.govendor/golang.org/x/net/idna/trie13.0.0.govendor/golang.org/x/net/http/httpguts/guts.govendor/golang.org/x/net/http/httpguts/httplex.govendor/golang.org/x/net/http2/hpack/static_table.govendor/golang.org/x/net/http2/hpack/huffman.govendor/golang.org/x/net/http2/hpack/hpack.govendor/golang.org/x/net/http2/hpack/tables.govendor/golang.org/x/net/http2/hpack/encode.gonet/http/internal/httpcommon/httpcommon.gonet/http/internal/chunked.govendor/golang.org/x/net/http/httpproxy/proxy.gonet/http/request.gonet/http/header.gonet/http/response.gonet/http/cookie.gonet/http/server.gonet/http/fs.gonet/http/h2_bundle.gonet/http/transport.gonet/http/http.gonet/http/socks_bundle.gonet/http/transfer.gonet/http/transport_default_other.gonet/http/client.gostrings/iter.gonet/http/h2_error.gonet/http/pattern.gonet/http/clone.gonet/http/responsecontroller.gonet/http/routing_index.gonet/http/routing_tree.gonet/http/mapping.gonet/http/servemux121.gonet/http/sniff.gonet/http/status.gonet/http/roundtrip.gogithub.com/spf13/afero@v1.9.3/mem/file.gogolang.org/x/text@v0.28.0/unicode/norm/trie.gogolang.org/x/text@v0.28.0/unicode/norm/transform.gogithub.com/spf13/afero@v1.9.3/afero.gogithub.com/spf13/afero@v1.9.3/ioutil.gogithub.com/spf13/afero@v1.9.3/os.gogithub.com/spf13/viper@v1.15.0/internal/encoding/decoder.gogithub.com/spf13/viper@v1.15.0/internal/encoding/encoder.gogithub.com/spf13/viper@v1.15.0/internal/encoding/error.gogithub.com/subosito/gotenv@v1.4.2/gotenv.gogithub.com/spf13/viper@v1.15.0/internal/encoding/dotenv/codec.gogithub.com/spf13/viper@v1.15.0/internal/encoding/dotenv/map_utils.gogithub.com/hashicorp/hcl@v1.0.0/hcl/strconv/quote.gogithub.com/hashicorp/hcl@v1.0.0/hcl/token/position.gogithub.com/hashicorp/hcl@v1.0.0/hcl/token/token.gogithub.com/hashicorp/hcl@v1.0.0/hcl/ast/ast.gogithub.com/hashicorp/hcl@v1.0.0/hcl/ast/walk.gogithub.com/hashicorp/hcl@v1.0.0/hcl/scanner/scanner.gogithub.com/hashicorp/hcl@v1.0.0/hcl/parser/error.gogithub.com/hashicorp/hcl@v1.0.0/hcl/parser/parser.gogithub.com/hashicorp/hcl@v1.0.0/json/token/position.gogithub.com/hashicorp/hcl@v1.0.0/json/token/token.gogithub.com/hashicorp/hcl@v1.0.0/json/scanner/scanner.gogithub.com/hashicorp/hcl@v1.0.0/json/parser/flatten.gogithub.com/hashicorp/hcl@v1.0.0/json/parser/parser.gogithub.com/hashicorp/hcl@v1.0.0/decoder.gogithub.com/hashicorp/hcl@v1.0.0/lex.gogithub.com/hashicorp/hcl@v1.0.0/parse.gotext/tabwriter/tabwriter.gogithub.com/hashicorp/hcl@v1.0.0/hcl/printer/nodes.gogithub.com/hashicorp/hcl@v1.0.0/hcl/printer/printer.gogithub.com/spf13/viper@v1.15.0/internal/encoding/hcl/codec.gogopkg.in/ini.v1@v1.67.0/ini.gogopkg.in/ini.v1@v1.67.0/deprecated.gogopkg.in/ini.v1@v1.67.0/parser.gogopkg.in/ini.v1@v1.67.0/struct.gogopkg.in/ini.v1@v1.67.0/data_source.gogopkg.in/ini.v1@v1.67.0/error.gogopkg.in/ini.v1@v1.67.0/file.gogopkg.in/ini.v1@v1.67.0/section.gogopkg.in/ini.v1@v1.67.0/helper.gogopkg.in/ini.v1@v1.67.0/key.gogithub.com/spf13/viper@v1.15.0/internal/encoding/ini/codec.gogithub.com/spf13/viper@v1.15.0/internal/encoding/ini/map_utils.gogithub.com/magiconair/properties@v1.8.7/decode.gogithub.com/magiconair/properties@v1.8.7/properties.gogithub.com/magiconair/properties@v1.8.7/integrate.gogithub.com/magiconair/properties@v1.8.7/lex.gogithub.com/magiconair/properties@v1.8.7/load.gogithub.com/magiconair/properties@v1.8.7/parser.gogithub.com/magiconair/properties@v1.8.7/rangecheck.gogithub.com/spf13/viper@v1.15.0/internal/encoding/javaproperties/codec.gogithub.com/spf13/viper@v1.15.0/internal/encoding/javaproperties/map_utils.gogithub.com/spf13/viper@v1.15.0/internal/encoding/json/codec.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/danger/danger.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/characters/ascii.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/characters/utf8.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/ast.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/kind.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/parser.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/builder.gogithub.com/pelletier/go-toml/v2@v2.0.6/unstable/scanner.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/tracker/key.gogithub.com/pelletier/go-toml/v2@v2.0.6/internal/tracker/seen.gogithub.com/pelletier/go-toml/v2@v2.0.6/types.gogithub.com/pelletier/go-toml/v2@v2.0.6/decode.gogithub.com/pelletier/go-toml/v2@v2.0.6/errors.gogithub.com/pelletier/go-toml/v2@v2.0.6/localtime.gogithub.com/pelletier/go-toml/v2@v2.0.6/marshaler.gogithub.com/pelletier/go-toml/v2@v2.0.6/strict.gogithub.com/pelletier/go-toml/v2@v2.0.6/unmarshaler.gogithub.com/spf13/viper@v1.15.0/internal/encoding/toml/codec.gogopkg.in/yaml.v3@v3.0.1/decode.gogopkg.in/yaml.v3@v3.0.1/yaml.gogopkg.in/yaml.v3@v3.0.1/encode.gogopkg.in/yaml.v3@v3.0.1/resolve.gogopkg.in/yaml.v3@v3.0.1/apic.gogopkg.in/yaml.v3@v3.0.1/yamlh.gogopkg.in/yaml.v3@v3.0.1/emitterc.gogopkg.in/yaml.v3@v3.0.1/yamlprivateh.gogopkg.in/yaml.v3@v3.0.1/parserc.gogopkg.in/yaml.v3@v3.0.1/readerc.gogopkg.in/yaml.v3@v3.0.1/scannerc.gogopkg.in/yaml.v3@v3.0.1/sorter.gogopkg.in/yaml.v3@v3.0.1/writerc.gogithub.com/spf13/viper@v1.15.0/internal/encoding/yaml/codec.gogithub.com/spf13/viper@v1.15.0/logger.gogithub.com/spf13/viper@v1.15.0/util.gogithub.com/spf13/viper@v1.15.0/viper.gogithub.com/spf13/viper@v1.15.0/viper_go1_15.gogo.uber.org/multierr@v1.11.0/error.gogo.uber.org/multierr@v1.11.0/error_post_go120.gogo.uber.org/zap@v1.24.0/buffer/buffer.gogo.uber.org/zap@v1.24.0/buffer/pool.gogo.uber.org/zap@v1.24.0/internal/bufferpool/bufferpool.gogo.uber.org/atomic@v1.11.0/int32.gogo.uber.org/atomic@v1.11.0/int64.gogo.uber.org/atomic@v1.11.0/uint64.gogo.uber.org/zap@v1.24.0/zapcore/level_strings.gogo.uber.org/zap@v1.24.0/zapcore/console_encoder.gogo.uber.org/zap@v1.24.0/zapcore/entry.gogo.uber.org/zap@v1.24.0/zapcore/error.gogo.uber.org/zap@v1.24.0/zapcore/json_encoder.gogo.uber.org/zap@v1.24.0/zapcore/clock.gogo.uber.org/zap@v1.24.0/zapcore/memory_encoder.gogo.uber.org/zap@v1.24.0/zapcore/field.gogo.uber.org/zap@v1.24.0/zapcore/core.gogo.uber.org/zap@v1.24.0/zapcore/encoder.gogo.uber.org/zap@v1.24.0/internal/color/color.gogo.uber.org/zap@v1.24.0/internal/exit/exit.gogo.uber.org/zap@v1.24.0/zapcore/level.gogo.uber.org/zap@v1.24.0/zapcore/reflected_encoder.gogo.uber.org/zap@v1.24.0/zapcore/sampler.gogo.uber.org/zap@v1.24.0/zapcore/write_syncer.gogo.uber.org/zap@v1.24.0/encoder.gogo.uber.org/zap@v1.24.0/field.gogo.uber.org/zap@v1.24.0/global.gogo.uber.org/zap@v1.24.0/logger.gogo.uber.org/zap@v1.24.0/sink.gogo.uber.org/zap@v1.24.0/error.gogo.uber.org/zap@v1.24.0/stacktrace.gogo.uber.org/zap@v1.24.0/array.gogo.uber.org/zap@v1.24.0/config.gogo.uber.org/zap@v1.24.0/options.gogo.uber.org/zap@v1.24.0/level.gogo.uber.org/zap@v1.24.0/http_handler.gogo.uber.org/zap@v1.24.0/sugar.gogo.uber.org/zap@v1.24.0/writer.gogithub.com/apernet/hysteria/core/v2/errors/errors.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/quicvarint/io.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/quicvarint/varint.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/connection_id.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/encryption_level.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/key_phase.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/perspective.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/protocol.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/stream.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/version.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/monotime/time.gogithub.com/apernet/hysteria/core/v2/internal/congestion/common/pacer.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bandwidth_sampler.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/windowed_filter.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/packet_number_indexed_queue.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/ringbuffer.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bandwidth.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/bbr_sender.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/congestion/monotime.gogithub.com/apernet/hysteria/core/v2/internal/congestion/bbr/clock.gogithub.com/apernet/hysteria/core/v2/internal/congestion/brutal/brutal.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/utils/log.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/utils/rand.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/utils/rtt_stats.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/utils/streamframe_interval.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/qerr/error_codes.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/qerr/errors.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/ack_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/frame_parser.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/ack_frequency_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/ack_range.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/connection_close_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/crypto_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/data_blocked_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/datagram_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/extended_header.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/header.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/frame_type.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/path_challenge_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/path_response_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/handshake_done_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/immediate_ack_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/stream_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/log.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/max_data_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/max_stream_data_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/max_streams_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/new_connection_id_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/new_token_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/ping_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/pool.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/reset_stream_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/retire_connection_id_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/short_header.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/stop_sending_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/stream_data_blocked_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/streams_blocked_frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/transport_parameters.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/version_negotiation.goruntime/debug/mod.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/qlogwriter/jsontext/encoder.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/qlogwriter/trace.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/qlog/event.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/qlog/types.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/qlog/frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/qlog/packet_header.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/congestion/clock.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/congestion/cubic.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/congestion/cubic_sender.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/congestion/hybrid_slow_start.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/congestion/bandwidth.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/congestion/pacer.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/packet.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/received_packet_handler.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/received_packet_tracker.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/received_packet_history.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/ackhandler.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/cc_adapter.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/cc_adapter_ex.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/ecn.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/lost_packet_tracker.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/packet_number_generator.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/send_mode.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/sent_packet_handler.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/sent_packet_history.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/protocol/packet_number.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/flowcontrol/base_flow_controller.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/flowcontrol/connection_flow_controller.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/flowcontrol/stream_flow_controller.gogolang.org/x/crypto@v0.41.0/chacha20/chacha_generic.gogolang.org/x/crypto@v0.41.0/chacha20/chacha_noasm.gogolang.org/x/crypto@v0.41.0/internal/alias/alias.gogolang.org/x/crypto@v0.41.0/chacha20/xor.gogolang.org/x/crypto@v0.41.0/internal/poly1305/poly1305.gogolang.org/x/crypto@v0.41.0/internal/poly1305/sum_generic.gogolang.org/x/crypto@v0.41.0/chacha20poly1305/chacha20poly1305.gogolang.org/x/crypto@v0.41.0/chacha20poly1305/chacha20poly1305_noasm.gogolang.org/x/crypto@v0.41.0/chacha20poly1305/chacha20poly1305_generic.gogolang.org/x/crypto@v0.41.0/hkdf/hkdf.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/initial_aead.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/aead.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/cipher_suite.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/crypto_setup.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/updatable_aead.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/session_ticket.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/fake_conn.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/header_protector.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/hkdf.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/interface.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/retry.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/tls_config.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/token_generator.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/handshake/token_protector.gogolang.org/x/net@v0.43.0/internal/socket/sys_posix.gogolang.org/x/net@v0.43.0/internal/socket/mmsghdr_unix.gogolang.org/x/net@v0.43.0/internal/socket/msghdr_linux.gogolang.org/x/net@v0.43.0/internal/socket/complete_dontwait.gogolang.org/x/net@v0.43.0/internal/socket/iovec_32bit.gogolang.org/x/net@v0.43.0/internal/socket/msghdr_linux_32bit.gogolang.org/x/net@v0.43.0/internal/socket/rawconn.gogolang.org/x/net@v0.43.0/internal/socket/sys_unix.gogolang.org/x/net@v0.43.0/internal/socket/rawconn_mmsg.gogolang.org/x/net@v0.43.0/internal/socket/rawconn_msg.gogolang.org/x/net@v0.43.0/internal/socket/socket.gogolang.org/x/net@v0.43.0/internal/socket/cmsghdr_linux_32bit.gogolang.org/x/net@v0.43.0/internal/socket/cmsghdr_unix.gogolang.org/x/net@v0.43.0/internal/socket/cmsghdr.gogolang.org/x/net@v0.43.0/internal/socket/sys.gogolang.org/x/net@v0.43.0/internal/socket/error_unix.gogolang.org/x/net@v0.43.0/internal/socket/sys_linux.gogolang.org/x/net@v0.43.0/bpf/instructions.gogolang.org/x/net@v0.43.0/ipv4/iana.gogolang.org/x/net@v0.43.0/ipv4/sys_linux.gogolang.org/x/net@v0.43.0/ipv4/batch.gogolang.org/x/net@v0.43.0/ipv4/payload.gogolang.org/x/net@v0.43.0/ipv4/control.gogolang.org/x/net@v0.43.0/ipv4/control_pktinfo.gogolang.org/x/net@v0.43.0/ipv4/control_unix.gogolang.org/x/net@v0.43.0/ipv4/endpoint.gogolang.org/x/net@v0.43.0/ipv4/dgramopt.gogolang.org/x/net@v0.43.0/ipv4/sockopt_posix.gogolang.org/x/net@v0.43.0/ipv4/genericopt.gogolang.org/x/net@v0.43.0/ipv4/helper.gogolang.org/x/net@v0.43.0/ipv4/icmp.gogolang.org/x/net@v0.43.0/ipv4/icmp_linux.gogolang.org/x/net@v0.43.0/ipv4/payload_cmsg.gogolang.org/x/net@v0.43.0/ipv4/sys_asmreqn.gogolang.org/x/net@v0.43.0/ipv4/sys_bpf.gogolang.org/x/net@v0.43.0/ipv4/sys_ssmreq.gogolang.org/x/net@v0.43.0/ipv6/control.gogolang.org/x/net@v0.43.0/ipv6/control_rfc3542_unix.gogolang.org/x/net@v0.43.0/ipv6/sys_linux.gogolang.org/x/net@v0.43.0/ipv6/iana.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/interface.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/connection.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/conn_id_manager.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/conn_id_generator.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/crypto_stream_manager.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/crypto_stream.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/packet_unpacker.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/buffer_pool.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/client.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/transport.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/closed_conn.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/config.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/framer.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/send_queue.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/retransmission_queue.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/utils/ringbuffer/ringbuffer.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/datagram_queue.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/path_manager.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/connection_logging.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/wire/frame.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/ackhandler/ack_eliciting.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/streams_map.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/mtu_discoverer.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/packet_packer.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/path_manager_outgoing.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/frame_sorter.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/errors.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/internal/utils/tree/tree.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/receive_stream.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/send_conn.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/sys_conn_df_linux.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/send_stream.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/server.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/sni.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/stateless_reset.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/stream.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/streams_map_outgoing.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/sys_conn.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/sys_conn_buffers.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/sys_conn_buffers_write.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/sys_conn_helper_linux.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/sys_conn_oob.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/streams_map_incoming.gogithub.com/apernet/hysteria/core/v2/internal/congestion/utils.gogithub.com/apernet/hysteria/core/v2/internal/protocol/http.gogithub.com/apernet/hysteria/core/v2/internal/protocol/padding.gogithub.com/apernet/hysteria/core/v2/internal/protocol/proxy.gogithub.com/apernet/hysteria/core/v2/internal/utils/atomic.gogithub.com/apernet/hysteria/core/v2/internal/utils/qstream.golog/slog/internal/buffer/buffer.golog/slog/handler.golog/slog/attr.golog/slog/level.golog/slog/value.golog/slog/record.golog/slog/json_handler.golog/slog/logger.golog/slog/text_handler.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/qlog/event.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/qlog/frame.gogolang.org/x/net@v0.43.0/http2/hpack/static_table.gogolang.org/x/net@v0.43.0/http2/hpack/huffman.gogithub.com/quic-go/qpack@v0.6.0/static_table.gogithub.com/quic-go/qpack@v0.6.0/decoder.gogithub.com/quic-go/qpack@v0.6.0/varint.gogithub.com/quic-go/qpack@v0.6.0/encoder.gogithub.com/quic-go/qpack@v0.6.0/header_field.gogolang.org/x/text@v0.28.0/unicode/bidi/prop.gogolang.org/x/text@v0.28.0/unicode/bidi/tables15.0.0.gogolang.org/x/text@v0.28.0/secure/bidirule/bidirule.gogolang.org/x/net@v0.43.0/idna/trie.gogolang.org/x/net@v0.43.0/idna/idna10.0.0.gogolang.org/x/net@v0.43.0/idna/trieval.gogolang.org/x/net@v0.43.0/idna/punycode.gogolang.org/x/net@v0.43.0/idna/tables15.0.0.gogolang.org/x/net@v0.43.0/http/httpguts/guts.gogolang.org/x/net@v0.43.0/http/httpguts/httplex.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/body.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/stream.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/client.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/request_writer.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/conn.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/trace.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/qlog.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/error.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/error_codes.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/frames.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/gzip_reader.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/headers.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/ip_addr.gogolang.org/x/net@v0.43.0/http2/hpack/hpack.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/response_writer.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/server.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/state_tracking_stream.gogithub.com/apernet/quic-go@v0.57.2-0.20260111184307-eec823306178/http3/transport.gogithub.com/davecgh/go-spew@v1.1.1/spew/bypass.gogithub.com/davecgh/go-spew@v1.1.1/spew/dump.gogithub.com/stretchr/objx@v0.5.2/accessors.gogithub.com/stretchr/objx@v0.5.2/map.gonet/http/internal/testcert/testcert.gonet/http/httptest/server.gogithub.com/stretchr/testify@v1.11.1/assert/assertion_compare.gogithub.com/stretchr/testify@v1.11.1/mock/mock.gogithub.com/apernet/hysteria/core/v2/internal/frag/frag.gogithub.com/apernet/hysteria/core/v2/client/client.gogithub.com/apernet/hysteria/core/v2/client/config.gogithub.com/apernet/hysteria/core/v2/client/reconnect.gogithub.com/apernet/hysteria/core/v2/client/udp.gogithub.com/apernet/hysteria/app/v2/internal/forwarding/tcp.gogithub.com/apernet/hysteria/app/v2/internal/forwarding/udp.gogithub.com/apernet/hysteria/app/v2/internal/http/server.gogithub.com/apernet/hysteria/extras/v2/correctnet/correctnet.gogithub.com/apernet/hysteria/app/v2/internal/proxymux/manager.gogithub.com/apernet/hysteria/app/v2/internal/proxymux/mux.gogithub.com/apernet/hysteria/app/v2/internal/redirect/getsockopt_linux.gogithub.com/apernet/hysteria/app/v2/internal/redirect/tcp_linux.gogithub.com/apernet/hysteria/app/v2/internal/sockopts/sockopts.gogithub.com/apernet/hysteria/app/v2/internal/sockopts/sockopts_linux.goencoding/gob/encode.goencoding/gob/enc_helpers.goencoding/gob/decode.goencoding/gob/error.goencoding/gob/encoder.goencoding/gob/type.goencoding/gob/dec_helpers.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/client_side.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/server_side.gogithub.com/txthinking/socks5@v0.0.0-20230325130024-4230056ae301/util.gogithub.com/apernet/hysteria/app/v2/internal/socks5/server.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/endian.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/tproxy_tcp.gogithub.com/apernet/go-tproxy@v0.0.0-20230809025308-8f4723fd742f/tproxy_udp.gogithub.com/apernet/hysteria/app/v2/internal/tproxy/tcp_linux.gogithub.com/apernet/hysteria/app/v2/internal/tproxy/udp_linux.gogithub.com/sagernet/sing@v0.3.2/common/native_endian_std.gogithub.com/sagernet/sing@v0.3.2/common/cond.gogithub.com/sagernet/sing@v0.3.2/common/format/fmt.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/cause.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/inner.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/multi.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/conntrack_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/addr_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/nl_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/link_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/mpls_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/route_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/seg6_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/link.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/addr.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/handle_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/addr_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/link_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/order.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/netlink.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/protinfo.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/protinfo_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/route_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/route.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/nl/seg6local_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/rule_linux.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/rule.gogithub.com/sagernet/netlink@v0.0.0-20220905062125-8043b4a9aa97/xfrm_state_linux.gogithub.com/sagernet/sing@v0.3.2/common/buf/alloc.gogithub.com/sagernet/sing@v0.3.2/common/buf/buffer.gogithub.com/sagernet/sing@v0.3.2/common/buf/pool.gogithub.com/sagernet/sing@v0.3.2/common/clear.gogithub.com/sagernet/sing@v0.3.2/common/buf/multi.gogithub.com/sagernet/sing@v0.3.2/common/rw/write.gogithub.com/sagernet/sing@v0.3.2/common/metadata/socksaddr.gogithub.com/sagernet/sing@v0.3.2/common/metadata/serializer.gogithub.com/sagernet/sing@v0.3.2/common/metadata/addr.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/icmp.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/icmpv6.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/ip.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/tcpip.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/ipv6.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/tcp.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/tcpip_compat.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/internal/clashtcpip/udp.gogithub.com/sagernet/sing@v0.3.2/common/network/name.gogithub.com/sagernet/sing@v0.3.2/common/exceptions/error.gogithub.com/sagernet/sing@v0.3.2/common/network/addr.gogithub.com/sagernet/sing@v0.3.2/common/network/direct.gogithub.com/sagernet/sing@v0.3.2/common/control/bind.gogithub.com/sagernet/sing@v0.3.2/common/control/bind_linux.gogithub.com/sagernet/sing@v0.3.2/common/control/interface.gogithub.com/sagernet/sing@v0.3.2/common/udpnat/conn_wait.gogithub.com/sagernet/sing@v0.3.2/common/udpnat/service.goos/exec/exec.goos/exec/exec_unix.goos/exec/lp_unix.gointernal/syscall/unix/eaccess.gogithub.com/sagernet/sing@v0.3.2/common/bufio/vectorised.gogithub.com/sagernet/sing@v0.3.2/common/bufio/vectorised_unix.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/ipset.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/netipx.gogo4.org/netipx@v0.0.0-20231129151722-fdeea329fbba/uint128.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/monitor.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/monitor_linux.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_gvisor_stub.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux_offload_errors.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/errors_patch.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_run_patch.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_system.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/stack_system_nat.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux_offload.gogithub.com/sagernet/sing@v0.3.2/common/rw/file.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_rules.gogithub.com/apernet/sing-tun@v0.2.6-0.20250920121535-299f04629986/tun_linux_flags.gogolang.org/x/sys@v0.35.0/unix/ifreq_linux.gogolang.org/x/sys@v0.35.0/unix/ioctl_linux.gogolang.org/x/sys@v0.35.0/unix/ioctl_unsigned.gogithub.com/sagernet/sing@v0.3.2/common/x/list/list.gogithub.com/sagernet/sing@v0.3.2/common/cache/lrucache.gogithub.com/sagernet/sing@v0.3.2/common/ranges/range.gogithub.com/sagernet/sing@v0.3.2/common/x/list/cond.gogithub.com/apernet/hysteria/app/v2/internal/tun/check_ipv6_unix.gogithub.com/apernet/hysteria/app/v2/internal/tun/log.gogithub.com/apernet/hysteria/app/v2/internal/tun/server.gogithub.com/apernet/hysteria/app/v2/internal/url/url.gogoogle.golang.org/protobuf@v1.34.1/internal/detrand/rand.goos/executable.gohash/fnv/fnv.gogoogle.golang.org/protobuf@v1.34.1/internal/errors/errors.gogoogle.golang.org/protobuf@v1.34.1/encoding/protowire/wire.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_unsafe_go121.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/proto.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/source.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/source_gen.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_equal.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoreflect/value_union.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/messageset/messageset.gogoogle.golang.org/protobuf@v1.34.1/reflect/protoregistry/registry.gogo/token/token.gogoogle.golang.org/protobuf@v1.34.1/internal/strs/strings.gogoogle.golang.org/protobuf@v1.34.1/internal/strs/strings_unsafe_go121.gogoogle.golang.org/protobuf@v1.34.1/internal/order/order.gogoogle.golang.org/protobuf@v1.34.1/internal/order/range.gogoogle.golang.org/protobuf@v1.34.1/proto/encode_gen.gogoogle.golang.org/protobuf@v1.34.1/proto/decode.gogoogle.golang.org/protobuf@v1.34.1/proto/checkinit.gogoogle.golang.org/protobuf@v1.34.1/proto/proto_methods.gogoogle.golang.org/protobuf@v1.34.1/proto/messageset.gogoogle.golang.org/protobuf@v1.34.1/proto/decode_gen.gogoogle.golang.org/protobuf@v1.34.1/proto/encode.gogoogle.golang.org/protobuf@v1.34.1/proto/merge.gogoogle.golang.org/protobuf@v1.34.1/proto/proto.gogoogle.golang.org/protobuf@v1.34.1/proto/reset.gogoogle.golang.org/protobuf@v1.34.1/proto/size.gogoogle.golang.org/protobuf@v1.34.1/proto/size_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/descfmt/stringer.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode_token.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/decode_string.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/text/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/defval/default.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/editions.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/placeholder.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_init.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/build.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_lazy.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_list.gogoogle.golang.org/protobuf@v1.34.1/internal/filedesc/desc_list_gen.gogoogle.golang.org/protobuf@v1.34.1/encoding/prototext/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/encoding/tag/tag.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/decode.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect_field.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_unsafe.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/api_export.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/checkinit.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/pointer_unsafe.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_field.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/merge.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/weak.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/encode.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_map.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_map_go112.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_message.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/codec_tables.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert_list.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/convert_map.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/enum.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_enum.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_export.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_extension.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/legacy_file.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/merge_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/message_reflect_gen.gogoogle.golang.org/protobuf@v1.34.1/internal/impl/validate.gogoogle.golang.org/protobuf@v1.34.1/internal/filetype/build.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo/v2geo.pb.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/v2geo/load.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/parse.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/compile.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/matchers.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl/matchers_v2geo.goimage/names.gorsc.io/qr@v0.2.0/gf256/gf256.gorsc.io/qr@v0.2.0/coding/qr.gorsc.io/qr@v0.2.0/qr.gogithub.com/mdp/qrterminal/v3@v3.1.1/qrterminal.gogithub.com/apernet/hysteria/app/v2/internal/utils/bpsconv.gogithub.com/apernet/hysteria/app/v2/internal/utils/certloader.gogithub.com/apernet/hysteria/app/v2/internal/utils/geoloader.gogithub.com/apernet/hysteria/app/v2/internal/utils/update.gogolang.org/x/crypto@v0.41.0/blake2b/blake2b.gogolang.org/x/crypto@v0.41.0/blake2b/blake2b_ref.gogolang.org/x/crypto@v0.41.0/blake2b/blake2b_generic.gogolang.org/x/crypto@v0.41.0/blake2b/blake2x.gogolang.org/x/crypto@v0.41.0/blake2b/register.gogithub.com/apernet/hysteria/extras/v2/obfs/salamander.gogithub.com/apernet/hysteria/extras/v2/obfs/conn.gogithub.com/apernet/hysteria/extras/v2/utils/portunion.gogithub.com/apernet/hysteria/extras/v2/transport/udphop/addr.gogithub.com/apernet/hysteria/extras/v2/transport/udphop/conn.gonet/http/httputil/dump.gonet/http/httputil/httputil.gonet/http/httputil/reverseproxy.gogithub.com/mholt/acmez@v1.0.4/acme/client.gogithub.com/mholt/acmez@v1.0.4/acme/http.gogithub.com/mholt/acmez@v1.0.4/acme/jws.gogithub.com/mholt/acmez@v1.0.4/acme/account.gogithub.com/mholt/acmez@v1.0.4/acme/authorization.gogithub.com/mholt/acmez@v1.0.4/acme/certificate.gogithub.com/mholt/acmez@v1.0.4/acme/challenge.gogithub.com/mholt/acmez@v1.0.4/acme/order.gogithub.com/mholt/acmez@v1.0.4/acme/problem.gogithub.com/mholt/acmez@v1.0.4/client.gogithub.com/mholt/acmez@v1.0.4/tlsalpn01.gogolang.org/x/crypto@v0.41.0/ocsp/ocsp.gogithub.com/klauspost/cpuid/v2@v2.1.1/cpuid.gogithub.com/klauspost/cpuid/v2@v2.1.1/detect_ref.gogithub.com/klauspost/cpuid/v2@v2.1.1/featureid_string.goencoding/base32/base32.gogithub.com/miekg/dns@v1.1.59/types.gogithub.com/miekg/dns@v1.1.59/msg.gogithub.com/miekg/dns@v1.1.59/dnssec.gogithub.com/miekg/dns@v1.1.59/dnssec_privkey.gogithub.com/miekg/dns@v1.1.59/edns.gogithub.com/miekg/dns@v1.1.59/reverse.gogithub.com/miekg/dns@v1.1.59/msg_helpers.gogithub.com/miekg/dns@v1.1.59/serve_mux.gogithub.com/miekg/dns@v1.1.59/server.gogithub.com/miekg/dns@v1.1.59/ztypes.gogithub.com/miekg/dns@v1.1.59/udp.gogithub.com/miekg/dns@v1.1.59/svcb.gogithub.com/miekg/dns@v1.1.59/client.gogithub.com/miekg/dns@v1.1.59/clientconfig.gogithub.com/miekg/dns@v1.1.59/dane.gogithub.com/miekg/dns@v1.1.59/defaults.gogithub.com/miekg/dns@v1.1.59/dns.gogithub.com/miekg/dns@v1.1.59/dnssec_keygen.gogithub.com/miekg/dns@v1.1.59/dnssec_keyscan.gogithub.com/miekg/dns@v1.1.59/hash.gogithub.com/miekg/dns@v1.1.59/labels.gogithub.com/miekg/dns@v1.1.59/msg_truncate.gogithub.com/miekg/dns@v1.1.59/nsecx.gogithub.com/miekg/dns@v1.1.59/scan.gogithub.com/miekg/dns@v1.1.59/sig0.gogithub.com/miekg/dns@v1.1.59/smimea.gogithub.com/miekg/dns@v1.1.59/tlsa.gogithub.com/miekg/dns@v1.1.59/tsig.gogithub.com/miekg/dns@v1.1.59/update.gogithub.com/miekg/dns@v1.1.59/zmsg.gogithub.com/libdns/libdns@v0.2.2/libdns.gogithub.com/caddyserver/certmagic@v0.17.2/account.gogithub.com/caddyserver/certmagic@v0.17.2/acmeclient.gogithub.com/caddyserver/certmagic@v0.17.2/acmeissuer.gogithub.com/caddyserver/certmagic@v0.17.2/certmagic.gogithub.com/caddyserver/certmagic@v0.17.2/config.gogithub.com/caddyserver/certmagic@v0.17.2/storage.gogithub.com/caddyserver/certmagic@v0.17.2/solvers.gogithub.com/caddyserver/certmagic@v0.17.2/handshake.gogithub.com/caddyserver/certmagic@v0.17.2/dnsutil.gogithub.com/caddyserver/certmagic@v0.17.2/ratelimiter.gogithub.com/caddyserver/certmagic@v0.17.2/async.gogithub.com/caddyserver/certmagic@v0.17.2/cache.gogithub.com/caddyserver/certmagic@v0.17.2/certificates.gogithub.com/caddyserver/certmagic@v0.17.2/crypto.gogithub.com/caddyserver/certmagic@v0.17.2/filestorage.gogithub.com/caddyserver/certmagic@v0.17.2/maintain.gogithub.com/caddyserver/certmagic@v0.17.2/httphandler.gogithub.com/caddyserver/certmagic@v0.17.2/ocsp.gogithub.com/libdns/cloudflare@v0.1.1/client.gogithub.com/libdns/cloudflare@v0.1.1/models.gogithub.com/libdns/cloudflare@v0.1.1/provider.gogithub.com/libdns/duckdns@v0.2.0/client.gogithub.com/libdns/duckdns@v0.2.0/provider.gogithub.com/libdns/gandi@v1.0.3/client.gogithub.com/libdns/gandi@v1.0.3/provider.gogithub.com/libdns/godaddy@v1.0.3/provider.gogithub.com/pkg/errors@v0.9.1/errors.gogithub.com/pkg/errors@v0.9.1/stack.gogithub.com/libdns/namedotcom@v0.3.3/client.gogithub.com/libdns/namedotcom@v0.3.3/namedotcom.gogithub.com/libdns/namedotcom@v0.3.3/provider.gogolang.org/x/oauth2@v0.20.0/internal/token.gogolang.org/x/oauth2@v0.20.0/internal/transport.gogolang.org/x/oauth2@v0.20.0/deviceauth.gogolang.org/x/oauth2@v0.20.0/oauth2.gogolang.org/x/oauth2@v0.20.0/token.gogolang.org/x/oauth2@v0.20.0/transport.gogithub.com/google/go-querystring@v1.1.0/query/encode.gogithub.com/hashicorp/go-cleanhttp@v0.5.2/cleanhttp.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/client.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/cert_error_go120.gogithub.com/hashicorp/go-retryablehttp@v0.7.6/roundtripper.gogithub.com/vultr/govultr/v3@v3.6.4/account.gogithub.com/vultr/govultr/v3@v3.6.4/application.gogithub.com/vultr/govultr/v3@v3.6.4/backup.gogithub.com/vultr/govultr/v3@v3.6.4/bare_metal_server.gogithub.com/vultr/govultr/v3@v3.6.4/billing.gogithub.com/vultr/govultr/v3@v3.6.4/block_storage.gogithub.com/vultr/govultr/v3@v3.6.4/container_registry.gogithub.com/vultr/govultr/v3@v3.6.4/database.gogithub.com/vultr/govultr/v3@v3.6.4/domain_records.gogithub.com/vultr/govultr/v3@v3.6.4/domains.gogithub.com/vultr/govultr/v3@v3.6.4/firewall_group.gogithub.com/vultr/govultr/v3@v3.6.4/firewall_rule.gogithub.com/vultr/govultr/v3@v3.6.4/govultr.gogithub.com/vultr/govultr/v3@v3.6.4/instance.gogithub.com/vultr/govultr/v3@v3.6.4/iso.gogithub.com/vultr/govultr/v3@v3.6.4/kubernetes.gogithub.com/vultr/govultr/v3@v3.6.4/load_balancer.gogithub.com/vultr/govultr/v3@v3.6.4/marketplace.gogithub.com/vultr/govultr/v3@v3.6.4/network.gogithub.com/vultr/govultr/v3@v3.6.4/object_storage.gogithub.com/vultr/govultr/v3@v3.6.4/os.gogithub.com/vultr/govultr/v3@v3.6.4/plans.gogithub.com/vultr/govultr/v3@v3.6.4/regions.gogithub.com/vultr/govultr/v3@v3.6.4/reserved_ip.gogithub.com/vultr/govultr/v3@v3.6.4/snapshot.gogithub.com/vultr/govultr/v3@v3.6.4/ssh_key.gogithub.com/vultr/govultr/v3@v3.6.4/startup_script.gogithub.com/vultr/govultr/v3@v3.6.4/user.gogithub.com/vultr/govultr/v3@v3.6.4/vpc.gogithub.com/vultr/govultr/v3@v3.6.4/vpc2.gogithub.com/libdns/vultr@v1.0.0/client.gogithub.com/libdns/vultr@v1.0.0/provider.gogithub.com/apernet/hysteria/core/v2/server/config.gogithub.com/apernet/hysteria/core/v2/server/copy.gogithub.com/apernet/hysteria/core/v2/server/server.gogithub.com/apernet/hysteria/core/v2/server/udp.gogithub.com/apernet/hysteria/extras/v2/auth/command.gogithub.com/apernet/hysteria/extras/v2/auth/http.gogithub.com/apernet/hysteria/extras/v2/auth/password.gogithub.com/apernet/hysteria/extras/v2/auth/userpass.gogithub.com/apernet/hysteria/extras/v2/masq/server.gogolang.org/x/net@v0.43.0/dns/dnsmessage/message.gogithub.com/apernet/hysteria/extras/v2/outbounds/tinydoh/resolver.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/ipstackcaps.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/zonecache.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/ipstackcaps_sock_cloexec.gogithub.com/database64128/netx-go@v0.0.0-20240905055117-62795b8b054a/ipstackcaps_unix.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_bsd+linux.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_connect_generic.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_freebsd+linux.gogithub.com/database64128/tfo-go/v2@v2.2.2/tfo_linux.gogithub.com/database64128/tfo-go/v2@v2.2.2/sockopt_linux.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/client.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/protocol.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest/server.gogithub.com/apernet/hysteria/extras/v2/outbounds/acl.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_direct.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_https.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_standard.gogithub.com/apernet/hysteria/extras/v2/outbounds/dns_system.gogithub.com/apernet/hysteria/extras/v2/outbounds/fastopen.gogithub.com/apernet/hysteria/extras/v2/outbounds/interface.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_direct_linux.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_http.gogithub.com/apernet/hysteria/extras/v2/outbounds/ob_socks5.gogithub.com/apernet/hysteria/extras/v2/outbounds/speedtest.gogithub.com/apernet/hysteria/extras/v2/outbounds/utils.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/internal/list.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/simplelru/lru.gogithub.com/hashicorp/golang-lru/v2@v2.0.5/lru.gogithub.com/cloudflare/circl@v1.3.9/internal/conv/conv.gogithub.com/cloudflare/circl@v1.3.9/math/wnaf.gogithub.com/cloudflare/circl@v1.3.9/math/fp25519/fp.gogithub.com/cloudflare/circl@v1.3.9/math/fp25519/fp_noasm.gogithub.com/cloudflare/circl@v1.3.9/math/fp25519/fp_generic.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/ed25519.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/modular.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/mult.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/point.gogithub.com/cloudflare/circl@v1.3.9/sign/ed25519/signapi.gogithub.com/cloudflare/circl@v1.3.9/math/fp448/fp.gogithub.com/cloudflare/circl@v1.3.9/math/fp448/fp_noasm.gogithub.com/cloudflare/circl@v1.3.9/math/fp448/fp_generic.gogithub.com/cloudflare/circl@v1.3.9/math/mlsbset/mlsbset.gogithub.com/cloudflare/circl@v1.3.9/math/mlsbset/power.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/scalar.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/curve.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/isogeny.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/point.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/twist.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/twistPoint.gogithub.com/cloudflare/circl@v1.3.9/ecc/goldilocks/twist_basemult.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/keccakf.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/sha3.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/shake.gogithub.com/cloudflare/circl@v1.3.9/internal/sha3/xor_generic.gogithub.com/cloudflare/circl@v1.3.9/sign/ed448/ed448.gogithub.com/cloudflare/circl@v1.3.9/sign/ed448/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/generic.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/field.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/poly.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/pack.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/internal/common/ntt.gogolang.org/x/sys@v0.35.0/cpu/cpu.gogolang.org/x/sys@v0.35.0/cpu/cpu_linux.gogolang.org/x/sys@v0.35.0/cpu/byteorder.gogolang.org/x/sys@v0.35.0/cpu/hwcap_linux.gogolang.org/x/sys@v0.35.0/cpu/runtime_auxv.gogolang.org/x/sys@v0.35.0/cpu/runtime_auxv_go121.gogithub.com/cloudflare/circl@v1.3.9/simd/keccakf1600/f1600x.gogithub.com/cloudflare/circl@v1.3.9/simd/keccakf1600/fallback.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/sample.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/pack.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/internal/rounding.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode2/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium2/eddilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium2/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/sample.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/pack.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/internal/rounding.gogithub.com/cloudflare/circl@v1.3.9/sign/dilithium/mode3/dilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium3/eddilithium.gogithub.com/cloudflare/circl@v1.3.9/sign/eddilithium3/signapi.gogithub.com/cloudflare/circl@v1.3.9/sign/schemes/schemes.gogithub.com/cloudflare/circl@v1.3.9/pki/pki.gogithub.com/cloudflare/circl@v1.3.9/xof/k12/k12.gogolang.org/x/crypto@v0.41.0/blake2s/blake2s.gogolang.org/x/crypto@v0.41.0/blake2s/blake2s_ref.gogolang.org/x/crypto@v0.41.0/blake2s/blake2s_generic.gogolang.org/x/crypto@v0.41.0/blake2s/blake2x.gogithub.com/cloudflare/circl@v1.3.9/xof/xof.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/sample.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/poly.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/generic.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/field.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/internal/common/ntt.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/internal/cpapke.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber1024/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber1024/kyber.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/internal/cpapke.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber512/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber512/kyber.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/internal/cpapke.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/internal/vec.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/internal/mat.gogithub.com/cloudflare/circl@v1.3.9/pke/kyber/kyber768/kyber.gogithub.com/cloudflare/circl@v1.3.9/kem/kyber/kyber768/kyber.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/curve.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/curve_noasm.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/curve_generic.gogithub.com/cloudflare/circl@v1.3.9/dh/x25519/key.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/curve.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/curve_noasm.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/curve_generic.gogithub.com/cloudflare/circl@v1.3.9/dh/x448/key.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/ckem.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/hybrid.gogithub.com/cloudflare/circl@v1.3.9/kem/hybrid/xkem.gogolang.org/x/crypto@v0.41.0/cryptobyte/asn1.gogolang.org/x/crypto@v0.41.0/cryptobyte/builder.gogolang.org/x/crypto@v0.41.0/cryptobyte/string.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/alerts.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/authorization_data_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/cachedinformationtype_values.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificate_compression_algorithm_ids.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificate_status_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/certificte_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/cipher_suites.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/clientcertificatetype_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/comp_meth_ids.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/contenttype.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/ec_curve_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/ec_point_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/exttype_values.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/handshaketype.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hashalgorithm.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/heartbeat_message_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/heartbeat_mode.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_aead_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_kdf_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/hpke_kem_identifiers.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/psk_key_exchange_mode.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_frame_types.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_transport_error_codes.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/quic_transport_parameters.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/signaturealgorithm.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/signaturescheme.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/supplemental_data_formats.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/supported_groups.gogithub.com/refraction-networking/utls@v1.6.6/dicttls/usermappingtype_values.gogithub.com/cloudflare/circl@v1.3.9/ecc/p384/p384.gogithub.com/cloudflare/circl@v1.3.9/ecc/p384/p384_generic.gogithub.com/cloudflare/circl@v1.3.9/hpke/algs.gogithub.com/cloudflare/circl@v1.3.9/hpke/hybridkem.gogithub.com/cloudflare/circl@v1.3.9/hpke/kembase.gogithub.com/cloudflare/circl@v1.3.9/hpke/shortkem.gogithub.com/cloudflare/circl@v1.3.9/hpke/xkem.gogithub.com/andybalholm/brotli@v1.1.0/transform.gogithub.com/andybalholm/brotli@v1.1.0/http.gogithub.com/klauspost/compress@v1.17.9/internal/snapref/snappy.gogithub.com/klauspost/compress@v1.17.9/zstd/fse_predefined.gogithub.com/klauspost/compress@v1.17.9/zstd/snappy.gogithub.com/klauspost/compress@v1.17.9/zstd/seqdec.gogolang.org/x/crypto@v0.41.0/sha3/hashes.gogolang.org/x/crypto@v0.41.0/sha3/hashes_noasm.gogolang.org/x/crypto@v0.41.0/sha3/keccakf.gogolang.org/x/crypto@v0.41.0/sha3/sha3.gogolang.org/x/crypto@v0.41.0/sha3/shake.gogithub.com/refraction-networking/utls@v1.6.6/cipher_suites.gogithub.com/refraction-networking/utls@v1.6.6/auth.gogithub.com/refraction-networking/utls@v1.6.6/common.gogithub.com/refraction-networking/utls@v1.6.6/cache.gogithub.com/refraction-networking/utls@v1.6.6/common_string.gogithub.com/refraction-networking/utls@v1.6.6/handshake_messages.gogithub.com/refraction-networking/utls@v1.6.6/handshake_server.gogithub.com/refraction-networking/utls@v1.6.6/ticket.gogithub.com/refraction-networking/utls@v1.6.6/tls_cf.gogithub.com/refraction-networking/utls@v1.6.6/u_common.gogithub.com/refraction-networking/utls@v1.6.6/u_ech_config.gogithub.com/refraction-networking/utls@v1.6.6/u_hpke.gogithub.com/cloudflare/circl@v1.3.9/hpke/hpke.gogithub.com/cloudflare/circl@v1.3.9/hpke/util.gogithub.com/refraction-networking/utls@v1.6.6/u_public.gogithub.com/refraction-networking/utls@v1.6.6/alert.gogithub.com/refraction-networking/utls@v1.6.6/u_pre_shared_key.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/header.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/packet_protector.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/quic.gogithub.com/apernet/hysteria/extras/v2/sniff/internal/quic/payload.gogithub.com/apernet/hysteria/extras/v2/sniff/sniff.gogithub.com/apernet/hysteria/extras/v2/trafficlogger/http.gogithub.com/apernet/hysteria/app/v2/cmd/root.gogithub.com/apernet/hysteria/app/v2/cmd/speedtest.gogithub.com/apernet/hysteria/app/v2/cmd/client.gogithub.com/apernet/hysteria/app/v2/internal/utils/qr.gogithub.com/apernet/hysteria/app/v2/cmd/errors.gogithub.com/apernet/hysteria/app/v2/cmd/ping.gogithub.com/apernet/hysteria/app/v2/cmd/server.gogithub.com/apernet/hysteria/app/v2/cmd/share.gogithub.com/apernet/hysteria/app/v2/cmd/update.gogithub.com/apernet/hysteria/app/v2/cmd/version.gogithub.com/apernet/hysteria/app/v2/main.gocrypto/internal/fips140/cast.gocrypto/internal/fips140deps/godebug/godebug.gocrypto/internal/fips140/fips140.gocrypto/internal/fips140/indicator.gocrypto/internal/fips140/sha256/cast.gocrypto/internal/fips140deps/byteorder/byteorder.gocrypto/internal/fips140/sha256/sha256block_noasm.gocrypto/internal/fips140/sha256/sha256block.gocrypto/internal/fips140/subtle/xor.gocrypto/internal/fips140/subtle/xor_generic.gocrypto/internal/fips140/sha3/cast.gocrypto/internal/fips140/sha3/keccakf.gocrypto/internal/fips140/sha3/sha3_noasm.gocrypto/internal/fips140/sha3/shake.gocrypto/internal/fips140/sha512/cast.gocrypto/internal/fips140/sha512/sha512block_noasm.gocrypto/internal/fips140/sha512/sha512block.gocrypto/internal/fips140/hmac/cast.gocrypto/internal/fips140/hmac/hmac.gocrypto/internal/fips140/check/check.gocrypto/internal/fips140/aes/aes_noasm.gocrypto/internal/fips140/aes/aes_generic.gocrypto/internal/fips140/aes/cast.gocrypto/internal/fips140/aes/cbc_noasm.gocrypto/internal/fips140/aes/ctr_noasm.gocrypto/internal/fips140/drbg/rand.gocrypto/internal/fips140/drbg/cast.gocrypto/internal/fips140/drbg/ctrdrbg.gocrypto/internal/fips140/aes/gcm/ghash.gocrypto/internal/fips140/aes/gcm/cast.gocrypto/internal/fips140/aes/gcm/cmac.gocrypto/internal/fips140/aes/gcm/ctrkdf.gocrypto/internal/fips140/aes/gcm/gcm_noasm.gocrypto/internal/fips140/aes/gcm/gcm_generic.gocrypto/internal/fips140/aes/gcm/gcm_nonces.gocrypto/internal/fips140/nistec/fiat/p224.gocrypto/internal/fips140/nistec/fiat/p224_fiat64.gocrypto/internal/fips140/nistec/fiat/p224_invert.gocrypto/internal/fips140/nistec/fiat/p256.gocrypto/internal/fips140/nistec/fiat/p256_fiat64.gocrypto/internal/fips140/nistec/fiat/p256_invert.gocrypto/internal/fips140/nistec/fiat/p384.gocrypto/internal/fips140/nistec/fiat/p384_fiat64.gocrypto/internal/fips140/nistec/fiat/p384_invert.gocrypto/internal/fips140/nistec/fiat/p521.gocrypto/internal/fips140/nistec/fiat/p521_fiat64.gocrypto/internal/fips140/nistec/fiat/p521_invert.gocrypto/internal/fips140/nistec/p224.gocrypto/internal/fips140/nistec/p224_sqrt.gocrypto/internal/fips140/nistec/p256.gocrypto/internal/fips140/nistec/p256_ordinv_noasm.gocrypto/internal/fips140/nistec/p384.gocrypto/internal/fips140/nistec/p521.gocrypto/internal/fips140/ecdh/cast.gocrypto/internal/fips140/edwards25519/field/fe_generic.gocrypto/internal/fips140/bigmod/nat.gocrypto/internal/fips140/bigmod/nat_noasm.gocrypto/internal/fips140/ecdsa/cast.gocrypto/internal/fips140/ecdsa/ecdsa_noasm.gocrypto/internal/fips140/ecdsa/hmacdrbg.gocrypto/internal/fips140/edwards25519/edwards25519.gocrypto/internal/fips140/edwards25519/scalar.gocrypto/internal/fips140/edwards25519/scalar_fiat.gocrypto/internal/fips140/edwards25519/scalarmult.gocrypto/internal/fips140/edwards25519/tables.gocrypto/internal/fips140/ed25519/cast.gocrypto/internal/fips140/rsa/keygen.gocrypto/internal/fips140/rsa/pkcs1v15.gocrypto/internal/fips140/rsa/cast.gocrypto/internal/fips140/hkdf/cast.gocrypto/internal/fips140/hkdf/hkdf.gocrypto/internal/fips140/mlkem/cast.gocrypto/internal/fips140/mlkem/field.gocrypto/internal/fips140/tls13/cast.gocrypto/internal/fips140/tls12/cast.gocrypto/internal/fips140/tls12/tls12.go 8E`    9  , &     ,ntz  -   !*  (('(L 2 @$#  LNM6    ! <W< ;b_$+LF...+    XXNM6    <  X   ( '('(!     / $'.#,  ,@ $&34 +,4:    #; !$34  /8 ~}       9*  : .7    A KHGI5:   6 [ mp]ZYZ_]OR      ^ ; H; NMNM^gh  mnopong8t' ['9;= #  "2    !    %%        ''   ) 9    &6  ) )  (1'(   @  DNM6    <  D     p "%14#D     =  OL  ORYZ        ) C55(  ,:L  \   r        8780/0   UX_b                ('(   (&'( + n )? 1   ("'( ' 365.),?? -    %  5 ILKD =@EH[? ;   ('( # ehg`Y\o? )      y|{tmp? %    HGH &L  * XRD ;   21      `_`*6     `_`$`   `_`(x     0/0/0 X/WX      5 81 43 @8(       9  @         # &   a D"?+ )% G ?  ( pop op%opop op  "#    " $~u .  V    J: p*op op opR    F0 0  Z $   N>             "   8u `>_` _`_`P    !%   K&' H  @  "         {$@  "     0  pm      #  X  k : (2"1 ] 0  H:GHGHGHj    ^I R  NK   k        (    4   &'  / L     -  @      !  & + ('LI +,+,  -o    &   b !   \5%2+D'=21Y -  <  ! (   xq" POP OP OPOP OP OP  FI.C.-  W`    7  ##   POPks  on{z %edqp ' ,        popopopopopCop2  , 36/2!  y|   H&82 q 0/0   /.-010    ABADC TILK Z )3   0/0   @>?@?@?@c   W%$ ) @8   XWXWX  ) !"               o)    0+/0/0u 0+i8 J       h|ghl<     - O0< P'OPOP OPOPOP OP OPOPOPOP$OPOPVl   @9NE      <&mH   CU  Vl  @?@$$ @Z?@K?@                           @) !"VE*'(ARVY\z9      @^?@M?@                @) !"VE*'(ARVY\~;      @Z?@T?@               ) !"gla`( zB       W $   :      7XWbab /! !l;! !2! !    &,?= L   (     `_`Z_`     C) !"rrmu 2ituXGA`CFABKPhAG           8=78 ,      G(, 8T78  )$ +07LO( fO   @?@&         7   8   ) 47!":}3TU   $        ! !     7   UVU   ) vy!"|^;uUH hi hj!        ! ! ~     ?   "  feLK Lcd) !"0U_   4 [dcccfcceh)3    $!(' *+*+.-. ./.-232321 6 "    8      __? '          7       ) !"U   6 -2        "!$%$%().+('('0/0/  4: ?@1  E$   ID=T     C 0CD  W:%&  ;8 Dl #   ?@1 '$' *+0-,+45"87 :9:9>=<;$ 878B782    t`      (U'('(f   #Z9-     8)7878 788  0  ;JLE8 p;opopopopopopopi  9 =L      %/ -  n< w     1    .(' ( &               .+  -&         #(/0 "-,  BkX 9    L "!  $%(',+*) .-0/01.-6543%89<=/@A DCDE- ('( '(+  YDO"   "  69         '  ../       "   p>opT#            7     ' $t  #        xowx4 /   p)*4 /       F              J,%O D9    6F       Z      )                      $  q  = F  ) !"#&4yjZg 6*       )   "!$#*)(),- [      +                        q p = F  v) !"Ir[>;U/" 6*       +   "!$#*)(),- [ 4$                                   !  &sY^ N \ &,+n87 U5) !"Wv<7BCD=, 6  8 ;4'     "!"!$#&%*)*) , ,+! [ 4$  )                              !  '(G,VON Y^ N l87  K5) !"   8 4' )      "!&%&%(' *+,+ *)!      ]    )           $  q  = F  ) !"#&4yjZg 9*       )   "!$#*)() ,- ^    +             q p = F  v) !"Ir[>;U/" 9*       +   "!$#*)() ,- _ 6&                    !   &sY^ N \ &,+n87 U5) !"Wv<7BCD=, 6  < ;6)     "!"!$#&%*)*) , ,+!  P  A      b    2  ) A>!";N- \%. A      R  F          2  ) 47!":'H %.! F      _ 7&  #   !  feFa g7>?Y^ T   &abn>= KU ) !"UzKPH ,LVDKJIsa  < :g7) #    ! $#$#&%('*%!$ $#,+,+  .  .-!  R      $   R       2  ) !"QJIU M> ?@?B8 $        !"!&#*)*) T      '     <     2  ) !"U  8 '        !"!&#*)*) Y 3  $       0  qej Pcyz GQ) !"4jYZVI>? 6N6  6  13'      $#&%&%#*)('.+21 434367:9:9<)*)0 @#?@         111SS (K'(3  xJwx#wxwxwxwxwxwxwxwxwxwxwxwx:  NA  =@E  HOD 6wz       $ D,uQ8AW ) 0%/0 /0C   7* XVWX?WXWX C@7>?8        O\ u popop ">r/(     ">    EF  "  n  hgh h(          ('((    , 9 -) p1op Qdc^ uzst3%#  p`op!      a N!  0C/0 /0E/0 * 9B? @    GNu *X  ~ Jg 21Vqbs"    /  ('( F,   21  e ( '(4 < ('(N    0/0/0 /0H  <$ H&GHGH GHO    C$    @?@?@?@K U AK          878  @?@(  `'_`4 (( ('(#      @?@ ?@?@;   $+; @?@ ?@?@;    D%+;   ^#   HyGH^'(ST`        s)1`  ^*A*A    "^'(' ( "  87827878O ,O\ sL,# h5gh ghghS\    " ! @ 0/0/0-   XAWX"            B<"  @?@r  UV,0/Z {}~ *.        G < N  ,C0 /0r   p)op-op`opop#opop*rFA,Hg hA,pghgh_0/A,5A,   &|uv MNM             _      !H 9Z0 E$    )  @\5"#   rA,: @a?@rV  &   b+V   T  ('()'(r+B0/A,   =,   0/0r%        XWXr A, ;<(wxwxBwxwxwxXwxrkA, A,10/0/A, A,{ghghghg h   Za#$  klk           _       -$  3o 4 ck    . B  c )    HGHr30/0/C              +0C    rghghA,    _   0/0r       rghgh     * hXgh Y0  \ .     nka\.     3 *@2 -"  |A9 |A9|A9:9|{)|A9 h hin  5X\Y     ) *  H6GH    6     H>GHGH [   *%.# **V 0Z     )   0 h @?@         #(9&# (3 .-"!"9&&'  &'987.-"!"&#  '&'  )9&#  78 )9&#  74  6_ZO2; ;   * +& '  > ?   " #:  ;.  /67BC   2 3  FGLK L,  &%#!###%""'65.""%"7>)%CJ G @' $ '!# %    HDGHT      H7  @X@?    <     #* ]#5      g )-#5 hgh(gh~     # #0 PEOP8OP OP i ji  V      Q PDOPOP OPOP    #     + 3  Z  TM +   5 3  344F  D= B;5      x3  34=>= 34=>=>H2/ (= &# '"1214 x        0$/0#/0 /0 5V"7 POP   I       "-D  I    hMghJ  *5 #o%  X0WXAD       #q" .  &' #  w      Q     (  , NM6    <  22CD1S5T$#  ) > J     Q  (, 0+/0 rA 7rA/    :+    #. ""  (+6 ## &  0/0#       ('('    ('(    @_?@?@?@"   +   " "   / ""   + POP         '7 8s   `_`_`_`?   * 5& ""   1$4 #?   POP"        '8 ; t      HGHxw2 LS   P&OPOPxw J  41  , 8 78 !r    !?6   3& @9?@ NH   5P,OPOOP%OPjijiCjiji8z  [dcd* 9C8 ('( *  0/0 -   0)/0/02 /  7 1  *5 1  AB   h?ghghgh-|   J? ! @# N/#9`7$$/ /& ,/ /&   /@99 [bGRmly 4$1 \  8G78G4MNMN1-$   D /  '<   "*(41$ $      "VZ '   8$78278[78T =op+opoppopoop4 "Xv6-& 1XXU<9 (CJ )   ;#  !R        / ,&, , poph] -:9:9G] ^  H        9   $ $Nl]    ?h:9:9LK1212LKLK12  QK ;K :9B12 12Y   l w     '.5.   0-         uv o 9:#  c 9:BEX!  D7  =@!++2,SQ   C%         B Y P8OPOPOPh  :9;<;<  2    7;   "h A"!B A"           4    8G78ZhD12h   -.  yDh XPWXWXh 6565  :9:9:9:9:9656 5G1265S656 5           >` ]P_j%!0 0)*/     & (4         %S  `_`h 6565  :9 :912J1265Q656 5&          T]l  k634 90       qE    %   Q & pop h 6565 F91212:k2H1265 8656 5%             X alk         1,IJ     a P   %    8 % `_`h 6565  :9 :91212:k2H1265:9*656 5&             r  a  MX       0       w)2        %  * & XWXh 6565 B5KL12.656 5>565KL 656 5 J 2G         *0M .             (+'('(hW   K0' 0i/0h*   klk'( 5:9  Jj6,*    h#   (('(h"  )!"h  (4'( h 4   2' ,    h tfsHt  &"V  B  +# ( fH @?@h 0/0h  XcWX;WXIh"6565 A":5:9/656 5 A"1:965 A" > %17 $ :!"  /     1   H9GHGHh:9 :9:9"  ?3 "  (  (   (  ( '(  (*'( #cd    + #('( `&_`_``)*;   >0303/0/0/0/0`)*)*=>=>* S)  '`)*=>=>  $(U'('('(`"=>=>F     &   9 r,I"*  8E78<78"7878`BABA=>=>=>=>=>\ }S8  S  (3~      LH#;H' `)*) * U,+V)* GH!          -  S        )VE:       !-C7 `)*) *GH           90?   ('(`)*  `)* )* 7b?P  4`)*. A 4  _`=>=>)*)*BABABA              Sm d     `)*"  0%/0,/01/0/0 ` $    !/9f @`!UV)+V)*x     (# !x8h78` GH&           (($i7           h%gh6ghE`=>=>GH     N     /50  -N]`BA)*H  ]H H0GH`J > !` &p}~} *         6-  $LgJ~E  #       C=      M$   06/0\%        /%  " \,A QR,A|v   hgh%\>%&3QRY        7'  1  X>3Y XuWX\%&)FEQRTS%&       !S)   \7%&&QR^ *)     ji  1N1*   A3k(7&^ 0 /0/0)\QRQR QR QR& M&  & yz9:9:9klk'( KL9:9: 9klk'( :KYZY ZLKL9:9: 9klk'( 9:   J] `FH 5J   IXU IDCy|  pm!"    @= J1873 3Z!%-&    :    +" !!$#(%&% * -0/  (A'( V Q2$( 0 /0/0yz&  & 2 *?N (   %   *    (6'('('(_* 65  xw 8+  (5#  []   *X 1 *    Z_H_0   9  *$ #$#$#$#b$ #$#$#$#l l    *1(     ! q     0  q     0  {$: }3 $i  $ ?   b      l POPOPOPOP OP *\  xwN       !=X+ Y  C  0 /0*       hghDgh*\      87( 1h \ H,GHGHGHGH1KLA<KLKLKLKLK%LAX An121A<KL*      at  m[        %    * @?@?@wxwx  mpWX$  HGH ijwxwxwxwxwx&wxw  X_    qtY*+         @_?@w~A<wxwxw xA<-.-;<;<.  $ $ lllooool 51 `         wxwx w  0 A  %%& K& K 2 `_Yb< @             . wxwxwxwx   +   HeGH$GHw~A<wxwxwxw x-.wxA<-.-;<.-.- .A< S  kkkjjookkkkkQ+    wxwx y    8Q78w~A<w xwxA<   _3     & wxwx   '# `wxxwxw  xwxw wx% PS  [D_ KL  V2_9:4-*+ r       %0/0 d   0/0    0/0     @ ?@   0-!   !   X9WXWX,N,    K  0 HGH,V  $  2/ "   G0` HGH%GH,I  ,vu ! ('( ,'   `_`, f e       POPOP,1   % X0WXE,  5u  " )    .| (0#,+:9HGVUdcrqPj+`)" " " " " " " " " " " " " " " " ""! $"#&"%("'*"),"+."-0"/ 2"1S4"36"58"7m:"9<";>"=@"?B"A D"C F"E H"G J"I"L#K N"M P"O R"Q"T#ST. ('('0XApXA% &* P     +v7p * 0 %&% &  2- $    0 XA% &     0%/00 XA XA  A $!    0XAXAXA BWXAXAk)% & % &  at e.ABf 7535IRi/  JY'fM  *  )6Mbef      ) 3M??$     k)    :0:  : *_0(' (-0/  rqrq , @3~Y*0+NM6    <   {|u~2!$34 [ K &-&+' <2           "!"    &%(' '7 X-WX 0-     6-   0/00 : Or   L 878.78j    1    0,/02 '(& <1 ,& & (I'(2V  5  2  `_`E_`2 T  6^ ^ T @?@2 '("!'( '("!'(2Y(lklkl(lkl k 6    ' h      (?'(2"!";<;<!"!VA'( VA jjjooooj($    @?@.?@?@?@?@?@2'('(,'('('(      4X,  M<2lklk lkl klkl k !  DCDCDklk'( k'('(  ' (Ilkl$ kl k"! '(< $#$     %4)4    J?  J; :        a                -cL0WT    !       " !'$#&% ('()*)*),$+ ./0 /2143 < p;op2H  ' POP2     K2    "!$ '(#          C  X     X p              $ # Z2$ & {   ~[<$& 0'/02$L K   $  0/0T(!"  2 '(kk lk-DCDCDklk'( k q$ 2'('('( VA VA/0 / 0*YZY Z121="!'('('('('('(-'('(0:ijAMVAVA kl k0/   h      J           (    -0  XU    y  -        1#          J     %        #,6E(<  A  -      q$2 ! $%(   /0/=65B8N7878787:  =>=@?BABADC-DCDCFGHKMNORSVUVU XWZ[\ [F 7 `_`  8 2E     (( 2 8,78D782lklklkl klklklkl k         4        r(   2/klklklk 2El       *      jW\c f[ V    +- #}/    2E  XxWX 2#VA";<!VA"! SogS/8#        2L K   "  2aL K   *E    K# O +1B+%za  0/0B/0 2VA2Y('('('(VA21VAVAVAVA!/0 / 0 &1 -0  G>     "#!&  ' @J?@2VAVA#'(   P#   0/02VAVAVAVA       W    @A?@m?@?@ 2  ! %,   * !5, ('() TjX\ .]  % | q r'    4'  ' @H?@|qrqrqrqrqr apopchgj_bX-    | q rq r  _ b>(    x;s|qrqrqrqrqrq rqrqrqr"!"!"!M"!Eqr"!" !  Em(9!^4/0 a*J[ JEJI JQ 'UY          ME  o|4qrqrqr$qrqr   _ _o4$    (_'(| q r$qrqrqrqrqrqr #    __=_b>;n!P  $        |qrqr &MR XJWXWXWX|qrqr$qr F `Y\O%  P   hqghgh/|qrqrq r0qrq rqrqr6 |   `_ S_~HW  & 4 nm nm >z          > @?@'4G  1;, 87878K4!)* I*C vkm5_. 2!C 4  )** I*)*/)*       *),  !"Ag5!    b2>  *   /   XYWXWX 4 I*\   D   * \ 8#78784nm  ' `!_`7_`4 TA TATS TA Ysn  nnX"!       14P),+*TATSy (  \U& "-< E 7k #!@P     _ 0%/04      GI4CHq*) *)* )*:)*)*#)*1)* BABABklk'( i%  BABABklk'( iBABABklk'( iBABABklk'( i  2=fBXz?  g%ghwts hg#4('(J&#w  0J  J J #R3?* * * C    :#1  % " $ ',)*). 163438 ;4 4   P4%:)*)*G!)*_                    3=%)M%:G  !  _ ! 4 TA TA  rg      HWGHGH GH4 TA ;<;<;<;<I*)*TA TA     fnnnnnoooq     + xu    A4 ) *TA) *   ;<;<;<;< ) *)*TA ff    ee ff  ennnnnoooe             ! 4 I* I*+"!"!)L!BIL =>!*rqr q I*ArqQ"! !"!"! I*5 I*6      X ' op    s .x                       . .E ,&0-K / ' +        *  AQ  "!"!$#$#&% "%&%&% ()5,-6 4 T   {     N#(, \4BJI)*JIJI.JI)*>JI)*JI)*?       *'&Bh"qX h"}dq)g'6T)g4>=&  "-*)     X  I:B.  >   ? HGH 4(Hq*JIJIZ)*JI  WTOu *S,8u<  K (Z   POPC4,+G,+ 0' !   C!G d4  ,+, +[%JI JIJI         'F.FC"8  9"2 _21  6CJ A     [   %  HtGH 4,+0,)*+,)*++ > !, CF"   ad oR$]};K0   + @?@4   @c?@c?@ ?@?@^4.+*+,)*)*+,+,+,)\JIJGW ,    # /L =/  #xVt  \W hghzgh4  #+*;+*)*+* ; # "   .   %#N7$W  # ;     \4 .+*)*+,),$   oa    X/WX4<    0$  0O/00 + P0  [ @? )D7IL4+,!   -  ;" [     [       X    6$Y>* (# 6 ( '            ;!) =IopoA   ^>          " WX @  <C    YRT R] (!         =I! 0&/0/0/06/0/0-&%*     4   "VW  j- * b VUrqr9 V^klk'( n2       " !  B     87  %" J       /?)7 ;#     T 2 PnOP   klk'( n       J    o   %        8=78            @d?@klk'( n    J    e<    0,/0 /0,      0,  0^/0-           2[- 65              -  /         K  &" _`          i^     .5   "   5 \.     .5 0/0/0/0*     3*   @'?@    @"?@?@[   "XWXWX. + #P+ +    XWX.+ #  ++ POP-+ #  ++ PqOP Y klk'( n J  q$%    p /0/0       pop opp)efefefefefefef   ' G)     (w'( p0'('(H      sj0H ('( pA*   R O&  pA*efef;<)*A* lool    t pA*<A*' ( A*A*  2 ' K   6+<         pA*A*  `_`pA*A*  K "    m` 3C  (7p/e f    ,/   `5_`pB  * 878p#    popp/0/0/0/0x,+,A* knmnmpop=        x   pA* A*@A*12  A* A* "    `_              ?      @   "# Q p *   !$#>      ' `_`b_`@p2121J  1 2121W JQJI0?  ##$        34Y#C!=J  1     Wp)   p(op\op op opp efef 12712e42           &1l+       H5GHpH   %  PXOPpE121213fef   H E     p1213fef  H,GHp@  pef  Spef T    (pS  QVUZ-&#+  (pL gnmp&&+ fp7] ^] ^] ^]^    63 v   7         > V    /)#  P?OP OP^  )  -#  K f    I P P7OPOPQ     E9 (e'('(dLKLKLKL AD74;>UZO XY ZWP5Y         popopdYZ Y Z YZYZYZYZ[ 63 ? 9   [ 0=/0 dYZL K LK YP+ '   @d$A $AYZ$A0 (k%   p  0 " dC   @ p1opop6dYZY Z Y,+Z$Y ZYZY Z eZ@ XU  * TSJ I@JM   { *A2   $   @ @U?@?@ dYZY ZR  XU    5=A J {EdYZ-+Z YZYZ klk'( 9YZ -.-,+*-.-.-.-.-.-.-%.). -.-. -.-+Z*LK Y Z-+Z -.-.!Y ZLKLKLK- .LK&YZ-.- .>=-.-* -. -.?.klk'( 9-.  B= -. -.-.-.-.-.-.-.-.-.-.-.-.-.B   J! *%&""C,    X ""#"""UdU     R    #L""""    $                 P  C Y%C %,;:"""     J  %+     S"""" """" sr """"""w 5E, <-8}r6 ^9=     !"!$#&%&%('*)*),/,%+214367 <;>=@?BA ('DC  *FE H GJK ('('!N MPOPORQT SVU&XWZY\ [^]`_bcfe ('hgji lknmpotqrINux {(Nuv}~gh  I+ ('('B @5?@6B"  ' d$A$A      #  pdA). -.,  3             VA    ,    xGwxwxdklk'(9YZY ZYZYZ+YZYZYZYZ klk'( 9  J                     J    .%       +   ~d YZ YZYZYZYZYZ!Y Z (             ~ k        !  ~   D ~U    I.  POPIOP~  &     # = (('('(~H 4 0L/0~Kst       EK ~D   '   PiOP2~* A8 A8 A8 A8GH%  *  Im     0/0~    ~#      ~*   (#'(~5   )  /~ A8 GH A8G$H   R[f  MJ      ('('(~ A8GH A8GH A8  41     @,?@~9    PaOP 6z   *. 66+,+, L9*   6    0/06zy                 a6+, hgh'?@?hg@klk'(g+, + , +,+, RA+ ,+,hg+WRAX'?@?hg@klk'(gh g  J            9$    J     `D5             ! #$#  ( !   06.YZY Z-.-N@?@? RA @klk'( gRAIRARA1  XU    XU R J      Q FC D? 83 * _RSR% '(Fm, w-;I N    I16) ! H%GH6.YZ-(    ('( 6& SV  . 6C    = .%6_ \a$2/0% KSXC 0/0/065      !5  64343RARA4RA"RA!RA+rq,+,+,+,+,+, +,++ ,+,@?@?@? @klk'( g P=  efUOVU"BX PJI &%&78        J # B 9 Z  2,    "!$#$#&%&% &%+('* ),+,+.-0/4121 6 9  @?@ 6,+,+,%*)#+,+,2+ ,       ,          !mF&     #      ;6lklk]lk        j         <= N&% (%4]        j (R'(6 @?@?@? @klk'( gRA RA J (     `_`l6+,+,+ ,+,~}~}o    %8    *Aki        i   P6+,+, 0"/0L  #>4F 0/006V  '++ @?@6hghg RA[RAXgh g    QUX  a*m &       @?@6hghgRAXRAXgh g  &  56'  f ]       %     P{OP OP6 RARA3hghghghgh gRAn}~}RA! !!     !%   3           ()'('(6RAn}~}RA"    ! *  PmOP6 RARAhghghgh g"  " "  l#         8L786 RARAhghghgh g# !#"K'         $+6n#  )   `/ @'?@?@?@16hghgRAZRAXgh gRAn}~}RA8$ "$    "###!$   iO        %    * 85786 RARAhghghgh g% "%!$         8T786 hghg<;<JghgRAXg;<;<' #oooK % KnnnnK*%      6 RA RA' %rK#' HmGH'GHGH GH 6RARA+,hghg hgh gRAn}~}RA&' %'$' ""   &'''$(sr%        & HcGH GH16 hghgRA$RAXgh g% ) $ $ !!&)  % 5 $ $38       %  8H78786+,+ ,+,* B#"87 ?$ " " ##QB*   0&/0 6 RARA* (*&* -   0/0 6)RAn}~+ARAn}~+A+,RAn}~+A RAn}~+ARAn}~+A RAn}~+ARAn}~+A RAn}~}RA + PO )**+J***+K&&)**+)**+#.)**+***,***+)***(,&)   "%&),/03 69:=@CDG JMNMPQ  87878 78786?RARA RARA"- '*! +-= >54+* Q RIH?>Q h_^UV *-)*-)-@WC              ( 6 RARA. ,.*.2/  @5?@ 6RARA/ +. ,.! 8Y78f6 "!(*'2$UT * 0E/03l  5% 1 hgh l6 bafeb!-.3(     c+67  7c p 'E    * @2?@?@l A&A&A&  8(    1l 6#  L %"S:9 2I!8 1      4       Y        wl',  &   : #  #             ,      ('('('(l56'   +' l-. \ ,        #   x:     L `E      ,  ,F3<  %    I-%%  + L -z{%3 ~ L    e       c"!"#$#&%&% 0/0Kl-.-.-.-.P  . "#,#&   P PYOPOPOPRls-.a                 Y  Bi+  &  1 % popRl-.+ "                       i ,              >+C0          ! #$% $ tl #$$ 9z     `w_` 8#ji >ji        '0H# > ?,8 4346i4343&   vqt pkL+  & 0A/08?-.-.  *$? (G'( '('(jfL   Vj #1Hv  ! #1H POPOP j   +, inJG2? ,34   ZY j5           x_wxwxwxj 83  67   H('( G$ 1> Ss  LK 7,q{S2LRQ$      "%&%(' *H)(&  \& n>   *i3 (d'(/'('( n   ,Lt   n5G*H,HH 6=@?(<G #2=.9  5G*H,HHn-I.-(%           F5 >    ? "! -I 0/0/0'/0n` %TA" nn 1     C!  {n3    {3 n#   ('( :4  :hg     :hg     :hg  "  `_`r_` _`_`: /0NA /0/0NA 3/0/0NA;0"/0#D   87878>3434    87878>343434     >34    (!'(>.   ( >U  #$&-N"     >V     ?,$ POPV>      $  #($G6 (   % #> U   :   _ (2'(>B    xwx)Alk;)Alkl)*  f{ n  wfv^wuv3 "      "! '&),-01 XWXWXeWX    rq ,q+,[  wvv-2w}     !$#&#*+.- @T?@7& rq|Nww|{wr`M b; 1   "# & ('('(-  878'% SX_Z2%@@.?@)@Z  W Q 2 @5656HA5656      Q  @5656HA56   9! @565 65 65 6!5 656 5656[565656                   !      [        `,_`_`W+*   )JIJIJIJIJ>IJ   >?@-&F+P ', +P    ?P  KP ST ( W     >9B78787 878  !"j i9   (B 78FA;878FA /2:D      Y B7~A7878 7878787 8FAFAFA vnk@6323 ak<     3NB&;<;<78787 878787 8 kookkkkkkook                  B7 8    ('(B  y |  0v/0/0B7 87 878 7878,7878   fsxqref!$ /,l"         8G78S78BFA#7878FA 7878FA7 8787 878787 8787 878787 8    63  , 63 , 23  J  23  8<8       !"!$ #(  +  B(    0&/0+BFAFA `Y             Q2     JQ      ,     6 O       $d  ) t )* @?@?@?@ D    +3 D !M!!!!!!Hl R7   D343!$  J=  z4kL I7l M  D^lPOPJOP   7878C     ) eQ 7XWXWX&  #   (%'(2  K   ;/ 1H@=>?     SS' y \   ? 87878(  hggh%ghghSgh2gh   MN    2   ?A + f}>V   ;   0 hDghghghgh3#    I3#     8!78 7  +       X/WX780-XWXWX  '  0/0#          @   [7  7878C D79878C- X_L?0"VTS       _J i!#    7 9-       mK  ' (-'(L r  P  0    L   @#L.   @!L,   @$L/   @"L-                       L!    L   ) L>  2) ELP      4 @#?@?@LABABABAB$ <9ws*) . $ 1 hLgh\L RQRQR4B;RQR QaXQ<    ,  /7(    a   x3wxWwx^L*RQRQ34RQ)RQRQR Q3<ARQ<;   4 "  bi *) 3     !   #L0   P3OP^OPL      :6 XLm      2*L L  J  L       m <9) E 0 /0/0L%  J [L5ZY7 %  &     1)D57 8%78'78G78L VUVU VUVUVU,           w+        L  ('(L+  ($'(LPOPA    XWXHL$A B  4 (PJPaVO^U  V  /1WOM$ 878L " H(GHL)    )H#GHL  .  X>WXLA B"     ,  " A  & LbA B<A      %Qb  L    _RQRQZ QZ QRQZQ<A; B<A<AXQ  6          "" 9_    LcLRQRQRQR QRQRQABIBRQR QRQR Q                    c              L7 " -"   L @%0$  /,  @   @&1H  P  \  d  p  x   P OPbOPf<;<;0RQR Q  5 -s=LKN9 = ,((         zJIEF EI#!  NBABABEFEF'EFEFEFEIJ0IJ.F  ,$"E+PP: !$ $     #$#$E$Bq,$9K3/8 q,$.- q,$#+l]   . . 1k#|z 5.   #  !   '.. H&GHGHsEI!EFEIJ0IJ.F %   . . #  5'!..  (%'(M A> & CK LKLKLKLKL -KL2               $   $   G  5,o #       -2 0"/0DAVGP D32$  6 G AV ` AV \ 07/0 /0/0E     ! E   #          @9 %4 @A :A 89   #      !.  " Vf +]  (  J^      Q      0 /0   03/0@ +(8 popuMN:AV      ( wu  0  pop~opT(;<;<;<IJIJ IJIJR SRSKQRRQPRTtt    ss"9  @9!rsss /  %:"   R     ?  T  T+ T  0XT4A;JIJ( X_ G  T  TIJ h?ghTJIJIJ< B3JIJ Ia4A=JI  ,952)&   a  =  piopTJIJI;<,JIJIJ I34A JI436 (#   :f 4, 3    6T       T    POTZ 0 6 TKL   = TIJIJKLKL q *w         XvWX TIJ4AEdcd c4A  ;         P E      % T 4A4A       ($'(T NMNM 34+  *  $$   @Z?@ TJIJI A!  MN  MN   g17     ! T  IJ   ZYXW:=>=g4AIJ 4A1 POP O\                                !       5 8+\      + "  &'*),+ .-011  \  "TIJIJ+ GS   ' + ('( T3  ! @?@T#4A>=dc4AV         &  #       T&  T   hsghsTIJIJJIJIJ'!"!"klk'( I JIJ IIJ0IJ6 J    . .' 7  5'     .. (T IJIJ _2_ >/  X.WXTI J XIJ I0IJIJ0IJaIJIJ0IJ6       )3  . .)  . .;6 5&6 5'  -   ..0.. &'TI JJI XI+      3& +TIJIJI JIJIJ IJIJ-;<IJ;<IJIJ       ^Y 0    g-,'          -  TT6&  T ; <;       " TJIJWI J      4  (('('( TI J   -  HBGHT 3y|   5 $ HGHT  hAghT$JIJI JI JIJ I  "$    `_`T 6T % %' %T   IT"!"! "klk'( I4AIJ"!"!2 "! "klk'( I43 1IJ4A4Ad ( J_JUVU  >   @X   @? )? m.01@ ]  c    2   "!$#&%('*+,+*))0-2367d:9  xwx T JIJ[7J7 J4AI JIJ4A;< ;<""!"!"klk'( IJIJ I K  _ X_   JAJ7$      "!$# &%*'(', /212 1(#'(T'%& 6 TK E% T    POPOP:T>= B3IJIJIJ4A IJIJ4A4AIJ4A4A  .      {I DC\72       #$% popT JIJIJpA_4A"!"!)"klk'(I "klk'( I"4A 4AXIJ I! !  !J    ""   "  QY)V _    )  " ! $'( ' 6T%4A4A#  """%% XWXXTJIJI4AcJ IIJIJIJ"!"kJ&4A#  !#J  o     !!!!!OX!  #4=B  $*A5&c         &  T$  `_`T KL : =*"!"!I J"klk'( I%""   $J### % %"(.A   *     T I JIJIJ' " ###$$ ($   @n?@TS;<;<; JI J'   #####t "  & '6S  T "!"!I J "klk'( I"!"kJ4A4A>= I J : =(&J%%%  ' '$(&&OX&&(%( ##' ' "U7      " !& 'FT IJ I JI J>=>=* %%& &**$ %$####G'#        )TI JI JIJ +' '& &%% *)   T ;<I JIJ+''A& &%&   8`7878 T JIJI ;<;<4A ;< 4AJ IJ I , "### (((( *,((),####!|$4         8'7878 T;<3- ))%"3 0%/0/0T JIJIJIJ IJI JIJ I- $$$$$$$$$$ $$$$;     UT 4A4A4A4A4A;< 43;< . ,.*-..*.,.,.**-.****R?       (5'(T4A4A #. ,.*.    #T/ XWXWXWX6T JIJI4AXIJI;<4AXI4A4AXIJ I4AXIJ I;<JIJ I9/ %%%%- &c T&`:::]B,,, c===,/ . &&&M+ &&&d,,&&&&<=a  l        !" !$#  @W?@5?@q?@?@?@!?@ ?@?@T)"!"kJI JI JI JIJ 4A;J-IJIJ4A4A 4A 4A1 <<AA...OX.+  X w) 1 10 0-./X.$@@1100 -1-1-1%00-1%^ + W      "! $'),+.-0/2367 :; >=@A `7_`T*IJIJ;<IJ0IJ=2  2 0 00/  . .$0 5.  ..   T;< ;<3 .///   G T IJI J4A4A3 1X12 21333/3 %       @?@T["!"! "klk'( I 4     2J111  0*>$[   Jc@d>MebTIJ;<"!"kJ44A4AIJI &$/; <;<4A 4A7JI8IJI JIJIJ IJIJIJIJI JIJy4A;J4AIJI JIJ4A4AI J4A 4AI JIJ#7J7JI JIJ 7JIJIJ%IJI J4A43 I JIJ"!"!"klk'( II JIJ"!"!"klk'( I4AI JIJ ;< 7 l!"!"klk'( I 7 J4A;^!"!"klk'( I;< 7 l!"!"klk'( I4  3X200 222OX2  <<3k6==157m22 37::l ll2 <<35 253K33+555 5ba33b43 6s=\436666&  3 :   5X534::55'  444 488 86r959(  1*7K7/78 8t77tst7K899 w8899  9:999 9998:66::88*  72J2221+ (  67J6665/K 5899(  69pp90 J777600 6 37::y3J4443-C9=pp=+ J3332,9<<a)Y8 : u,9 7 D    ; 7" 7+%6!   I% 8-\  /$ !  ' *),- 0145:7<;> =6565 @A65DCFEH KyNQVWZY \[^ adehil knq tux {#~ 65 %                P H GHDGHGHGHT27JI8IJ7 J ; 7722227K880::  0 6 H7       A4T;<  @IJ\; <;<; 77 8"r:::::r q ; :9X9;: 0000-.#V/ ,+,/ 3l ll8/0]`ef: ///cfST10] Z/ 4  /0:`0B     0 8 8178078 78TT4A 4A4A <  /// /1 101:< 8<8</X        @N?@T`= /// ///.1, $  POP9OPOPOP OPOPT(4A!4A4A4A 4A = *;= 9=:= :=9=/+  '(!     ( T IJIJ> == ==  &  TI J> = =     T"!"!;< "!"klk'( IIJ4A;<4A ;<;<;<;<4A;<4A4A;<4A? 44<J<<<;;  ;;;5(??A0=?+og+;?3oo222332nnnn%2;;=?+og+;?22=?+og+<?L`04      $#& %   +.-0143:;>=@ADCJK 878TDIJ4A4A4A;<;<;<;<4A4A*@   w  ?X>>@>@AH))GH>j))) 1nnnnnooo1=@`=@lmrs*j D   "#*T 4AB =A   XWXT"!"!'"klk'(I;<;<;<"!"!"klk'( IB ?J??? 2A>7=>==>$#> @J??? >8T 8'  XWXsT "!"!IJIJ "!"! "klk'( I;<;<;<4A;<;<;<;<4AIJ0IJ6B @J@???? ;<<<?7=>>=>$#?@B'nnnnnooo/?B440 . .4D  5'      "#,- 0/2../C  TF EC ? ? C  propTIJIJ;<;<;^!"!"klk'( I )IJ0IJ6C 0@@@ =??=>$#JAAA@:U2 2540 . .40$ $ 5'    &.. 8[78T "!"!;<"! "klk'( I;<;<;< D BJBAA@@==A7=@@=>$#A\;     : T "!"!"klk'( I E BJBBBA; $    E  pop'T;< I J@IJIJIJ;<;<;<>E AAD D    ?AAADD=AA=>$#B-    @   >T*F==  `_`T"!"!^IJ-;<IJGEJDDD   , FXEDDFXE Bc^-    ) T"klk'( IHD>%  0?TJH 57G 5 $T 4A;JIJ4AI FXFF_GEH#    878T;pA0!"!$"klk'( "klk'( I4AI EJFFFE HHHE?EI/!/$    @QT\JEEJEJA 9 T "!"!"klk'( IJ HJGGGF@: !   878T$K   K @d?@?@2?@?@T "!"!"klk'( I+"klk'( I LJJIIIHB )HBL5  +   TL 8!78T%L " M  847878T 4AIJIJ4AM JLKXJJ_KIL     POPT "k l!"! "k J "klk'( I;<;<;<4AQRIJIJ;<;<;<;<4AM I JJJJI L I7=II=>$#JKjMMKXKK_Lnnnnnooo$JM   F+-      ! &#() ,-67 @?@TP @@@@  TP P   0/0T)P popTJIJI;<IJIJ=@?: 9:-9:9B 7& > T"!"!"klk'( I^  [J[[[ZT% (%'(T;<;<;<^ZZZZZZ  8BTM^ / 6 (<'(T "!"! "klk'( I^ \J[[[ZT !    878GT#;I J;<4A4A4AS4A_ \\ \\  "\_<9    _ _\\s\`\_*\`C[_O  -    D @&?@?@4TIJIJIJ$4A`M]]] ]]#\_+.$ T 4A B34A IJIJ 4A;JIJ$IJ4A 43 IJ 4A4AI87JI J7 J,IJ"IJ4AIJ;<4A-a ^`` __`00"aa_X_aa -aa_X_aa1 7  ___]a  __aa__`aa k]ar`babbbaK_a a X ^KL``  aX`ac`_aoo_c       $ !$% ('*),-0/ 2367:9:9<?B AD E,HG"LINORSVUZ[- XmWXT 4A[4AI J4A"!"!"klk'( I"klk'(I 4c ac =G  `d d d`dbJaaa`Z`[ dc#b?"G))> X    !&%$ 0!/0T.e    2T$IJI Ne  bbb _!7$  T 4A;J IJIJIJ6IJ4A;<4Ae eeeeceeeccdXWd6cc D 7   )*      bf.'bb   x cf feX&_      6  T"h   T!4A4A 4A;JIJ4A43 h .fheh fXff_faafheehh %t!   @a?@?@ ?@T 4A4A43  4AIJ4AIJ;<4A 4Ai gigieehi eigXggig_g oo eieiol     "# &' (S'('(T4A;< B34A4AIJj giogiffifi iih  T;< j ff  3+TA;<;<;< koonnnncl' @?@T+JIJH;<I J)l liii3230/ 4CDEJI Dhhk l K&+e$            @s?@ T;<FI Jm hillwxyvu xklmpo ll l s i     0/0 /0TIJm  jj 8#78 7878T6;< ; < n "   kkj j '06    9@ TO;< 4A;<4Ao  kkmoogko7^2O T;<o kl dT; <;<;<;<;-!Q'jI.E    7    H GH-    .NRpE('   44       :&'(B' +   9-, 6-[a          6 s" o A_Ab abaJ  IN  y zq$b v}ru! 'Jz   5    J      (6'( 0/K }   O O K (;'( AA <  7   AA   p@op*    *          ARA=@       @Q?@?@   xw"!ws wV& &     @3?@    wxw )  (1'( WX2 & '  8N786  MN '!5  8Z78.# /MN0;MN<!I," 878H         G H t                        9  W 01     <!01 08/0) {#  ) Z]   [! &] y ,A "+,   R   " R[R#  +& !"1. A:y ,A   WX %  ,$% (*'(A A-.qtz t       C    AAX   [ \] fV /         0'/0t&-. F   '&  5 t4-.\   /( 5 4 -tijijij -.A. |st[sd'      t1J ijijij)g h0-J)g h #0-.- &%& ,)R~*):%)R~  )R~J"VWq % (   ('$   .    "!PK"!:O         ), ( _   !",-{|, RI,/{,+ H     5y    ZWD      4-i2PEM   s 2*@(P) r    1J      R )  J )  #$%&%R('3('3*)*)*t#      POPOPW# #  %A;     2) *     )/8A"                 < ; B>A " (24 ~ y9 @L3 ,@@ I.'F$    :   @    < \]           "    < 87878K2# $%   2?21         G t +0/     342 ] r     o      @=. W  _R,<           "$!&#(%*',).+0-2/416385:7<9>;@=D?FAHCJ     $!(%,)0-4185<9@=DAHELIPMTQXU\Y`]dahelipmtqxu|y} 0./0 z Wf%WF$mF,qZu~}T,V,!  OWFN?YEH  xwxwxX2:9B& 2/:9JIVU"+*>Y(2 & XZWXWXWXXB::9   ZB  X    yxkl ! &{, 0  X!   X  wx   8F78X B JIAM NMN  B   y |/       pbopop opopop!Xj 9K %( L   oLOj    *C*A  ,878XMN popCop?opopXi:9>     gj   +''  !X;  8( <.OXyz9?@?@ 9:9 9 9?@? NFEFEFEMN MJIN NMMNNMMNNMFEMNM JINMNMNMNMNMN  9MN MNMNMJINMN  :2        L J    @                B         @5     EVS          <  )     L Y' X5 B         VS   CJ;@         & #0/ 43 658765:9 <;>C<;DCFEHG JINKTQX Ub _lknmDCpsvu  xwx,XF0;P  ML )    6561           ,! F0  ; P.X6 +31 $ !   XE9       o2#E E  XV >GB (oXz $+ A--X OP. (2'('('('( '('( '('(X":9g 2  3/'S="g('('(X: 9: 9    H%GHX :9   #   X   8E78XR  5  HNGHX7: 9  J[ U  0/0X"0/0X :9    -$E  !           )+# !   :  B   @i?@  +abN +*%&    CD8 Y <    +  ('(7    %  ( '('('(;   ).1.      (! ,  nn    ,  n PbOPOPOPOP OP~OPOPOP .-.%     /4          PbOPOP OPOP OP9OP "!" 1(       '    xXwxwxwxwx wx,wx!  #/> <,   03/0/0/0i  K %  P/OPOPOP ^  E $&%&%$#$#        K   "  = H  POP+ !  0+/08  0         +m H!GH. "  " " H"GH/  !    #                    0 /0   87878C Y ^  0     5   % 87878: WZeh $     wz    @>?@7V6 +     0 !`6+ (Y'(V   K,+L 5    )8?      5 8=78VB1 2A   C6   @A?@V 212A    i!.   @*?@V2A2A   '    7lV)LK&2A  2A     klk'( G)2A21    7>@   DC J*' ;G    cN&c ?7b/>%       )$#"! &% ('  xwxwxV    klk'( G  K,+L( 2A2A  2A2A JB]BAEL   9 G S& S: L        "#&'*)*) HGHyV  LK)LK 2   87  &#    *h   ) 2 GLV   6 _+   ^h  ?V?  ?     8 78Z78V$@21      @ a      %- $ %   MVMKL^P O POb     X      W%'O 5          V=>+D CKJILPO [PO    *   S% `S  V32222       )4?3!i  )B Nw&[ 6(2<       +      [V  V  / i     !VKJILKL IL =>U=>  Q\OPXD' op. ! i".    R `=_`4V2A 2AB12A3   k   3 878@78 78Vm    ;2V ( '( '("   G+!*  A de                   9$L'    4!*      A  " ?@&I5E3     lghS    zW      /> ,)>+\h(  '% + ' !  &"            &I5E3 (@'( "?@?@    2#" F-:  (+(+(!    V/>c XWX)~   h#gh0 $&  x'wx4 (*  +8 ,.  `E_`3_`          9;  `_`+   p%op2 &&  )6 **  0/0$/0/0 Y $  9:-   0?/0b   !" @     PnOP      $" e {           $ @@?@]    ! 8W785 qr6r656565 rK      @_?@5qr6r656565 6TR   hIghghghghghghghghghBghghghgh       b     f@?@?@67F (  xJN(XWXW XW   H #  <;&           "          =  M   @I >%3B@8        }N   $       )4  popNCDji   )        0/0RNf "! *c42   N  P)OPOP2OPNXW$XW c  b    fR     N6  .  @?@!?@NC je   7   Az{NPOPOPOP O$CDUPOPO POP OCDPOP O  !T    FEF "     S+,+:  kG  K!)g 'U9           E<4  PEOPNXWXW(    B ( #   N%    &% RNb  !+# @ ?@?@NTS   %   @ ?@?@NTS +0&  =<N $    , %81\;$  H+GHGH        HKGHGGH J1212#>='B= 1X %"   sv Z3 #'   J>A>A P  8%78 J>=B=  @7         JH , P(OPOP JTSTS>A>A>A !>AXST S     @<         !  ,   HA=>=>  #$ -4A XWXH!    878 H  L I   `k_` H=>q   ;  ]qH@A   ( '(H ('( H => @A@A= >=>=>=>@A@A      i      (`'(Ha=>=>     Wa `_`U_`H=> @A@AA= >=>=>a=>=>=>@A@A/ tm   *)3&IB1Hyzu  P1  &      Ms*[g&  (  A   $  "#/H  POP H VUVU@A@A 0=>=>@A=>@AXUV U =  l"   # =$s    # #$ # POPOPOPOPH!=> =>=>@A =>@A=>@A=>=>=>@A$ "          3  "        $7.>@!    !$ @ ?@WHI=>=>=>=>=>=> "!   j           7 I   X2WXWX!H=>=>= >=>=>@A=>=>\=>@?-      t mt     F/      ;>=HG    H   ) -w&  Z  8278H=>= >    $  xIwx$wxgwx H=> =>=>@AK=>=>=>@A         =  / ^- (          (  #ELe  K  8E78'78 7878H=>@A=>@A%=>@A.         =(%.   $ Ho= > => = >=>=>@A=>=>@A+@A= >#@A@A" *  ab  (#{ nQFEFE&   =C?5?8A  $o       + #"%(  H=>=>=>   @(?@?@H=>= >      @H?@H @A4@A    G" 4 cH     p1 5 !`KH ,  %&     X[ fJ    H(  HOGHGHGHH=>=>=>@A=>@A  '( #d(   H (m'( H@A= >=>=>@A     /cwX       7 H@A= >=>=>@A    +    89782AD A^ w  _%7   A^A^    `_`\)A^ A^0  4: U *   #& )  0 +,+mg   2'  :@GMO g `Y_`;JI& 1 ;& `_`    'f8   X wq 8    %  0/0A^ A^     A^A^     hFgh"+)  -.1K? H*GH   # xAwx) S@ H)GH6  "  X6WX K "  $ 1      MO  " '" * B=  -1 uDC2 O *8W X W XWX?WXWXWXWX  )4 CD " E[nmp,   <; 4 6    C(U  8     ?       py;KW X%WXWXWXWX   4   s        8 5, <$.' K % @?@^\ V /#m#0&\   WXWX   (*'( '('(M     + td,   ("7"   vDz  xKwxwx  WXWXW XWXW Xn Gr           `  9J,+/ 0 kD,  ) * eD,&5 ;tmr   lW 4  )tM   -xI-x   WD, _D,'A                   /            ('('('(V     A x;wxwxW    X6WXWX%    -% hghWXWX!WXW XWXWXW X     \ B!   0/0/0-    !!QRQIx        bkbkl4  =F ( !x n     $C rlcWXWX$WXWX ]WXWXWXWX "   <  T  2       3<3,#$          .A<KJ|st(   ('  ) >O ! 3 Q            ]o F&& & AWX9WX     +,5A9   XWX/WXW X  +        ("G /    0= 1(   %2     878786  8+78 78&78/7878 #WXWX$   CN3 $ (%'(['( m     $t  m  II f  C, ,','" ;> wx    `\OM&           f hGgh 3    "+#   8678778QI0JI#  ,>0   XWX (! +.32  ;AH  ('( '( '( '( '('('(.W    XW1 1G.  x7wxwxa    $( 0/0/0%)9   ' $ 3%)9      @+?@?@,   '2,xwx# adc:*)*          &      P*OP.  %       CDAD     ('(  $:                        ( ( 8?78 ADADAD     /C       @8  (.'()  X_%   F  ; {{/E  ;     .$ @?        % t]^g 0+.         @1  5                 <      $ ('("    0"/0Acp eH    {~  1' b8 wIP{ /K0              z mpm n,+,+ mp mpm n,+,+ mp R   ~ }< ~} ~ }< xw}~ k       "!$#$#$#$ h)ghz h jitstqr  z,   hghcgh gh+        R65 !          )6"+     0(/05     P3OPOP 7X X  HSL     7 `D_`+_` A; A  MP~&          0`.-|_      vv vGJ Iv('('klklklk'( ' kl9I     vklk'( '   p6opv  h5ghv]`   7  #   878v%  H-GHv:  & hDghv(  (   Nv!"!& !  '( ' !        v!  `>_`v]^      `/_` v]^/  %/v   ev ml!#  &- " !# \v ]^) '" )  xEwxv'    ' xFwxv'    ' Wv%  #   )"%  # jv mlk n,+,+ ml   }<a     Gv      $  v4   # v  klk n,+,+ ml  !   }<    aP       ! HGHv+ v kl%  % H0GHv ml  &# v$  8'78vk l k lkl       P(OPv/BA0        ~K%JIB >3% 2 `e j;2%+ % 87878&   hEgh"   uvklkno: " ~V &   t                            $  Z5V                    l     ?-E l xZwxg 1 /YV 0 )2/4  3" ?0)03,     321,  34"KE H     )      4 ix* !!$d`_` _` xm n,+,+ mnmJInUf ~ }<  ! &3 .~!     U@x_ \A>x._ ` _`  & TC.  44    878@  popA  4 Al   H          XC       (        ('($  AAp  (     '(3'      y|{:BAB               0  M-          &'' AFAFX 87878&6   P8OP N   |{   6-&mn mn""*0`                    0 C(G-           "5D  "" V    " 9 NM6    <     Y-  ) PGOPOP"*$ !  +M *$  "">=>=>=          p;op,op&"3J Zu6(!+ *GL   klk^ (7IF %B! 3!   ` _`_`P_`d"0fA#fe$# ; +=h&  "%+4/    XWX)WXWXMWXd"NfA# fe$#     +{ k=&  "+34M     POP]OP OP0"/fA# fe$#i    =& "3f.    i ('(9'("   I)     Ef"4, + #  "'0M  (!   C&  %19T 7-1 4  r, 0z%f"QS 0 NM6    <  iNM6    <    *!vu QRKRK :w + 78!]  !+klkn o$PG34 3$PG34 B E:* ` 0* #  @4   6   g Q     0      0\  d             3/7z       E  +    ~  HGHGH8   ##      POPOP.OPm   p],ASH GH%GHM  4+J85TX      UP ! A^A^ _ux      `__` -.-.+ m .-klk'(  J   #7            XC: 9: 9F            (  (         HGHTIJ;<;<g TdUUUU7   )&=! ^  @T?@TJIJIJA4AXIJI4AXIJ I?  55555? ; 555; 555!@     T  L   DL[ L   0   8  C ': & $#   X8  `X        !"/! (    , 8    ;          4Y    /  , (,'(OKL  ( & ?t_  %q  ( "II  -KL,  4, 2    (+'(3    0:  POPOPP,qrar qrarqrarqqrar>ab0   I` 6 . c   5+     3     I          >"!     X+WX ab        8b78$qrar3   !2 M #3   V  8 78278\ o pq# "  N    ;)*    ) 6    g\  S   ZYaX1 qN J              40 5'3,N4TSWs t   `, 7 P2OPOP OPNZ      B P3OP OP '     0  JJ   J J   P(OPOPHE$      HD   HX hghghHM?           A2!"   `;_` HP   "/H%   X$WXH1 ('( '($l 6        -.-.-klk'(  -.-.-klk'(  A^*A^+ m++,+, 2 +m+,+&   OP      ` uJ _ J    t    :  <#$%   2u-9B 90 6                &%(),+*./2 3+2121 65656528787 87:;>=>=@AB AD CF EHGJILKNMNMNMPO RQR  `#_`0  ("&   0 /0  5   = *%  , @  (''(4)$ H'GH4 '4 '5)% '5 '5 '5 '  5@'@@8 )('8'87L  39QQ  79RR 8 9  R@9@@R9R9R9R9R9R 9  R@9@@R9R9R9R9R0                                     0,,?CJJ?*6`p@?@     0/0/0)?@    $sr  ('(      {z       3$#$#$ #$#    .   !   .  @?@    "    !     878/ , +   @   (-'("  HHH  (b'(oR (F'(; R (/'(<<1 A 22' ( (&'('(8 ('(* 6' I1   8j7878||f ('(m-  0/07  0/012  0#/0KK@A  m$.$/$$(         $ NG^[   @$!7 ~}^  #    :0 "%/%#+%,$        @/?@  #   :&# |%  v'"p' j+ & %7^7  2 !3V3  .A 6 n  g       5  *Y aNM6    <     ('('(     W    ^aNM6    <  YZ eV   (  A    E> A @,?@  ' K:  '    0  ! z  >>         #+      "  yzw        #  >   yzw$34   OL        ;   0  ( '( 6  +  i    {R 'NM6   <  $ ap    #)C     #) !   "          9  "!R ('( '('(  ,) 8/787878(   ? ( h7ghwghghghghghdghgh-ghghghghghghzghghghghghghAgh]ghgh0 $   ($?     V   q  " }~!Kc~c "!"'.  Q/4 +&34 +xwz,+,CNcET3  H  ! 88o0  $ ! & #$#$#$#$#*'('('('(',+,-.-05(:;@    7>7JKLKP   ENEF 8378 8      -  8 p5opop 9 ?D?@ ;K8( 9 87878+    ` _`BW  !9) ` _`bz   !\I 0 /0/03/0"(/  %NG^[ r6D"%     0/0/0/0    I %     &L    *B +      K (  #84      3Y I) !w4    8   ('()  " J" 03/0 L"  $  7  (.yzw0ENM6    <   NM6    <          /cr       %    8$7878*Z   * XkWXWXWXWX'WXWXl     $GH ?        R %  NG^[{   _h\'K    R  xwxwxwxwx4wxwxV       NG^[O  &!#'= $, ! V (4 <           :  (1'('( b`    9 W  (7'('( j    !; _ HLGH GHGHGH   &#  52= &) ("(.Fdj| |         hgh Z   -#HG 5  FC     _2  W 0';F  K M ,"       Q 0    * (6'(  H ID   .'   5 * +,   &     @?@ "d  n    x   POP &    @?@               \ "-      p.-<;            j A`   HPGHGH   2!0 or  ( "# 2mn    # *  ; '   @D?@Q    3'  P)OPOP OPOPOP   98*I#    7        " % r     Gz { <  0:/0/0/0      %    " 0% @D?@?@    <     +0 I< PCOPOP      ; >9:)>;    ;+5; @?@?@6              !  A& 6 0/0/0      % @?@)?@ ?@          1'   l     , +                   3 4        Q R          "0 xs x  "     >        -<;     D   0;/0      2 "   , +   3 4   XWX/WX   *  , _f   L? &9:% cdcb_    Y  *       ,   H>GH&GH           14]" 6 &)1   2  ('('(+ ^k         :.-  @-?@?@ ?@"     I*-  0/0    popRopop T ) " 4!>M  9 #  $c7+?M          (     |j- M           *  N   U   ! @  ]4)                  xn% E              *  N    M " !  I$                  r  k3   t7P@6+  " M  D#uMn _,J#6     2 $7(C0+: )-           mf P;OPLOP < 0       $   5     D; 7/tt BNMT(@KL?BrMNi xY585[^ >          r E #<.T4H*F)/&            jq HFGH)GH   D      %"4L          XqWXWXWX  "L2121@    3 ""         " P>  v 8:78A7878T                         &TC%  8,7837878                   L5   HeGHgGHGHT !       }                 + Q )%!$           HSGHYGHGH  !  CE  W   C'%"2          ""T9  @?@**"$  *  P!OP..&."  POP(".*$  ""   |   v/  (&'(3 '  .,  (5'(B7#    @"?@?@d  Y#   XWXMWXv  . 0+ `F_`_` 0-.-('   &!*   `"_`   -! 4Nt6              /! !"!Ko=3;1$ @:?@ ?@     < 1! PEOP OPc   G <!TT       2 P OP3OPOP~     /%O/c    xWwx wx     <'.   @2?@E 9$  xnwx    J!  XWX WX $          ;e# XWX+Z   b       M 7m P,OPOPOPI   #$% xewx wxwx          g,;G 09/0/0/0 ',R] ,%   ! '0T 0-/0/0< "M   !" @D G  nf        c $#  i` # =O  E"         *6#! `HCF ('('(0        @?@!            ("'($ 878-" @?@ @?@,!   H@GH - -   2 -    Z"  &-<;k # (='(JJ2 (#'(0%  (l'(yynJ        @& D     & &H  & O-v(3  X WXWXWXWXWXWX4      w y z{ ~  O      `_`4  rFz   8@7878<   ; <#$knQJ   @:?@/?@?@B  +  2  0+  X 36 ) =!n     @ 4 (* )   :P deP  $!"!($!"!)$!"!)$#         ' &(  )  )  9< F ? #'4@ ; () )    ?$# $!"!($#    (   @ % 5 ? (  X!WXWX     8D  84-  8 plop "!"! &"p )* &;  #  &x 12  & #ECCD "!"!2"!2"!0"!E"!0"  < a <+ N?#, % w: pHGB=   & & & & * +& ! =; - - + A s1 = = ; >8 &ZE$  6& & & &&   J:#"!>"!F"!9"! "!            g  6 p :  #1 I J R !:       PXOP(OPROP OP""!h"!9" &    & 8   8 % B1 A"&B&qq         /% PuOP  "  9 4;2*Y l  !X        q        !_  ' ?   4   3' z   .' 3BE.UoU%  T  r       4F!  31  4          _[)  24             _Z)  .d x     094GPU43U4x CV[\ KV[\ GVq"  :UZ_\YZe A Lc/aA!DF     #:781:789(':78/  &%$7878*JM  x1wxEwx&wx&wxwx  ! $$'5 C(D2 | ""    &    "      .1 ?XZ   ( &47 "k&$  :          "@.b pop  #G" \* xm    54)( ()( $# (7E9      !(=* hghghS*   #  7- 7 &'G.K2 K      #  7- = ;] C2 0/07  "! 0   !  4          M/5 <          @?BAb{ 8;3 n *%    //1 ""CTzI'  q46      6  XWXV    8     A7 5F   D7HG         H7GH GH Y     N'25 q P8      # 8`+!8-   h.ghgh W  Z Y^ ] XD   h4ghgh ]4 D CH G BRJ  F   ^ R & %* )0$N I  X f    0|H I  0  Y        0        A!HL H?    PO %   ; [Oni, @           | "| PUOP**v    0 B** h;ghRgh5ghgh!        """ """ , '      K#!W!*~9jQ =!  !  8:78787878Z     ? ('(6'('(]'(&'( '('('( '( '(2'(/'('('( J    d,+ & mn     ]  VQ C   " 3Z# 4;  '$ J POP OP/     K) b9! S  34- ! &%w    yz*A  x>) >=>=>%    &(   =2      E %  !  v KcDn!Y ! 8!   S  )D*W( $Qdc. 1  X cpi  hg dW   F  QXW  NM RE :oL" %# !     * @?@?@ ?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@+0 "!          65*     />  3:   -+      POP%(    3.(  # `        !   >  "/    +    PKOPXhX  "$ 878                                       8!78!Q!                                                                                                                                                                   ! 0/0/0 ;f  # $&/       <  % 4 D* !" ! V8 :& !" ! uL4 0/0/0/0B    # 0*/0/0/0    M/) 7a IHGLKB-Q<^  @?@?@/  ' @?@?@0 ).( %B         94  X   878  dSP" _         R    $z$ 0/0/0     #$)*  ,   HGH[GHGH ]`_d-"!"#(q| !%" 9d  JY         (7'( wx& - & x`wx wx          ?# ? Si   ^+   H): ' "     H?GH GH%'  0"- $ ('( '(('(   3C& $   1       2   0/0/0/0W     = 3!       &!   :G  < 0>/0 1   (.1 POP    :  C#  4    t gp  yd <J 4   H"GHGHGHGHGHGH?   f$M 1 h7ghgh!ghghHghgh"gh$ghgh      [ Z   $ )P)&4-09 2%   N &f Xp  7:  - H  !"- 8 5414   9:  3Q!^|e@ 1 J   / $    34  ;46! Q             0&,Q   `1_`;_`_`  " - 2-$ @7?@J     0 @0?@@ + ,% &%5   @       +, =*$K?$7 J$  PA  E  H 6   )*'() !() D-yX2@!    (    [ @-?@ ?@ 18J (?'( '(\P   A 8 (>'( '('( V f     1 #5$V  "  ?   $ :          0+/0/0 /0k     O B$        S V] P.   8   0       | 310    HGH8GHj    F9* %22       XNWXWX2WX   EH   -  R3 4N XXWXBWXWX C@7>?8      P` z XhWX>WXWX SNGLQH        [a[  B :>))))))    +  *  *EX BC VCDcdWCB  -C:!D cd  I:(ij QJQ"0M  .W d9 .W d-9 B#***1** *!*`?4S1>5WD      $:1"      =  ?    < @?@?@  1` 9   :9 T7 &SX+#"!<*%          #)*) &4b0- ('('(   !3$#$#hQ          $,   # h, $           "  M X c . 0 P     @ I   "(#   #    O!hV+-L  30 !K  $45\] LM(DE 3w,lm<=de  0TUtu58  vN QNT    d^ a^l klm:9=nV YV  D~ ~  Nv yv  ^x {x~ }~$  "              '"+'0))$9)    @   )                "!"!"!$#$#$!   HcGH3  !"       ! !23 0&/0/0a  y~ }vyS")B  8&78'  @ ?@ `nil   hIghp 7<1#7&"  O H1GHGH  ` 6  H0GHUuvij '(  -   A  G    !'  A$" 4.   A  (2'(       q '  "     f$ '   0)/0* *  ) J xwxX   %('" e $  GJ  ('(   7  !^ hr x   @.?@> " $ U L I  "+   `O_` e m d4a  & 0# <  P@OP V } t'q  /$ -  XTWX $         052     4 6 (>'( '([P   @ 7 (='( '('( U& %f     0 #4$U ?& % (+'('( '(h     L ?$& %& %0& %& %  HGH5GHg   C6* #00 5-7Z      0   @  UG   T@Q) L @"?@ `8!   popop  P  qn O    ;:   !   Q  !/02a \ B pop V  "   &5 "3""% 34%%( 3'6  i-V  "      %. )!)EW@ `<_`I 5(  5)    P8OPE     -    @?(? 9$=2 /*90! '(C16/   ?Q             $            ,.wN       popopopKI    1  )       "      (?NM  1) H;GHGHR     9( xwxwxwxwx%    *)   '  *    2'0V1    UEI   34   -.  )$!*# '. #P5-" x|wxwx wx!    ,+    ( 2'04'    XWX4 e {b   .    nwp  Vge$"  `|_` "!" !c0           7%  #/8  c P>OPOPOP"!0/-0/" !" !V 5> G2 7&    XWXWXWXWX]WX    2-4P  hW X= _3?pZ X        #3 ]BQH= N  W X?DZ6     @5?@  #) #3      ?@Z2     8278   % 0*/0//0/0   "{-Y pZ '$  $ )         '#     4*:0&.< 0&  Z '$           7q .-        $  16QT9Z ?kJ5 P,OP  !  N O &  (1'(>>3&  f, ()'(+  *C5   #"  '& ]R *+ (^'( , 2      4!, 0/0',  0/0/0..  ($'(0     ``_`{@      % -% 8(78 5l !" XUWXWXWX WXWX  #n, +      K-Z  n $ #^3 4a    w  #`W +    )K   `%3 4" l  &4/   - D8$2    ( '(' ,+,                 % 2+ 58                        c   "!     | `WD H[ >;   fo  b_ VU RO2E     *!  EBR#WD ("; ) #"" 6 &"j1*A(  (  4   \( `3_`_`_`_`         (     a %      13V %  U+    A  HGH +   p,opgop *          e0& @ 8'787878*A    M R1* .  ( ' ( '  B!"   .  < 1.        #  x     !!)%&6B  .    B   . @?@?@?@0      0P. +   6 +>344u/" E   "      00T0 8:787801M"     #31) P?OP _X  T#<(     _ ,       z       FQNWV_^ h#  $ ) *30   %\ J N u    !!      "!     P$gN   Kq           n8(8bj `G_`6!" > 85 6   > P   /0          bv@   a 87878b            % - ! 0/0/04343 GLK (( $  #0    FT < z ,O &   e  -I=z ,O P6OP OPOPOPg     #75  878 781  @'@@@@@@@@`    QD T       "  0I        '* 5* HGH&  ' +   K    ,      @8?@?@(?@?@%?@:?@ Z/   gh c    ^ '% $ h=5 ?     T  :  . F .            m4). E-            4(- !r}vuzy %!  @?@?@5  ('('(1'('('(  &O"      0/0 /0    :   POP%   8O  C $G ;$# $M   4 $) *   &) *U    : &/ ? A&' p.opopC   8 p*opop  )  I  ) p.opop  )   0M  ) P)OPOP     AB    P-OPOP      'F    P&OPOP    $6   878781   %  XRWXWX"             pkli  p,%   pVopop"            8 RMNK R0%  V 4/0-  4t   xZwxwx"             /436nunmrq|w /2 '   H;GH"          VaZY^]hg%  b"             chgj  .5.-21<7 c: ''   hjghghgh "                       D'%$         xXwxwx"             9.5612'( 2!%   PEOP"!           WPWXSTIN'! pFop""         mfmnij_d'" @9?@"          4  H=GH"          8   @:?@"          4  pWopop"              1 %   H?GH"          8   PFOP             hBgh"        %            H:GH          %            P@OP"                  '           @;?@  4  "         4    hKgh"'          # ''   n "                   H'!%$   "         '    pHop"$          '$  HOP %  xPwx",          (%', hJgh"(          $#%(      `S_`_`"               -%        `E_` 8 *- &J I  (4m r g    8 3 XWXp XWX p op !p#op $ POPOP ?   3  hCgh"!         %!  `A_`"         % f (8'(-   0/0L      &QL  %   &   )     %  * '  " *'       ",` !*) ;] XL $)1                ABIJ !0 V?     g  hghIgh  #$     x@CW       La      . r o       1            *)*-/). UM!!!!! %(   .   >    #" p3op+opop  )) $ !*u&= (M9  L1  gA: 1< C ^  |{;    :U 89:365Y < y<;?:O   :O 2  :O T~ :O  \.   :O  \:O  \  :O N  :O V:O  \     K:O  \$*  *   O:O  \ c:K K g:O  \ k:O  \ ]:O  \/XW@1 >q:M=u:U9 {:O  \G9:O  \ =:O  \@  :O  \ :O  \ :O  \Qxw:O  :O  x[ :O  :O l[\| :O  \ :O  \{  :O  \ :O  \ :O  \ ST=:O ST=:O |{ ) Y:O  \YZC:O  + AB+:O mAB+:O m   )  G:O  \GH1:O i  +  3$/$..#. +)[ b# U E$ !*  u&=   (* *    11  3A719   %010/0  /4/     /"!./&303&34    %$8!&  !(/&/%9%@,E( c           1 PP   %9Z$  -%',  '  !=9 !RA Vy0^/w656565c65d65*65665)65665[65@65I65 6596565656565.65T65.656565?6565;6565=6565X%76565$o6565%6565$]656565@6565656565<6565656565Q65656565@65656565265#f DC t&2    V&2    V&25 t&2 n  V&2  V&2   V&2   V&2  V&2   V&2   V&2 7>        V&2W*    V&2!   * V&2  V&2.*  V&2*  V&2CH  V&2  V&2  `&2 Q=nm .-  V&2  V&2 +P     V&2S&  V&2  V&2   V&2 Fuv C  V&2 q 2  V&2  n&2  V&2  n&2,  V&2   V&2   V&2    V&2) M  V&2  W  V&2      $     $   $    $$    WZ    WZ 1M      WZ   WZ #0     1         )          )        -  V&2 )*[ 70 ;  V&2    V&2)D)"*+)#y%&3%w//~Eo#   O   4 4 \Xpp"{QTwo >  y @ j G2Z L2   K'   R  5  D  91843w+ ?4  **G7   R,&& &$#"!"!(&%2,+*)*).-7434365o>=<;<;@?@?BA@?@?HG]P1MV-SX  FWXW-$^1[`YVYba5d  cdcd cdc+ . %         #TS\Y &   VI  POPvOP OPOP  \ oz s   h-H#$8 0 *88 i1E33D1S%j2  1      no  .'  0  m v      :   '    DCR*?=O #P-G $ - 0$ & : ( ( 9 & *  FAv$ i   1   R-S! %  8   2  1T " r  NID&                        $hu r  NID _"S  ~        88I   _"!'  ' &[. $    3j       "    h=gh  !+ 1 878 /    9  6 .)    HGHGH$  8      $P  `_`(_`_`_`$9       X     d%9  hGgh &]J  # 5 9  &j   878&=  2 ll &4? -!:( ^^    ee    S     )"=   # -K6_ 6:   # - er  ( ,5"!"!&    ( \/H' D     PROP8"!"!    8n+!"'*A     pop         $ T$M pop          2  K/O @%?@2     XRWXJ"!"!    8}5I   PPOPA"!   (:G     PSOPA"!   ( :J Q  ( ?; (n  %(&\X (@   .*  @#?@ $ @6?@C 71- @-?@ .($   @!?@.     p&op6   8N7878   '(F9dc #(Z{(7aN,   ]/pyv +{(bifGP+m V +Q ^_`gps^  mZ,   oG;)n YK+7$HsAF M/ :8 8 :   N    :     878  pGopT ,@ pJopW -B - 87878 " 8=7878 78$7878 7878    ! 0 % + 5! POP     - e 4  &%  1 1     !9  k 37x  *  .% 8N  *1 0)* , n{ % ;#4 %== WZ   D  WZ    G ]  WZ   Z  `/_`<   0   `_` e h m p  >R     %   HCGHP      8   HEGHR       8    7        ZN       # $#"  ? K-.#UQ3 - p&op op?   #           WZ   WZ   WZ   4`      0v' m             9F  yzyz !    o]     G %]  >5 G  * T815 G G 5   +  (5 % ,9 - =J - 1 6     ;    I  DG  FMJ         WZ G Av   "!  y     DBWZ3   ]#b ~2WZ 33     F"m  b  ,;N1[xs  cd5 dC$  $k ]      `: "      0 !Gm A  @?@6?@?@5?@?@ ?@ ?@ ! "     41C 5_  P                   UE*    -  Sc!* |s[nmvu ^ ]f;<   M@?F EVU  g      wj ip o RQ fa b AL  k^]d ctsHQ  ZO  L ALMR  aTSZ YjiZ}@? r     zy  s{IG.E(    u        '               G   'A  J       {fG     [.          '.%T    %        %    r  9       wzq r} P#'  Z      -$                      ol   >?@GD   J#  8; 28; 2       4      (   $ - ! &5. %& '1U   i6 /?s X %:Cg'UC3c    B                b   "  &  #$#('  %,+,  )>*).-. -.-E( 0 /212  /  P-OP(OPc X*9 tn T#^[~AV  ; <-B  ;<1 40/Y y| }   E6 E0&        S = c . 9J I V! )  !  A     L>         O)  "!$#&%+('V P7OPOP[  .4' c    Z   :9:9  ,+  ,+,+,+          e^u  (0!8[ 1  Z A/AAjAA AA AA@  b       $   4$,@  b  [c'* : #8;.   #bhD @?@        +^3M HGHGHGHGHGHGHGHGHGH+GHGHGH GHGHGH GHGHGHGHGHGHGHGHGHGH'GHGHGHGHGHGH+   tsC  "*DC}  5.KD 54  "y $e g  NB]&p o#b3kN      ;<?  " 0=/0/0/0m 73"c %$),  "%  $'  &)  (+  * -  ,"    YV (s XKL[  ZMP  N MVUVU  WZ   WZ        (k    CXI          &A%  "!(') HCGHGH GH GH     "  N$6Kl (y'( '(       -4 kk`,4  @>?@?@ ?@ ?@     "  I&1Mi (v'( '(       +4  70"a %$&,  "%  $'  &)  (+  * -  ,"    YV (s XKL[  ZMP  N MVUVU  WZ   WZ         (i   @XH          $A%  "!('& L\\ 6& N^ 8& 0@5  4D15 9! ! "6!  p*op+ `&_` x,wx/  h(gh .+ h8gh!!  !+! @\?@ (*(  WZ  o( 0=/0!$!  J! 0Z/0(((  WZ   g( 0/0!!! D!  ! $'!   @!# !#  '!#  hKgh!2! 2 4+0!2!  ! hBgh!)! ) ++'!) 25  0S/0(!( WZ   `( 0;/0!!   H! pZop!9!      M!  pXop!9!    M!  @M?@!3 !      !   hYgh!@!  ( B+>! ( .  IN 5`#=   .&< B_   ;=   .  ; '      XC  ' #EC  878               '  U@  & Z"C@  p2op9% H+GH  (  P$OP RQ '  #  ^  efiha h8 f  ; $  h8;c  h8;c  h8;c $ tq +, =D   +,   ry  g1D/e  P                           =b     ;.(  3 $$       SW$$ ] ^       z  ,  #%%   6  ln    *  aY      !"- p(op5  0/0 "  _=|  (%,% <  HG  / 1 M ghk<)  { |y!&  ;  76.NS \ %  POPOP" #   "        `    U 'Lw@T  POP #       br: `E_`1_`_`  ?# 036#2;6 )6#  )6#  ( H,  ' q<$ #      JGHEF?=E$/ HzGH   &O!    ('(I( qnqr ~}$1 k( heghxN     ,%  'L XWXWX*         c @.#    j` &WX[ZS Z8 X  9"   Z8;U  Z8;U  Z8;U $ fc +, =D   +,   dk  zY4:`9G/e  $             +         (&'( '(      /  ! .      ! . @)?@#   " # 0./0/0$8"e   $(\ f    t   + & H-GHGHGH  ' lijg  n  ' `3_`_`_`  /: PMNK R  / h;ghghgh  7V 412/    #6P%  7 p*op7    0/0/0.(   HGHGH,GHGH GH14   ',   #1 %/$h      ER @?@?@,.$   h ghgh<3$   , ^OPOPO   , 878+t  @?@?@2v   x  $   &  P KLVKL KLKLKLKLKLKLKLKLKLKLK L KLKLK L           X qdU( 0 qdU( 0 qdU( 0 qdU( 0 qdU( % X qdUV c  d V     b9P% &% & % &% &   H    *- (' *)* + gR            P~v268|~ X0WX$WXWX2         ruporqr sC=     " 8"7878 l     "+ X-WX.WX *r       ` @'?@      p`opop*      #  B-K  xfwx *|             /-8   *&    *  *   B  0 # (N '`9%!" %   (<'('(0$D baf inm z  (X (<'('(0$" $ BAF INM ' "Z  5e   POP0$    0" < D9 PYb a       +K<& <0 H&GHGHGH< )2 /, )<: `0_`)_`_`< BD HKFE HGH IHB      Z 250/ 212 3b 8&787878< 'r -, 'z (-'('((Bp 4 8$78(  =:y x      0'/0/0( UX/cd*  H&GHGHGH( - 30 -( W v(            $,+      wx$  ,1#"            x3wxHwx(  %&%&    4%. -  NM  Y Q      Hw(   [. %. -      ),$    [           Dm(   Q         ) (     Q        = F= >       L (   Ns |s t     )"2(    N       H(   H        )".$    H              J  9(    f t     %&  +$  3&%('.   - C^)S%'    7-       b 8n   ( A Y         .N1q)+ A Y CX (   N!         ) (   N    !          CZ (   P!         ) (   P    ! Ef (   \$         ) "*   \    $ Ed (   Z$         )  *   Z    $          M v(   d 1             % )7    d   1  X0WX'WXWX(      F@           PMOPOP OP( 1+        h) 1+ X-WXWXWX( 1    7. 1 (    5.(      V[  YP6        XBWXWX!WX WXWX(               a)      XAWXWX!WX WXWX(               a)      `>_`_`_`, T 3'65< +U  L%E  ',4S T3@3 4 @&?@?@?@, 'T *,\ 2b,   j       VU65 )B#        h*gh"ghgh, 3 !92 3 P"OPOPR;     1R)V? ' >  VSVUV QDK  @?BAB ;.5? '  ] =  V%+ ,+ ,%&%&% &x   | 1-   ;<  56F'0   56/0#2B:0 L%   VV&z  V ? @     @?@ ?@X7"   )# h&gh"ghgh@ )*  74 @ h&gh(ghgh@ ) *,   =:   `&_` _`_`@ ) *>  52  F p)op%opop@ )*P  <7 XB ! "  B `&_`"_`_`D - .    DF / 0  ,   x6wx{wx wx wxJD      + 0   GG\!N DWJ  K"  #$#& #$#& ) $   %      " Gi J  Y .  mnmp *8565 *    _f}~(1*)U )/'   +     . X#WXWXJ6      J-   HGHGHJ7  !J    VH   +$/0//0< 9/0!/80/ 0"  po  dm : `%;b%&%;   aD& & ] VS.&] 4     5 k     +)3;i!~   +$  /  < 9  !  8  HJ!  IZ0     0  %  0 /  $0'/!.]^[b      y  ; -    /  '~4m;b0 %   $'!Z $  0/0 ~ EH, $Z| { z y x w 3                \    , 878b-t  H*GHGHb=v  b6D  xwx wxR       xwx wx      #    <J>~}~ }  7 > J    BChgGhgh ghghghghghghg    Q    ` </" - *  CF cfkp abadw~,wxwz,+0qUVmny  -  U,E# E  /  / ( n&  +  , $   G                 QBC ("      #}u"   l ghg h       l ghgh "       p"  0/   )   -$"%5"O =/$ p  #" =  56  ,""9p    0/0   POP,n, rAx  @?@?@P  M      !        ,%IQ!    M   dcdc  ),      P9OP+ S^]b  +     !    36   .O           POP*    *      ) +         h?' S  ["%"!    - WEjiji(ji6    36  ( V_I  :?,* *,WE( &!"!"! "!"!"!"!"!"!"!"!"!       1 0'\    "!   ('( '(z*,    p8op opFop"op z gn%)*)* )*klkl,g B U^]  .       w  ) #% %     ,  ('( '('(z0e f    / )0  XbWXWXWXWXWXWXzmnmh gn2e fe fe fg +8 U^]S [ V Q BA <:'@(b       zg h$3 4' `5_` i  WX        ;H <=-  HGH$GH 65656 5   #*   LI 65 @65 6 5&   *       (+1& P  @  & X3WXWXWX 65K E* K   h"gh21   hnghgh 65656 565  <9    O#'%    P I 65 K65 6 5&   * "       , )1* [  K  & /2      HFGHGHGH 65 0 {~  4 ' 0 @!?@ 7   @?@ ?@4     PuOPOP! 5     /79 PbOP 6?@565 #F 6 *5    HGH    (   65xw            ,\   )   165    0 /0 /0   Q  -        !"2!Q  - X8WXWX&6565   & HGH MNMN     P%(    @;?@?@?@P?@8 7.  '/ ) @)?@?@?@PB   '   1    @(?@?@?@PA   & 0 UP* -  ', ** - P(!"!5!"!4                       0        JG   xwx"wxP+%& 41   8  $!    _iR!V 21-1176   TSTS /  ::98 U\[ -us-ARA$91G<!V -7 @%?@?@   HGH         P"  43;K hcgh$gh 2?@1212 1."   ( . )0  .  " hOgh!gh 21212 1P ADABA H ( 6 -  P POP OPe .+   '  #=e P=OP .+    `-_`a_`_` 21 121211H A ,+a{  +w/#*  H x( 21  12 1B  YZ W )1%'    B  P OP$OP> %'  h^ghgh ghM /       '4M/ _ ;/=k lklk 7Azyzyzyzyzyzyzyz"A+,@A+,@ klk lklk klk  kl)kl77873lklklklk   yz7Az,klk A@A@6 *)0 1434U\[ " ( 0       0/.!7"   U\[ d   U\[ | + J? ):7h/.-.-0)( ^~}}zyjgU\[ AC< `\  ghgU\[ *" c q '     M}. L]:6D;=  "             )7   "#,&%& '* ./ X=WXWX4WXwWXWXWX X Q6:Q56?@5 5po!p4( '%&+, rs !#% P566# X    !4 J `*    UY 0@/0/0/0/0`s>      3 a 8787878`7l    % 6JQ`7 QR QRQR))    96 OPOR  x  H 3"  H 7   ) )  `MNM    pRopop opop`%r qrq K L  +,+ , A" )%   ^c`  Cf? `VUQR ARQRQRr qrqQR/   1 U 5 //?#(         /` `3_`#_`.  ni $ . * .  %&   )~   0/0/0AB &    %  8  J   Hu   /  u n  q'| y  ZYZW    ; 0 '@41C*/  uCDnC> 9d(:)wd EF ED CD  VEFEF ED ^CA  (% (,, +>'  fm'! ~  {|{ |'edc   #65$dM- (' N7NM   F?@ABI(Z4D2"&M&6'5"3T*       V  ^  hghgh 'HG HGFEHGFGFEFGFEFGFEFGD   q  ne          >EF,EFEF     ?N ?@=T!3& ' V$ 2  $e    *rq rqrqrd             $ * d H*GHGH GHRX      3  HSGHGHR @<  ) 9 ,  @V  )   CN  Q a    =D  Q aWXV+& XWX4fNMN MN*MN.     L * }v fKH&%oWXWXSH     ( @?@=B d*0!') 2 Q    S / f&%LK&L  cdc h iFY & |I02 6  ^|+,+,mn,  PI K !6 hghghghTn5:9:9x=KZYEY:&A     )      +fc*@i* j  . a(!%S-AK    : h)gh> HGHGHGHTHV    ~ T Z Y'(&  (N'([".  (6'((  (A'(NN"!  popopopIx:hghg jiN,  o%hg N Mtstsjiji$N'M!8]^[b     y  ; -    (  '~7m;b:  %   $'!x $"       NMNM&%,+ NMNM&%,+! |{|{  P OP!     +  p)op!!   , !  !    !  N5 x    Y    *  N5 x    Y   ,   @*?@      H-GH      0  &(    `A_`-_`_F      !,'D_RQR P  X WX&WXWX  Ax Q`     '  A pPopopopNv$ 0  k8 > =z     2 (@   N  !  @?@L  n         'QL X?WX>WX9 N  "; $    D,%5     pop &="#   2 :7 > *%&   ,+,/ YD *2E5,4 : 7     6  H  UL #$  ( STST:# C?TH8= 1S(      H  U> 5  " H &       u14 5  " X h  A XhWXF!x ")    ^F  @)?@6    ( \  b h n t z 0/0 +   0/0 (   Z $   C  ICFEF V    9& 0  PCOPOP"    /   3B/       0/0 %    0/0 $         -      '    P+OP 8    ' 878 4           @?@?@  * ;    *       &(   .        &  ( x{wx&'%M< $  S ) /'M hZghghgh+D('\f      CD   `7!6 D\ .9 j  q    @/939 j           uv   `.HRJ  *!*#  1@U-HRJ    )%*O 'jT !$    $     2 1 B/O'j  X_WX+     (F( U.       9&CU. HGHGH  > D A -(   P$OPOPOP OP !     gjilkp  T,  !  @-?@?@,?@?@?@%   7 7       "  W P(,+2 %   7 7 *4           -K &! )  ?5 x0 %C0 %-          0   XOPe   e0E :.!+ x  C   b-"!.   JO-. J     ,.,4/ J" !"!   j"(!$     U]  $  &  + "    8  ('(   F        \      D 1l%  3 ) 1 F 1'  5! ) 1 p,op   -  x.wx       0   -                  `3_` @ , (2'('( +65636 XOPe!7+   H&GHGH $ ## m p + # , XOPe    4 p}opopop, +,+ Z* ) ,+,+,: & ( '$5 $ ! !('('5 ='"8  Z   .') X & $ x S "3' X hgheghgh* ) .-.-O m p   K ! .#  O @?@ (F `._`_`_`($! "!"  L  & 3 G   $    (B ' R    d  $ "     O /#'.)%B'R     `^_`_`_`( & /     #    >/*4%&/     `G_`_`(>  |}~' *  F-   (f ; ! 1 cfe h j 4 C@ !C f  ;    !$%()!,/0/ *          8+  B  "(        0 )+EE8+ .   7  _ +JE>=     .&)t7  w+<YYL E     ! $&K*%. &4  -        33- |>      m S SI  a             # =#l)  3    5     b      B  1% %%%  0   * z$34 yz       4   4 *%%%%'J:F<O3Ca *  3  %     &+    11      0S_>%:P4' >J8(        1         !     \CX   %  !   ! "?LL:>N;78 %%% n%%% nm nEU $ UB$$   c  c$$%%%% TMNU $ $U $    $ $$$$$$$$$$&% $$$$$$$$$$$ ZYG U$###S$$$$$ $  0&6KA#  J( L+,%, '!H&5 I  %  z  *+  " W    T  1             $  ,+,+..-./2 /0/ 434 565<9:9 @ ?@?@?@?@ ABABABABA F EFEFEFEFEF GHGHGHGHGHG!45L5N5 4MRSRSVUVUV UX WX  YZ [X `]^ ]bafcd c%hijij g nmn opop otut ux w?zyLp]~}:>H /;& q-( [ ,-F?VS--F?VS""" """"""" . H [ y<<9B8;8C;;(%7)  *, ) -:#N'%%%%NM %%%EF%%%IJ%%%MN%%%QR%%%UV&%%%YZ&%%%]''^&%%%a''bFE&&%%%ef&%%%ij&%%%mnEfK'C$$#$$H 1 1 . 7 . 0 - 8 / 1 #      ;") 1 1 . 7 . 0 - 8 / 1 1*)      "!$%&%(' *+,+.-0121436787:9<=>=@? BCDCFEHG:JI#JI H,GHGH= ) 6     PKOPOP    $$$$,-VS 4%  877878   ,-VS  .  PPOPOP)  ,-VS  .)  x@wxwx   F Pa    VI xBwxwxS   = xEwxwxV  @ xDwxwxU    ? xGwxwxX   B R>R%%%%)) > 8178 T  /-VS% XUWXWXWX%WXWX7(i:#&$$$$]: 9'ab\#####+     ;"*(i:  #   F0  ! 0 xcwxwx"   ####HG--VSH,-VS 6 " "   hOghgh ){|X,-VS!#0'  ) hgghgh) )ih,-VS/! 0F ) )$$$$) P;OP &  --VSI("& _ ,v^    + &  . z,#$u  $$$$/   +  ,  . r   #**)*) >*)@@X*)*) *) *)J         5878M  9   !$C>E  * >@   @X       #9      '    ZV&!   #9   popop4       '    3 sZ l $ w" ? -  ' #   0        ?- +   ',  "F  %78   ? -# 8$78  "    ,%" pMop    - Q\         -        )         D$   @/?@$    ( #  " = (# $   #  # w\D             +    C :9 ,    "2$,"J      +$! "  # 8 78$     # "  #   TS  !# NM6   ' @?< 3 L    '     HGHeGH.."   1B!}  .." HGH2GH."  B!J  ." @8?@L $F )" @2?@F @ #"      !6 0             P    6 )      @?@?@?@?@TS"    $$" 0/0B/02-   !' $  S~ ) J4/1G @?@   X_WXDWX    MNU  [G 8z78 3V ~   + `&- V dq  G" "  D$zhABAAt%1 .&g  B_`Eb% ~   2= "   !  abA& G &I &!'-F/ !@d-HF @8/ -'   Y8# ~  )"6R%Ac#!  '   b   ~R NM6   <  $ ]n      #)C           #) !  !"       H"# $' *+,/21R (|'(        ~`                    ('('('('(-  * - HIGH GHGH,;        + h6ghghghghghdghgh-ghghghghghghzghghghghghghAgh]ghgh/ $   ($?      F   a  " ~!K "!"'.  /4 +&34 +,+,CQ<T5  H  ! 88o/  $   "!"#$#&+(016    -4-@ABAF   ;D;<   ,)"  &        8'&,) #!%`"!"!"!,) "!"!"! 21 . )*  -.!;<   "   5       L]# "/dfD]   \J        @ d    + z "!"!"!@&% 6' > 8? @       "$34          16 9:9:9:W(=V<C$; >! (      @      z 9  POPOPOP0OPOP x   $R B1 ('('( '('('( =    ) = @??@/:    A:   "!"!A"!i"!"! "! "!             &)'1     0-        4 %\ [\[! ' 6 %  HOGHGHGH;ZY! !  !A"E; B. =!     ,'   !y60!  '88 Dk" % &(   00   XWX WXWXWXW2XWXW=uH"!"!"!,) "!"!"!XWTSTSTS!"     ,    3 &        ~       NM6    <  $ !NM6    <     $  5 4$$$ $"$$$$$2$$$$"+       $      t t pkLK  %%%%%%%"% %%%%%%     $$;_     '3  $$ -  .   ' NM6    <     $ON EF  .  }f   .            @M"""""""!]& '  #     )[2?E(2 a ;#$; HO   B ?+ B5^        "#5&%*) ,+* )()*)*)2*)*)=.-0/0/]214343.6 5878787:; >=>=>='@?B CFE=HG1JI(  +*)1NM"!LM POPSVUVY\[\_baba1dcf cdcdcdcdcdcdcdcdchghinm"!lm popuv{|)"! ="|   -9! 0"/0/05' % u "!"!"!B&%&%%%%%% 8##@ 1A B&%#'   X@'    !!!   #g1%2O @3?@?@! A( %%  %%   F $ A ""!"! T S?"!~8N !"!"!A"! "!(  '''' (  '' "  ;< && V#"    #" ,#""" "#&'&& ))))G'  '' '' M+    h] &9   1  "  9"   8N !*    @'?@?@)E@ECF* \L"!"!D"!|+((****     $ #"  **'#    = e8 U1S 74 D"    LC+    4 , ))#,+29:E) >  5$7,; ,-.+'('LK"Q U1,   21,8    '  C RS :  !R"$#  : POP;o   !     !I 8)/oW  !z   !         9 "  87878.   8>78H789  Z   <5" 6             @ 8;78, : /mpsvy| "TN   # x)wx$ ": # " L+#  &' %   *N"   #   &       0    W 4R   Iy 3|PDYZ1  Bjx   x   @j'. '.{|y'.yz~alc %X< Md      w w !   '."!    lklwZ     &34 +    MvX 1 ) ,!, + kd     +    P  Ht 4   34  \> ! ' +,$'$7D  1I0  7 ( ' $+  +*eL$        ! ('*)&*+.-.-*),+ .-2387 :9:96523<7878'( 565 @%?@?<;43 2121NFED34 ABILKL#K*)NMPOLQB K&FEPO TS TS VUFEPOXWXWZYZY0L C\[\[^]@ 5a`_`_a('W ba4 R J     $     N %     '   F  "0    2     klk         NIJkllI   1:n/4    6     eP();f%;<    ""C:kllklgh  W   pp  ? " =z  # Y Y'>,3 (J      $       N%   "! "!'$# F &% &%"0('(' *)*)2  p & x  ^^   t 2` &   x       , 1$-    z    )%    |{   ,          ng( |9zy@*^        kABzyl        +3 EABF &  !         3  v*Q    =' 2  2~6g      # 1$-  z"!"!$#  )   '    ( '( '(%    ('('(\'(&  -                         5         8(784D  "I   #  HGHGHR  G'+ / @/?@?@6?@+7     F?VS  `      (*'($      ~ )=     p$opfop,L Q     "%i 1     # &$N ^]7       " #%~& 3     # D$| '"4 & F# <Q %%& 0/0 /0@   !  ($'( '('(. >  "   !% [4u'     $ ('('('('('(d      S U  )   8+78$"" " 9  # (!'('('(\   K M *'",5 469}*(< L5   6    p}xQ              z    K I0@G <    ,          /  & W 8 787878 7878&787878 $'#Q ('( .- "/NM:QF    *     (%'('('(\'( '(- >    *     -   ('( '( "    " (X'(7~    W0    4   Ap $;!"- 8 78$< "  # H GHeGH & /* /1: u  .. H GH2GHb  :  . (7'(C $ H . (1'(=  B ( 0F/0/0/0/0/0/0-3 @ 9;>;.)*9 n]      `!_`$ "2  # 0l/0 B         $ *(  )  `_`$O "0 # XZWX5=  < 6    XYWXf!   L$   A 878$G! 5"(   # 8=78,J! 5" ;   '# 8R78, F! 5/"B P      ## 8578"     1  ) 0'/0"   ! #   (='(^" ! 8  D 878,S" 5"4   # 878,# 5 "8   # (E'(# ![@  L 8$78$T# 5    "    # 8%78$U# 5    "    # @_?@1?@.@H># ""B?B% &  "  ##=  ""<3 9  )62L&' 2  *   $ 8b78&CM$ ##.+.'(  "  $$%## <  -5@ 5   0 /0/0% $$   P1OPOP% $$>3: 9 *  & `"_`$& """"""""3  #& """""""" 0/0/0*&  &   0/0/0/0$ .&  ## !)$$ 1  .'%% ('('('('('('(k' %%    Z \ ' '  #:! (+'('('('('('(-  B( &&!!!&&&!!>;%%0+!&,&&;& T;&        8V) 7   @?@$M) %5&&& &".   # HMGH 0) &#########  AD  0 H;GH$* &&&&  &"&$   ,# (-'(>* ((  #(  ))( %2   K${* ''''  '"\  B# )<   + ))'%'%'*)(%%%%%%%%%(((((('(((%%%%%%%%%(%%%%%%%%%KH0}N'  ?)) 90                  ( (L'(4.      (;6,6/     / -F?VS-  (&'('(1/ ,,))    % 1(0 -    2 ( 7C48j%0    //-- /     %u I =  .  O  % @2M'1 's  M' P\OPSOPOPOP1    00+ 00!+  -@   XSWXWX%WXWX(WXWX8WXWX1 00         #   '+]e        K  * ]W3Y3i=2 1  1 RY111        QR    %   Q,+R%   %+ ()6    85                         ..           ;  # #*;D*'=!2 /:        %"       " !"!"!"!"!"#$#$#$#$#$# &'*)*,+,-.-.-<0/0/212 145#  0"/0/0/0/0/0/0/0/0/0/0/0J/0/0[/02/0J/0/0G/0/0/0/0/0  (&+     +3 00*'000000/G11B11  +11.)11111.........1111.11.........1.........1...........511-)11HG1.........11> 11))  11))    11!%  (&+      "     &#$#$#$#$#* '('('('(',+ .-01656 34343434387:9<;>=@?+BA! 5 ..22 1!  5 ..  2222   5 22   @??@& 5 .. 22 &  P*OP75     P,OP6   ! 6    PGOP6 444H   POOP6 455% P   X6WXX6 555!!!5%!  6 555!!!5 XOWX6 555       D    XWWXx6 555% L    XEWX0WX6  55555!!!5*% !      @6 555$$$5)!   P[OP7 5         55 qH   PcOP7 5%  55yP   P6OPC7 552222 ,$   X7WXD7 566$ #   P.OP;7 66* *7 666$  ::7  66-4?' - C:7 66  -=?! &- 0//08  6666  *  P\OPi8   67 & * &W  PNOPOP8 7  77C  $9    C  @?@ '.  ** " '     @?@&3  $2      2i  6F #&&u     u$34 !:    h ' P> $ '$HP=Z* * <           6% ]1z    gjNM6   '< 3 L 2  ) % se v;' ;  >    " R NM6   ' @?< 3 L A    A @ ?@  &     2\ &%@F 6` *% @J >h 2"&%CR <f 0 &#CP   @,?@!5  : *"  " @ ?@"  " @:?@$ $34  H"      @ ?@"  " = .l" ! "!"!""!"!V"!"!             +98 % :%6  &        <      (!'( 7   ! !       9   21 2 52         '   /&   *pG  W5# M      ? P=OP OPr    ' %, .J9    D 0/0" B  (P'(]@   !  `S D   +    @?@    pop!  !(! ('(   #  8'78    (  P#OP$    "       % %'  ( '(    H5GH     ,-   H!GH"$  `'_`$ 0%/0    (!    (<'(       L       @$?@4 (>'(     N  8578 " H}GH a   /* %1<*w.. HKGH /   &<+D. (C'( )  $T) (='( #  #$  0/0" *  0#/0   %%%% &   0$/0  &&&&   (C'(        ' '''''''''''''S  -     ''''';'' "@ XWX!    \        s"! d %%% % H   H+6 ^ E10 -     s   ko}v#5\-]>P                            <   `        #  s8O %%% %%%% % NM # 6/0& &&&&&&&&&&&% &&&&&&&&&&& :34*W.+, ) HAB;<QR.[.+, ) NGHABWX].+, ) TMNGH]^6M2&), $$$$--F?VS-- $$$$--F?VS-- $ 'opij/$$$ $&S.+, )NCD=>784 ef_`7v/**G 2e'A6  3 '! D6K                !"! $#$#( %&+* )*)*)*) 0/0/4 1276 5656565< ;<;<;<; @?@%,E ?>A@9   ,$    p{opop, d; $ &1 & +8 &   & !  &    (=E  Q%,$XWXW XWJ       & @.?@,       !)    HAGH,XW XW    '       ,bababa'('('('('('( '('('+(   -< = z  +  KFE> -  #J5& / # J5& 9:       F %%V-<J   + ( ('      .   B O      I     33 3 `0_`=       P'OP       )   `,_`       H#GH      )        )          xwx9wx0      $$$  # 4K 4 '"> # 4  043 43434 36r        "'#     # 2% ( F W ?  "P"I%   "  # # 2%     !  HGH "!*    #    M # 8x78    #)\ `_`   '8? <i+'  HtGH&('-('  {|     wx   ; b&- t3('  (' @9> 102,-VS  %%D 2 C&< $4%*)'6 Q Q3 02       & %  %      k      * )& %$ .$*%   ;^O !A"$*". A        $ % %9 g    D(' ('$43 43434 3  &-F?VS-.4f    010 $ %W ) . % # " $  <Gu""<   4      !0  $ iC"&D  h= 3 N    A :A!bg"[ #"      878 ( ( ( ( 6b*  A     (   ' $-F?VS67J   [23  &'./  :; F G  " # *+>?  BCb#-F?VS  P'R9e)A * A ( /               >                             B  9    .    '    `                                              *  U          u                         /87sc     ,            1         P      .  /    2 \       D%     ,      1                       >     +          5    2  5             !(         #         #  ( n          &              %    %         !        !    $    $ T &4 ![ ! * k] - %]g c - 03 &W([$4  }4-*' "(#) : *'% )) 4+t  !0u p" 6 ,D          ,   1 /2 " ! $ #$ #&%('('&%&%*)*)*,),+.-.1-0/214 3('( 3438765:9:9:9:9:9:9<;<;>=>=>+=@?@ ?@?@?BADCD2CF5EHG J IJIJIJIJI L KLKLKLKLKLKNM PORQTS=VUVUX#WXW ZYZ Y\[\[\#]`(_b9'('('('b9' b a('babadcd&cfe0/0/0/fe0/fefe0/fehgh%g4lkj ijijijijijijm'popopor!qrqrqnmn!mtst$svuv$u ('()                        2 (' -F?VS-.        3)          e     R   0/0 /0 /0    ,# pop-43 43434 3D     - ( " l   -     - h('('('('('v ,$ *#$M`e/0   2.    '(    20       Q   D  /3.f$'# 5% "  2M81       7M >  c/ @= ; ^/ "8BLYK5KD" %'nW0,2    J   2    }$"#  5"!"%!? %&2%      x*P    '    Y!N*  pyop   &3) "3'& (9'(.J  + ?.L    .          POPAOP.c        +%(.  POPOP.E  0 ( 2.  X+WXWX.>   (!'(.3    .6 !   POPOPOP. $  B ? ) $ h4ghghghgghMgh.          8 .      "!      wBv/8.   .     0g/0".  $#   3.Q            HEGH"GH .v    o *Tk5  XnWX.)*)43434 3*    @ V   `_``_`_`.F)43434 3 *   eJ=    @B?@.O B?@+  .1    AI6l.    ? BA BA BA B5 87 87 85Y%       @0?@ .>      ")    h6gh8.T #QET 0R/0 /0/0/0 /0.            >S  . / af |      #   UD0  ? _+' i       . / af         UT 9 _+    POPOPDOP .                  "          6       o>.      q2           h9ghRghW.\[\ D      "5!` %     SD.}   z!#. 4 YC.  !E : xwxwx<.)&*)*)4  3434 3*% )43434 )*)4  3434 3*S  &           %               $; h>"?N&       8878078784.} ' "      ,%$)(  !:g  hKgh .)* )*)*          +7@)   M.       1  '  8   #  #  # YS  J #  >. / 2 3Z_& 'VW    6 7* +   -F?VS-.     0        % % %EQ $,  K..h[N       & #  88* !  @a   1' 8K 8"!& !(', '.-2-2389 @5?@E.       )C  p3opYop.v          @D(7!K  .@  -~  (%  % <  HG  /  M ghk<)  8   ~5CO2  [I"~- @ 4   "       @ 9ij- @ 4 T~?     /  b?  4@~P   ?0   : %P  }~    JGHEF?;?$- X~      #e     ('(7~ uruv Y `P_`~cR      %9 A~-.      S - $~/     ;/ ;#   =-  . 1$&>  )*)*1x  [r  J[9HQ) . 1      -  38"L-&L vqrs!"  QRQR1!EAX    J  {49X%)     8  "  -  ('( '(      0/0/0<        !$#&   PCOP#OP }  =>?B 7:9:9DCB  " -# 0*/0/0 V _`Ed Y\[fId !      @(?@!U      @  #   8   '  #L    :   @1?@A    8678    # $1 X&WX WXWXl  6'E 0s/0 4($   an g I-b 4%$  P[OPOP OP: X>     B +&$   20          pEop       "       H,GHGHLGH _      *&-!    0  $#&  X1WX>    '     (W'(  %   "leH .  9 %   (T'(  %    "le .9 %   0     "         "     ;          "       878  -*143.9:9672 $v3  .B  ( < &  + 9- P'OPOP Y* ":MDCDCDCDCCU   U  P,OP  DCDCDCDCDCD   .&     J   ; h6ghghghgh9     &NwzMVU^%& ]+HAB         ;@     +%\] t e  Pd6 vj  P"OP JCDIJI  DC   hghgh  * ]h   1  uN)   * XuWX  &     1 X1)   & P7OPOP OPOP,OPOP\OP OPOPOPOP "     i        q  )   Wd"r  D  b  H.GH;v  /  X\WX  OP  I H1 > M&)     #     1  X^WX  ?OP  I H1 > >N')    XfWX ! MOP  I H1 > L N')#    pop %'  '%1  (!G pop %'  '$1  '!G   p*op5opm !' " ,! h#gh:gh ghx     O(* +P M   4OP  I H1 >  @ ;L<&)&H   :G + "%" 7D +"  Ub <))9 `-_`:        ( OF I   1      ?-!    (    : OF I   1       ?-     :   " -.'$37:10  `2_`!_`_` K FE  Yd]ZL>P,  6  8)78 NM     H)GHGHGH    ' P$OP1  06/0$   0! ,  ?   FE -   & N    j   OF I  1   +)#E;;3N   j (  "   OP F 1 <  OP H 1 >   n^9353-CA#                 n BAc           &     ' H-{ c hgh     8.78         H "   ?OF I H   1 >     >  ?OF I     1       >  7q8"!8 C%3  '8&8 ( T /   OP  IF   1 <            OP  IF  1 <      OP  IF 1 <   ?  Z C) }Q(+++/(J?5$ /5)(%>                    -&%&#' `_`?_`)'  " 6N)'   N '  MOF I    1       L    OP  I F1 < U.+%#'    3     S+  ;FE9     %    OP  I D   1 :       OP  I H  1 >        J/      P     1      OP  I  1        %=+'+)i'!'%$#        7              % `&_`  ! "            ]-        6  FE                 OP  I 1     OP  I F1 <   # S- h'2',G              HAGH GH GH GHGH|      6 X)WX6 " hSgh&gh  !! &a hghghgh)gh '           /-L!' hYgh'gh  !"  !)k |*D :% # (" *(s c*Z? "%;# *!(*(WC |*] :% ; (" ((s1 c*] "% ; *! ((Z1 h1gh.gh ((  &G X)WX    HGHGH$3,   `1_`=_`$|> />! $/P !$  6$$          B3`U     >5$n9l65 23$#           [Ka$C""  ," #  #" "> 7 $Y  #%4 8(7878$<       $  `O_`_`$\        9 \  878178$( !&     vG! ! `_`3_`_`(sD  "*#>+  plop( (4 d #%$4 ! (4  p[op( 3 n -0* #.  3  P+OP"OP( <;5x  #  9 5 HGHGH(C !* 87878(8  (''('(S 1" 18# $#&%.      on[ ^  P ? >1 4  i o("&%0 E  /       =? >1 4T    &,$&*  A    $    P (  # #!   -"> 6,'    X2WXC    5 45  D66:O3  D E       p`op^]^]^]^!]8^     6/)7!8  V$  ? >1 4          G'(:]!       Q        Vy  E H? >1 4      G'%:;         %        f!                    &     (.7-,*  -   !  2  8Y78 o      $D  hghgh     ? >1 4  #'(&!       H}GH     (H   6  `_`     .M   9       pop  1 2++ + +    Jp8G1   >     N$Gbjs" FE FEV l/;Z)) ZY</M \Q  !   ? >1 4 /N   '    ~{ |q \         #D ?     21 J 1     21 J    '21H'Ji   w!  !J!1 ")*=69 "!*+ %      "!      # s%%>&E$77 9 #*96#*p  !        .  %          I   $[FE      ? >  1 4       $ ' #  -'#% j   $Q  R     "   POPO       1          "  85        16585 .+  ///x3,+$,P:  2    & 0            #    @UV=>1.%    >      %        $+  b           h              %#)(2)1*#. 'C5 /    ,  M          8r780TH GHGO        &Z.    ( \J? >1 4              ? >1 4!&;)P/$ &              N            BR&u "  RQ   ^QS    fe `]\YXU (! DxGvZ!  /whY,J/gx, ;yt4 h4 QT  G, @/gxDe K, @/gxD k2 '  M '  M '  C   <1        *)$*%$/)<P% 9     #$   PO):9  9          T  BK5<1    vu^[ :? >A1jq91N&<,)                T   ~ L    2$#*gh%434/KL27    '#    $U :!1'+G8" 3      4  n.*+,*+c                    "             "*= &12  3 F 1  !21"? 1   % 6wY B?#'--.,c                   "    l  C     tL  C HXZ24L" ? >1 4' /)&6*2     L   PE    4         ? >1 4   &&$&#           T  H  `<_`5_`6 56565 6 5.    B2&   . "6C 6E   :8   E        D @      --             4 35K)          3                      P_65 D565 D5/     ,+,/`m     $!         f e , 0/%! "#<W_    %  Z  D713Q!";W; O            +    '('  LKLK       /                            /             )P&9A#r(%f^mR D7  1     3Q!";W;      O           ;$B R "  &% &. ;   OP# / 8 QR   Z )X8F^3'1     ;  $ B  R     n  Z     FCD3     +. ?  = .  QZ   en m6 5 ji ba NM  :9 ^A(713_             R( "4CD384CD3         "   # )G4"8  haghgh  !    *"  %". !   R h  !/  5. *   ,  2                B W  ; =0  :*   ,   .% &  +,          8 7 3 6b!  1&  +.-. pop"opopJopopop"H60  I0+3!!K!H"   e"#4 :6    FE  U,    [\U V 1 L  #&    "5$4mp13=4Q%#4 , 6           IcaB"&  FE    (V4S14 <4{*4I)*)7)%^e% *4OPE&    N*!0%4+@0@0"#3D-&      6  7  DCDCu &!1 <Tu <  7  D CDCu  #&!1 BTu    W H*GH  XW !   "!        C   &     Uc,0 "  C hghLC      >                 /.A2C  'W   x     b)y'7 (% Wx (#'('(      "   "    `_`*$  w-= #  :  F  h    (4 T#J  # HDGH&GHGH+r  M+ 02/0 =@9:?@9:( #W +  ORKL  +    `_`E_`o    !                         COP  I H1 > BEOP  I HFI1 >FI FIDGOP  I HFGHO1 >FGHO FGHGFOOP  I D1 :NQOP  I DVS1 :VSVSPSOP  I HT[1 >T[ TSRTQPMJ GF C 634 /0 -.+* '(%   OP  I F 1 <    OP  I H1 >  vUTlXSZvw/+1-1-I-2/1-'&  ):)                                           & & *) ,+ . - 0 /21214343656587: 9< ;>= @ ?BADCDCFEFEFEH GL KJ  QRQT  SZY\]^]`_ba @?@,?@          %   ORSVadOP  I F 1 <    k por          |.)! -&f+       %  "!"! $#$#&'('*)*) J0       ?5 HGHGH=    xCwxwx 1  0? (4'(6  @?@?@?@F      x wxwxwx M         W)  #7" M  `6_` L      P>OP\      k!                   @G     @$?@ :    H8GH       $| T          ^)#7 T  ,XL                  (      D Q R Q         >                      /sE$ W        (      @$?@?@          9 ****$ ((,,"  0/0& S        "       `      0l/0 a   (   "M D    'SF   xwx    &     "C : &%%%n'&        % $       &   ( *    0    *  d   z          FE    `c_`t       (^B ( ('( &%&%&%&%&%&%&%&%  TSTST'  '  '  '  '  '  '  '                     "!('.-X f }}4.    W @D?@?@?@?@ IREL?@  ;, 6 Cf  mxircd  t/:(f 5    0 0,/0/0     B!3l kl k    "hgh ghghghgh ghghgh  }mS 3="      `B_` _`,_` _`    #  2      w 2  u     # , %r 1 '+!(*#K]    +!( * Q +  0F/0/0b 2 Q V - 9TSTST STST STS     (9#9   Tm$MV UcV U fe   "  &!   A]>M c   XTWXWXWX WXWX WX"WXWXWXWX V Ux    ZY>Y        7 &  %#-R,i x !i bdcdcdcdcdcdc   @!4$53      vO   P    =   #  Y $+ 51 ?q%  *R+WIW39_3 (7 xg ('( 'VU('('('HVU*'('( 'G('( '&%b*'l& %('    )21* 83 D3&,$33, 3+     ,303  7  43 (3 9F33 d          3 <7:DE@565GXOX$('T  0 3" -6  A 1   7 7        ^         #  {< ,-VS                a S  %   ,-VS  * #r!$   $#   (# #-F?VS    <3 @3  &DM * !C*+:6=   "      ;8! $,3 E;* :! " !$)@,  3J @*! 2'/ 8$7 : ?  S;        >     "!"!(%O, +,+.-. -G0/0 /21b85l< ;["!"!"! @A$ BA  0 /0/0/0('('  $  &  % @'?@?@?@   : z + ( '('( 'Y&%$ -F?VS 5 '! D> = #5   Y   $ R$#$# Tc H/ !"#H7%&'H )H 9H    cLQ\  cV[\ ]^]d_6 $c< 0c045 #% r    ('( '('( '( '(5'( '( '( '( '( '( '( '( '(R#$ #\$                    u \PF  PL Z ('( P3`  rx  P(  P6OPPG  &   P?  .   B   $  &1 T(2,?. BP$    (.'(P>      MP_  \ /   LPIJIJ I HG HGJIJIJIJ  MOF I   1    L < ' <p1 !* !;+(I         rP   47. -.C$ J     b)7$   $ =P (4'(PN  76 <  X  mP      "    P=7  0 B  PK,L   Q , p$opopPD   %!    pop opP  U4VWZY"d .V4"(  P  e fkr hI!),( P   ,  ,/  $    1v-K/{!               +  ~% 5 =*W]7?w#(P #$# $#$#$#$#$#$#$#$#$#$#$#$# $#$# $#$#$B# $# $#$# $#$#$#$#$# $#$# $#$-# $#$# $%&K#$#$# $<% &<#$#$q% &tKL   d8       FE  & s           0 )  # ,ktu nS) 0  lm     "+ ^ F(_"y gH-0) 1 a " $}7747Z       B       " !"!$ #$#&%&%&% ( '('* )#,+.-K210/03<6 5<43438 78 7 871: 9J  21    >sUX{%.P#$#$# $ #$#$#$K($#$#$ #$#$# $ # $ #$#$# $#$#$#$8#$# $#$ # $.#$# $$# $#$K*($# $        K     KR QQR      zo zy $ % 7&<d "  $;B'$  $ K1 - K; -f) .[ 9  %%#%    Z  Io/0B                8  "! $#$ #$& %(*   * ) J&P #  $Y $-F?VS-$&   ':, Y%  hB^|  (%,% <  HG  / %1 M ghk<)  { |y%) ! C  7;2SS e *  `_`_`"^ (   " "  #$ 5*     m  b'UH^  `_`^ (        l@ pJop6opop^  ?( 036#214;6 #6# /")6# /4 ,M3  / {A(&' ^ XWX^ "  +Y&    ('(N^, qnqr ~}(5 p, hjgh^}N     ",)  'Q hghgh^*      %   q G3&  ;  nmnmn k('.-. :  NMNMNMJIJIJI$  T S b a  0*/0 NMNMNMN MNM^]^]^]^ ]`_, vuvuvuv uxw 0*/0NMNM$ YNMNDMNM bh& 1NM > 0B/0N MNMN MNMN MN M   ;D    NM06,+21      `_` I&%&. -%& . -%&%&%&%&        ;'WzI     hgh&ghgh &%& . -. -6%9&   k   &  #  (''i  &9  @%?@?@?@  ' |!26 56 5658 56  516 56 5658&56  5656   " # +-F?VS+ ++-F?VS-+ +-F?VS+ +"+-F?VS-+       :o)uJ    1$!&&! $! qHY    #$    a/Ob*   @+?@?@"?@  KLCD   EK1 @/?@?@?  ijal  !wm < @??@?@    S @6?@B  U V M Do  < 743+        .  ++ `N_`_`_`_`     8 { j    & 2  ( 2 G   & *2"  Y (4 @A?@?@?@     I T 87878 4 1   87878 , )   ("'('( #,  $ @?@?@ =>78 $  .6 56  5=    OP  I F 1 <  $-F?VS-$$-F?VS-$% #      X   })`$   .= 7 Z,/43434,343434 3"4      x             bJ7/     " XtWX *. -. -C    &  k   &  XzWX *. -. -E    ( !  m   (  XWX * . -. -I    , $$ #q   ,  `_` *. -. -P    3 '  $'    3 *     0&/0/0*9 # (#'('(    # *D. -. -      3      H*      %2&*> 5   3\ 13<*. -. -    IJij4/ $9@  !6  E N3I     k z 08;3  + ;,*?j'+9`   5~   3 `8 ;cs b );8w    '       P;OPOPOPH      !   4H     (8'('(   " XWXWXWXWXWX*( RQ*) R'( RQ*) R'( RQ*) R'( *)  HGHGHGHG ````  # EBeb %%#              "! hghgh'gh "                 V l"           (n'( '( '( '( *( Q*) RQ*( Q*) RQ*( *) l`cji |`c~} ` +(UR" V)        ($'('(    878C  XOPe%  _`_``IJ`56`!"   `_`_` , XWXWXWXWXWX*( R'*( R'*( R'*( *HG,HGHGHG ````"0Q#       "!,$#&%(' xwxwx%wx%wx%wx*( R'*( R'*( R'*( *HG78 5 65 6C787           3'#' &'        3   `_`_`_`_`_`*( R'*( R'*( R'*( *HG0HGHGHG  ````4Q!        "!0$#&%(' XPWX!WX]    !-]  `6_`_` HG;  # ( ; `Y_`_` HGHA-  Z%(  @ - }Q#C        XOPe @ %Q#  hghghIghL(     > l v        IC2  (          xwxwx  0        Y)+7  0  POOPOPOPd  .   H Q  # (d  V  VF# gt        %t  2n      ?/8D    7 (   orkl    tqpm%   */ Q   J6  $   #    ?/      8D x$wx"wxwx C 2  C n ) ?9,       = I, ,) ?    9  ,  &      '+ 3   & x/wxMwxwx NB  &   O" ('(N%\    xwx>wxwx"h:G7>8]^[b     ;"-    &  ,P9U4:G7> +Z QROV/ Z$N,B,  N  & ' POPOP    QG&D 3%         $ e  7  (2/! &D % ADA*  ;  =  X1WX HHHGC 1XOPe(     !  h@ghgh ghgh V          '[  V   @)?@?@?@ *        h)/  *   878 78#HG     #        878 878#  XWXW D    21\ +.    hGgh 0 1     C0 1 yO  %  & %(!""       7 )+N' e .  %        &d?@?F9XOPe  01/0z efel_XOPe 0/0 "   [($( R             _ b   h g i n |   C*  *R        - {  ) XOPe 2 $      xawx wx" @          e   "   B  S  B $ 9  $ #   ,) $   $ #  %*:G7>*$, ,` a  hg.XOPeM    .XOPe HCGH*x{zy$* @-?@  "    /,  9:9:9<\ y  =[ <  &  J      sr u BAD . >? ' 8[^   & a d x   k H  1 4 w&  V, -   d D,LYB   &  *     1     ]c<  & ($#$% $#P$#$#P$% $#P   T         #"  *A!?221TE 2 D %  &                 <  *$     T        1 3   >   1  \t  *$ ,           , 0    <   '   %    43  8- fef {|ij{| mn{|{      )      R  Gc2   '%                 - <   #   %q    :9  >3        3  $=  GK)   #%              ^       <5636           <w[h      T     <$56      Q0$   popop op op opopJEDAFEF V 812 ' #  " ) 4 6_T  `-_` _` _` _`J^     # ,,  B hkghgh ghghgh JEDAFEF&%  %"& %&%    P  ` *5d    "   PXOP OPOPOP6OP JCF, &%&%% &%&%&%       !   P R $- 'Hb6   ,   $#! `_` _`*_`J 56#565 6    @  #          8.787878#7878    ^Tlklkl  XOPe p%op"op  #" E3E   -%6 5' 44        3s   $ 0B -% '  76 5    "(7  POPOPOP   . (   6 5      > *(J IJ 5 6 5b~6 5 JIJIJ P  D    Ob  0       )    8R,51&&&&&&/O (    b     ~   8M    5 *&&/&&:6 5656 565J6 5656 565) +  UTWVYX  0  < 7    / WP S+ L:    J     ) T;&6 5656 565{6 565C ,6 565I"      $  OP  I F1 <   Ab4  Y    SNc+$")&?   {   C          , I @-?@?@  ! - ! 1 HGH"   ^KL] L c fSTe T 12 ;<e E @   %0-b % $ (1'(   7@   /           - . hgh4+*     M#  +*  d   P  A xwxmwxwxlwxwx  &% D" "!  '  +   ")ly Z*> ) HjGH $#$%* ) V#8' .  @S?@?@?@ ?@I?@?@?@g?@?@  58  - !     oj .%0)  7 RL xwx-%.        yF#%.  h?gh    &  / poptop/opop`y 8 C~9  @GNQ    *9       {UE y      (M'(7  (#'(((( (='((( 95 (    PPOP   NR r m   /H  N 8(7878  Bz .+  > B  &y 7               ;43 6;0 wt0%       f6&1)\%/   !H  s r   I +!  &90  $(U Q7U1!_+E/   6% y         7      P,OP[OPOPOPOP     !    YQ+^2 @.?@?@    ;g A )      n    %H ),  =    *I!JUL  W XWZ/= %` .  3&X% )   !       ' 8%7878   !   = #  (%  % <  HG  /  [EF E1 M ghk<)  8  ~ 5b|SO2  %  "C # # # #L #  EF E EF E  "   EF E EF E     >H     >C 'Q*SE*0 C         L i # #! #   EF E EF E      @Nw,i    ! ERh #*#1#,  ? EF E036#2EF E;6 )6#  EF E)6#  (  B ;   < vA%$$ h  *  1   ,  # # #"  EF E  EF E  EF E <: O*30             ( uruv $ ``_`sR     )#  %I 6 #  #,.   FEF E     @EF E   ? 7 D6$ 6     , `_`~6 #8   dEF E&  F D-6  8   9          f  `+_` wz   , P*OP      2 8786          80/0 12%12 1R  NI POZYZ[PO FE  NG         R/&!*  ! "!"!  % "!"% 2/P 2: 5!b7#      @?            '('(+,! +,/0%$/034)(3478-,78;<10;<?@54?@#! /A 02343y43  ] 1     ?/$0  y  !!!!!!!&& Q )3" ^  A  kZ,7(BL* ( ) ,  ( *, 8+78 78784N   -$(4 p|op br  #  ?8CF b ptop   -            ?-C>    -   @-?@?@?@"      G*+  %      hgh4ghgh   ' 4!>M  9  #  %E8,B-             sj-D            *  N   L   ! 7  ]4"                  pn%=               *  N    E " !  I                  i b3    k7G@/) I @#u Mn _,J#6      . $5$C,+8  '-            < 0 "$3/tt BNMT(@KL?BrMNi xY587[^ >      < #3.2?*>'W          >    D     !#M          XkWXWXWX "L2121@    - ""         "  0)/0//0/0                    B2   #                    ;A    @Q?@S?@?@       }               = #"          @E?@H?@?@ $  CE W  2' #!"      ""(( 878  ( ,,,&  ,( $  /     )4 (  # ?  K0##  11 $$.R0r/ W   !6   / /!5 36580   !6       p''      ) ((+&Jr (<r K "PD IR&)G).>).)), %J9 /    ( 0 -q5 %%*"H   *** oT!c  *b ' * **2;E*^im (-g-((+129eK Y>y F<9 1  .gh   XWXWXWXWXWXWXWXWXWX@  )(#$)(#$ D C ?@9 ?@9   4K<6      @* 0$/0    XEWX       X1WXWX"WX # $   b W   g h M  L     q r                    s  r                                      @_                                                   $ 6{          $P                                    E    2  W;A        %&  ? @         * J * 4**A      0         hDghF      ] #    9           ZT 04/0/0/0$          0"/00/0/03"        /" c/0       #`{"    !! !  N       OM!   ^ (  #LA !FA  BA  DCDK DLK FK BK HGHK H LK FK BK LKL K L      PO   ?(6+*#  ( "     $  -  #     ) %      *  4EE ;    : ) Dl       #   "C2U B;W#!'#%) "  -0         "!  Xr;1> ;"! %,  w      +,+, 6K+&   %  B  1 !47 $ "%                      705q$ "  % W:)     ( B ( Dh= F  \  8   -$*6q F M      "                   Ey "      /p  9O/Z<?<6    ;/$   0  0   " ^ _ "(2 : VtH 9 0 /    O   0  06   hc  A    H2W       ) 1EYs"         %'B*?    hgh Q    !"!" !"!5  B  1  N -     0& -  bD*    ) M  ) `/A       , W/ %  8<78          T <  0/(  0 l>"`=/> "    0' 0'       ? @   ) #3 / x6u& +&(3 $ 0/ 0 2 4      x  G   1#5 8j78V78&7878,1       $   >*      $           *+      4*V+$#      .        &      !" !/ 8(eEq|     2     a@      !"!"   1     ? @     .b '   +  *  ? @    ) '    )      ? @        !4      %  C    *#$ HBGH+GH>GH!   % */R >  f1 #/>:&       P0OPLOP 2 0       $  5     +m% KHv N=2=  NH[(HSTGMRFE585"  4 t  & +#{) S  / %    K 1   `_`5_`_`"$  57  <"]^[b     ;"-      ,GB?4$57<  I        @6?@?@  &L  (    3( & 0*/0./0   =   , '        8F7878 >" (:'(G" v(L( zPg   D  +  77/07430/0 .t #8 g   6 B;    6 43      ! 2! ! 1! 1 xHwx  2&O$/  0+/0! ! ! !!  X:WX!!! G!   0&/0! !  3!  g!=!       t!        Z!A!   G ! ! <++? + H Wg  =* [(*(   h(     0'/0! !3 !  ? 4 2!  0 878!! hRgh!9!     _!   ! . \(*(   F&(  0 x(wx!  `(_`!!  5!  878!! !    B GB    &         XOWX WX%    !""  # %  8778      ` -  `/-  HGH?GHGHGH7%  8B7% @?@C?@?@%   !"    %     )  p+op[opop ?A 0 + cK+  ?  H8GHGHD    W,6D m3-'6m ?  B *   !"O  ?@) 6"#  %+    2  D    "1*E "" !    6 m   ? B * M  h(gh  ()'( '("1    ,$ "1 @?@  F )1 (   !"      7  7 )  "0& )  1 (    878    . 3     !0    1#  5    $S g.%        Q!/   \ K Q!/ HbGH (       "    "  %,(    K 0  @ < 0@/0H ( "! 3H @?@?@1?@ ?@G    `BG O      +  8"7878   87878787878 78   "  $+  . .  * + %   h@gh$ '&% (& 8,78   "/   @%?@     H)GH   !      hgh     !               0/0/0$/0$/0$/0$/0$/0%      # #####$'       .#            xiwxFwx )   B Bmx- u#  AHAB;6    )9pC ^ XWX WXWXWXWX   }~wxql >) ~ >2 j *+     & B ;)) )    $%    'NL #        Fa  @4?@o?@ ?@"?@"?@    " > !! ! $   !   P      +D ?  !    "  "  $U ?  !   "  "  "   X WXWX WX     7 1 ?  !   "   0c/0/0 /0          b   < {            &3   Ki  C   )'=? L!1"I `j_`_`_` _` _` ;      (!w):5 Z  !                      4 (4+" *  :  @$?@ ?@  & " * % A ^] ]^ ( V%               5 XWXWX$WX$WX$WX%WX & B ; # ####j i +%      #        T#I   @?@?@$?@$?@$?@$?@$?@   F" a@> w &&#  # #pu#Z_# #<        "        c#H  :  +8  % NA  ),/      M@)  B? , 3 ),)I  6],GR U/     r snid[   5 BUV     S " ) 5 08mf3I7xr{+  U,! % A 'g 4$! 6 *# 7 %* S?#  ))' 4 ;5 @ $ $  %&                    $  T  !F*-, % *O  A**'            ))) ) % 6 !   w7 H+&   xwx  X`       Z                             ~   HaGHTGH  + < ` ")      2";9 +<   hgh~gh ` I ,  1" - "% &   + <4 m`I  ,% hgh&E  a"wxu K   S N&E  XIWX WX WXWX N"V       S!((N_$    "s ;s 6s ;s ;s ;s ;s ;s 6[ (d[%`,UVUVU- "  ? @   "  ? @      ? @   "  ? @   "  ? @    "  ? @    "  ? @    "  ? @      ? @          Xa Zc \e ^K  5                                      N    vQ!D/      ;      6        ;      ;*     )* );4       34 3;>     => =;H     GH G6R "    QR QZY\[^]`_bad cf eqh,ghghgjkji'.6N* N02> !9@IX WXWXW XWXWXWXWf$        p%<7 I  f@X?. @?@R& #($   '  87878   , C,               5@IB, C bZZ     3   2B%4 bZ 3=     5 = l%410   C0/0/80 /G0/0/        .F+2- 7,59 PF0   C    8G       +      ,O& #~:  H          ($:   H `9_`_`_`% 0 /k0/     t-N" k   HKGHGH ^ J P 0/0      "V h1ghgh D+ U    &  "Q$    & h5ghgh H /  " N}L-  & \  B- ~   u- /0( n E7C *5\  8O78G78W 7                  eD# .#       .    (Kn     4 -       GW(#G it oz        3#  G (%!B     %.,# Ju(     5    j>6 H[GHAGHGHGHAGH GH ( 7popopo0  & 3  " !  %(   AZ'? 70 3 <(}T   !ba  jnba   '  (  . &#%K: &#!   - &#  #   + ' L   &#&%          .(; (Z  D),gii-  _C6(   $3 8   d;A=A3 ) +}T !    j n  (    $(2 DA&$ ((6  &#*((*  /(I T D/( > PM"43   L 0      [     1- ''9    " &/ $ !\Z*-\8d23 IT  R         D /  (5    (P  .   K 3       ) %& /'i  6&  =  27  P (" "(  # Q(^   "+   ;(w      8787 % E  mp    1,)4@D*<  W # -1Z# 5)3 + w BV(   8/C]j   `"Fd. : 6  #     sP(F7@|{      5        AD  6 Q )  @ #,H% >6F7) sP(F7      5         6 Q )  ' #,H%B>6F7 $(1 #  Tf>     , +550  D  $'(  !    '(  '(  '0         ' f9BE?5 /  , +   5    5  0    >^ 0 ,2,, PUOP > M   > M XFWX>;    1          ,( x ILKL LEF       4(   xaej(    2#,3   [ X WJ=3   =,   "'# g  #%/ HL4,VP O+POP OPOPO&POPO    "%#    O%:4  V + & g      "  %  "  N  ,H B \K0.  ^\7 @  "$1D! :   42    &+DH$E  >  H    B _  )        ,6 j #        3     ,!(=6 j I      , &       ` & o      ,                           #,        )   8LK" @'FM]    $$ C !!_'$'"WC M  S     `M_`,?  %   I? ,5 `CD=  C $  -  0  ?.*' 7 "  5  ,NM,  \,,O  !.     =KG 6-m! O 8*7878,  >, 3                 /   +, _ U 3 *G:"'  3  /    J  ^  ,   $ 1 F$*  0:" ,,0b    0?   Q05<E2 ,0b  """!""["""""""""" "",M>     #        %6- ]" "  r""!         >  0  !  C  f  2  @?F<+9Nk  El+ =l/M8lk  g    ; d [ '(. O l$1ng27^7' , , , { <C=F3GIB >            # *,7 # PXOP,e D    /  X,[ *#$4[ o,  0$C#!?,  ?  ,:  #    :   - t  66 ,0    .   ^  "  "    #  : Lh( -  ) . . . 40  R~  ?\POjOjO(   '      { !  1  9]  t  w~ h X!" LA/> =>  @ O<WRY<Y^ynKL OXWLWX [dcXgh kts       ! m%)4\ ) ,!`  -M \kY + 4/  F  -  ! ?\           O2B `R_`_`_`m     =  # ',, BPO<   " P"`    Pd>=c=cl  IfcH"iL!   X?WXPd>=cdc efcdgh'  ! xGwxPd>=cdc  qfcp st + % Pd>=cdc {fcz}~)  ! fc  WP&d>=cdc  fc', 7 )&  QP&d>=cdc  fc38 5 %&  fc?D  fcKPPd>=cdc fcW\+  ! fcch fcotP%d>=cdc fc{3  #% KP#d>=cdc fc1  ## fc x"wxP    #$ %   !"     JM G* 'K n STSTSTST4B STSTSTSTZ2  (*43h*   J  '$N 2+,`  =J  =L & /p* & ( ;  (  4 B     ]nB >;* &   B ``_`n&STS TSTST 5&  x&wxn     <nFEF>N1 212121 21212 1 212121 21212" j       4 $<!$                     "   `5_`_`n  %  hRgh=>?, RM2 3 (? G87 :K1~}~}~} ~}~} ~} ~}~}~} ~}~}~(KLi%jKL'   `]                  )   $"'>JE > :            (  %   ' p7op%op%op)opopop(   Lp                4%(L p9op6opop!6565$  d_  ZW  ' -! x wxwxA& * QM}% &%&)!%& !%Y j - '(4~w   n 4    a  R OPIB7+,)   z {|{ C*$&O     #    *1    !(d+/h  )7)/&"/%  )! ! %>ij F&%&%&% & %&#TZ& % "z  hOPeh gvo$%+  Lw b  V)%8-   # T    `O_`_` _`_``"       I&P`]T    D3  `B_`+_`{ " ,) # 1) " , `_`/_`\   -:  * ,7p *+/" ,     7=2*A.7: p,opKop9op)op * +  *@ 0 (P'  ^  I         !6 1*&0.  4i l i liji l i lt s t*st   + 4  + 4    " ]:8G           * POPOP#i l i liji l i l    + 4  + 4   1           .921!2121" lg   d_   N JE   . )  'V+;2!v P o     %&9:-:   o)K `._`1_`_` _`2121. in qv    & . ' ).  21    (     L K*. %_@.G        &    a<<5:,>''@.G Ta  0 3}[ $##     "     "   "5",$ ['@ 0T      1 +  1$ C!4: . @?@?@!4\  04( -   6'4y    T% J   !4V zc b8 '  4 *'4q \E DaL% B   $$4h J32OF" 9   @]?@4j     Q!@ 43'    87878&784J   !7, $  4p C\   [8,T B   HZGHGH4'O   /Z5"3>  ^3 4 $ -./   ! .)&4'Y 8$  F!4s &6+, A   H M 4 C <;J ; >'A 3; &  %''  `_` _`48     S 4   / !# % B+/< ('(+'(+'('(4      "!       x}wx4 4    70ykO`                4;7 :1     x2wx*wx 4u   -3  % p G   @(?@?@?@4m    G5   |JP4 c         8(R ; #  &    M.4A-.-*=#  /   kA= w$Y4M-.-*dcJdcdcdc-.-.-.-.  ! % %   %; &     5   (9'!BMJ             P,OPOPOP2)J  ) ('('(2%`   xrwxwxwxwx 2  &  BZ O: ( '( '(2 /6    % h[gh gh2t  8 (N h`ghgh gh2  8  ((] i 2 8 2T p^op op2v : 3E#N pdop:op op2 : ; 9=C) h 2 8 ;H+Q q2 >H 2=;F @??@&?@?@6y  2   /64   `_`_`62F  6\ ) $ %  F ,>z   6 )   # ! .& POPOP OP OP6S   2" pop op op op6^   ;!& {6o(  & j (Q #o(6%  z6n(  & ZQ i (P #n( *      j          P_OP:OP*0 /        /2GfX%   *  >1 * <) +*   mn  *    cd   HTGH[GH$GH$GH-GH$GH$GH$GH$GH*     . CF -    [T SN  14 38 7& %  $(-> u  "     %/\5 h           * $!"#@           ""  G   % ;  N-  *)O' 6RW >a@ HTGHfGHEGH*    &   ((;R1 > I!O 7:   !         4?  PP*' I!O 7 7D $  pPop1op ! kP9  6:Y ,  /B'E!k   17 y < =$ BA2 U  %6&'&7 y 61  _      7   jF %1     _ an1Z 6 8       !  A /411Z 6 X9WXWXZWX4WX2WX     3 ' i/'<3B  3(UI"6!<3B ;{    $%) 1.m   0    A 8 hgh  d E    &      $  f31 ;J- .   $@ S!.,9 0/0/02    |+I            >&%& %   $ C< 3&'&' ( 0     e  (   /012 ( - 6;  0 J ;"1 +,!,Q.[!'e,    U    > A     * !  x+wx8%#  XWX!WX%WXWX .@ ""  && `>_` _`_`  % ! 5 ^ }  212121*21    &   *   - G K @*7 * , 2 121 2121" -p       *) t 0 %G"/   " - p ,y 2 121 2121      *   ) ` %*/    XWX 21    *w    1) b &&/ oG       ; 14G |++(  J  F    )-  HO     F!(   :  S1  ! >>{+ #J F  @))R   0   /  Bl mn 7:"  B  # 6  ('   !5y'R0  @)) R   0   /  B  "  @  # 4  ('   !5y%R0  @)) >S    /  X  8)   :;  # P     )T!6l S xzwx@1 21212 b (+,    +0/ <$  x   h:gh @ 3 ,b l 4w` A 3  ,  J @ 3 7  C %5"3"   (    +6*( O'       %rHG  'L'!    (   1J KGE(12121212121*M 1(2121212121*2   1(21 z {XUVUFOP     L  IJCB ?@=>= *#    * '  5B 5: D       '$#j;  .BIBh,!%%] " D(      +             &    A  +- 0< 0 hVgh gh4     F.#!, high gh! @d     0 (< ! @ pop6opb3, ! P8OPOP  +  + &  + pop6opc3- !1    XWX     J%%eK  4 0/0/08   # @/?@?@E   @s?@?@0?@2 3  0 ?67@  I<K  <A  D F0r                $N   }|}|K a &@>I  DABA  +  f $          )dS&   n D@ 0*/0/0+"   !  xwx    G     FL<EO XjWXw    L t                v L XQWX^      3 P  f 1"         ) ^  k#8   @?@$?@M     '/ 87878=    %   ` P%OP6OPOP  $#J- .- $     FC@ !8I9 :9:9: 9:9:9:9:g&       o,  /P6 I  g9R0  n G`    @J?@ ?@a: 0 %> Q @T?@ ?@kR : %H [j 36:  Y\ -  #>=$#$E.    (  /0. SfcRQR ! c= KA  '*T E h,gh9` H6GHGH ( fa   ( ,*    `<_`_`9_` _` _` _`+E FEFEFEFEF9F    WD+ 9E^P  w"&+&     &    e 9 M  ! &+ #BNM I JIJIJI JIJIJ I JIJIJI JIJIJ5"6 I JIJIJI JIJIJI JIJIJI JIJIJ I JIJIJI JIJIJ5"6 lk5!656  $+> $'$S> /&.$O: -.$K6 - .$O: +,$K6 '&             !SVX }  % ,<t%.DE$ E R E$Q (  r              "            " ! 0v(NMlklk I JIJIJI JIJIJ56  &         #   _ 23V  & &g((( /               vNMlk I JIJIJI JIJIJ56      12 &        .-  _ +&{3V  &g!( /              `]_`_`     ]c J  +%   6  OU &    @  CI ->=.=.\  9fc82i<%  h  EfcD&iHt  QfcPiT XGWX%->=.=.  mfclip%  !% !>_>=TS(     9fc46-;< , & 4 %. xlwxwxA>=TSr  YfcXYZ  $, :.A }h B#    $jh V qCUVUV%_ `_`_"`_`Z        '% "%p   xowxwxwx  4  ?QY1JI    `q_` _`  8 \  8  8M7878 789:9:P @  MP 8N7878 789:9:P @   MPk  @   @  @P?@?@ ?@m  @ " M  @   &    X_WXl   #  4  ("'( '( 0I c   %  8E7878 78 U 7   8F78 78 78 Z 8  ! L Z 0D/0/0 /0 F 6   C F x&wx wx 9 0  #   )   8M7878 78 M 7 (F M Q_ab 5>#L )    G*K)_FL @J?@(?@?@"  =     : opopop8 `_`_`3J  H#GHGH GHP`   # HGHGH8t  P OPOPOP\   J!;-  *  4   H9>Q  +3DQ5  [  @/?@?@?@Z    4& *G *.  Zo /41 4  pNopNopNopLopop op  @@@ @  ''% D D B M3>=4 =4  fcpi HWGHGH_`_`_` 5>=6=6   fc ^i   % &%  <   )fc(Bi,  HAGHGH5>=6=6 X  Afc@*iD  # % h wxwx% "% l< #    9 < #(' ]d  )   p]op opv 8 *N P!OPOP7     z (8 $%"K uN' 1   ))GN '  08 ,+&Q :    V  !'1 : ;  8    V  ' '4 yfX 5=5HQH5  S54T%EbFH Q 5>L~ *    G2L)qGL  =uvuvuv63H  ^ 2  4/, C @ ! 7 # #$   @  @ ;'a!   >   8      @  K <R[ >  =-*    &."  &= $(.'." P:)      !;!    '   $=,((,"  popop op ope    =*! *Q<+      "="   1  -h3+*3   D8 {3 1 8%  C7 h_2 0 7 >F $#   _`_`P /658@ _`_`P ?FEH@ t  8   8   8 v :  : ;  8 $#   e "7 j 9<8 a SV 6 _ V ux #  @P?@ ?@I . )A I =+cd"  ,) 0        .- d 4<X'  $  7j "x     3 ! m  ;<?@78 7 49231  }     [\_`WX W 6"=6?5  P6OP*OP OP OP  uvyzqr    a B3/+Y  pop0op7op        C/A;$Q  A5 >50 . 5  0"/0/0 .%  jij  `    878MN      Rg +9-  & @4 Yb/ - 4  XXWXWX WX mni  D & U i,>=+ji,+4  fcZU%  #  >>    , <t>  <'!4 8787878%78787878c  ] *I`L` !s]@5%'c  ] G .<   7 /3 %2 #? # 9  ) `  C  (T'(aF i (]'(jG  (0'(2  W9|  (%,% <  HG  / 1 M ghk<)  { |y#  4  71+JS T !  @?@?@"    "         U     J 'Dk8L  @?@         Zf6 PAOP-OPOP  ? 036#2;6 )6#  )6#  % D%    i7!   8n78     "G    ('(E% qnqr ~}!. g% haghtN     ,"  'H HsGHGH*          X ;*   K  |  212 1   x;wx2121  $   8B78212 1 s %;   2 1 21     .212121: T   A521212%12 1<3%  D * % -=B]  pTop?       F@ ?  ("'(            J     &   J     '       8'78  x(wx 3 0 h&gh  %  1     0   h$gh%  /  p$op  /  4 `_`     `"_` -  878  878  HGH # p:opHG% L Z  K <   0/  0 P <   0/"  0    7H    w     &P  ZS  3TWF 3<ETWF-1<  }   }  }  }   B@_t/                       <-$#  *+78        !Y+D? `2_`_`    0     B 1        E9B 1 T* {    (  (;(   :% { H5GHGH  ( - x%wxwxwxwxwx(wxwxwxwxwx  R&%$%$#&% $%&%$%&%  C$%   &             -     YY m      #J9i E{!-M D9   R         C"#& % ( '  Gmb 1       &#                  0 WL  5 * GB       &  dF$ A ") *     n  q                 7!" n !   'o!% 1"e  !  &   5 !  *    aI  @F?@ ?@?@       B (K'('(       I @Q?@?@      S @D?@?@    2 xF             0  &w         }             12    = 9>       }     EF      OP  }  " q   q         m  q &  }   u       }           q>&40T;%9 -,+ ) !u$                " #"%"!('*  -0 10/0 /&%& &%6 76565: 9:9> ?>=>=B ABEF   =  #  % 0/0/0   2    XFWX C$ +         (#             C  ) ,   3            [ $7< 0   3        }  &}   !& 6?%# ,           &        '86  XA   &' 1+$'  '('    qtR9(9*  78}"'7(9:}tc / qt$')",Y;?,; BA       '   " #"'!$#   0/0 /0    PVOPOPTOP:OP           )#<  HGH   `X_`$%& %E     %  E     POP? &':$%$%&%"&%/(         f>       "    p3op (  (  `7_` 8 8/7878   2 I&%& %>&%& #&%&%&%<&%  8          l\4d+ ! I >       <      x^wxT= >  +S f  1   2   `I_`Zh!   %2 XRWXBB0 !+B ('(  !     !   !   @C?@22  2 ('(L[  :    @%?@ ?@J 2%     D 7    XWX; F5     /C" F5ttX    uu$#  C2__   0  `Y )*% ,' . V! K 1      ' ,   , \ X1WX5` 1L ,85 X2WX6z Kf -96 0/04/0/0W       5 ^ W   `_`  {   $   1 F"XBt#{ `_`  ~   ! (G <1 F"ZBw#~  D )   ,  $ j  3                   S       'TQRQR OROPOP MPMNMN KNKLKL ILI JI.|   |y $'&3         S       ' d  !         ! $     858 - = *$L,!               | XWXWX       &! &!   ~ Z 79"   E  . 2.  #9              &     !*  o*]J9  & ('(                                                6  *!                                               9                ! $# &% (' *) ,+ .- 0/ 21 43 65 87 :9 <; >=@? BA DC FE HG JI LK NM PO RQ TS VU XW ZY \[ ^] `_badcfehgjilknmporqtsvuxwzy|{ ~}               6 ' (           POPOPOP h k= %  S T$       !# '6 Kdc d c dc        ,     *) L9                + x   / WT gZ ,  '  6     K     4         g '!#   1kt XUWXWX  '' ) p4opop op  RQRWXW XWX W   _ bah     sd         @.?@?@/ B  ('/  * j  3                 S   r 'nklkl ilijij gjghgh ehefef cfcdcd ada ba.    $'&3              S       ' p  !            . , * ( % NKN C ' $X,!                # `_`_`.  #           \D+&.  #  KG  .  2. G !H           mjg`+4un (eRH     E  .  pNR  +(@   w mM0uVQpNR S  % .:0 8 2 c&$&$ * n m  Xm<; 21"!`4242 c&    $  &$  @?@ &- - $$$$$$$$$$$$$$$$              4  4   50 - ,  $. ' 4\[\[\[ |  {~}|   x '(  -.    12   .,  O G J15`U4%= (5(*( 4 =   6  12 9-  L%%:=% MkA 4  4  <7     0-<!>WXM  6   9<k M$L%/  !:=-kA   8784#('( `  42 4X     < H 1"4o  E5: 4 =  5   9  F%%4<% McB  [8p "         '   "   '  ,9Be]g9 :    .   @8?@?@ 21 21  5   <M 21G2121211    #          e*$*! G1 < p7op ,  ,    *   @9   o1212 1 2 1 2 12 121]o1(             8   "= !" \:"9      ]( 1 !  !  `T_` _`! $S $   F&&U $    .    #,%[ H,GHGH GHGH)GHGHGH    3 ,       w PA  2121$   /      2121   y 1J%IJ0I O  >=> C}-4]%$#,>]< #&   m -m} m m]2m^  Q" C 1#0mH2mn-: INRJ-3"%G" ")2 %,MA  $        /       "!$ %$#$ #$  '*%)*0), -,+,+0/0  xwxwx      '(. 9 6Ym$bK#D z 5$1# k    H ( | "Zi%& 1 . 1 fC  "Y H L { ~  m j  E   U 6 " ^   . @TLek#D z 51 k        - (  &c  Y Fd cq          @=,8  6 +   ,       (.   o\+5  5G  Y F q   J&&*d c# 3      7 )d* # 3  HCGH.GH GH&GHdcdc " ;     .$ , " ;    h""!# !##f xTwx&wx&wx&wx$dcdc8         A 'r$8    jWl1 .!" 5.-.-#           "V       "    " *       .-.-.-.-.-.-.-.-      4o                               V[                      d;UO?$: 6  &  2 c '.IF.     5  #           V   " !  $%&%( '* ) & %,-.-0  34*12 52 7 : 9 < ; .->=>=@?@?BABADCDCF EH G J I  @$?@0?@ "!" !"!"    4& G   8E78787878dcdc dcdc!                ,S !     XWX,WXWXWX d c      5-    X'WXWXWXWXWX$dcdc!                /?$!       * ! *$#$#X $#     +       HJL-#$"B *X  <)4 U  7            %     $  > _!( ]\4 U  7              89     sB%49L%     G;~n;,;jWCd cB$# $# $#$#A$2# $2#ZYZY %-x%-/ \ Y& w.&     *.&q *G-    - +S.&qT- +q.&qr--  ,(D-.&C-.   U Z4   > >))&U-4** - 4N*-i-!C #     A  2 2=  Iqdcdc dcdc&"p            &dcdc""A    ?   dcP  <; .!  $  %<% dyx e:T   [#;       E >&   '#  S       P     &#         A      Au 3$  Kdc h     f0 @ YL(?,Al@% z 4 [8  dM#1j =6 %> 7 )X 6O(/$P (T  &   p            " !&$#$#&'('*+,+A. -0 /2 1( +4 3?6 58 7: 9<;P> = hZgi .   9 99<;<3? 3! -9 ; 6  ge CC(."/   R                                                              5      .-.- ;                                     ?                  B     &                                 &  7"     L  U @0&.- 'D b#(K')    m (! $=! H(& ! ;               " ! $ # & % ( ' * ) , + . - 0 / 2 14 3?6 5 8$787878         #5~   (  "!x 8 <D "          in 34-.34-.34-.34-.56/078129:34       9      P[^WXA >    - !  &!Y*&n+                     i "l k  " A 11V,  _T w O$,$GvKLrqrLKLKL o p o p r qKqrq KLopr qrqrq KL(opr qrqrqKL K LI$#o p/rqKL K L#('o p N 9:3 $ ' ( - #@HA6   =X_`YD 2 Uryzs\     ,% t }~1 & s+ !O !(&aEB  *  :       (    " !I$#& %/  ( '#*), +  _r[bOe#v' 'WrqJ ItsJ ItsJ ItsJ op >op o p*  @ op Aop o pz$#    #$ R        +"2 _   }~      v      > {   F    :  . !mB  1 ! % 4T+=& & @ D 9  O'     >  *  @   A"! $ #z&%( ' (' * )#& @`I| +Q 2   $Tg hSD3 4 @??@?@$RL   A$ 4f 12=T S*@?&T S12HB B?  POPODC b WDCDA   '('('"!: 5"!"   8Ee $ :' = *&   H Vf}     - Y  -# XBWXWXf)N KL ?   2  ? &)    P!OPOP|.u v ^     &.   iW |#EFEFEDEFC1 v CD-  Ct     @0"8# -  | W   t"0"  **   b0;|QR/EF*EFu v u v)QRQRQRuv u v u v&u vJ      q ^ ] R  78 7 4 3 . Ly v X 1 7 E )& j  /* )     & J `!_`_`_`_`_`_`_`?_`_`_`_`(       ) #$r ; 5\s#(   :9f-/    !8    + 10/6 +  !  $% $#!  3R5/ 2! W7"     f     -/     w(&%J $ 4.*J P OPOP  $( @*$(h g    3        (U212&  #     AH&   IHO&*OPO#  < n !./8 M  '(+~h            A*x,2%](+  xBwx!wxwx( ~ }r   " %  r Fe%$ (~ }i}:iji}f   [S&% ^'L :  f !!$( :1 <   "3"b  4 P  > B, NO^=(   $r  &u &-F?VS-&      E &-F?VS-&     >4+ 2   4       $     r&  u 4      q   '       n(hghg42 1n! "?R        <)  $ & 9\\ jsr  /0  ~          7   j Q9>))!#E-B$'  C4n ?    R           u p-.TX (   !   .." -  */ !'  ! ( !   " !  P$OP(@  &% X%WX(A  )& h+gh(G  -, 5  r($          R   )    HG           4     )       :  NC -DC          /  18 "G  2^  B0(  6:.. ' 5/; $0/"$R) d((EhghghghghghgC hghg + !    +  , &   ) Z Y'CE;CEC         (f 5 #  $?&:-(T! "      1 60     2  (/)3!$T "1"_ /7(~}~}g hG   <+   "%E(g #  NM NGHKL  -GHGH klu@9 8  1+#(ei}~}~}~}+~}~}~}R~} B  m   >  < ]         6  "6>.+  T           9   m(,:9   QR   a D"       k:*.B* * ,;3D p9opop6op( <O &9;( h xwx7(X  4 6(Xhghg5hghgh g7      . L? #  61!X5 7 (hghghghg|{zyzyz yzy"hghghghg   (81%& )0Z#  6z2!ts&  Ns>L3s#   +L=  *   !       \[ S\a<.Ns\YWWa0 -:s3;  <:    6    1F      <.Ns  <m  <]f    _\ 9BDI]y:#    " :? }+ *      #    " d2  6 '?!:C6, 5 ) \+!,# ! $`6 7/-2E 6);0>: H ' +:%  / !TS T 1 !V 6 $ AD EH3 Kz eC&    #  x  S      \.    $# (' d   J )*),+,+,+, +.-.-.-0\/2-1 0% & t U&36\.36%3 %l &7P ( [ T  3?+ R !,b ababa % &% &+b ababaX,WXqXWrqtststs'b ababa % &4:=     2i  ] PO J    Ri   @_"(87 9           x" 0q! :    sD)OK  .NQ =    +  *         4  ,-    -  0/0/0,    "   -v]"",    dcdc   dcdc               O 7<.(P{        "#$# $#&'('(',          ?00',go tS go tS go tSgo tS ``` `,@       # ('('('('('(, To TS To TS To TS To TSM `c `c `c ` ""     zI        M,+   ('('(,dcdc        hghgh ghgh,_    ,$U  ,%    %   % 3` 4   3,V r% &"nm% & 8-TS  "             C           , BK /V !, " D 5 D,Q 3"% 8 #?(,656 5b a-65T  2121<CC*) &%&%07C)            G)*   ")*1 .56=  r r K r;'K'jM (#(; )5~pv  [       P:OPOP,M B _Z  e~,mb aPb ab apopob a3pojcdR  w            +       +          , d    +  >,E +   /     C    nmpo   +*nmpo *+nmpo nmpo nmpo=   nmpoA    #nmpo1 0#  #        %% %% $   , L 9 1*. 0333/& 120$"W]1D1#&(*"-#0 P QH!   $   1  %" " !"!  %&%)j*) -.- !"121       ()*565 0129:9 678=c>= <=>AdBA BCDERFE,> $,pop  Cop      3 !'  %'  3      3  '%&,popo pos        %%!3&&5H,      pop ,pop  Cop      3 $'  #%'  3       3    ,p   Copo/21 &,   3' &"7 ' v   3      3  ,zb aba,     ?(-    5,wb aba'% &%&            3),A/%:5    R,5b aba   * 2-5  |,,p opopop T ))7,  @,i    #E( @?@,@? e l  )> 8 ,"  `_`_` ,pop  Co% &pop      3  #'  "$',!  3     N,jo  7        E;4]#;7o 4,;b a    0!;   <,PTo TS po TS po TS po TS% &%&% &%&0% &%&0% &%&% &%&$#   ``,)` ` $        .#&$  ?P         0 0  " !"!   ,       ,H#     @  -,*       % & % &dcdcdcdc% &  % &dcdc%.-.-bb abaJb a ba% & % &7          ?N& &   <<CB; ,)  C         WZ  WZ            %     Jle &     P& >6'' F 1`&!7g#*                 % b$ #$#J& % $#( ' * )7 O      @     ,]% &0.-I.-.-Yb a?b abaJb a ba'   %       WZ      WZ    WZ         2        ?&5        9CO(#L!79] 0I Y ? J  ' pFop op op op,b aba % & ba            i '4      ,5 M        BA.!85 M O,P  HC% &  ,+,+,+,+    (# 8         4)8!(;1+ P  HC  d@   ,% &b aba%& ba?1b aba*b abaJb a ba ba(    ' -      2    *\      ,*)*)  "           A Q+[%&IJ   N    % DC     <F+ MN! [(+Z H$  4 E.RQX:*(0);&,$   %Q@!78'-E#&(/   ?1   *   J   (  p&op opop,"   y, /% &  #$ #$-"        " !  """"   " ".   677#!^(  "]R /      -#  o,| )    .(Y  ( '( p?op- pGop--- (!'(*) p? IW 'a %1TQ@Nza>u %+$+'")M) [F5'        %             %                  &. :      %      (&)  $ '  ,+  u"  0#/0 GFG$   989 8%78 +*+$     Y  ZYnmvs ;K#  d  oHG@ VU IR    (J J $   g <q%V & )E  & :!            ) <  "! $#$&%&%1( '    =  ) Y       d RQfeli M    \     k@?8    NM   @?   21  AJ $#   BH   % lkj] X$+)#%*C ,H"*    !        " !"! $%(+.147 :=@AD EHIJIJLKLK5N!MNM  &'*):9 *)6523 >?:; ./*)67 "#*+  B              P2OP      P5OP#  ,#  hLgh:     8$:   '  *8     - 1>         $  E P     5 8   P     ] " L!+                         @P [ 2 m     (?. ' $#"%&)&  W* (+   2M[ 2 m n v>  "  @5 W6565  &=JI> =W 5n          n      G  n    (,+ :                  + 8!78   XOPe *'   XGWXJWX         ,*(  %   #$         <   *     =  U*    '    ;?,<,) _  " +$ibg  8ef.ba _5p{ !0         ' !$  !)*  +,)    *          ('('(,  R  & -  ,  fn ( t _p ) ' !  {   :9! `+_`    z }rsp     P&OP    2  dgd -           !)  > xuv   y   LK   LM  :"$Z %""        !)   &   !%H l  ,# 7  ,   hghgh    4 <9 DR &  !%     HBR n    4 3:9 4 $ u?^ `      $B , (_'( ?_ l     &F 0 (P'('( u     K0  N        K0   G      t  C  D        > G       C D       > HGH ?  "   =P  0   @y?@ ? s     :L    ,  *       (   @X?@  Q OL(   Q @?@?@     8j78w 0   =  < "%##(# 3N %dah e!%#!0 /8 3 &+  )$+   :**q  lcC"FGH&     &=:**q   ,+W  Dj%   1 %$,)W                '#               >1t!'9$2 z2         3 m   !        s -? < ' m 3 ^   !      s ? - ' ^ XHWX  )  4  ; 6 po __ (& 8 (   . #   @#?@?@0      6 0         9 3&$   )V    '.?    )&A 0,/0/0 /0/0&     # W &   x!wxwx98    9A H3GH   -        %2 NG^[ -   % X8WX     !T NG^[-  ! 0/0/0f  0/00"77       D  $  @>?@?@ O*   : P:OP GN       '    |    < HG&#   1 1  M   ghk<- . 8Y78O78      JC  8U78   P H4GHGHGH? ?01" 36  ){ HGH1     0* i    V IJ GHEF?60" ( 8@78 M    )      H@GH    K ~+-   $7D (       W  G   BCM `8_`- q 6;   878) G   PDOPOP U*   > P    0*/0 . ('(    1    > hgh      HM ~l JI LK NMTSVUXW Z      W! W t[] _        |  HHGHU  $ PxOPZ  f  m   P!OPOP/  =7/   ..33t s4t st s0 2   5 F C  . 3: / 4   XlWX3WXdG    587@    "   dG POPOPOP        ~H  P!OPOPOPOPo     *"M -$ Z m Z m Z m , /```4 %-#!J/X$           z "mt s+t s          8)   ?P@r m +    )  :(Z m Z m Z m    ```) !  '0 &%#aa=60]2d        :D6 ( <;<9  FEhgnstsnm== +8D *$ 6       'N~}! &D  ('(Zr &&&&&&&&&&&&&             ('(Z ''''''''''''            POPOPOPZ^    7 Z   @!?@?@ZC  "   HGHZ@?     8A78ZT G/  Z ZZD '  ;ZH +:Z S Zi K>$ W Zm ! O>( XMWXZ @?V        1 0   * V @\?@Z? .    @    ?  Z  Z# # #Z`           Z   Z   IW  "$5 @?@?@?@J[   +                34'(     C     "\I J[ 3 4  1&! J[#] I4   L  ' '     ?62;8! #    R  I\I J[, +  &  5'*J[J[\[ J[\[  J[\[ J[y J[ +4^Y 4R 4 + :2) 4  nu:\Y  .):AB `Y `c%C    0 5  # 5 6$  g r 0 5DE/        K !B e"!"!, +3 4 ~    /      6% zz zy    1i,&+  )  &m   ) #     #  i8?)&m XxWX zyz yz C   wX   C)   ( 0/0/0    ) 0   #h A  S          . +  \ 8 %.nS B'i1 KQr q,r q'r qZ k Z k Z kbRQRQRQRQRQRQRQr qRQRQ!r q    )*D          0 1 3` ` ` :9>  23 +FC%%&$#C"$'5=-^ K<    , '          W" !  !$ #  POPOPOP-OPOP9ARQRQRQRQRQRQRQRQ    Mc/ { 7    O$r q    +  /-  `Y_`,   0    &1 O^I^I  >" I    O  878782  qzy&  L6 &   0*/0/0/0/0/0 @ ) !  :'L @zy 1  "j rr q-     #$     h?I$. )=   PQ (3<?<7<;"SRQ   RILKLKJIJZc&    "7>"   }~       % I P)dQ `Q> dO V/3'".*( #'$0e> k  $$       yOORQIt XOOOOOOOXOOOiO5PB,|abaxab     Z m 0 1 nPP*                       %                            @?       '              #                                         !&& &  x:< ) ( 01  / & & & & & & & / & & & ? &   ( O m 9 QW?2(]  &  < &57$#$hc6  8I00 0 0 0 0 0 0 0#&0 0 0 0261!0 ? B2,3I$1Z,Y5X      J  J (  X    K    "  ! & % (  ' ,R+*J%$J. -*21 4 3436 5658 7): 9< ;<;> =>=@ ?@?B ABCF.EFEH GHGJ IJIL KLKN MNMPOPOP OR QRQT STSV UVU X WXWZ YZ0YZ YZY X0WX WX0UV UV0ST ST0QR QR0MN MN0KL KL0IJ IJ0GH GHG B0AB AB0?@ ?@0=> =>0;< ;<J98J76056 56034 34- \[\ [\[\.[\[\[\[J  - 8/78O78| g     ,  #   J XMWXWXWX WX|           *  &< PAOPOP | .       "  # %  .  `f_`O_`O_`|          :' &  o2#% 2 JJ H4GHGH|_JI`"  !0  (#"|I`    H0GHGHGHGH`|    6 1        7 "U4 `?_`_`|l 4 + ( ' @.?@?@|B    )  _ +|  st    # 5    @ I $             = H 1 Q YMO5e HI  L 6N .   J |*    U |_JI`O!0    U$ $O  hAghgh|_JI`/!0  5#/  ('('('(|    ;-| h+a    %     +    6:,;2 O   +0  7R!|   VGHG Z[B7 NO8Qhcd_ FEN    ,' $  #837&HG@C4/&        - ) +1j "3 3  0 0    `8|aba b_`_JI` ab   !0      `          ;9% m O9ZW(': %          g% .   .  |ab ;N  %|'st"_`_JI` abab. +st       !0      D "&4?*'" . +  pLopopopop opOop|(      ) /_  ;#+#(  `J w8O|!"!" X!"6_`_JI`           !0          S t ) (%7 L4 0  R      $  7.  0  X>WXWX'WXnWX WX WXWX|$_JIv* )  !03  !     21       R [(71            *   `V_`_` _` _`|aba bab[     Y/( [   |ab    |_JI`!0 1 # ?+| "   |   |abab_`_JI`ab_`_JI`1abab abab 5 _`I`I`n   &!0 !0   & " 0]^ed 7 $ 5   &'+  ->  &&T`Y8'" .    1     5 n H|U     8#78|0   G|_JI`0!0 &  ) %0 |ab g  }1 h3ghgh|@01      9'@   02/0/0|_JI`!0  %$  PGOPOPOPOP OP|_JI` ab     !0         #"b     x   0C)%   0/0/0+/0/0-jZ ij jiijjZ ij jiijjZ  jicd    `ef ef`ef ef`   %*( .;j9-        ]0   N] P OP OP:~  !  W|7     =>  r  o  ! Q   ^  )m $ WZY65 0 =`_65 0 (u  '|{65 0  oj gwp[ j D65 0 =65 0 b  : 7> ; &65 0  +,D-U u X4r          ro  !"  Q& #( ' * )^.-.   /m,   ;       6- 0  "@    0 5<4uL8&   `@_`R_` )<;  # 5/$! h[gh ghx  $ (C; C >   ' W   L   (   650  _    \  !   ! 7           65 0  5    tf ()  a% !      7   - "  =>  > >    ('('( 3 4'('('('('x w 2  (             -"  "             F'/&O" * v"           !"!$ #& %2( '* ) "   ('(3 4'( 3 4'(6'('('( '( '( '( 70+ (1  &G3     /") R.,)!    3         4%! * ('(3 43 49'('  (' ('('  (3 4'( 3 4'('(' (' (' ('(' 0  C650    ( 9   N 65 0    ~xw      {(E 2o%+(U Tu!   (         "  #$  #"#$!* ),+. -0/2 143$# pop ('(3 43 4C'(     3 !'  $'  3  pop ('(3 43 4C'('   3|)' ($'  3 GB;   30A  A<5   3*;  ;6/   3$5  ]p C5 $( 3 4*'( 3 43 4,'( 3 43 4)'( 3 43 4"' ( ' ('(' (#   !   #   #         !$##  !   #   #     " #$# $   ('(3 43 4C'(      3  '  %'   3      3  uQ  . %]E0!(K>uQ xwxwxwxwx:wxwxrqrqf      ?/f V* E  !  => > xwxwxw xwxwxw   65 0 =65 0                '      X0  $* E           0')'  &   V7   )(  3     5""X Dq c- >Q  "  F&( '('('(       -/&   '('(3 4'( 3 4'(7'('(     3  ), :),)'   3 ddd(dddd dddddddddd6dd3ddddddAddddgdddd dd dd ddddddI   w xw xDn'w x(*I wxc,,  wx  wx   7  g ,%  7Z& #   "     8    }zq??=  T OH  D% &"&  g)~   ,  -"#     ij ST S   i RQ    )"     d A615)   Ujq 1                |; :W ( M[   j .H = D    =L/+1]e  1'D*),+.*5.?1K46L-       D'  *I"# &'**+,. - 0 /  21 43 6 5 8 77: 9< ;g>= @ ?,>=>%=>A$ #7 =$57-Ew x 0#-.-.; ] -.12     LU   r qcfk W ~             a#   @   * : #)Z# eW"+   )B  0#    ;    ]     12 %     i       "  v u~V-. A B"-.-.Q-.-.-.-.-. A BZ{ |{|>7{ N.,- .-.n2- .   "!    % F "  4 ,!   "  -       ,!   !  $            M4h ; *J>$:NQ?* ! 3  ~V  "  Q  Z >7    ,  "#2  X$WX$WXV    6vuvuvu 1$#$ #$#$#$ #$#mnmnL     !)*    !  2          CLN &R$ Xw![ 1      L x- ,!"+$(!"!   % .,;$!'    ('('(-.n(n0 -         6LP$ (  0   g9d%"G *&S vuvu cn2  02$ #       VS  @)        RABO   !ZqXGZO87        %  Y=   a        (  3$ 1=e I;p" ^ 1>1 B1 /5%S+ ,P' 6, 31"# " !&S    c  2 0  2                  .-8 -6X:7& 4 7vuvu   3vuvuvu}   D            ^]lkr  *i    n     !    nilk| ?9  l,)ET& 4 7         ) z          q6  )  0        & XO * 9M)   0 x2wx&wxwxwxwxG            $R(/G  HXGHGHGHq       & i ,  6- @?@?@?    $ 0 :7 QLXE Dgh\  /0 /0N /0 /0              $2ED      $'  -#   #  aN[# #/< N % *   8 \*.0;' '  +"'!$ +'% D\   N     popop    D'    !   !    ,;.@o ?  /  % !     4   bB9:%     B,69B% `V_`_`)C     *   , @  AC    < 9^ T[' (T\[\[%>' ( ' (`        qrq HG   # eXOPB  ] ` S V '  !R$/)V$hFg "[ T   %  >  0_ 0V/0/0/0/0/0/00/0/0/01\[\[ GH' (' ( ' ( ' ( ' ( ' (GH ' (#' (G     8                $1:1         #   l;%<3G1z' (L' (2' ((zy' (GHGH# i/pGH[ \z yzy' (zyzy56+ , @' (' (8      F M4o =>  $ XOP Kw;$N*  )M) -r#-$- 4-       !      "  !   (         '( "!(E    KKR6  3   8{ TO8 ^y+&2<d% b 2!< z L   2 ( # i/p  !$ #"!('*)+,*-@0 /2 18 0>/0/0/0/00/0/0/0/0_/0/0 /0\[\[zy' ( ' ( ' (' (zyzyGHGH' (' (GHV' (                    e+       V  *v %' (    _' (J3434 343463y' (' (                c$"      O   += ^#)$ 1*8dY2%  _ J       6    3y    1O0  (  ($. ' (   #' ( ' ('' (' ( ' ( (       /  /  "66  6      1   '   /  /*p, C Y!(3E=7L  0    $ .                #   '      >8%?,| 30C y' (zyy' (zy'( !            )   )           Q  6 * &- 8'&<0  !C       ]8! s' (343434           XOP           n G"PE3  0 !     JU'(        !4    :     ;+/6 :u*)'"+!    ! U q34Q'     'B! " R= ' *{M qQ' D)  ?' (GHGH' ( ' (' (GH ?$[\[\%K=                  $      A )  )o0  )  /= 9 ?        ? $%K=  H,GHhFEFEF E6      ( hFEF3 43 4CE/F 8   3) %' 8$%'   3/  hL  ('('( h>9=>5=>Z #ba\C%ba\CB5J hF 3 4EF 3 4EFEFEF EF3 4EF 3 4EFEF EF E F3 4EF 3 4EFEF EF EF3 4EFEF 3 4EFEFEF EF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF EF3 4EFEF 3 4EFEFEF EF EF3 4EF 3 4EFE.F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E(F3 4EF 3 4EFEF EF E F EF3 4EF 3 4EFEF EF EF3 4EF 3 4EFEF EF EFEFE FEF 3 4EFEFEFEFEFEF /   1T AG    I  < /  Y   [ * !g uj  iuj  y ;  ;; { ;  ;;  1  11  1  11  '  ''  '  ''  !  !  6     6     P      W n     u                  _d  _kl e   AF  AMN G "  '",  '3"4 - '        ' H7  H7  7 \1%  $P1  aVI  VPOPOP  9 ) r$r$r$r$ r $ r $r ${ _J,                          ! "  ! ! " !( '*  +,  +*+, +2  34  3234 3:  ;<  ;:;< ;B  CD  CBCD CJ  KL  KJKL KR  ST  SRST SZ  [\  [Z[\ [b ad  edcf  ededcf el kn  op  op  u.x  yz  yxyz y (      (      (      (      (      (      (                                        hFEF3 4EFEF 3 4EFEFEFEF EF EF E F EF  `[z{  ZTSrsT        +'[*         hFEF3 43 4CEF      3x hFEF3 43 4CEF  y   3n  hgh hFEFEF3 4EF 3 4EFEFEF   vo ni  h{bay -%,v     pop hFEF3 43 4CEF  sng   3^o $'  #$'  3 hF EF E     X#WXhF E     $    OHA    38I  h2ghh&F E   -&  `_`  ?81    3(9 %'. HGHhF E   hgh hFEFEF3 4EF 3 4EFEFEF     %  # ,%+v    hF E       3     h FEFEFEFEF3 4EFEF 3 4EFEFEFEF   "  )*%& M+&&           3!    */6   3A0     MT UZ  [HabJ   hF E      hFEF3 43 4CEF  fkt    3}l          w        Y d          3     3       3     3  0 )    3  R EhFEF3 4EF 3 4EFEFEFEF  ?   NNG !o       hFEF3 43 4CEF     3 %'  $$'  3  @?@h  H.GH GHhI   #&%.-( %$#  _>S_SebVt%h0>=>!=>= >%=>=> ='>=> =6>=> =6>!=> =]>"= > = > =>= > => = > =>=> =>= >=> => => =>=>=>$=>=x>=>=>=>='>=>=> => =H>= >=> =->= > =>/=>=O> => =F>= >=>=>=>='>=> =U>=>=>=>='>=>=> =$   65 0      "65 0 &     65 0    +rqfe856    C Don WIJ K X#O |w i0I st { F  ~  b;dxIA.G&s 65 0  65 0  9 65 0 %     ba \<    9  65 0  >m 65 0a\    <    4`  W%R Pj ,  U5  F\ HIX $8!9L@ KD !  d!/9 0       '  5 6   " !]&  ' * ) , +./ 2 14 3 6 5:7< ;>? BCF EH GJ INKPQV STSxZ WXWXWXW'XW^ [\  aH\[ fef  c-dch in klkOp or sFlk x uvuvuvu'vuz yU~ {|{|{|{'|{  $[  h   h  " $ $ $ $ $ $ $ $ $ $ $                 !  %  '  )  -  /  1  3  5   7      7  "  ,%%(+.14:>@@@@@@@@@@@                 " $ $ $ $ $ $ $    $"!"!" !"!$$#$#$ #$#$&%&%& %&%$('('( '(' hF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEF EF 3 4EF 3 4EFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEF EF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF3 4EF 3 4EFEFEF EF 3 4EF 3 4EFEF EF 3 4EF 3 4EFEFEFE FEF 3 4EFEFEFEFEFEF                                                                                                                          ) +G,                         "  #$  #"#$#* ),  -.  -,-. -4  56  5456 5<  =>  =<=>=D CF  GH  GFGHGN MP  QR  QPQRQX WZ  Y\  [ZY\ [b ad  ef  edefel kn  op  onopov ux  yz  yxyzy                                     hFEF3 4EFEF 3 4EFEFEFEF EF3 4EF 3 4EFEFEF3 43 47E FEF                  &   )&:#2(t                 &      3    3    3      3  X{WX hF3 43 48EF     ( "  !m   (      3     (  pop hF EF3 4EF 3 4EFEFEFEF         ##"q          3     (           3        3      3  kh0>=>!=>= >#=>=>=>!=>=> =6>!=> =:>=> = > => =/>!=>"=>=> =>=>= >=>=!>$=>=Y>=> =G>     65 0          65 0           65 0    ~z i   +HAl65 0 /65 0 BIZ  -06- 0  cX   8    z    Q  \- G    970 `,  #VId$K0          6   9"#& % ( '* )/.  +2 /6543: 7<= @ADE!J GHGY8+L MG   q hF3 4"EFEFE F         %6#           :hF3 4EF 3 4EFEFEFEF3 4EF 3 4EFEFEFEF3 4EF 3 4EFEFEF 3 4EF 3 4EFEFEF3 4EF 3 4EFEFEFEFEF3 43 4>EF 3 43 48EF9                                                         -    (  9&#0#0##%#6 # =%3                          (   '&  '(  '.'('.-210  -54   (56          3         3             3   F h)>=> =*>!=> =/> => =G>$=>=>$=>=6>   65 0    07      *# &)%`!:eF"78)  *    /  G  6h!   h         XWXhF 3 43 48EF 3 43 46EF    &   &  "!    &    &    8M787878h>=>=&>     f  &        h F EF EF E   1     pop hF EF3 4EF 3 4EFEFEFEF             &#%q       h        3         3   xwxxwxwxwxwx6h(>=>0=>=>=>,=>= >=>=> =>= >=> =>=>=>/=>=>5  ba \ba \ 65 0 ba \ $+,f\3(                             :hF3 4EF 3 4EFEFEF 3 4EF 3 4EFEFEF3 4EF 3 4EFEFEF 3 4EF 3 4EFEFEF3 4EF 3 4EFEFEFEFEF3 4EF 3 4EFEFEFEFEF3 4EF 3 4EFEFEFEF9                      9&##%##"#0#0#I%?                          $ "  #$  #*#$#*).-,  -.  -4-.-43876  78  7>787>=8              3                  ^SS^h,>=> = > =>!=> => => = > =0> =Q>=>=>=>=(>= >=>=>=>=(>     65 0     6V3  =\OIp  9) 65 0/* 65 0,  HUIA&9"=",            / Q (  ( `_`,h          %h) H!GHGHGHGHdGHh    $  ]7#a^        hF 3 4EF 3 4EFEFE5FEF             !    GhT   @/%/ Whh  -!&E  h+ h,     'h4    XZWXWXh(>=> =$     ME (  $ ^S h> => => =O>!=> = >= >=> =%> =H>     8^Y65 0       @) #4  1M ,  U.M    O       $ Hh@       h0        hF EF3 4EF 3 4EFEFEFEF       !o           3  H[GHGHh>=>=>=>    D#V             (h?           3  @/?@h>=>=>=      xwxRh                  -3gO 2\1h           R     .   A   /KK - A1WSFg        pop hF EF3 4EF 3 4EFEFEFEF      &#%t            3  @C?@?@?@ h>=>=> = >=>= >  65 0  W       H9GHhF   !  0hL    "  H(GH GHGHhk           G#V     + '   )5 Q E     *     7 &K} E g)H3  #) *P''--    _        /% 3                             ) E  E  rU.,O"  $H$**      # P'  ' 4 -#- lk#lU1 Z) *) *-             %                       !T   g (,.  KDvg  ! 8= G   ') U1 U    -  #"S  #   $4' 0H/0/0A) *    !  -4&A  5rIJIJIJIJIJIJ)\ ) *IJIJIJIJ                 & (?N h$ )  \         ;%C[#]q]^ [ IJIJIJIQRJh) *nIJ '     %    P  "     481      ):  ZP ] :} z;wq [         h n   J  }     !    - %/=IJ  } #$"o$:?T KLlY>2) *y w&5)*  xw2) *'K)LK                    !!s        ) 9  !%=           G  3."hq Y% I *N  9B4?5C=C/Y   8 &)0 2 J T lY>    2 y &5    2 ')'('(           . %7'() '( ) *0          &  XO   i<  2  + !3!"% ,   9-K SO)* ) * KLKL KL                0    O#  #Y/ Q  iXK+1.c  3!*SO          0J/0 /0/0/0/0/0/0/0/0/0Wyzyz>    ;QW>e;ee7ee eeYeeee:eeeeee)eemeeeeKeeeeeeeeeeeeeeee eepee9   "    (9: z9 :   '(,.           q A    1  .   97:9:9:i l          0) :   ! ' +P    6)   %  "   d[\[\[\[- >    /3     '' "  I ! !   W3  _> Y . 7P ?!!<?qE9* " $ = # + :,($5 s :i"*9   "    (      "!$#&*'*)*).,+,+. -.-.-.-q0 /A2 14 36 58 71: 9 <.;<;<;< ;> =   .-.-0/@ - B /   ) 0+/0= ' )  qH1? tMN %9:9: 9: %&%&%&5  [ `%&%&2#   )"  J=      +%   % IL  2(   E  #     l# ij  XOPe9  L L _ <=;!3 W "; 7 f* O? t %       5  [ `2#      `9_`_`_`_`_`/        +& 6*3k-                 ' 5 H*  #(k- ~R1%I, H     A    f    +*  &   engha^          "        & ]    H         g  +cy%$?:.* F : $j0  , H     A    f 8*787878787878.7878jijijiji jiji)jijijijijijijijijiji   !()018                                   )           !%&%& %&%&636-N "  # &%           ]$"         !  1                {+B# J'3F6*8dYB.71 )"$ 9    6            3           6 - N Xp}LO;<;)<s ) <;     0)  34      "         # !  %)3 S 1_p ,!$>  G   " 7)   ) < l%&%&%&5          -#     - " " iD _ *W8U) 1 l5R  X ^%&  *   /   )       7R ^    * n  9:9:  ?      " 2       4    !uN 0`&    ?   A$?,| 9r\ -  t !        !      )       )       Q# 7   t)- +3.&<  '  ]\  -   t M!            XOPeZ=)S!    ` 2 8 \OST= $f   %      ' f_> O= $\          \STK L STu  KL      ? 8  (i   4)  u   A\' # 6  ' \,0    b _ A I,,0 /$4\     ( <-\3cT<;<);>   ST0 X  JI    MT  @-N[    ,    +       kl    )j_<-NK)@  2 /#02 $6v 0  !G S 3)>  0 X @?@*?@ ?@ ?@\+<;<;9      ' 2 ++9 ;      A \<  ST<;<;%<;<);gS=  *,   )           ) ?    l   )      # K3<  5 = .1VW= N_ n  5  ) <       % )g=  *,    \         4 l_ `&_ .  & 35 & l^8 $! ($ g l_ `Y_ J   f5  Y  Xl 9\  )   " ! 9 XWXl(`  8K7878l    ~   ]H    1L     xwx>            I  h  IHGJI JIJKDI : ? 3 I  + > / @ #&      / "#     %+ +> /T! <[  !  L   9 <7+`//b!!7 M6   E  1  %]^]+> /   Q Db   `u_`_` X4.Y+ + }/ 'W##xxb" 5'!<    0"  `v_`     +b O @?@(?@L     ,9 -'  - $       :>5$  1 2       POPOP#OPOPOP^2     1 8>78 787878U       Q!/U   `_` _`      F 8` 0/0/05    FC W  $qrqJIr- J   !0    21  + t  61C *q +  $-     J'Ir @'?@?@?@?@st )      rc )   @3?@?@?@F     2 'F  ,:&# 0= / hWghghghr    ()     fy '% )> `__` _`w    "!< xq JIr       V5 _0 'Ir" NbL3 4KLKL KL 3 4KL 3 4KLKL KL 3 4KL 3 4KLKLKL3 4KL 3 4KLKL K L KL KL 3 4KL 3 4KLKL KL 3 4KL 3 4KLKLKL 3 4KL 3 4KLKL KL 3 4KL 3 4KLKLKF KL KL KL3 4 3 4+KLK L KLA 9  ; G   OLK   OE   G 2 +@ 1i   qnm   qs   }xw   }JIJIJGJKL !KJM  ! *     AA $);O6|M                     " !$  %&  %$%&#,  -.  -,-.-4  56  54563<  =>  =<=>=DCDCDCDCD CD0CDCF GJ IL KN    UVU V   bLKL3 43 4CKL     3 bL K     H+GHGHb LK L K      )     bLKL3 43 4CKL     3   < = bLKL3 43 4CKL      3     3  ^;T?(kb'D!CDC D C>CD CDCDC > C: 1     d *D C D C^   > C'D0C  DCD C    DC > CB  D 65 0     65 0   pS V         h8        .  ,     .) 8    (  ba \  65 0     ,       )  x " '"$   F( 9x@58 %+ 3 [!.'           :" !1$ # & % ( 'd* )*, +. -0 /^2 1 4 36 7'< 9> = BAB  ?D C F E @ 9 H IBL K    bYZ  K             K b@     P b&YZQ R>\QR        0 #    !   "' "'+   & >\   X(WXWXWXbD  % s:b.O   L    +  dOP   , A# 1 .O  L  PLOPOPb E>  )2 ( >CDCD )* !  . RcG 87    ! ,   . .     &m   > o 4 !    . ( A  5(  ( -:   8 K'6 )?0 7) nm 9 5  nmhgh   s  4  @   H 9 hg  1      *        "ONM   '    .   9  # * e1v uX.===@% A H F! :  9 5        4  @   H 9" !   @D?@?@ ?@ ?@ ?@Q  j i  ji            \BIQ     a| "  M-.    `_`h F3 43 4 ""  5  : 3   W !'VU>    BL  UT   "            3>N &     T  ,  8      x:wx %587: &%  @?@ @V?@@?OPQRQ)= 9@)   5 V@) @?    haghn  ihglif_ da^]^]d #   < ;   phop   ! %             hggh     %   87    p'op    a   00    *-F?VS+ .*-F?VS* * !!!!!!!!!!!!!!!!0! !! ! Q       0 0        878 78  # `R.-. -     '  7 R                U  , E!'   % 7 !$!    1 4"   4"2  1 4 o   8+. 1 hghagh                > .(  H , #  0DDCDCDFCD)CDHABAB,CDC"D/    3  5 , /    )B %  '  ' % Q[ 5M@O&*  7 5D3  5  ,"  xLwx  )$'                                +  H+GH      !             $    MAB A    1  3  ,((5*   ",:!      x:wx     & $"  "   1Ee!_>o?#   ".#^9:9   " ('>0  >$#(#"   g:8    < '   (O'('(     &%B */0/0/$ +,+,+     &- '  2X      !    ('(         (J'(/  J    "&@% HXGHGHGH       [(h /1    C D ''#a U -  6     .26*  HGHGHGH?GH1GH7GH"           FW!  4 ( ` "  .       # 0i/06/0&.h    ZN&. N     w R1?@   + 8 ?7B B hAghgh$gh      )  rd  <   $ P  $   ^ 8<$P q    *  ,       8  mmd'S   1' ,   '   X3WX+WX,WX*WX7WX6   F;<;  !"  "      /0#$ <#$9  =:39  = @+?@   - $  ('(1'(   " &' XWWXWXWXWX     %%+0    popop  &IJI$  12 5:    N@=C [ !    U\   (. 8=787878787878)M      ;7 M , "!          IMX ?H  k `   *,-,% #       w@)#?5M3 6 >  ,-N             . -.  9 @ MN  >IJ IJ  )r qr  q##  Z   #S<    t          '   R8'9WD3./-G5E                  S&R 0/0+/0/0 /0 7   # $ ) ,  $M                  4   !A  5   !B     W5) @6 *-#  P4OP    e  +     ,&!"!"  -   T<  #2O   J $  r            , c0    +`73 4       ::~>;: e jmj   &z%    }  6)+  5=pst 7=puv s@=:U czyzc&)  %  3434) d94     cd  cd!j =++x Kv 1&# 8   @ (    !q  L" W$4M 5JB  '!=  8 =]7i>V$2)1  #D1!    +      (      ,  8  0MA  p)opGopopopopopopop  f ` _        r [    &'        +$/6 9 K%& 5`    0/0$/0/0/0/0 * 6    (  -"%* 6    04/0 :      * h.gh %#&%(  1  @?@ V@?@?) * 9 @)5  / V@) 8 > B @?@ V@?@?)F '9.)@*)  6 V@) X!WXWX >P $ POP"d  X(WX5n KN  !     }P%1^S???)z2 1      /84/?0))  7 >   U  -  <%.%1^S?)z d=6~ "UX +  +0=6 xwxwx V@?@?)= 9~y@z)6 "   <% V@) . hghgh"S???*&   8~y?z$Zl*Z'(`   I"S?* 0 > HGHf  X'WX4p [^   & POP )      4)8   X#WXWX AB  'V ?@   ` IJ    `%_` #IJ   1IJ   BR .   9 q   (. X ^ "-"-0 '+   hAghghU~   $()   * X0WXWX  '(6%* xXwxh   5878 0   0 x>wx$wxwxT       T   2    2      3   S @  c f '   ++S @        ? ( +T      877878   ! $&   $      * )    >    XD h " 3 *  3        P2OP OP OP o * H!! J &   ^ P0OP OP OP  * h!! H $   \ P OP OP  * !    +      +=3-5!    V   ^   kT XRWX WX     !!  '  !  0/0/0  *       h.gh    0e/03/0o/0/0N/0/0/0/0/0/07/0                              )      %    '     b* pop,op      = %j 8@7878 7878    [  *a   0#+PF &          nH      {(  +      +(!  /(( )'  $)'&7e " 3 5 ,   4    -   x1wx ) '    XWX &# 8A78   #  - XWX  K    3    6           !(    "     ! \@Z30    *) ('('(    *    hJ / 7 B;28E= x]wxwxLV U0    1 ;' L 0  @??@?@   4   )   * ,065* @?@?@94   '>F  XWXZ GH   d QR    #QR   1QR   HR .    9 w    9. \ b ","-. '+  `M_`_``   #6(&  > X=WXWX^   +0/(C4& $ xVwxf  5878 .   / x>wx*wxwxZ       * ZF   2    2    1  3   !    065 +4   A>   R ?@   \ IJ   ~ #IJ    1IJ   DR" ~}.   9 s   (. "" hCghgh"W~   $*)   * `2_`_`"S  ' (8%* "h x>wx&wxwx"~}V       V"F"2"2"1"3 XWXWX$4& |{<  * -.-.-      P*!' 4&       $b $j $ X~WX$    ! !  J*  0/0 /0$  *   `U_`_`$f   4  O$ &    &&~ }0 &'4 &>> &!"R ?@  &!"\ IJ  &!"~ #IJ  &!" 1IJ   HGHGH(44   !(>(#$(#$(#$(#$*4*>*%&*%&*%&*%& AR, ts.    9 p    . , `G_`_`,Z   #0!& ; `7_`_`,X   +0/0=-& !,f x>wx#wxwx,tsS       # S,F,2'(,2'(,3."   XWX.,4   .A.)*.)*.)*.)* ER0 po.   9 t   (. 0 hDghgh0X~   $+)   * h3ghgh0T  ' (9%* 0h x>wx'wxwx0poW       W0F02+,02+,0103 HGHGH254   "2>2-.2-.2-.2-. @R4 lk.    9 o   &. 4^ "," `<_`_`4Pn  # %' H.GHGH4O    4& XGWX4/popo  UXWX    / x>wx"wxwx4lkR        R4F   42/0    42/0    41    6 S 6/<&  / !' E /<6: F"6 0:@ 0#A/ 0: X%WX WX 6DR   *6!12f KL  6!12p UV  6&12 #UxwV  6&12 1UV   }Z:%x1w_/4 1      / #! A >  ".1 V  - @ .%1_/x o: "   - +  G:0  0 30 pOopop:c   / +  4 `>_`_`:_   . 4:W   5878 1 >:fe6/M      /#@) 3  D 6/M   :256    :256    :1  :3   63<% $13%  POP OP"    P.OPOP$    2 X1WXWX>QH  #4 I  >lZ. - !K X0WX>&9:n -0/0  7  X2WX>&9:x 7:9:    A>69: #"! 9  7  C>69: 10/ 9  9 @# @,  @A6  @;<J ;<   / @;<T EF    @$;<v #E hgF    % @$;< 1E vuF     Bu" :#   !,(BK6 9 -BD@     2 03/0BEZ      -BlB*r   P!OPOPBR|   !BF   B2=>    B2=>    B1  B3   v Dfed< a. H  >   *( ;*  yDdk dkli \[3@   iK#$#  p $       pfopopDzV  7  A 6D*z  DK 9D&  D  DR   DF   D2?@    D2?@    D1D3 d )FZYZ YZY2    !  %   5 f zF5^ ]#hghl 3 6  &$85 # 9F" FZY(Z YZYT       # %  ( T h ghgh FD  F/AB      / ! X:WXF/AB      1 ! X.WXF;    F=   " l )"HXWX WXW2   # !  )  9 H |Hdfefl   &$:d 9N" HXW(X WXW\      # # % ( \HDH/CDH/CDH;H=  a)0J:`_^< [OV UVU2  <  >  !$  !!  6 *K1 8  ;#0:* O     J^e ^efc!dc  )    W < efi! C` 3V! $1  !    c J`_^< [=V UVUN   +  >      !#  *91 -  ;&  * =   NJD  J/EF    J/EF    J; J= L0 HGHGHL34   !LGHLGHLGHLGHN NNN4N>NIJNIJNIJNIJP PPP4PKLPKLPKLPKLR"RR HGHGHR64   RAF  RMNZ GH  RMNd QR  RMN #QR  RMN 1QR  TT5T>TOPTOPTOPTOPV JI.   9 V\ ","VZ   #VX   +0/0Vf  5878 VJIS      VF   V2QR    V2QR    V1      P.OP     878       *!<; !  - !   878  P/OP OP OPOPOP. !!! ! (#'('(       ('('(      h?gh - " 6# N c?'    0 +       ) ,T)+L&         .   (B'('('( 7       B!       nn<       )* +Jx(       #             W XWX mSE"z^/ -     0     } ~}~*YGrJ      EH'PJP J        CF           m2x4KyD L1S58 ! ! R!!$!R$!%)$  `h_`A_` S _      f          !  jB_@      (        /=T,B*C'S!- ! !#!$    PIOP OP    /L ! MBa       3,K) \ ! !  !$ ('('('(P    MM  5 p6opBop      _ -PC! 5Z.B /   /  v[ m]a4 !    87878         O_       pMopopq    3V ! ;            Xd 8)78)    wpo%   'L 58)0 12121-6 )  +* -  1 % -,  5 43,> '  * ,  S1 "= 878  pop >+= y *z{ zy+|} *~  '1A9$ *+ *   3 ' $ ('(  m&  ((         -* 4-5G l&             ]X 0](`YZ  [\[.` E      ,  5V82+ 0(.    POP >>  * * 1K **  '$(  )$   ;  } t  } t} t'!&/GQS  '    *O GJ;B CDCDC-H )  .- -   pQop +   + '  6+  ?@!"12  '   3G  } t ! 4 % IS    4  `W_`d X5 "B P?OP  ;   '   1! '  -.    PEOP  A   -   1' -  -.   *    }  1D        G }  ! 4% DO   4  X `J_`h - * ./   "4; %G! } t } t' } !"! 4!% %7O  '        !   4   `\_`i ]5"G  pXop ,  , '  = ,  %&  c!  l %" p      ,+ &%     " 2 "y    !   1'e"y\a  \      +          +  K  *  /*  `M_`  I   5   '  1 5        5   '(     M%]:>HH(        3  } t'   *       5     5  ( $ %$' ' PKN8j1? +%3 ' * 55  J??   , z,y ,    &@@7#,,, POOP ,# 1(, `L_`  I   5   '  0 5   5   , ,  $I +3=    5    + } t   * !"  ' L' '2<1<K5 +   *  PCOPP /*0 /* (;'('(Mv      5 H    5 - h gh>ghp' 1< ctOHG H Q   T&$        = # pVa 5H    pBopO! % popC  p  %  2) ##    C p 878l  ./1      # %K .O HGH          W"=AJ )*R  #  #  $ H2' )*& H9GH*GHq   ( /B P8OPBOPOPOP3OPOP   $#  !'$    LH $                 ?  $30@ 1'$ )          ),]#%<N +34 QTS TQTS 4      1 9)T   4 W1,0B$0$ #  8  (;,),0B$ , ; W   @$,       $    g  -  ,!H. +"n$, pSop@     R@   .  &  &*+ QTS QTS  `  QTS  N&$ QTS/0    83  FC  +N&)21,KF     *       6    $B,(    \!?*;047E 9  n 47. ]4     &  %& O  &"!"!$#$#$*#'  `y_`    %   ,u,F  !! ,5 ,  # $  & $ F&P=/>W( ' ,8'        , 9 , , 1, , , H75  QTS       *      *  % ,  9#(/?Q* [*     *  & +/F*T   5 ! +- QTS  QTS - `               )  +9*2v        - '   5 \9%V0  (:   ( %&).      (!  N(     -  J  h  + Zu- 3    ,"9%' 0 ( : ( fJ<>a3Bv &%w* "& .-"POP' &!<     c*d/    7 J # %U  +  $  0  MQ% KQ H C 8 3;&%)    *   &   g$   'Z N'     Z < 'Z ('(EL  (g'(O O6 ,   ($'(     [\ !            ,-VS''''           x  XIWXWXz    3((3 l X9WX&WXs 36   U (# e  $$$ $   &%\[\[\[C&%H | 9A  (      C  H `Y_`$      3e   % H&%9  ,,  ,-F?VS-,%F BN/%H  9 xwx9   67 & './* +*-    ? Q   "" 5 `_`_`_`   3   ad " """""""""""         '                   3   M-Q G'   3  B  FJi"   p=       "rq  "JI   65  ("%  #   #'   ,-VS\[ -  ,-VS    :Vv!b ;=  " * !    # <"  -        3  B$#     &# @:?@  - @!?@  #          U3?3^?*L $$    %  +0  %   /-  " L   %     *I3L.2 %                   H2GH   N','+F"@w      "  &-VS ,-VS    # '%*%- 8OI {;w'   %   w POP*OPOPOP@\ [0;  #$#$# ,-VS  ,-VS ,-VS  ]. ,7!@  0  ; \ [  #     . n+V n Y  0    m(2 m e '6^51 r  0 `'& ` \-.  : 4 J  x   M ^     '    &(G & $     ,-VS      O,) $ ) ! Qp"}!V#  ! !. "3  : 4   J  x   M ^  u  5y }Z      ;XQ :LM" j? kl@78?8787 6 $ <;  )  $   ,-VS 5 ,-VS   '   r!)"# ) !     112121   03?:  A;J @2+ i=</4&$%O,'d cR<(7; &3%'    5A' k  Z$#"#"!"!" !"!  hghghghghgh m X &                  3 ,-VS  '0y  4 4       X"   k: 3:<_*+C*L     1! %13qxmrqr       "      ,-VS     4+#,+-$R_*D*/Fd4c   L `<_`        E' E `>_`         G' G hIgh       R2 R             p;op       ^!)+7w      -VS  ,-VS   $%  !"+ )  $  8_      @J?@?@    _ 8787878 "   " m- L    o$$  ; `_`_` _`                    %         , +&`:             (  % k` H(8! "!"!"y .-F?VS-.$$$$ " #`K0!& 8    y b3(  64/  H GHGHGHGH(8< ;<;<; <;<;>=>= UTOJOPUXSJ   :")8   PNOP*OPOPOP( sehg+  p)  3s(   53 42 U: (# $#$#$1!"!" !"!"!"! " !"!"! "3         "#### ### # ## ### #' =] 1      3 POPOP,OPOP( !"! "!"!"!"!"! "!"!"!"!"!"/!"! "/ $ $$$$$$$$$$$ ### #zR   /   / % - (X!"!"!"!")!"! "!"!"/!"!"E  <;    """"""" "   """"-4 &(!  'IX)     /    E r+ (8,(!"!"!"!"!" !"!"!"!""!"!"       #$!""""!( $#$! - -"><<!:  "     P/OP+OPOP(!"!" !"!"!"!"/    !!!! pi /(   Xsl  (!"!"  !!!!0  ; ; .     ,* O ! 2 @ "( . y+(0!"!"!"! "-!"!!    !(<%0 -! hghG(j   5"%        (:'('('((!"!"!"! "!"!  U  OKo(!"O!".!"!"! "!"!"!"!"!"!"!"!"!"!"!"!"!"!"! "!"!"!"!"!"! "!"!"!"!"! "!"!"!"!"!"!"! "!"!" !"! "!"!"!"! "!"!"!"!"!"!"!"! " !"!"%!"! "!"! "!"'!"!"! "!"! "!"! "!"!"!"!"! "!"!"!"!"!"!"! "! "!"!"!"!"!"!"!"%!"! "9!"!"!"!"!"!"[!  \WXSTOPKLGH  b]^YZUVQRMN       R   G<    "    !" .-.           %<=% 8 L &9'F YvE4'@ z" ! $            !!"! &%$ #$#$#$#$'('('('('.)0/0 / 2  343%876 569: 9:9'>=<;<?@?@ ?DCB ABABABABABEFEFEFEFEFEJIH GHKLKLKNMNMPOPOPO%RQR Q9TSTSVUVUVUVU[L    m(!"!"@!" !"@!"! "!"!"!"!"!"!"!"!"!"!"!"!"!"!"! "!"!"!"!"! "!"!"!"!"! "!"!"!"!" !"! "!"!"!"1! "!"!"!"!"!"!"!"!"! "!"!"!"!"!" ! "!"!"!"!"!"!"!"!"!"!"!r"!s                             %                               9 &&&  'GLR!                 1     " !" #$#&%&  '(' * )*)*)*)*)*+,+,+,+,+,+, hghgh(E !  POPOP(.   hgh (   #& ',+(+$ Lr  @?@(?@( 8 7%      %  (  ry          !*SV ; P       G" HJGH(GH( 878787#    #@ # (65   X$WXO(>!"! ")   ###-F?VS-#   ZY >) `_`_`*oh w      -    >/<6! D&C42 *r<   & >' D< P=OPOPOP*  / +    ,$ /*   3 4 *U  0   C  +C-4     !                     MK0D 0      C 8*78#78 *d  ;   ( AR"                      8&78       (D'(,     >   878B        wxb    p=op3{|x '!3 P b: Q     b p9opopLV 7  }lJ # !%  l cd   !: 9< ,   !   hghl_ `]   '  {1 ] lh_`_` "%# @# # /## ## # !   !   hly "$ popl "#$ &#$  l  <_`e, +   V 2  !$   <el  3 4l0_`2    $ 02 @ ?@?@l4  !  # P OPIOPl5[\_`  *  #"   #  l_`   (   l  ## %d  pjopl%cd.c d   !     4 %.  .l   !8  0  lT    ! l _ `-cdc`_`     #!#    !3 S   - Ulb   0  `_`_`_`lN MNMNM#   #lRQ   n42    ann@   $ /  `_`_`_`nL KLKLK%"     nPOn  xwx           --F?VS-.  $# --F?VS--]   ##  gx(                "!"! $# hgh3ghgh          --F?VS----F?VS-.y  {$### )          POPOP  "    " `:_`     PvOP P : 7  *>  C       L  ($V h gh       #              & 3           (9'( F    + 1 (%+. -      !$ #  (%+. -  2/58 7  0"/0/0/0 >  %                 XgWX S      %6S             <    "         0/0/0   *      ('('('(     K   ::   "  &      &    &        '   '  '*   *)*)*)*)*)2#B(K     ::  A                                    ? # 8$A            "#    pDop op op i  '   & /6 w    "l"             I"(D   )iF-  $   '      .789 DC       DC     DC    DC  DC  DC  DC  'DC  #  .9DA"  %  9!5O t5:+&1'          !  [   P ]         /  1O%5'5$]              K K.v* ^   ,                   {p      dS      $32=<CBQP     o ) $      f l^           2    "       ( '(        F       "     $   *   '!f )  '  E  +# hlghgh   9 L  7/ %c      ;   !  C  4&  * " 4  4&  C+  *   ## 3    C  + ptopop   &)&)&EFEFEL  W5  5  w 3 @,?@>   & hgh  ,- 6-  ;  ;\  9  8%7878 7   " N >1  pop         5>=@    .  P%OP 2 "   " `&_` _` #  0 <6 0          ? " @  pop  !<  (G      * sq XX   sqXX      @7?@?@  -   H1GH3GHGH "  #&  ('"  pOop \ P'    ( '( '(!'('( K &b c8  ('('('( =B   , + ('('(      0_/0 '        +''          *      @?@ ' 0         0+7 ' 0 HBGH * *       POP ' #       #+-  ' #  * *           @?@         4 @             )        8*78   *        @N?@    _ *  *          `s_`_` ) "   # d-) " 00/0           #   PrOP             <#          p"op/f # xPwx%wx wxwx    & '   X !     3      33 "     b   E  @  C )"  `*_`_`= & A#t@*[0y 4 &l k lstklk//(b    ;<   &#$)  $#$)      G%ng        VU       LK3 zKLK  KLA  '@3+, + 34'i8(+Ba.'*z*9LA~a j}VKB Z   I  "B'5\Q2^ L ) UC92       0y 4 &" $#&%&%( ' ,-.+,+0121/21214565/6565(89:9b @&?@ * f      xwx!  Q     F~ 71!  Q P8OP8OPOP   *  *            ^] gi    G$ !"W r  &% $  g    i'      '   xewxr HU 1 xnwxwx4wx wxwx  Q ,     ^QL]     >5 *%*NXXWXW%5\%&)* 5 w` # A&C' H  Q   ,  0@q o o o       "        '( '*!    +, +.!    s !    G !    geee.'  7    (R  &R  &R  &"@ q   ooo HGHGHh eh e                knk  l il i       b_`_`_    (5'('(G    !   y    a 5   1    pghgh gh4  # !+!  %  p4  pJ IJIJI%  %pNM .r(ababB    * a  's F   8(  b    * a' [r|   pr-    @)?@?@rab  *    r>ijt  $#    ` K!"#  >t Ior   "0w:!    @or   "0n:    Sre   ' *  aQrij!abij     * ) "#  # !     t:   !(  % t4  tF EFEFE% tJIt     `)_`v62  @  Z .-  `2_`v?n .'-   '|    XWXv*     x4 @ xJ V xxB ABABA% xFEmhx4  xn     05    >?B?>1   " ")) !4%  05     L k    Za   [ "  0= !  ! 1    k pbop o        C Q % xMwx Z   . -         :       07/0.       ,   . HMGHGH)  E" {~   (  )  Y!  5VU  WZ  9 `5(#} #ji jij&k ` _ $#$&% &%&"= #*) *)*"A #.- .-."<;K  65$87 878"O #<; <;<"S <@  34 JI  Z  %S  `_` _`;_`_` 0 #  7 # T5 .     !/ &/   (  '   @ 2    #2    L($1'       KP S* 0 !   %:   !H")9   (       ' !  #$#"!"! &%( '@* )2*)('  'U-X3   N  K      ,-VS  "O        #"     R = # #  #@#         4 K  "!"!"!   e- Hg<;<; c ! 6S     >9:# "'        %% 1-,-VS #"t0/ h&#$     X7<iykz%   p{ ^]x{ bS: -      /          / ! ( #  D   ,|  343(07nm  ^ 0++nE     65 4JI&3&3m  4 V -:  =9c7l! <   ' #0#  m#     *3,6 +'1 +'1  W "08##+5k";7       N  $   A 7 "! X$#$#U&%&%e('( '*)*)*)2,+,+,+.-0/, +!43216 587:9:96<;<;S>=>=@?@?  XVWXWXWX^  '< #1-^ [tpP a ] T b  @dcL G c K GE:FEI R2% u&`- b 3 >  ?  &     &            #( . ?@214     #                         #        ,-VS 7 .Q*    +*        *   "      "  !-VS        ^ 2  @  +    "  +    %    +    C   3                 +-F?VS- 6G  MkA = "x X$  < }TS(z 43 Z ,!I%8#" $-! $6  $"/*%(?,'6.)5,$+. 0$/(#D 8(5 J <(9l @(=361 B$A" -DC F$E46 &" &         b   "!"!$#$ #&%&%(' *)* )c,+, +.-.-0/ 63:9: 9G<;<;*>=>A@?:DCDC*FEFEJIHGLKLK*NMNOPORQRQTS ZYVW^]^ ]`_`_badcdc2he%l inmnmpo+porq$v&sxwxwzy+zy|{h}~}, +3$  ? 8978      j   0     >- " xwx)          $ o B B" | `K_`_`=_`_`  X WXQ  ' **>$ >*  e&4 9     " 4 9 &!! 9  &\     %   M&Z     +  ( '('(&:   , % : `;_`_`&   *-F?VS-* &3   (''('('(& )     ,& ) &(  0/0/0&        4& H6G H9<GH1 HG  M`  -      o,&>  6    @+?@?@n>v   n6&$ n+&  IY/ I &  K          *)   .   !  -  " OK9%%.$Av1) "  9  &   8 78   $] c&   44            19!$+ #    4      X[e& $&4        M/M&M    $  &     $%.a&   (4             %P"+    (        XDc& $4         Mf$M    $      &FcdEFEFE<       "   P`94'     $  &C   (         (  b6  +  &C   (%  ( j6  +  i&  VUV UZY XWTXWXWTX#W0        R  ( # g  _rS(        T+ #  ~-&   ^   H  $     / $ ('$$ % A)0         2  7 @J?@ ?@& (  M C( ( P=& )       <&   65&#, % 4% 4 %6 )4   54 +   &%4+    : D:~4  &N  D-DCDC Z.-. - cK  H            87     ) 0'       %;  ,   ji $  ]  &Q+? .'       N    Z    c ; ,  &" " 0Q/0/0&e     *   &   J         4'. MD(  J  u& H      %        ' ,   <4  &Qf .   ,    " 8\7878 &#   >  !  %  %#>  PTOP&=   J=&4     u& fH             ,   l:4  &S+ .   f,   " & &   @ ?@`?@?@&/$ #< ;<=>=        =)U/    ?&M      .  X'WXWXWX9WX@WX &    '  #         8<c    '               #  J[& I; ,304#N@ I; @Y  .       '6, W    B,   $4     / 5 A0P+5 IBh  67> 87&+!&+   (' 66 "1 /</  R5b4&0(#Bnf  k B^]^[:K^]L9 :U :; Utsfe;:!:'-:  '_d_(' ?:C:  ?@9@?:   K: 3edcn,372'%L!4k#e$*"N #   3  . 0;/0/0/0,^D    ?9 > $ ,9  lo* ,*    7    ,V  )> xwxwx, ) D  ( 4.:O         " xwxwxwxwxwxwxwxwxwxwxVwx,       ,   ! .  D%                ( ( Q    ,K il  5 / xwxwxVwx,   D  (H ( Q xwx"wxwxTwxwx'wxTwxwx'wxTwxQwx,      D    D    D A    (     (     ( % T t s 4 ((0O"O!   O L  xiwx  D (- ( O xwxwxYwxwx,    D     ( I -;Q  x=wxwxVwx,    D.    (m (_Q x#wxVwx,   D  (> (0Q   D   D   D xwxwxUwx    C    'I (;P   ,0                 xwxVwx   D   (3 (%Q    ,<               D   ,#   xwxVwx,z   D  (1 (#Q   D   D   D  t Dq  b D_  P DM  > D;  , D)   D  m ," !"!"!"! "!-"            )F  - @n?@?@ ?@?@?@661212_h       . aO/'    * P;OPVOPeOP6     z{ZW:3:34" U4E  85  FC$ R9V85Q n9';6    W,/+" t(  6;  t   "   /  *4!)1$; t 6!!  6   66   `;_`_`6HD C , ) H  H;GHGHGH!GHGH6     #& 4  4  6(  9(D (   ` _`*_`_`D 8   "  HGHJ&   '     'GO# 1               HMGH7&     E#    @4?@&        XvWX&  *        #!%   *  H+GHGHGHGHGH&22c43437  67&# &22c    s Bpopopopop oNMNMNMNM>NMNM=NMNMNM'   +*)2  '(   ~}~xw   341mx 'w'('=9h %O<(@ >    =  '  E,&   ,           &m.-. -.-. - 1       KLL [\"!"! ! JIPO!"!!"  $       " C   `OgLKh  L LLhKh  jL vL `L 656/   87 874) ,      6   2  Kh XgL 8 * !!! ( I *Hb 02o3)!NyF (&"] ?E9W'[$$^+*(?N1!m W   `  1     ('(\v +  mV|  (%,% <  HG  / 2/0M ghk<)  { |yA '         !8gJ}U   &  +V  (<;    +$ &" +5$<#$;    )*&    , %  . )   % )0( V  ( +=:       ,       0_ tRV   %&  5? 30!214564")6  /"5"5" /45& $ 3%        m3R2 V V  3  &  &  #   )H 7  *  *  wV"E qnqr   ~}      !. "E VN      ,"  (x V*  &    D"    % rO0  & zy  # ! !!!!"6FA7< 0 1%Qz#uh  ,.mz&= G,(%p9%* m +V  (<;    +$ &" +5$<#$;    )*&    , %  . )   % )0( V  ( +=:       ,       0_ tRV   %&  5? 30!214564")6  /"5"5" /45& $ 3%        m3R2  V  3  &  &  #   )G 7  *  *  w VN      ,"  'x V*  &    D"    % qO0  & zy  $ ! !!!!"6FA3< 02%Mz#qh  -.iz'= K,/%q:%+"  (S'(`=             &%&%& %&v uv  &%&       -&%&   (N'(&% &"% &  2G   ,&%& %&9 D&,%  :,&%      &% 0"/0&%& & &%&%& #$)*  '3  &%&% - & %&R w   )    0 4343  "   ,2,   ,  WU" ,4,  H0GHGHC    `__`, +!.,  2 POP 6   ! ! ! ! -       P OP    ! ! ! ! ! ! ! ! ! ! ! ! ! ! !" !!$ #!& %!( '!* )!, +!. -!0 /!2 1!4 3!6 5!8 7-                               M+VV] [P]. . #!7#X M-  xa kkikhq1)(=UI# :9&%~  / %  / .`/  \/  Z,  ;JIBLEf+"iH"gF"ghiH "ijm DCb,Af!"5"wf!"efwb"/   T/  R/  CX(  //0/0 /<;' ' &   XWX[d_    agh     D N = = : FJF = : P IG3XJliwT +liP$.QB *1 &1 N 1   1  .   -   ,  1 !"! (1  %&%,1#$ )*)01/0/0 /.-x2 1~4343436 9:: 2<;<; >=     U^]LI)`_b]b_JI^   , W0) '  orq-rqrq r % B)r /    -  % :)j /   X)WXWX  '1  /        ''   9+W[ 1 . #j     `}_`_`      >) 70_  `_`_`Y      9@=89456C L 7 "! 212/I"C 8 7878     1  HGH+GH      "  P2OPOPCOP                3 %&  x!wxWwx+wxwx    9 +(Q   DS   0Z/0g   (4       9   %    4     `D_`-_`1_`_` _` 8;<3(,%))      *  0 " &   - !1.:* &[ 878787878   #D H`GHGH    +3T 2# `g_`_`          %543. 6$ `5_`$_`>_`    +3 k( P        @     , 4  8@=7*   )    <aLa &&%;l-Y(  2 a(Yn *JIJI6 0"  $#    "!,'250     'J9& " LK    ,+*+ ) =BKL16C             3 kl G (Q&M< *D '*#*\%'@' %  9X*2-3\`1-3g=y^ 8>PU3:       Y    z POP,OP                  !     _!6'=2_ POPTOP                         $  #**&;2 /  cE &      ,C '      ;@M H G  F 2PO4 `-?  2 ZY<a2Q/ 72{1EN22 02B32 P   P~   a  s  e2M )OE2mFa-2#q     '4 *   w  - ' < /l! ? :' ` 8 R%E&-6$ 1K F N    G 9n  XzWX    $"? K HGHNGHGH GHGHGHGH      '     &&T [+ '7"4 $ " #0\Y04cZ- < 5   B1OXW `,m  # s e^ ,  =6Nf%"+/U     .m         Nj!    POP;  K <70 "Ic >fb8" XzWXJWXWX     = 7ZI4d T         8  E; `B_` _`_` _`c_` _` _`_` _` _`_`_`)_`K_` _`"_`                   0-   M A     ,K  !,      ROPWHE % fk+  I ! o   /  U HGHGH#GH^  $<  %! `_`_`#_`_    !:, U! ) w      & 7 =0'3) w PyOP  B/ % R          4 103. 343430 N 3 p@opop"optopopopop op x   (   `  %  0R? x % .     tm     65 478-$.     5&  &  "B / 18A$ %w  (@   jjq30/O,+          sp  on s ) L# %P   '[/ & .C|!   + ;    R HGHGH: ! P4OP"OP    # N xwxMwx%wx   '     q   P/OP D        XFWX [      2 Y4  "            1'- o:         # +*  XXWXx!     O) 2 " 3? " ( "  5  8@7878"   !. 9 (1'('(" $ #Cr  X9WX?WXv  )  $?  g!    .   B  4      #  #    & Q  ) :      5  20   '' F   ",9 -D   ,   !& - ,;* 9)) *:%GJ",!   ,,    % , 5 5 6,  ! -' 5 <  6 5 6 5 5 6    7< ;>GD C@ ?4KNWP#$ OfCD ol?@ kh   <g  ,!  ,  ,  -\ ,  ! [  -_d78 c  ,dc ,!" -  ,  - ,  ,  - ) ) ) ) ) ]) ') ) ) ) ) ) ) )   & 6 & FW )  R 5335) M")E3 D33233           "! $# &%(' *) . -,-.-.-. /2 ,36   , , -%F'&'&%&,C J IHIJIJ!I L -M RQTS V , QR     , C DEDCD-I JKJIJ,S TUTST-] ^_^]^,c dedcd,m nonmn-  H1GH6GHBGHGHGHGHGHGH,GH$  W  n   .stmn &/ WXQR" !& Q Nm l.V $Wn       HHGH       $6 HIGHq  %](  Zd5 .  &#$           *    2 z TE F^Z Sh ]     +LOR  g4G  4)E=%%"?2     )=  !(+/h=:=+ s 70@9+* $ K   Z   % ~   & =    nmns   "" > - !$"" "K -  4$ """ "A$  6 ( t $   +  =(  0/0        .*$+  0   !>=  +  D  +aY+=}+++Oa2'/2k lk>= l  ~}>=MPx4X>=WZL >=   Y(PIw_Y;$YY/qYH aI z9WE_KBI/& 19#                & # vt  5 A;  ^ # + +) #JL  D%c%j 0D      FS@CT9 :Q&65,# 8!$ 3"!  32      C*GL"  w  3g/E       :E(+ */M:EXQB SZM:EXY :EZ=*1 :  %   ?  -Cbg/6 [  PM   .9< ") P69( AD     i^=(' )')~:7/ N C      F   " 'A;     }zyfc t]`_ rE`]  x + udY8 AJ7Pmd)  EPmFG(@ EPm , EPmF=b](!8+'@Q# 2   "w8= (    V   21   'A;B + .  6_I:   B    R  X#WX+WXVWX2121T   NG  8)&=  )*)$ 3= 8      )# 7 & '        '               !        + !\&R&T&A&-SB)#(" " "4             -.       QT'    "O 0<   !        $8 022@(:II=    D  , *)*)r   XW63! '&*  G Y\%  G    2   *  H   H  +  ! j q    A  :z|@@16116a e s%f F) *) l   Txf }"! |$# [ `     "      *i    ! H  & o G                         3B?z  & oG  1   ) *     2 6- , + L )     S ) 8786787878#7878A78  "        !ZUZY^]bafejiA R  7U  3   3 K"=!"   17* 1   @?@ ?@=    , ('('('(  *2565  0/021    05/0     0/0/0/0   -4343  # 8:78"     0/0 /0/0   "         #&  2 17  " )  7 $   x$wx % %   `M_` f  G'   $    XWXU 4HG5D50/9<=H (  (    /.gD " D 4 3:  ' 1  : I ''+  # $ % ))  `P_`  J)   3 >78 1   *5.! -.a^;@a^;+dA@ C2c 3.C%?*  6W  !*  "   4  '  !9     ;<  $ d%Q - .  % !2 121 21         8#$9'    * 09:   "0! ;<;<956990   H= D    (H-8E-7!   `_`}_`_`5_`F              &1 $   %H!S1@F   *#Y ," :6    `$K )# ,!  2?  3  xrwxO / 9,    X^WX?  U   xowxL/ 9)  p'op4  ( ?   xwx   $  / 7 h-  :  O   xwx      / 4 b-  : %             - & I8! p4op '" ' p0op       500- @ 40? 0P 0000c0-0/    8!78 *)*34[\   XWX *"GH"O- $''   F '(     !           ? C$ mB  8 & "# O555053=-G3$$$U#X<*+&' "#   "#(                  =  *3$$  $U#X$#9 QWQDD 2 1G|     CF    ''*          &\! AD  G $6 4S34?34=F)=*F    8?tR)t d? .J <S?)* p^opopopopopopopopopopopop1op opop0op opopop op  "#& 'F M  * +   )  :ROJM? ."W     9g>E   xpwxwx"wxwxwxwxwxwxwxwxwxwxwxwxwxwxwx:wx wx  .;<  :;* +  > E "#&'6O     !    -3 xnwxwx wxwxwxwxwxwxwxwxwxwxwxwxwxwxwx9wxwx  .;< :;* + >E "#& '6O    !x  -0 u  !  ,   36 =^  e" )@A HILMho  PQT   [D2       !   10*+   -> v" " -            36  =T ["  )@A HILMh o  PQ^   eD2        !     53--   -A           36 =^  e" )@A HILMho  PQT   [D2      X3WXWX'WX     '!-F?VS-!    ,%    9{*     !-F?VS            %X *          - 27$- |8 743U6556588 7 BC./23    67    *+  >? &'NO"# :;RSFGJKXW `_dc `0?w4| U58  G*5#        D  +'9%b2# 6)LVLRRVRRDBEBB+   89./$% PQBCLa! <" 3 C" " " " !" !. C8  B  8  >  >  B  >  >   +>5!7;4 6 ! 4 4 "DBE    B    B  + k^ ' U :   '-F?VS  +    5+$A<'  U :  A(     !/ -222 A  "        ! P F6>t   !" , 3n   7F34 CFopst 1'    87878J 2 ='J     ' +  8    ,  (         4   babaL       * /?L 8078  $        H7GH GHP    -     ,%b     ,  /     */ m  6$D 0I%(> (*:$"Jb aba mb    ) @ K Ka    b   ,7[  ,    '/   #]          % $  ) A  &3"*  K%v4;4t  6*5-d/  HGHGH9    1 =!         .4%!       6>"       #$/6%"              p;opop     K  h     5  V(<!Kh 6  6   6  K  W      5  E(CKW   "           p  #        7,34/0%& 6 565    6 [`_b{t{|wxmr [        "               `D_`     8jcdcdcdcd     j!cdcdcdcd  jcdcdcdcd  jcdcdcdcd  jcdcdcdcd  j,cdcdcdcd  j(cdcdcdcd   jcdcdcdcd    j!cdcdcdcd         $*P (,'(!  (   %  * 0  7       " /-F?VS-/%%%%///-F?VS-/%%%%  EA            m$2"   G$ # T %%% %%%% %   L    _"E"L #"   G     &" ! -,1 I*!   hghDgh&<">    87    )0<" HGHGHGH o" ! " !  )))-F?VS-.KN          2      /.v%   o     h7gh  )))-F?VS-)*  .mr ( _ Z )-F?VS)( 2.-  "#, Y- 0! 0  |  R  Q@G: C  .   ( _ Z `         WV '-F?VS-.   '        e   35!"#           W  V    %    23  4   I: &-F?VS&&&&& !! D           > :   6%        N # /*       16)I       "!"!$#$ #&%&%&%4( '('*)*) ,+, I.-.- hB      # . -.--.-  F: &-F?VS&%%%%       81                   - +6A       14<N"  3 ,&K     #  "!" !$ #$#-$#&%& %('( 'F hB    F Z #   F: %-F?VS%$$$ $          LE                    - ?JA       14E` " 1 ,&K   F Z #  "!" !$#$ #&%& %F m=        .S/0?/01H*/K AHE: $-F?VS$$$$ #                        %8  ?    *%  -  #  1,  7  ))F      S!"?!"#&*   K('( )*)*)*)*)A&   hB      # .-.-;  F: #-F?VS #### #          81                  -+6A         146 5  " 1  (&K     #  "!" !$#$#;&%& %('( 'F .          !"!  !    4!  """-F?VS-. """       ,   I8'57      -k  * )  6   "   6      &   ? 2   ? 2P                        &     !  2  2     ! 2  2 hMh6   T:$"(  * )                  ?2 "!  $?#$2#P U6  =       $ #$#$ #$ #/     "  ,J          #&          :78EMP012%&7  F ,-VS #             ,-VS @  ,   o6&<*&+=    &%(6&2   =          /$!*'.-.-0/0 /2 343:98 5 < =< =@?@ ?FCJIJI" LKL K,NMJ ,;     * !: -F?VS          F1           ;D :*dN    $!"!"!"!* %*0+, +!"        V -F?VS   #0)    V U4>+d       ! ]     * )- = 2T ' -F?VS;    ? ( 5   5  Yn            (                   $#    02 #      ' 3 f q1Z"  T 44&- +    $    ! ]  #"!"!"! $#$# $#$#$#$#& %( '-*=)*2)T.+,+  4+       }" ?*' * )- = 24 -F?VS/     NM  5                         02  f 1  !%  ## #1&- !)     }" "!" !?     $ %$ #-(='(2'4 ,        X -F?VS-.        ,3 ..9  6       "!" !$#$ # X b    iI  #$#P  % = 2 = 2 = 2  3 = 2 h  #$#S& = 2       %(JHG^]EFH9^H  ,-VSJI2/('pm|  |{VU023>7 $#65   .  *   * C902  C902!  -F?VS-f e026    "Cg>=>=   LK H?  K&02FO.YFH!  :f @ @ G DfG DfJ fy/f# %T " +OQ8'#  -9. $78@/5 ,3 #  &!A(3# " #&&'!A$),&("GJ*[!^ X0 &  P+|q   iI    P  %=2=2=2 ( '3*=)*2), +h0/.-4185 : ;<;@=S@?&B=AB2A @9?@3?@   .^  n  X   pDop('('d    w   z      l7)7:  `!_`  !('('  ! ]  d .     arqN   3 >5dcdcdcdcd) (  },    >5 X W \ ^I *lPN.2               F (    09/0#    1# `!_`_`     h,gh1ghPgh      $E#   D( ,+,+,+2, +,+ , +,+, +, +,+,+,+,0+ ,+,+,+-,'  }  }1&   ! >#  B"+ : 0 ,%         & -  + )  HGHl    |{|{"!")|{01|{878?|{F  UX  i|{pqpoxu x    %4 l   ",  K   &+c   P6OPOP ( '2  *   2 xwx5wxG  '' CG _ fe MZ4(L 0/0C/0/0J/0/0 *     ] ^     ` * `&VP  #(N * L RQ R     5:X .   Y;    yy (,g(,S(,+'       $[\[\3I D   ?  #  U ) !A"H&''  D `V_`E?4 +E l k   PMOP<*<)!   < 8,78 \[ba %      3 878 l                     )  b abWXWXW      2  pu$               2  1      "  0  0 @+8 2 bWXWXW4Xa   ,   mhstkli! r}! vk)qp}tk)oFSTE!^}!)3=[9}t)3=W0QRD(w&P!QRO5`_ JI  7876`!Fpab[8}t7876}t78`6785654}t56=9@? 0/L}t}F&EKV4Z<56#}t{*+,#}!gfe\[8be!~}!}!>I!Q"$D".s4K { $z } ?2 #;$ "%"" (      $     ! # & #&%$#$ (). /.-.-2121' 65658 98787< ;<;<;@ ?@?@?@?@?D CDCDC 0/F9,$(##J IJIN &MPOR SRQR UVUZ YZ _^]^]`[XSL# ^(]babab(ah ihghgl mlkp qpopor 8 8p787878L787878  ( b{| {    (        TM H_ be \ k9[  (      (    A ba=babab abab abay ,   bab#e *ba    TZ$#$ T           %(    D5,))          + >7  Cn D a  :0C  #&0 ' = "1#$=    y      ,    # * hSghgh ghghgh babah &  ,$ h \ <       (  #,  } }.. / >vx[%            (   ddj  b-ab {| { ba b/ab a ( bab"ab ab {| { ba b/ab a=babab T M   T L M w tT      T L M     a: Bbq"03g,13*# $    "  ( "     "  =  s1j#    @G@I !!   49<= 49<=    c,q.+t   H        & -        Q6B?@=>9    2=    *    #z "    C&  - Q P4  B)        y         `Nstvuv   :8.P y     (Y  zy`_Y                 * '( #"  %"    = Q [  <@  f$ Y      2 R QRQ \[RQ \[\[^ ]^]^]^ ]\[\[F be  "  83:9  '*B""         VUP%  -I;R QRQ \[ \ [\[\[G    8 5    XU'B!     Gz 87878?  ! POPOPOPOP>   0/0 /0/0 /0X     2 +x                 !                 lk6 ]>  (g   +-  &l7.!IjS \  !(!/W>I~N.9 !          b , V, > 0"4,B     ("    |*)*)*) *)*)*)*)-*)*)*)@vu *)zyzy*)* T  xqJI%*F  zyzyzk  EHKPKL IRz        J?zW zy        )A    $ zzPBzy %  ozyzw J     %< b T  :xE   >?1C.,W :%<O V|Y -      @   e    Tzyzy3vu"~MRQT      M- 3" (< D! qSvu \[#vu v uk   #   B R   .*3$  #           0/0/0@ $  0/0 /0+vu  +B    . 8;U  >F     $"  I. 8*U @%?@?@   c  @$ +,+,+,+   L >{ g 8 2'c )  G        #G#  ( +        ;G# HbGH GHGHGH3GHSGH GHGH:GHGH*)`* )* )zy*Pyxzy *)*)zy   klklkv y         JKV Ydgt s pU   Rdck,  !     "  `_`  | y  X!WXWX>    # /         4( )  *)*)*) uxB9   T#!)    6  +%;%4  (%'()'(*)*)-*)* ) @EH = :  (%'(Y'( *)*)`*)*) "'*   M m9 @#?@?@c?@?@  Y ^   !     4C!  Y $ #)   ) h8gh %  "5  % :g7 "A     +L! (<  Q7 "A 3=4 =4:  & !    3=4 L=  "=8  !   % = G -0 9     . POPOP     hgh%ghM "!   /-  , @(?@?@5      5       2     32 /    1/    0V/0 5  E J       :   HwGH &EF'$%"  % @F :    0_/0 V   *)  DS  #  ?   1$     G( (   340?GXkyb   $   / pmoJ\ HKGH+ j     p opmnk   *) CD71    `_`_`    ! V ab56/   7 LX+\ #  ' " ++&  2 +H V  f#B  R ` `m&38%  &%  CN   z w  @7 I@ R S  BA %-7#8 1 R `  l   $    6# (L'(4'('( #X    1-M/#X ('('(   -Vs ;0      (    pe  "    ' `.  +!  &fefc 8Zk-/T^&70 UVJ#/ Qv+/ " r;%_  1 #7 + ts3    % Y              VW )   8 N' &' f $& SZ" n&  % _   1 #7 hSghghghgh#   3I   t q   D    M +3   &%   ) &#  n2E2 #*        2 /         C$ " 59$      &   8)7878 O    #, ' PwOP OP OP   A<; DYY&d B ' 9  W.           )  >     &5OT X 9   ) .    `   CBC Lw      %      &I2:Lw POP JQ        " JQ D R  FL !     % 2 )  6  FE  R Q  0/0 , , |{|{|{        <, ,  , C  & {j    Q  &    !       #>  0/0&/0/0 !  $  !   ' Rz AD CCB YTSRi d D   P"J!_"!"!   [  >.: orop 5!c DE P )_ s H8     ~ } ! "!)RX$$M8  N5uEH%  2 )     )      :  ,  I      $ #      /A #< 0//Q- 3$4+!C,! %  25                      -C ' |8   A B    '+ 6  'J$*/ C '   z  .  `_` F   "= J " G | x l     kb  Q(\Y\YZYZ Y,ZYZYZYZYZYZYZYZYZ YZ Y^Z' ",-VS ,-VS ### #    ####  -F?VS-,2 ']" !' $  , ^ h+gh  # 8)78  |    -0= ) 6 L D         ~ s   ,e } ) 6 L D L A  , !        ,e Z  +,_ 0D/0/0.     "5.  8"7878        @|?@?@ ?@?@?@ @d >=   < 0%0|@11 k E dABABA      h_gh u  <F A, `F_`_` _`       4      N';74 `c_` "      %     O@("% 0 ?   a l    >= *p y    R-  3 7  %  0h/01J    3D.% 8;78       ~)!    @7?@ !       noxs loA1 !  @-?@  2 HzGHGH'               ile hongl srknwrqnmU1;D#'   I    $, POP    8/  '" '" ' <9: ! [  KI!X %  O  +  ?   `         )  -&9: /& 36js./       *    HaGH -1       Fa-  1 8-78 : 8978S7878 78    A <  5t , 87878K  ")  0B/0=/0/0/0       DX   6    f  m n  *   A :(K    f  s 2  =   >=  d;R2 = d  CS $ >=K\ [LK  S # G Z i" 8[E[d  AS 2 vdX8G          w D        ?  }   "C "C ,)(# C* f{`_`YZW 65  2K214'(@  _  \-   CL #           '    n  4   k   / skP y 0r,  d5^U  ) L    w D  3    "!"!"!$ %&% & !       x    &6  - *    S    P  s8#x   6     pLop      )$   H!   8            r  9   JG  )         , $ ) mmC Y   D | #=c)ZNE, 8            6r9  u    -6 ) ,    S   P  z6%hBu   6      v  5 '  )N 5  \    9    C4J x    9     C 2J .  @   <0 9 .  -'Ge@ (('('('(    Z  d75,     O<-)!5,.    !-        +  TS0$S T# $# . KT  );-    + % 1=       <  P       3     &NK$CV3! $  &,4+ V #/ O  H) 19 = <P    3   ("'('('("'('('('(/'('('('('('('( '(+           ,e Z 34,           ,e Z 3 ('('(.   (#'('('($'('('('(2'('('('('('('( '(F           ,e Z 35G           ,e Z 3I   B[J      T + , *   !   -. -  .+,'FH  8f&#  ()(POfGC rq fi       63 .-0/ "%&  ABC.?   ) . N  s  '8!+$" d*A#S?fB .      ^ Q. . (%'('('(     +   U%  8cdcd 75  "   0. 0# !!:?<;8M: %50*9H?/#XWB   '  O4 1%_L<,*%2:=.!6U6aW(C% ('(0'( *-.-&   /" *& P>OP-    /- 8/7878 7878Ws !   " 6AB!  \   3O.W6; P&OPOP1OP+OP1OP-OPOPOPOP%  *:K   ! !     !                  !  ,   & % $ )$%  * :    K S"""""/rF      tOBC6 3M F32Q:Q F34PS  ` _h gF E< ;4 v DE FE          :E] F*     $ }'/a( 5%        c Mz /jcjcdI dcd]!ZY   lWJC  X UDUFGZ+  : 21230 `GJK323:7[X abghg $ LMPQ 3,3:up Ue\  :,9$2o6:. B  &                ,e Z 3   [D       hUghLgh. O %    [ F)-      6 878:)*  @0?@?@   *    mdM     %   B%(!" )#<AB    )*O$#.343d.:2                      n,        !f9    v :l z!y z/ ,   (H'('"H      .'" f orklm   $$ t  utyz{   !%'"    'NS   +S[p!<>!|     $   $   % `@_`_`_`@   ]^ -@ ji DA   , ? xwxL 2  /0HG)*LK)povu 2  BC14>=789GS0'<#!%         - ('&#$#*)('&' *+0/0 +  &'"! !  !MKPM++!( !$'$$. > d j  >#    (E'(#"   {|vu    /#"  &%o      7  S.ui   ,  %7   yL  F  c   #m!-L  :Q4 0(/0/0   c $  XQWXHWXWXWX     p   '0'      )$0F9   p @!?@?@?@?@ ?@ ?@. P          $e. P  1t         # # 95(   i  k6 E   >=               ) !7 -%6)0    +  0/0/0    1 BO       0 KB2   M  C         7 O\3 h3gh%ghgh ghgh     #$ ($3  h\ghgh     &     & XhWX WXWXWX WX>WX WX  (   X  ,d `%   PW0        K $#0%(   0 )$"  ( X  , \j "!"!" M:     WC Y7 xwxwx!wx'wx!wx  @?   </ "aIj F    36 56 76;<!/ _D,h  -/ P?OPOPOPc  # " `%_`_`4k  3L> #G P(OP ,+  ! !` _!  0/0!!!<; |      v         8  8*7878 * o`(   * 8(78 78 & o`$  &  o`    . c !!2 1    Y 9xwx[|,+,+      PKLKHGHG       2 .   /  !!/!W&H)"*    1    Y     n PEOPOP !* ' *) \wxw,       =  P ef DC (#p1K/ =;     " !( '. -43D43(:;<;,  A )0    "Jg               3#? M11P$  H,:*&'   %(* *&' J"\w#  _ *   A \[ /  CZYZ  TSFE* )$ #h  -'+ ;"#    _     p*opopop +^   ( $ 1 !  /1B + @?@?@        %  K <;<K     8'   5<      !;N"!;N  VPMF  1T6&H %  K hCgh)gh ghghghV  &      s       *B9,,V&    p\opop opopopop   f%6   9    /          i /    (@'(      <    ) -(< 0I/0*     * .(*     8^78 _     R       *,2,9 0K/0/0/0/0D .    GD . x7wx/wxwxwx  ." }($   6   5:H+   F0        .    0 -2     Q/E%(5d/   Y B + Q,,C  6  - ;F0  t "    i hcd(L  " H#GHGH     "    @*?@?@   (^'('('(I ! ) I   !)!5- P|OP !<!$'uA#!<(   b,Qvuv x,wxwxw |\@$2,s L! ,  R,  &  %,%%%%%         $ 1 !C@?@?@)<          ; N  0W           ! (  +FF Q+m v VZ8.#,,    ,   V!24  !9 0 0   !; 8878 > 5 55555 % O O  0/0                            POP $#*+&                        C u * * * O POP7             5/ 0F  Q ?^]^]+  0'kvwx  0/I  ( P @   ' )1 _Gj kK o=  *_j k  j k 8      ;<1  !  #=1)VUV -. -  !% i         9<-       w;f    B#!&  J+ ;"gj @#      !=   v *"!_$ % (  )./8  ( @ # . ('('('(#'('(U       %  M: 8U 5h  .bae3{baA      $  (i    +  -            I#"! #+2.  e 3 { A J/ts    ) /  '.6  @#?@:   % `_`_`    @$?@?@?@      fI.G( l kh 1 =   ^]^].^]m        "l5?0,Y                    #=  5%VK%V%        8o?  - $7&%/ ;   U  -+ 7.  $ * 0G@U $C'`9'.* -g0  36$5 7(  h 1    =)   .m `d_`W   F   'W   MQ y  # B6- A) y ^]%) =v   *#X !?      3     #= ^   g 2     <2%)    = v   l k    j =  #= 2     =  h:gh     $   0 /0  -' 3 hdgh ghgh  - 5  +     8M78787878 J"     .& " P C     8  C 85787878dM  : NW9S4d**    (. JQ!R*  * )$ # * )$ #   * )$ #    !"   02 5 BVNJ3V> = HP+ (% VDl,@ &' & WZ  ) :o8 69/gjO9z* )$ #vE7 60L$  F , ?GXeQ  o$)2               J$!    =Jd     !-  d.-   (  4'po& ( Q!R (  ( ( (  ( ( (;n! }   ( *('CB (  WZ md(m((( (( (( h!D ;# +*"3 % # !4F!*"+**1+,)        (   ( ' "!$ %$(# ,)0 /0/4 54(38 98787< =<(;@ A@(?D ED(C H IH(GL ML(KP QP(OT (WX   k3++d.-   Q R U  4          F r QU      8    Fd{ *    R. |     ** )$ #,#$!      * )$ #* )$ #$   $  $E#$#+{                   | @dEF    ,3 du <' !4 `8_`_`_`d  )     )dd fdDpo   < L*E. DdLe f1  D?5Zd      h(%>5Z xhwx wx wx.   R O  u 7 (.  ##  %#% l}4n    #4    +   "#     "   4  J   + B l4//   8}~ } ~m n}~      H"; 8    S, "Km=n}~M3"}=n}>n}4n } ~}=n #&m=n} |A{|  "-{    &!     %=    (~*#= 5lk!     6#>A#4  #=  $  = y    |{  N  o-  "  ; B    a )#       6    / %'  $    (5 /DE$H     GP O K% =  + 3 " =`6>4 "=#"! &*=)( +A,+  |  %V    r  !@   %V       8b78$787878 ,JWX ` * )$ #   H]      ` XWXWXWXWX} ~}~ #}~*  OP$* )$ # 2l  #    1z} ~}~}~}~}/~Q  %  )  17  /Q xwxwxwxwx}~ #}~*      $* )$ # 8$!E #             )0z7} ~}~}~}~}/~Q % %  >)  =17 7 /Q )Q<8}~uv}~ } ~}~}~}/~ uv u$vuv %    %       Q  _   AJM8      /  u v"  "   P" -u!v}=n  WZ  #=  #   >  - =  8M786} ~      06  `]_`_`P_` _`_`}~I   %    a05N&2I *fA1$!"J          f_  >     !       %"  ]  VOPz    ;J   2  ! " &   7           07/0 /0 /0 /0e      71 m0}=n  #= 9   "   0=  XMWX <    *& <  6lS     ' 6l UR  J &   1  %         %0."1  &   1 9ZZZ ,    )( * / @ P * )$ #  } !* )$ #* )$ #  !  ! /2   !    ! < %Kf}&GGC'Y  P G[5       )          / @ P   p"G    G 3"G65;"  4, <  "12 !"     7    &    C ;E"&.E* ,  <  XWXWX %(     % pzop3 (  % !0   BA -"  $ ! KD, *3   pOopopop !  !"    (     ('     "!(8!  ''! s    ,    "           BA%   $$  $ ! D,*      h  !0  8?@)  (    E:7!@  }  !.";! 8C/    G E!0   K!  E !  0I/0/0/0/0P       )#*P Xe /@ ]j  `]^Y%%LGW    &%('( /       N_  KA 4     %  -,/ PQOP%      $B     *).+   3Z&I'  XbWXs       ?1 hghJghn /; '/ POPOP 3 +  6) 4*!   `+_`8 ,  - ! ! ! ! POPOP  .    @??@+     $+  vg   '   D*!"-    PHOP OP } ~  }~      B      ? V   1)- hghFgh l " A      $  #3*  %= 0/0/0>  #   ,      e ur 2  } ~3 }~L  !            +   C  : <Z;  #A%$ $ ( (  L znAa V B !          .         "        8 ! IZF' ($ A *a R   '  !   #"      0E/0!/0/0/0"        )  ,6805'   g `_`"  `_` _`6#    p&op opopop# ;>   &      &.) !42    Sl!0 4 0/0P/0 /0/0/0#            < X C $   0'/0/0 $ $#$#  $  1   $  """" " "@    $  1/%   !, # 2J)  0*/0/0 F%   IJ #    pop% ( ! "/%DI ( ! % ) # ) &   ()'('('(`&     # hjghw& )3 # %  < )3 &    HTGHGHGH  U&  $ $$ $    #49/#  U hgh'   (v% + 0 " 5   (% +0 '   4' (  % H+GH GHGHGH l' $ $   )  i*] l POPiOP r(  ' '   vu     . F Q  . (   ((( pAop[opop op opopf (      + ++&        5  82ID3\43         )   `_`_`_            ! RQR QRQ   &     7<  + >*%0 (   L:'# )!        & *  x>wx/wxwxK :*  /( (     K70!K : XWX WX WX+                 '   %    '$- '  %  ('(#'('(( -+   ) )  G( - PuOP OP+          .  - (P ,. *  L, (   ,,   , p}op op,       ,  8  /;    A,   , @@?@G?@?@?@?@b h-      + ++*        0/ M2[    h   .        !  &7<  $: 6 (   4:'# )!     & .    lk , *   # ,  I*>=7/  ..   AD *7 h="/  ..,Q," h3gh gh,>=/  //  ',  <,>=0  //  $#$#$# "                 #     $ -14(C=   Ea>1G>= >=)> = _"!>= JIIJIeJIJI$0 ../'*..). / 0 / K   0..  ++& ,,!! ++!++2 5o7"`, Cb> r  "  /  )  ^ Ie$>=> =1/// /   RM>=>= >=1>=K>=>=>=>=0+./;,,(./)(000 0./1   00 #//.. //# 6/66 5-%  :" J'$M       "K    e)F- \  2 0 11D11>"11:!11 10111#$)*111111111 1 &4'D";6_ ,e)F-        <I2' |o: 3   **3  % 2222  4( -R:  3! l 4  Y7^cd O#XW44 34a/9S*)   43_ 5 `+"O   @E?@    5  4 !4 !4 "(       6 7 * N7 7 8 8 8 9// H[GH  9  ////////#5  @V?@?@$9 000/      )$9   :    *  9  *#!p :::; &;8  3 0/01;1 m{; ! (   "- B;     ) 0,/0/0/06<;";    %6<;9 8278 7878,<;";   1!,<;9 `z_`_` _`_`<;"; "     # <#<"4<;9 xVwx"wxwxwx{=<";      4$4I{==<9== XWX WXWX=<"<             :$A*-d+==<: 0//0 /0/0+>="=    0"+>=; @Y?@?@I>="= = 4   (!? (>=; `0_`"_`@%#F 0/0/00@  87878@  (6'('( A @"@ @ >       4   A @"@ @ >       ,#A @"@@ > * "# % A $  6` ```%` ```'.3 3k)?   @  @           51P!;$,*4@ ]!JI JI,B>><< 9  4! ,C$B  FB     \:  D   01B=D KJ   RKLCD   + )*   rrrrrrrr,,,,-.CDB%% 66%%   " JIJ)      "7 *%;HG  '   7 6    2,2)j0 7    )9             C!D `[_`hF  "!  - F 1" $!HHHH @1?@ ?@?@?@ H    RI 8 JIJII EECC: ,' 87878J *3434ux (H9 `_`_`_` RCJ   FGGGGG  0 $ 'W7 1:  uK       ++  V S`K `6_`K    !- ? UK    &" + 7K   '    XMWX WXAKK"J      "$$ AKJH       #      5 L       66    ,  ,   839, 21 &; &; < ./23   % *' $-  !  T cf   i-?UV    .3/A           J    <(AG`%Q  X  X @^      ! -1# MMLLLLLLL %f5N  ! /0  -   ,    3 O    9$   O     # -I !(O ~)}~P}~O IIOOOO (  II/_!   )P * P   !          3 -71 >"    <  \P      9( 2  HGHQ  ZZZZZZZ Z.-- %-# X Q   u   `wR      ///H 40 -''    k*uP%!!  S R&R' "R  NGRRRR" "!  &%    MRS ,  iQA  '    H#GHmGH T      ),   .!  }  8)78 & T !!! !T`SSS! /  T  (!'( '( U !!! !! 3   HDGH ZU """ ","    A 0  @9?@ OU """ "" ?# %  tOOK U """ "- @787  87  +      )'$  3"   &$W6) $  B3   #0 V ### #>> >?'    "'       U# "-5S' ,  P:OPOPOP xW $$# $1 =   $ h9 J  p/opop"opopop W $$$ ?*?? )??#$ =0   J  xEwxwx rX $$$ $ $ b ( H  hgh.X %%% %           S$% D+      -  2  `5_`_`'_`_` _` Y %%% %4 ?44 & " #B  2 Y &&& &"  "" "" "" """""")  9& ZP%`.   P   Y uZ &&& 'AAAAAA' e(   IOQ0G "!"Z ''' '8>88$ * CC"CC# CCCC"CC     C: 9ByCC#"XA? !B  #! "+  J""    (    "    g  hPgh f\ ((( !  ( :#*    \ ))) ) ) I   " 8  ] % ) R ;!\] ))) *   # """5D55DD  2-   .=S7 +      # " Y1*N2 +: O         q   _ +++ +  A+  (   &  _# KV>=Z>=_ ,,+ ,6E//#/ /////#0 .. /  I$/ fT> 4(_b4   9   ,     `0_`_`R`    *  xwx` ,,, ,   ''''''''GGII . - - -,, '     F+ : ]         Ga.@>=P>=V>=Z>=^>=>=opEp op=p` --- -1 ..  11111 1111111 ..  11111111111111 ..  11111111111111 ..  11111 111111111 ..  11111  & / &211&1..1111 .. 1``aa```!Aa` `aa`#=a88GG       % 1 JPTX["6  ,  c @DV\`dN >b 2 "@8&                  & E $#"=#&%('  $(6 a ... .,% \\\\ -%\- 4  ;G4J*  }(6  878 ;!!b  XXXXXXXX  56;!! `f_`_`+_` b /// / >  $/ 1'i  b# hghc /// /   $ / O  .4H  c# Cc"" , 9& < c   5 < j  0( c! @"?@Dc  k d 000 0        #  0 ^#+%&    5 Kd 111 1 1 ;& !  0./0 d 111 11 4   @s?@?@*e 111 MMMMMMMMM M   v/ "" e e`ddde ((  hbghgh ghe         , \<f      7S  g c c ;;; ;;;6i +    :  B7= pT  fw!xg f ffff3f^SLQ --Q--QRQg gKPQLK g g----  >787d WZ d81D       y gggg ('('   @[Rd6 > E= :    D6-Y  2II ti %iiiai Xff . ... u     #-($ 2     3    wxwxoi  ggeg+ 4#   @Wo 'w xj  gg 2V  G   #' "wxwxj  ggfg+ 4       @W ej  gg 2Vjj Tj ``    %  5   ' HpGH   9   k jjj"jhh hhjhhh     %%9 k22   5k     l   }/ok;poprl $#*, 9  jjjj* k3kkkk(       jjj Y$  ( &4'   >  * !!,  8$m  XWXm  H%GH0GHGHGH O 8m  22  l l ! g:@ ( 8m      70 hO) / El R m ::: :hI-  mnff"   m m1+ L nnn nmmmmmmmmmmmmm!%#               #mm!m2 $   > (  ',0+/ 6  0 !  T:)$ Xl R  s!8 !  X)WXYWXWX o <<< < `    < 2   4   r  2o<<< <0/         A (< A ( #   <,& >  ; *!!8 p# p[opopop+ , *p n* )$ #nn \kk nnn* )$ #E 4             x>wxHwxwx q  ! p p% 1  (*'('(q  #  K]q       qqqq> tD  !K]r `3_`"_`ct'#F 0Qu +  0/0/0u  87878u  HGHGHu   Qv ,,, ,,,P, ,,,"&%"33 m 7          ;D)2TV p7opop]v  0  $vv  \1v    %  -  #0  vvw   @3?@?@ "yx!0x  ""yxvy  y`xxx' y  8:7878 (yx!0x  .#(yxv (9'('(Jz        0/0z  h-ghghz   " zz{  9Y IOPO {   3  z zzz{wz{w www{NPD#Y         1:5+ 0 K/u{ z z  z z vvv`z     &&&& $ vv  &&0vv ('v`{   %% c&& u% 4MG0@;.. )($ E!  &! + 0 "     N/ *+  @*?@0| vvv`vuv @ !  popop8opopopop| B)7F  GPO &-   !    "6B B ,  h2ghghghgh} % xwx} $ $$$Nb   0F6i ] y I~   ' } }  %#ny I~   1 + 6 B= B~  #"+!$     ## ##~ ~~~~~~~ffff u uuuuuuu ~ ~~ > ~~ } ____  cc     }D|  cc      $$$$ hh$# ,  /  -   %' ;B    7 1*    Z w!b A C*A xD} 9\#!           D"j"!"!&%&%.('& %Y* ): xqwxwx!"! ! ! !! !$"%$     0(/0/0 !0 ! }  !0 Y dYY "  e  '0"'*!} 8/7878 !0  $"  } 8678 7878 /!0   5"/~ POPOP     K!"!"~~~ !0        ;*X       K~  `  L121I$_!N xw xH ĀH    W.H H6GHGHƒ  &'   ƃ߁ځ݁     ҃    9R      > !"!"܂܀    !     #   f      Ճ!"΃ك ҁ3 ! &:f  H^GHGH   :s!0   @B : y        N!"!"ރށ݁ !0        T%54      N Z + !"  2!+        ƅ Ä ƄńȄ     0//0/0 !0  %!    :"  {|{|POPOPOPOPO 3Džȅ B;<    <ff % &i). J12^]1 25634B m). Z12^]1 25634R    w mA a7 aj+6* -> ->                 U - &  -&+N҆!       0NQ6 i   X+@      0!&3ч ҇R!!&3R!!&% "   yppyy yzz     ч    և$#$      ;D  Ul ׈Đ  '# F$ hRO\G.'1103 ,J U9 '.! p6 i        !  @?f "!"!%$#$#&%&%('   f 9?  f5 1 ʊщΉ͉!0Ή         \*@2 f5        ԊωƇ p l Յ؅  \+E   =          n    '     ‹ ي!"Њ Ј Ԉ  ݈hފLS hLKhC /R] R OOW  &"ʋщ‰ ϋЉɉʉO O"!"     !g'$ 5 *T#;#/#!        G            hghghgh gh               %F< d z          D)U              N      7   "\&  Y    V581.  +0q[|| ,'&"Ȏ5ƌɎČȌ5ED,SMӏ"΍  !0  mm EFN65 "ݎ l m ٌڌٌތ|UVs[ v    E,5 Q!19 :P     .  N    B"!E&%$%&%*) , + ( )*)*)Đ!!   !0  8/ xxxx x    *$4mA   d S3' l >= đ    #Hc0!$  l   [*JI! ы֋0 -*!     !"     #&   ُڏ ) -$!($#'  4   rB     "  % >  '     ,       A     5 ǒԒ"ʒѐuʐ)<ސՐK pmnK =? 9 04 vvv`u"  - G? /    >&*( '  ,           5 8!78  vvv`u “ `c_`7_` _` _` _`_`Ĕ  ~~~~     K  C* 1# !   *+,+  *%      ,-  -   #$a,-,  (efg <"! efg <"! efg <"!  efg <"! efg <  efg <"! $efg <"   efg dU   ,J&  ;   U963$+$$"*J-oH!  ""  4  ; =  `=_`_`+_`_`_`._`_` *      n}# a`,     ', "#   na3B^ 8>==   %>=  ,ppW>=Jc  gg g ..  gg.    ggggg .. g    $#$j$#       2 o~++"cc  """      T p  " p   $#$ ۗ3ݗ3a  #     h {G # 2 %  $n '$Sa  '2 **".: 1[   ' )A !\$ %&%,-01)43&658 9  878  > K>=;>= pii i //i iiii iii .. iEi05  -   ]c :         X36< Y  W  ~֙    Ă !"!"Ղۂ Ƃ  !0  ____  ++ _"  J   e  6>lAV< R   !       )   0  '  Iš ]]]] ә!"Й"ՙ" ݗؗ          6 =< ' @  P*,2`   5 V      s       1   X yyDyy  yz!"!     Йz ل܄ ߄؄&  z:ƛśț"  zי̙HCǙ™zzי̙HCǙ™ӛ z:;87S z   I!"ך" ɃɃƃۃڃĚÚƚ" ǚ    Ճ   T  /x  = a)  2v!' =  ~ \          !!!"! &%&% &%&%$   ' *)* ), +.-. -0 /43876 787:= <=:A:9D!CDC@ GHGFGJKNMN M D/  `d_`_` J !0 _ _    #+(  HDGH GHGH <!0    9##< } &vvv`ޜ&uڜ&&&&  )G         PGOP OPOP ?!0 y Ƅ  E% ) h8ghgh)gh ghgh i!0 y ބ  f  h o% \ 8@(! &/    .7.g g 5 63> i "    xwxVwxwxwxwx* eȟ ՞!0О   k#- 1*  /؟Ӟʜ   NJȊŠb bx% 9:    )   !" ǟ  $$    G \  " #)   xxwxwx wxwx#   gԠ++۟ܟݟ؟ן!0Ο      + 1' gڠ՟̝ ]J A Lz !0   !0   F  -+ "% A  L X[WX 0ء !"֠   ' !/0 JI  )   آܢ XWXWX:WX??     L 2 >??   3    " @4?@" ݡ  ޡ " P%OPOP  & P%OPOP֣ ( # $( ) $#))))+6     0./0/0 {| žѣԣ   {|{|  w x  ϞҞ ã"  ¡ ;    4V        p#opop     % 0/0/0          /      $Ħ   ֦     x9wx :$  `_`         ) ʧ +  ԧާ  Z*JI  0 -* ڨ K V  pppp77            ~$LFK  7   2 $+" Щ G T֩           :CG 7  2  P    B) Ȫ̪  j )8ت  <787rrrs r66r       4 Y% ` )8! Ȭ POP"OP OPOP   ÔĔٔ̔+  A Ӕ S  nT$v `  .  ֭   = 1. @ U `_`_`%S    $,,  -&% *   % ? .#e'1E XWX$ȷ      !    '.b k! XWXWX       3  -JJa? XFWXUWXUWX   >        ;        ?  **  SV=> ;     ?  hghFgh#ghgh        4 ;  30 379 N_ T  S TSTSVST ST STST S  /-F?VS-/ &&&&,-VS& && &  %%% %HQ)   :!           XIWX E> !?"' + E H@GH <P #<&    < d  v     3 6                    A )          J    n#"$))I     y R/[*J  "!  43*  )4 / ,#     * )$ #  '?\R) :/<k R/[   J ( '('(E'(!'( q      K  Z# `flr   16+0%&%*##4  %4_ H!! 878,,   0(/0/0  '/ G    &  '   $ B8*%   h k&&C> haa )J J[   "JJb    \   R  1    * (           |i lk `*'11  d=UV'7  ''   5Z ;% u      Z)?$<< d V,5k.$a )    [   "b$#$ !   & %( '\* ), +. -R$#  1 h8ghhE /, H GHqGHGHh2      5*")g2  @?@?@h _ ` _`      HGHGHh $ ('0/(%5>%= |  '%2 &#h    %2187>=DCJ K X YfABe  "!      +E %             4  ! XWX0WXWXWXwWXWXWX(h      !   '0.]$U 7a h %%  $  #8 )  u  *     / '% h F    }   3 % A|  3   (h:   0    0' } & } &    !Y%9   &        &    4 hI  0   0(   0      0 0   0..3} popm q}=8&5>2y}=87 &5x E=}=87 &5}T}=87 &5 }&"}&&!}tc\  3P    e,v"#v 44r H  &        &     &  ! $ %$#$# ( +*)('(  &-(' 2 5434 &7 < =<;@?<; @ &?D GJ MPOP530H n   (0'(    1 ;!(                   \               w 1$M  Wv  @;!(          8 7878   878 78 78   $ ^]^]5 == 6565/ #=#=w         5 = =    0!/0/0/0.j i j i       7"4.     pzop opop op op tj i=        q 2#0:  t =   Z'"4{G  j in! i"f5e    A *efefe      2!        q!  2 !"             0 ' $ $ * )$ #" Pt 16 2"$  6 91@3 .1'F!  .G   n  "4     A O    e (*'('(     H$GHGH         HGH9GHGHGH J Y     =  Y XXWX WXWXWXWXWXWXWX)J d         AD) d /5X (j i  p  Ea   K     !"               +4I +&IJ      /  a!"".ePWR J (    p       Ea       `k_`/1  A9/1  hhgh   @/ @?@?@        s !=  #=-     != h5gh gh     %    !  .      ;. $     0/0/0    0&/0  A  @  ' PdOPOPOP&OP    ) B -U*(6   m. Kj i*. j i6    *=  P5    *).#       !5'  K *.  6   ;I  IK &  H BH R6"  # &X   X ^1Z YZY(ZYj i 612)     8GL3 :K =  .1 (     8;78 78 7878_j i       8) +_   HGHGH,g 27678 ?6?1"  '  HZGH, % $%& -$-   /5  R   0 /0%/0 # 0)/0/0 " 02/0#     EFE2  b   8#78 78 78bW XWX/   3% / V~=)')b  & $  [#\  [!\[!\[#\        #     $&*# '!!#  "  c Q   # .B#   & $  #         _ !!#b   Dwb IFE?,W X    BWX!S    E    !@              "  S$7 f)2% 8 .        3  "     B!S @A>:=#DCDIF:ELOL:K R Q"TWT:S0Z]Z:Y`c`:_fif:e lk nmpo r orq twt:sp o pozy| {.DC ~ ~ }~}: XQWXWXhWX1 ,     * * * )$ #   * )$ #* )$ #EQ6                 {     '"  # "  a1" n  f  @     D.?   W .n ]  <  6 ;*6 ; 1 ;    T#-    2  / <      +  0$/0H .1  |   st etst !      )  ,Y !$$   (&'(0'('('(   ! so w  _&G.3,     M   &  {|  n         *  !   ZS 8T        88888  :  ?>KL{|   Z + W       &    !e!  mn     .   i       f+EX%_  O  2)k+b&M% Q ') # "%"%8(96+,^-/2369< f )     &n"!j$#@&%&%$ J( '('(' ('!*h),+, +,+    3  %  !I!   % L4w# 32 "  ""  "" 3 !!!        & 2  PHOP{4l" "#4".   4 `d_`_`     C""""""0"    #  %  #C#"  @V?@?@  @#"!0" ##  ! %"; @#"  87787878  /#"!0"   5!/#"  P,OP/g#   .?!F P+OPOPOP/#    .DO$   xwx{l{4l{4lG$ #3#$#4$$#4$&A& G    4 4 G$ 2V*{=l,{4l  I  U V%   #%EFEF   %#=%  '%#4%"   $ ;  %% %%% %%%%% %%%  %%% # #h  S 5  F  &     2*=, 4  e     &  `g_`_`AJ0)    !(()    &A0 HGHGHGH  #) (  &  # XWXWX6)  $  .DRzc *    -**))#8 #**  ! : L /  . $ 6  4 Ez,  w   p+{=l**#=*4     +=    / +) +)  **"#** I +  %$+   ' /  +)3 4) 8 78787878 -+ + +++  +5 -   1J ,* ++ $,+,, #! 1   8,*3 4* x]wxAwx  {4l0,  %%+#4, ,,# E   %  3  4N @'?@;, HCD)! @+?@XWX WX - +++ +2-.+ 5(   )7 c#  S   Z - , ,-0   ---  5- - ,, ,L -    C o ,< ?:  &6h X ' #  S   Z  IO :X. ***  *  +%  :X-        ?00RQ00"/  0 -0"0    E+#      ?0/-       11RQ10"0$+0 . &%    $+6`"        %1 &  2000  `d_`    #    2 1!"1//#//1/   !J#   *   stI21!01 "!"!"!/// /   / A#s  ) I21/ ?L2  '3   H!GHGH GH 64 84  0" 6 @?@?@&?@   "5 443)33 (3-   n(b  p  5*  :::`994    4 5885   * ,,"5*%   "   Ac  [(2 0   `R  1  !6! ('( 5 5       "6 :::`999<55  55 9  "R\      =    7   6 666')(=   +          *7 2 (27777777777!j  !^ +  * 878!7878        7 7767  776 66   H^GHGHGH     +PO87!07 888888   66  4"2 +  875  G87!07     !+G875   9888888     9 8889   hEghNMNM9 55339  hegh  NMNM9 445533 J ,'   x%wx&wx wxwx S:8:    !% &$S::  8%78*78787878    P; ::::   $,P  = =`<<<    w({4l yzyzy z> =#4= ++ ++88888 80 -  !@4  > d>  <<<<    sd>?      `E_`_`[,      !+F1 ('('(vuvu   &Z      g    .,_J 8378787817878  v4vu.vuvu         0#/U  . -F  C  (I3?023@;cN$ ` &  xw -  T L [xw &  xw % q  $I,>  P18 .+  (   &# 21   ' "UV   U NnaX     "5 xDIqrJO klP      *+  +  TA Fv     "#'   E 9 5 ( s(*! -+E3   J   *S    $O" =    N ` &  - T L [ & "! $# &%%('( 'q(' * )*)*)$I,-,+>0 / ,+  +P  1b\ ;   8%782P )F)  xLwx wx wx wx:*      7 * ;:* @?@?@ ?@?@?@?@?@?@?@?@cxw+           h-c+ W=x w, +,+ , +,+   # "   &'      xmN   Axwoxw ZxwD `5gl  b   :   7  :"^#J" Q3!B! ;!3 >  1  U      J :  K0I     0     S %7 nK0I $./" xw          3      !'. ( D       zy:9 *)"+27ZYJIBKRWjibkr{$`  `h_`_`vcnL  8 A "   Z    o ,+*Y.   QD <&@IX ]JoWvP7      c  n      5 ('('('('(*o   m  "*o   V0     $            <B,$,#Q ! ' / 'V0  ! =   ('(K'(E'('('('('(  ;$UA Ub#xwx wL *,!"/:!   #L     0# +  Jo "%7*(Jb#   L eM BxO Y      % 2YZ     ' &   '%"&%X  O &"2#7$&J ./O    Y  ( '('(6   `  M   # !0 M     8'787878Y   ?   h    `q ;D    (;'1 '    s!  )\  0       #5F<<   h   xvwxwxwx8wx%wxBtststs       : "9  d 9 ." + ?0  K! "lkSl(klklklkFl*k%  L;    3    3 + * )$ #  3  !? * )$ #% ag&h*1 :  ")    F % POPDOPOP!hghghghg hgghg            3^   %" !  7($P   3     (*$P { :#+        # o9 :#+ `6_`_`_`;  !0  *$$;    XWX WX       U #& P8OPOPrqr qrqr           ]rqrqJIJIpopoJIJI +p\                 D   7 @I6        +..  !0  :965$#     C I   ,#e*  !0   0,/0/0!0  !"   04/0/0$!0  ! $  @?@?@.   xwxawx wxwx*wxlk l*k #/#  * )$ # # # 8P      #/ #  8#78787  H^GHGH    -F?VS     cK.     8+78!78 78 78    !  \;#  G       `       !""    \       1      $w  xr%  >  B+*     DCp  )-F?VS) )      '* ;   &&./,9i2C *         p  8J7878#    +2,1         !"!"   !& @j?@?@F&  $#"89,@  & ,H*)  z#8 *) 6E  ;P8 ,$+j j j  l ? ) `/" "    # 9    V   "   "# o o  "K  )           %       ooooow) .D  "b!+ >  z %49B    "!I $ '8    ,    #  < C#   " # &%( 'l*)*),+,+. -?0/0/0/('('( 21) # # -:   #    @?@?@ ?@?@ 9u )     K4B9u 8`7878787878787878    b  C n n      O        mmmmmA'4#2     W  C +  4%  !0         % c ?!47  4%     $  #  `     "        "          - h :%"         @~?@+/   !"             /#"+/ @C?@  !"            !"         !       ` 8978F     ;   !&$0       DL.* "  '  f    B///...3:9 /    .&   HK, #      (  J + .    75A$T$8-!S     >I  #  7 .   $   ?   }~}~+P" ( - %# kR GRQ  ? TS0[   T+/0 .3:9 / S>=NMH   )3 #       '%  %W(3_  %H    $ G @/?@?@"   $! S+  / .3:9 /       ""  "l  Z1  $   30) C      #+) C  !0 !0  ##  xewxwxwxf!0      2">%f q7  !"   !! 7    e x 9 .-4+G  : Vh /0+*Q FE'c  4<    "<   --")*) *} ~)|          <=<= >;      SAG& -0n H     k !0    %# '  , " #  -% '3|%@ P[OP 1   R1  H  @  @(+ ,/ *  0#   Z ^on}|         #= 6>`7     9 =J 5 p   H        %B %G5:.       P ;=V! _! !6 ,Q '!2!$ $ ## N*%&%*=)"*),=+",! $7  X% = @? @? BC :  B S; V  ?     )\  S"!$#& 2'* )E,+.*/234%36 56587 : 9Q<== Nq3- $# $#@$M        >   .L =3" 1!- $ )M =v#=   =-   h.gh   $%   0/0E           5  R_  I#   h0ghNgh!        Q*!'!u !  !"!"    !  ! !0 !  01/0 !  !"!"     !  @B?@?@2! !0    !#2!  XEWXWXWX=!!"        " =!  u- "   !!"!"!!      "A  %E]Q..-. -.Wvv-.- # $ """""     " [\   $ #"!!#"U    $ EFE$_      k  1"  H ;#3$#3$ $     /%$  "$  s  !M!wG`* 0)>gnD&?  !' ^ : L      Q   CYW !$%f  5  H6GH GHP$    3!  $# HDGHGHb#   )'#  #$TDCU%   (%. )#   q, +,+$ $U z+*kS-.3- .-.\#$R& ,#  !!Y0/  ,!   !)!!?D -b""eba) %.$7'S H 1 @3?@?@#$#$/( "" "" % $&/ XWXWX(   /4 ( ( 8989 :7       3& ,  A D  l'    &.'( E m)     % N " ! )''' ****#* 5))h*   4u4v `4v**!"!")''*(""""* *0/* *.-##+4+**$43%%*3* (( ##+#4+     , h'=FG  K L  *)  2 K*I   V=G D9B6)* i `[^q ncl g  O ) c + bV a 2 ) 4    &"! $         4 G4 =   " !"! """#,*** +- ,!"!",**,*  ! -,!0,  &! -,* a w-       =% .    ~ . /.)*%+* * ***|  +    _.-!"-++-+++--."-  * 1  .    &C      ,.-+ HoGHGH GHGHy/.!0.     ! -#S(4-/., `y_`_`_`  (/ . . .!0.,,,,.,#  1 6     (/  00000 @?@  W30 / ///////.u?S /            AF ' 3 1  0D/02          !2     !0    1 0          v 65BGH       U   P   (,  $  >5 >/           p ,3  >/     '( %            >   POPPOPOPOP        0CE;   ),'Ac'IA7\_[  1 # !          &*   J  EFMNcd!R T  M&#E 5jB  '@#  ! ' A7_J?!  0/0 '<   gP  EK          >  .:#V 8 %!)  P B   @ # @^?@@?@ +*(  ehcd     > / #F" *(  . 8 : + 8B78O4   <5 !      H/GHSGH      V &!/4 r 4 F# x$x"x xEFEF"EFEFE `W_`E<!?5 +E '        *  > 0/0 3 k    b a  PNOP<N#<)"   < \sba   @?@           (       8/78 % 8178               P5OP,+7 678 ?6?7"   P6OP,+7 678 ?6?8"      a   a   PdOP,V+%$%& -$-!   /? L  PeOP,V+%$%& -$-"   /@ L  a a 0;/0 )  1)  0=/0 )    1)           HGH   PO\[hg P3OP   6    #  H GH#  X=WX  1!   X?WX 7777 2#   h7gh# 7#7  #  R    7  77 77 77 7     ******     !    6 666)  x-wx"  ĬìƬŬ   $  3 3  ((   (  (     (  (  ((((************ 88 88  `<_`" f  fff !"  (<  i <'f    @*  M*  H-GH   $      !         p;op% % "  %       $ $ rr       0 I1  ' 1 w www +   $ H,GHЧϧĪê        0/0! !!! ! 1  @-?@  *  8478   + )   >= j\̝   ՝  %\vu$# `$_` `R\ !\N %R]] &  O O  O OO OO O 9      V2   ' $< Y;$ 2 K2 \ [\ [ \     [ ^ ]       HGH>GH2j   3 "* T SJ      HaGH* T, STS ^ s  5 )5   *f  @?@?@* T Sn      @?@?@*-   * * nm   * T S    * lklk   9 5   x!wx*. "     PWOP* hgh%g  % 8 ; % * T S  ( '      X^WXkl  E &5  A,(' ,  D , ( '     d c  @(?@('('    ('  (n    (T {     ( '      PcOPgh% % D %;%  `J_`_`_`L  ,   `P_` _`  #h T +)R 4{ .   #l S  T |     O 878#78)78 78    K+M  e    jij[    _           $   /$# $#      " >8#/             _  ]   c               Kr ]c `<_` _` j[   5   !$ 5 H/GHGH GHGHGH GHGH       $ k- POPOP OP  !    & 78 0 ' (Id@ ~!&9  -   78     FX   yz $@#   #   F H          m&   "H "  0c   s o"    -. nk bklk    !>      efef kla Z & a XWXWXWX9      =lkla@07 !-J$#"$" ;"$         s o ('(6'('(]'(&'( '('('( '(2'(''('('(    d,+ & mn    ] {|wvsr VQLC   " 3Z# e$x pNop2  1   LR\  il!    S TN    %$z      ),    ),$ /Ek# '3 ]qi!   #&6T o    #$&        # 9 2X+$#G*   #        &6   T X.WX+ +X W;+ +N M (  `._`F(#Z 5 ) np    0+"  ?!0+&! 0! -M%ER  i!x pQop WVUVUVUZ. #,  qpopopot 434;% % 0 /0"/0  7 +   @-?@% %/ P#OP0       "! &' ./6B  65/ *)#     /  $  $ 4%       PEOPOPOP OP OP      3U;B 0/0/0      @?@  )2   8  3</%, W .j      6 8778-78O78 ^ _+      7  d # #R  ! H4GHHGHGH,GHUGHGHkGHH ^ _ ^ _j ^ _- rij d2/-14  d     dan '#A\iF   !&     !     ! 8\78" ^ _2    d;Z     %  E  V])         '  B  %m    /Y#I) 8Z78 78     / [ 878       !C @?@S ^ _-  (    dm 5d     `_` < ^ _I  d!T)z:   # D0 / -) )K Q%     #           %  -'  g*P  +) ! $ * @a?@?@?@j "   `6p2  )36  93/;CF  cfclk/t!  :%1"(% /& n   '/9    + 4   '$* }    $ # .- )*     (   9 + 6!     2/  1  +< 1 #*%mwK#   .& H`N RU VKLaNQL%]^STEN#  =   N  !> +"= 1 Z/ G B G 6 4  O_ -=W$3 .N b?P      /$ .#48  -  (LLP  ..!   V   >G.QT.c  z  %o & / 5  - 0   **,0%#8k7/*3 -@ - -  - ..!         xQwxwx."6 < p & %  MX    !%2Y 5I'       T  ! ! '         OR    T POP OPOP OP OP&    %] H (  P&OP4OP OP #$   #$ 9+!J  XWX  )2  "' =G- X      * X&WX_WXWX: X Y& 0   P 10  !G@"2  8  :" X Y2    P   8P78 78    / Q        @y?@C X Y- WX P] u    `_` 9 X YI  P!Q)w7   # / -%       ?A^   * * /0   & 4 #-  )b$ @B   * *            ' 5 U& *% K  B $ 3  $  @Y?@?@?@WR " kp    WX5.   R.{ ADAJI.P   % 1% *#<H).  ;           1;   ."P& &       ! "  " "!     '" &"#       W:k1 0      .       ) 7 $l$p2A   '     (6 E#l&  k pCopopop F "'I  ' //\6*c^_bo h  g 43^]  WVU/M ihg/;   %B 3 - ]#5c56" (  //[ nbY\a*  ##! Wno'    sx- 0 5 T   R            )d=  #5@\  (   878786    P  5B Ab .-F?VS-.  @   5  %& ' y   &   (& )  !!! !!!(!!'83zd 0o    g!@S?@??@ ;H );H  8?4)--VSI &$ .1  A -!S?)    fg3      ^]--VS!&#$$ $ & Q1(& -3   o<g J2  &,-VS"   2,-VS   2=>&"B9162!#! 2J 2  W)   E   v       ,  1    s ### #,-F?VSH, , {^ + +& + +e 16,-VS# "" " ++G,-VSd# "" " rR},-VS# "" " <* Y^+-VS# "" " ++o,-VS# "" " J !NU1<=; 8=@:7 3       E  v  $#" *)& -. -0/63: 9: 9,@ CD C1JIF MN MPOV YZ Ys c\Y   $'0  %!!!!WXW ))K&@   " 1$ "*)-VS)  -1` GZM(1D5(7!A  H$  / Q  "" 9#Y     pKopop   -   )   - <  `  \[QRQ N)  >=>= >;:;      ((  A:!8 $ !FA2 B  C    ` .         '6G/#"7!U  }Eg<  &    '''-F?VS-' '-VS# &\J19.  -<   &            D    *o 65T65  c  456565 " #)*)MGF]^Am$CBKLKR (zyz(' DA&  .=(^aJ'(^*$' KC(^(     c(^; * ,(^(pen ,-VSWVUpUVUZqpo  ot   A 5a<S<;   BG   3 O    OB5#,44TqS_i5=) +)W !!31.F `4]C.8.G  /  !) % 2&&B8#&!34+/3% S4o T                     ,-VS-!      H)GHGH(?&   @ ?@?@?@*R0   1 h{gh   .  ) * -\  POP   0#/0     0)/0/0/0    ,0# hSgh < SLOBA N;    N;    !B +0;< ;  0-BA H;  B'@"C: xwx/  '(%L%2=> [D ?21  "  3'M]+^6 %M&    ;>= V] >5 E(     pEopop,     +93#* 87878 $ h[gh Y^]  `g3##' AJ f N  "u    @ V  ^] $ N,+ ! 5+@  2T7>7*~ "%@ 10-@1 *   ,#e")"T7>7* %\    \   cP!;    |  (  SB XW!" TYJ mnmSBfmnmSBf          65%\IBk!G"5~s,+      +%R? ? *@$ 0 YpTC >u  2mAB      c  G"!!$#&%(';     G  !     %   % ^;*+=G) VV  ^5O  ]!          %   ! $1 j t  %B3V    315O  ]     U B  @ 1 -     .q   jr@.qv   A.q  E.q  J*% P.ql   W.6 @?ruv  /;<GH 6                   A.*A.q  A.q k #Jr@? *  PG.q(G<DG.q(G<    %G-q)G-iurq       G-^q G-^q 6Gq G-W  q3#~l)%B'S'#!_4-3G0> 107Ntx9X>!E" .    #  (1 9(    ! 1  -$#$#51%A2>    (' *), +    "A  *  ,                4       %      , 5P/(+ @?  5 34KL :I, %    F34I 1'Y >7F( /%  I    ^]VUVYZ] H7 % baH   \     adQf                       baH      "bI  I   HbIH  $j'u % $ 1 90E <vAK"   H 5.)? #% 2!  @     "8"@ x        1 x  xfwx3X            7)6/ 3X p opIop         T ! *      UW . $    # r JIJ  MI%  HGHGHG  T              $ !:1    T$:     N"* *LK   *    ' $*$IJI JIJ7r'q  6   #(Y:    K  D            $)*5  v u T     tqrqbaf    /z  4 J= ba               o 2 "$,<"%(    F-B !` ! 5HC  & k,HV& %v : r ? ( !5   ?# k #! ! \)"f,/ 7 V v:r g,H1   d  +   3 l' 1dH S3 4P H+GHGHHB I JK   D Q   HGH GHH9     xwxwxH   }+   - (0 !%81}3 4 `+_`_`_`Hh    L( H PGOPOPOPH,$ #    !2 ",  pLopRop opH  -  . %  ,  =.  wR1A[HM  /01 U       !  1       ~   0 - / 0/ 0/ 0 : & &#$    ""#  I &0 V DE$%  ux$   lu    \u \u \u)D v[k[  v[k[ sv[k[ak[   & sv[k[  sv[k[ uv[k[ 5":   i X '8jEBS Z}  ,tB5% `;<A,&.Z?!M 1U <8    > ! 1   0-    H@/ 0 /0     '  ~$"  &1@   @?@?@H4   -0bu@J?  "    * .s+uJ *_&V7  f   "3078+  ^0%,.?7   [ .dV!= >z     650+0-    !JO ! z PWOPOPVj      * )l   1#8             1 M @* h4ghgh        $! $#L     %    ?*EL  fZ "   0    ~ )iv  # P@OPOPY    "# '# g|50  }/  T M    !" $           C4)   '9\+D!68m$   }    / N$> =>)=   785  "  ' %"!   ]8$  % -   ) )BAB+A<;=>=,+LKB>=>=G>=>^\>=>=>= SG  > ?   x`_w  /' ~`  x` x`Y x`+ x`1x`%-< ;@  `)x`! 2"        % .`o`qkx`e `  RDy ogF=+>-=#$H* h( #I$;" %/    9*BG7  "!$#"   OKUT@  Z    ovu|w^  c xw~}z!]Z$+~  4    $"  ;#L@  ZT HGH GH   ^:/T '    '   C    +L + 4     0!0!$ ' '   C   HGHGHT-      HEGHTY     DC @? ^]    Y FE  FE .    7po       V@ '9   + & 8Y     By  &f     ?B0/ F  %& to R17 7  # 0#4 * y     &  f H\           04 . x "  G '-F?VS-.$$$$  7D( G z)bD2   "! "!"! K)>=;" !9o $$$ $     {zuv  &    i  + +)O") !M,-VS       ? ; &0) 34Q+x        9('           . &- K) ;"& 3%&)o B "! "!"!`A +   0('9       /16--F?VS--Z%  L            '   L A  + e >=T  %O% T  >=>=R  & R  $R'    B C5  C p ~"     e !,   ,&   P*OPOPOPOP@h<     ('('(@5    ('( '(@ WX/436@  ij?DCF@\        /@<   . `_` _`_` _`$_`@3 ?   m     p&@    ;T         rQ@    *  ;jE   *    @2    ' )#@ "        *"   `]_`7_`_` _`@   POTSXW\"ni&  F.-  "     & $ 6G@& c    " gH& *"  @?@ ?@?@B     :/   t0 / B%=:>=>X"   /*&#$- 8LS - P1 -  I"(4/'%:XB& `OB4t !   4 X'WXB&~   # &B%   878RBy    1 ?%1 V  $  S VU    X   :  Z    (P#  `7_`_`_`     ( POP,       -   87878    87878  8678 3    0%/0/0    87878      PROP!OP  9    J ? @?@?@      8787878   & pMop       ) !     POP OP"OP    5 @?@?@         X WX WX"WX     7 `_`_`3 2  2 B  2 p#op3$2  2;$ $2        87878      878 78         Z"    |_ GK :" RDx   T   IA# :  ZDx6   6" QA  :6       xvwxqwxFwxwx  !    ! K #   & " 3  &8 =    p&op    4      1K  LKTSXUPOBGH [ EJ=  * A"   +0(  34  G    k(        X8,:X          i,#+    : :    'P# 0  ( $  %4  :r BD C DCD CDCHGHG   F=  +, 3, 5  %5      @>/$   &B     POPOP% $ `8_`   pvop    %'S*   HGHGH*GHGHGHGHGH2DCD        7G2D `_`3]$ 2J1  0 )0$#$#0 tyzyz{z{je 7     7 k@ C'9  &)0 Sry(-   ,ft      ehgn&sngng \WV ;] ?   1 2 (#  ,f H  "*       6*  ,-      ` _`KL    + .  $J H ()   -0     GRI>  6   1&#J  $t     ' t $: he@0/?  '0?H POPOP5: /2oHGp #&cHGf?Fk0/l !G      :CFHGMPHG POPOP OPOPOPOP OPOPOPOP OPOPOPOPOPOP!H          .-&    /6      F@  !! XWX]WXWXWXWX ^ uv     .  /]^ pop%opop f   &K h\gh ghgh gh5gh gh /5& +        Z   1  R   B .5& X!WXWX  + / "  0                !(cD1"     0 0 "                  !(bD"      n9I  "  &                      !(:^.8"   &          \&  \& ." -"   vs   #+   #O.'    %= ij   ,;,jH& P& # <(P <(L! -` -`m <&   < & ."   "        y `(_`_`      :  "    +    N;,+    ,#          ,7 !(lNr"     +     !  !!X       \Y FST#-   &#     5 J-   8S  d  + 5U!!X   `J_`_` _` /          1H/ `E_`_` n   \ w}5;      $ ,+, 0        &,)*   />=&%:92165*)  6).1- ++Kh"0 S  J'   9'      $                                W  C('w*'    '   Q!!; #     , ""    K  g5/         . Re.+, 9@?('<;4387,+ 0MR[^!6 0     3.!H|  x?wxBwx!wxwx   1"! &  } &,@ `" *"  &% 9<                                     Wn& M& !K-`-`m`"      "   0E  "   :9  ' & ebab  cm$ Q 1/"  y t "5 " C" R" )  ?>             _`  # -    $^$?$ N$ 21c(1c:[9 S  t "5    "                    C"         R" )   h-ghgh$gh o $ %-B pOopop$opop f   # % 4r  ##4" 1   6 ? 1EFSR(!3   )# ! *=E#7  X$WXWXWX  !A pLopop#opopop   # $  1| `Q_`'_`_`"_`    (( # L~ xwx!wx$wx$wx6wxwx!wx!wx;  ZYB G S2ABAL)"?   +""%6IG68  peop F2 he@0/?@ 9  %)F 0./0 B  he@0/?-  *      C ('(;'( k   %$9 (9'( R     8  PKOP OP OP*       d#+&-O  1{ #           X he@0/?\[     ]^  ]^W^  p /0@?<& 1\[       ]^    @?<1s ;P' ( 0 jK5 (!     @  .         on.      4   { #           X he@0/?     ]^  ]^W^   )*  @?<  1       ]^    @?<1 ;P' ( 'jI5 (!     @  .         Jn.     4    W0%  6      he@0/?     ]^  ]^]^      FHG  @?<&1& ;G( 9 (   B/   )        8D787878  1 PHGhe@0/?   9% 1 @?@ ?@ Y -  0PHGhe@0/? %` I+.    0  ()2165<;C           y P%OPOPOPOP"  !$f h(ghbghgh gh gh gh<     . - 3     (l+] D X8WXWX  !   3   "  ;d   3     CFKH U2%  ( ! &H% $ $% &'&'&%=+$      FSTY' (' (' &X )%. AB % u%&%&%$<"+0c !6K&%74        &'& # 3&%4y L   # 2#  #   #  <6     # ' +'$x x?wxwx wx;wxUwxwx       =>AB       % ??H6(  p0opop'opopop&op$op&opop#    -.  .7 $   .-.(!   ->' !'%'" !W09 4656 56(56 565656X  ( ^ _`  *=- (     4!z    40/ 0/0/6 565656 5656565656565656565 6 56565656 5656 5656565656 565656 565656 5656 56 56565 6 565656 565656056 565656 5656565656 5656565656 5365 x$t"t"!"     !"   +md*)   t"  t"!" CmdBAdS8ImdHGLOmtNMT -t",+./t"!" 2 5t"43: ;t":9>At"!"BC&f!St"RQTUt"!"XWX[XW !" XW\mdX     j//P  5:&2/" &2 (  ,  + &"")8*&2 / 2                   $ #$#( )('(', -,+,+0 10/0 /4 54343 8 98787< =<?<;@ &?D EDCDCH IHGHGHGL KL KLKLKP OPOT S3T  64 0//  /  4   *)  $#)*EF QT I8  ]^]BaJI N-L'\)C5[i 0436  52B(/ p5op2 6# 2M< 0 # 0 HGH GH2+F   2t 21) #   =2Z # # H2F3## Y2f 1$;# 1$  =2[ # # H h:gh gh80.-.. 2/ B9  @&  ^8-.` --F?VS  &W;@` RF!RFB&)&"&&%8- .-..-.- .-.-.- ./ 0/0$-.-.- . -. -.W- .-.-.-.-.- .-.-.-.-.F-.&%(' *)*)-.-T%(' *)*) -.M-.-.-.2-.-.-.N-.F/     .& ?  y  z"" ?""" "   """ "       -4""""  LK~KN(% " """""""""*G%%( 9%%( S5 00!!!!4' #|!y'$!!\ {'!    l 9   O0--v--kZA#OHu##,GNX'2 98K$/@(C ' .          W     " !"!"!"!"!F$#&%(' *),+.-./21 4365 87M:9:9:92<;<;>=NF 8-.-.-.-.- .   8            m1 %#I<)  9 8 @;?@?@6?@?@F?@?@?@ ?@8 -.- .-.-.-.-.-. - .-.-.-.-.-. -.-. -.-.- . -.-.- ! !!!!!!!!!!!                       k8 -.- .,/ 0/0$        6;O  , $ p4op^op8#$#y  $!5( X 8  &0/P565  %&    !"      , -0 22 6  :$**2  $ 8       3#    /-8$#  '  m$r   ]j $'&?(!*rX$! 8 -.- .-.%&% &-.- .8-.-.-.     , R BC  ,*  BYDJ!D"" C.  )L%    8      )G,#e 80 " 8 -.- .// 0s/ 0-/0c/0/0'/0/0#/0X  *)*'      &  stH*L>= hw          Z&LPO v6f9N(L'+ =T`3  / s  L     L  F8S , % 78$.?     Xv)/, $[ 8/             `,_`_` 8  & z    &$#      9E  & z {+8 +*4] , .-.-A3.+       D)   !  ! ! !  !   & 8!4PY)$C>2.YS"/  h    M > ! 8 .-  .-.-+- $+      $  2;9 26(E/a DW 8-.- .-.-.-.-.- . -.-.-.-.-.- .- 0/0-.-. -.- .8-.-.-.-.;-   %             "          %   3LVED>             8    ;  L!;8-.- .-.-.-.M-.-.-.-..   '" R#=  63 M. =:'8 -.-.       ((0&%8  8-.-.-.  +               '  &  v^=$;9!!$-&/ 548y-.-.-. `_ZO  J+ 02+ " $  2+  2+ (!'   # /2+()*.));#!" ($>       x<Vf    > O"6V~  5  4>  0<        L   M3 `Q_` <    he@0/?zhe@0/? Y  @L?@0,0 |! , \)0  @*n  0 % &% &%&%&%&#&6> ,-F?VS-.,-VST    A:   <    6 > @5?@ ?@0( urkl}/*).       "0(        DA85"   -&!v. (  `1_`_`0  5 he@0/? 5 -(f'0 %&\% &%&% &v%&%&%&%&%&%&#%&%&% &% &^%&% &"%&% &q `  ! ! !;  m!! !!lkle    "!!! ! % *" !  M !!! !     -!clD ""& -) 4 >    v   #  ^ "  q -: !0 %&%&@% &%&% &o%&}%&% &     ;  E"  !I        " S$& 4   & <    o }  N3 W!0 %& %&% & #&%&%&%&%&%&%&%&%&%&%&%&% &%&15%&% &%&% &\   ,-VS   ((   /+  $   Z[ H  ''  ~        ( O   2^ @( 0$#'  *! $(O!7%7        "!1$#5&%& %('( '\0 + #) + ? 90 %&%&%&? <     he@0/?ji   ?      n  09I  121/)      + 9     >  0%& %% 0!   pwopopVopop0 %&% &%&%& %&%&% &$%& %        'H5-    $   %   p*op"opopopopopopopopopop"0%&    "%   !(  0 %&%& %&%&%& %&%&% &# %&% &%&%&%&%&%&%& %&%&%& F%&:    PHG  /       he@0/?    !   **e A , #            "!"!F : u770 %&%&%&%&%&%&%&%&#<% & (     '    ##&%" PHG % # # he@0/?    f2. *   7 ( K0<#& ' ,-VS   6< gE0"%&% &"#&#&      ,-VS     ,-VS  1  Y1" "   J0;#&/ $ ,-VS 5<#;/ p;05%&% &#&4#&/ $   ,-VS  ,-VS    5b'#5 4 / hOgh gh0%&%&#$%&D     "-VS #M  D x[wx(wx'wxwx0%&%& #&      ,-VS %   (  0  ^ACE 3O;97(0%&%&#&%&5#$%&6#&%&8#&%&e#&%&#$%&.#&%&,#&%&*#&%&$%&% &#&%&%&%&%&%&% &%&% &'       ,-VS J  !-VS  ,-VS b ,-VS nP ,-VS     -VS   ,-VS & ,-VS 2 ,-VS >8  ,-VS      AA0C*986Z'10 4    (   56  8  e&#  ,+().2/  ,:7  *B?  $DCD CJG  LKLK     NMN M' E;0 %&%&  8#&       ,-VS  g+    8   V0  #%     FHG %   0  6 he@0/? 6 q& 0 %& %&% & #&m%&%&%& % &#& 5&% &g%&%&#%&P5%&% &%&% &z    ,-VS  ,          ,-VS  %   H     W|!         R       2} 3( 7+b!*$O 69 "     m     g"!"!$#&%P('5*)* ),+, +z @p?@0 %&%&%&%&%&%&,%   M$ , hsgh00%&% &%&%&/   %(#0 / 30 %&% &       r A  -    0O    0V' ('B.G_        )7 V _ A"0/"&%& +&" P07/ 0/ 9 %#/  E0// 0// %# /  h3gh!0/ ! +!  J   3!  (C'(8   "*  @ ?@        *[ ));dP               A B<   .    ## ,2*'W.  (*'( '(  , )BI 7* >=> =>=>=>=   "  c,X>=>= * ,*>0jX*      7 .po  .% !7. P;OP OPOPOP OP OPN:9: 9          / \   hghzyVU<;<;<       #R   &,)+, `_`   * # $ ,8* A:[ ,  ,' G[, pop     y   - 5.x-  `_`%:9 }~+1  &    $R)*% - 98 pop%:9 ~}.*  2  ,      %OX;$S% -8 8 mzyV$y<;<; y< +   u V+1  )m y p[opop Q   }~AJ $B Q pxopop; Q  $A J $B ;Q h    T )-F?VS-)   U"<T ,1< &   m ! $    )     L$8<#< &   m   p'op"opKb  !  1@"b  *G,f [ \ + *  % & ,' ,-VS 8  5       %& +I* "E';=6NC!  ,(   \+ * ?;Z ,    ,!Z, 867878    %   (HnS[QFg=-!!)-pWe 6$YZY/`    / &!&7&<&! [ % 6 , T TD  )< p   &-F?VS&&&  $    7 &$& 8$*  r    :Ms  " "   "$% "*  . < tw jm   ZY Z{$%`{|{P   +&-F?VS   $-F?VS-     $     &$.  ) FFl ?!@@DbI#/]F&lfF y" > `  1 B>=  1(  /`          /  "!"!&&#!*&'7.&+<2&/!"!" ![6 3%: 76> ;,B ?2CTJQR QTSTST ITST DVUX)W xSwx   ( $-F?VS-$  4      ( TN   S^3  ,             ,*1 >  '    S    ^ 3 , +y8* 1  Gzy VU<; <;l+   +<;   """">' """" """" """" """-         C    ""> +:7$ 4;<  '4;<- '4;<-4;<-     +6;<%      p+6;<   +      k            1)  UAd#Fw !  o /#8    *       1             #$    =+ !$#$ #&+%  878B7878  ) ,8 3  %;5Nzy VU<; <;L  l  rU  <;   ba\[      a  HG(  1  ,'XU$ RK  RK RKRK   XI $   X?+ . n-6         )6 '   n X/ 6I X !$     +  SE!-GN=y7J j8"   EM :  %; 5 * $         ! l  r     U     Z W ) )* ) ) 43 . /  ,'' ) G )   = ) 7 )    tC 70M1LZ V)) ) ) ) "D7P      [D~f      - Y #D#    +!# 8787878     D\&  B   & (@,\&  *=D  (7 ;D"!"!"!     @- a(9H ('( '('( '( '('( '('( '( '('( '('( '( '('( '('( '( '( D :9     ( /XWF    Md       '$' BDn    M[M p'op0opopopopop#opopop6opop8opopop9opopopopopopIopopopopD          XW F#+ @    +   J 4IP f#E PPOPOPOPOPOPDq )D( 878=787878787878D}     \)6\ `_`)_`5_`_`_`_`=_`_`_`_`_`_`_`_`_`_`D + @9      *(  M@ / wl&A!0 `_`._`5_`_`_`_`_`=_`E_`I_`_`_`_`_`_`D , D=  0     ()  QF /@>tk6.!1 XWXWXWXWXWXWXWXWXD  *( #` Z&$ `{_`h_`_`_`_`_`_`_`D +    )  T!6/ `_`\_`J_`_`_`_`D ,    ))  m A4!6$0 XWXWXJWXWXWXWXWXWXD`   # 3D C$` P OP OP2OP OP OP       P%.W D5  " XWXWXWXWXWXD   ,       "  1x #1K AD!:   B?@ITJ!   2/09D *D  ;6 72  ?};   (%'(|'(D2{         o { @)?@?@?@  !  @-  V      X"WX"WX.:%&% &    :   `=_`. %&% &1 #"# #FM(  1 7.l#&'%&%&%&S%&%&%&%%&$% &"       O,-VS      !!!!!!!$! ! >B>/ (3l'      S  %$  q.$        :$   .$   %&%&"    | {| {<<W$   " 6.,$O   ## . %&% &, +3,$= +> OPO * $  C    9$0: ?4         ! .   3+ -*d0  GB 3 +     * 5. %&(  &  ( S. %&%&%&%&%&&% >  & [. %&%&%&%&%&%&&% % !!!!!!!!!!!!F  & R . % &N  3E  N . %&%&%jCDC\%   %{ \ .P#+.  =       S  * @ E4 .  = 878 . % &%&     D.  &,$O  8P;,  >P;,L , +{ +  ) + ^ Q;    /2    887  8  B   " 8   $. 9      ^7 +) +     _ c<0 <0  !   Ll+4G3 4H?c  - & +# &%B('*"(*0.' 0(   8     >L   !{$+#&)% (+'^*)* )Q,+; . -. -       pop< 01 71 71$+( 710 105,7 7 7 D2<2<2< #  <;   3 ('( '('( '( '('( '( '('( '( '('( '( '('( '( '('( '( '('( '( '( < >=    ,    3baP     Wt       $ %N<      $"x0   %V<    <7* BBMP  O       ?H    k;>  E L=}# %b | ^<    3 d9-  <        5B!  ) E$ L[ZM3< *)*)*) *)  *5 4$3 e$; J b34% # 53  ]^]ji   ^     AB                              )- /*$!     ";:"*!!  #   M4MD4H =     2  #        E      E 8 E8 E! R " 8e8< 5       )   16          IV   +s>0  #P  L0M  "  v8E <     )  16 ;. X4m  R0[ `|_`_`_`<     >  8 O2 e87< 5               )  IL           _l   +JL="/  #PT  J0LE   "    m88<     )  % Od  J0-  88< 5              ) /    .       _   1 (^40  8"7M5 V"D     E      FM< )      )6=^X-  d8< )   G)!R  Q-  = T  7 W('>=(7-(7"+<<J   \ i X)"X&J*  :]? 3     y &            s    gF`    r POP_OP(OPOPF       O/42. 0D/0/05/0/0/0/0/0/0/0/0&/0T/0=t 8 ('(%.+&9',    _DS? zu&IE"E?@$= $=>=U>=$ =%>=>#$=k$ =;<9:34s 0 1121   #     fab[ $X   L5 0+,% "   wt~ d+oHj^ .w +B-O. -!. u   U %k  N^5@$=$=++2> =>=-> =>=      jj)+haba haba !{    m?;#0>r       )+     @('( ' (). - #         k_#f#  0@ @  '' U5 BH  O  H 3      3 hghH     ,  P<,  XWX WXH  !&#   35 0/0/0/0H      D   7  G*& 4  4z'#              HH             #      +,        vmlc ;l       WXab   k  5;    d3 2%$!KH !% 878787878H<    ) XaWX9WXH   &#%$>  * | 0$* H 1   + 6 /# H      1!%< &EH# J&H   ZK  0/0  #0) ,97IN8 qH .  X T<H    !1  5y#$2 M.H   *  I` $) MOH   '. 5*  H$E FH^   #* % 5= >k H    <M  #* A  dZV $!8 >HH       AZ3 $9 0=HH        9@  =  AJ "$9 0=IH        3:  =  BJ "$: H       8        a    2qx W$  ' BR83&! 'H>     %    >1H       GY  $'      06H-Q6@6h  `_ ZYHW @G$       .   _$@? J' n[  5-Q6@6h  .a(*yH*83J8  $      I  D D Of        $  )_   (  !D*N)E       8 3 % 8 XWXLWX/WX%WX.WXH*            l      M*((,) 878%78F78787878H#       Y  2<K#3() ('(7'(,'(/'('(H' ~  %      S    ' ((  %X%R.H)8=                  q  n   )8(m )   In8H2  &  "    S2 & | 5. H  0/             7@U     (!#]()" p:op7opopGop;opopH}         "       L k   $vPH & 3( ! D3HZ  !  (':'        %&          jZ # hgh6gh6ghghgh H?! @C                 #$          F!      ?        4 &  & &  ?-&WA-gdHJ?2Y3883y 8/Y"   !!!!!!!"O7    !!9D   ""   O OqI!!!! !!! !  #!!! !!  !       7  DPc""""O <5<%%""" "2!  "  1#$""" " .1 "))<$)!"!`  ]    -0 bJ(2   ( +  3883d(y 8/  HGH,GH,GHGHGHHE6=_% >5   6;*)## ###  # 7 65 ##   #   6  :*E6=( ,-G$nZH9 4& UVUV      UVUV$$$$"    B? D5$5%$5%5     ' $  $ 21&_Ac=g9-;e6 {%}#!o1q/ ")k536u+w)9?aC][E SMKU WIGYFAOQ: FMZ    J'' +'''  &,'' $         +, ' 'C ''''&'&&&&    !        )  & '& $$ %$           d)6"$'D   B)'9 ( V   4  (( =BH44   !* OP+s- Rp[^y|sz      ~Rp[^y|sz d)))))  )  P ?@    p$q-   vQ'#rQ'(#$jQ'(# '(Pc P OM(w^ u>-)))))  )6))))         -,?!  !0)  (   VJ0 UA44   ( !   H78U,  ****  >@    +,3 -*** *    '*) *bQ{ 78U HH) )>0-    $Q (mrq KF\ UhUVl0++++++  + ++,,,+,,++,,,,,] "l   6x (x /05"l" UVl" (l,,, ,+,+ , ]plmr ve pe[q b<Qe[qklq]`TluxTluxTlW Xklk,$O -?Vl=VlKL?, lVX+     G1?Vl1Vl# 7?Vl1Il!$5,,, ++++,wz    ,,,(-+!! oyOG) )> 0JB = N~ J'AB ABABABAB AB ABABABaABA BABABA B(   Y9 V(A&B8  kcdcl\k [ d   F$$$ $@?$$$ $ _ Z0=B  :;B 8CD                  &' &n/PX/MH</@ C +%1'       a   ("! $ #$# &%&%Y('9* )*)V,+,+(  0/0/04/0=/0/0/0J ABABA BABABABABA BABABABABABABAB !  % %%%%%%%%%%%Tm                  P#OP^OPoOP8OPDJ ABABABA BABABABABABABABABA BABABABABABABABABABABABABABABA' G Y  % %%%%%%%%%%&% %%%%%%%%%%% Q%'U                    @;?@?@?@ LaD  !   .9 5 pop opop$4   I   --F?VS-. !  U H !4    I $4 >9=>  O       @--F?VS-. ' "\3   4&4 "+49   O$>=> =>=>    $ a            :N,-F?VS-,  I/("    w0]    $  R    $ a      >8=>G      :+-F?VS-+      @pG/%!2     w/  3(',]    8G  R   $1    $; / $* PIOP$ZY65 0, w: C$ZY656$Y :pm ;  ? B     3!/8+  %  O      0W/0$P6 5      #.P   H7GH$  ,-VS "      ^;22$2  )2 )*)j 6 56 56587 8 78787% ]8 787 87  +  4CwxDCDC-.wF.D    2.D  ab  4$u.Dy  "Dep%   I       !ijDQ  \@? D?@? 7  (('(' 7rC    4 hg T% F   4 ; ' 026a  \'  " .-(:+(- # *+$) )W.K" *L  "   j        % ]   "! U4636 X$         &D                        2C &A  >>=              D  P&OP OP>?     ) hX    u LXj  Y P:OP< ;<;    5   < HGH'GHG212'121# I' "" " H3GH* *   *   Z\  (d l t |  xZ $ U#0\3> '  XLWX'\@8 &/ $!"< 4#)  k\x    F    hgh gh gh\Z"@+*)* 6  1JG HG sCDC " uzyp K &(Z   6   ! .   ('(           lkxw              8 .FX  P OP OP  0-/0    xLwxSRXWXWXW8 2 8*J  )R8 XEWXWXWXWXWXWX:M    - '7# D:M p op}opop       ,"?+s HGH=GH2GHGHGH:f    %+ 7,P:f HFGH2GHGHGHGH/j       + ;4T/j HGGHGHGH    ,+ `*_`+_`_`':       J* ': X2WXWX     g (# 4)-(* ' $ .R"        * +     &  '  . /    " #           0OL  *  &* ' $     .R" #   5      $ 5 DY      @?@?@?@ ^    -1 0 /0/0  Mk'i`Rk'i`'G< eTI ?I  eTI ?I  ;j           ,.#   +  L           '    21  L           )         $ # # 2K0      #  Ef0       #  c  & + * e  T    ?  "!" $ #" &%e('T.-.  )434 10/?:9:  5@?@ =<;B A;@ 3"3<    >   L< 7 5     >     ' *47   ;# #* 7   5 PpOPOP M- ( : .2XWXWJD  2     >2 '!  +2JD  ' 7  '    $   %    !F# C 7% M( !  %    (]W _ 8          n, 8 I%,>  %,> kv3  XWXW!XWXWXWXcWXW     W A   2 3  !c 0/0/0"/0/0  A   E   0"/0/0!    U9" 5 :k  *lf eOfefe&f eOf efefef e: 2 2  2     L)   '   ( l O& O       P#OPOPOP8 7!b  T K  (  ! HDGH GH GH m   $   ( (L'(''   p=op& & $  &   HDGHGH            !  (6'(4  $  `9_`   $(  p_op " . `H_`9    ;9 r& 5 8 3>1 >=  (341 >9> $       )   mD  m&)'*  k1   , 2$   .= ( 7  8  T (  `8_`^ 5( h r ' ~  h[gh IHGHCD* 2 #$    5 $  $ `=_` 0)  0   R  tq  # (,'(  P tqSPO #  :  D &  ()'(   P tqSP  # & f &px   &  && && [^  HGH GH&5 %(+ {~ Z  d n x                [^  HGHGH9 !&%()" y|{~ ""!"  "","9"" :> 2    >2B &J   0 6L  @w?@<6   e  lV##^        = !+++++ Q TST  =yruvuvu+z E??@++ ++) L1 T J + .2 / !p?$+ *  ! H.  o=!+ + +++  $'&          %, 9#" ??@+  w   }~Z# "7; 5 *1(6'."$' + #" h j lp    n L      LIJ I0 M  -  q "W    9    ,3"W  L ,     ! RQeG     P!,  Z   `F_`$ # f #1 $# z   3#8 (v'(        AB xXwx3      K             O   P&OPOPi       0-      ('(        0    r   ' POPOP-OP  M>C     6 WX F  0       o   6&5T HGH  *      p,op                          &  6C         (;'( "PZ   0( "   "     .  #       YZYZY  \e#hSV \W_b 0  $"%$#     +"ls tslsts     .  #      tst       #M \ / <  @#"%$         #     "dc    $kSL"   !""  @  B 2%G <  !   XZWX"g 8 ,, @"M  .) (3'("@  1 K0^     =.  M 0&,+, +,+6d .-F?VS.. b7&   6 HXGH 0m  " ! <  I"  "6  0       *#$#:$#'$"#$#:$#$ :9   *#2;`_lkt mneP    WZ    :A.?X"179'r'+U+,    R *   ,  # " #  0G/0/0 /0/0/0*A^]^]@  1CA@ Y /  B  N*#2  1215 ,-F?VS-.8#   56  #\     # 0n/06{)      K6$   6'  6"   6   H&GH63 6  6#       6  1 }    ,1 0./0 /0/06#   " cb  :  8# " xSwxwx6& 4   4 A  "&4 6       !     6                                I 6#!0:-+"               6                                              I 9&"00=0,":"               6                   nmnmnm  IIHGHCD6#&*:-/2    pop6                           I  6#!+ :-+!          6                         po       po           I#$  #$  6#!#$&! :-+, /$+           6         hgh6                     I6#:-(    6                   3   I~}~~}~3 E%1  7/,"  3  pop6                           I 6#!) :-+          6                         &     I& 6#  :-*/$        &    e6      /30        #I    I666**66 I6 7     , 4  ,  (7'( 6L          6         1        /                           7                         ,    KL PNI   ,"% ,A<q%6 715 %/17('0  1      /,  "!&%&%&%('('(,' 6                                       I% 6#$)!$ :-.+.                 6                 R G 5 H G 5 H G 5  po  I 5 5 5#$ 6#> : : :-    *   5  5 5   6B 5      ,   v5,^ C !1B 9 5,  6F 5  3   T5 3b = !< = 53 >6   !                                    !                             !   !    ! !1(.!%!%!("* (,8+/+/+2,.;2$!            ! !  0/0/0/0$a        ") POPOPOPOPOP#OPOPOP$         j           POP"OP OP$      3,+      2#  8$%   $   <3# T  H5 % ' 3# \   %4   @I?@Vl !      1 8+78z8 =  .55   6 64 4644//66 4644.4     p\opi  <8   - xfwxs     (  - NI 7 -J T' )NN! ) X@WXM  )MMK )KMKKK #(M)N)KMKKJK8 J      @9:9<       .-.-:  ) 87& DP)             @  @J?@@W '0 D 0/0 0  HKGH@X      8 `@  !*4 *+6! ]& &'& '('  %"       & &' & '(' 3"      & pCop&P  ,    (X'(!9 +! \[ X5WX T S & "!" !     !  !  0 & '4 3  4 3         4 3 4 3         434 3  43434 3 4 3   4 3  4343  4343         )* XCWX4      3+! 4      3-!   @6?@%%&  % hAgh$&$& ) $& >=JKLIJK   ?7$#$ #;$#$ 0zLs  B?      f]  VY . = ^]^U^           #  9"?K   $      8  *&% H  .5    (' N XU   3B     8 78- )      '              9   +           M"1            O%-  ."1  *D ;N3*LQLI !JA<9!:341 , 7 M,     8H   f@  +   #"5( &5(@ - ***D ;N    3@+@'X  J)    *2 )  @ @  p.op op opT       '  N'  $  z 2 +  (%?$*(    z d3 4g HSGH .hn        !    6.C U  V&  Ya0p#3$ #$6        *  )2mp    C"0s:>  -FP z[;5;\0@\1a9;\:1;@1;0;1[25D[;J;nE;[\@10a;\0o;\6[1;e\;;@;1;.F+7+0Z)Vo$)$V  L /           z {FG n o"#  J K   3    RSN Q O./ ) :;1    r o s]  !  B G C 2  3 Z [ [^_ b c    &}  !'     vw> ?jkf e g V  W~ y    6 = 7  * ) +  - .     $$& &% &% %$&%& &&$    $&&&"+ +&$% & %&%""&% $&$%&& &&&$<!-!/X/rP/  9 =  0  - .$ '  !2$#)& ''*+ */+23,67 6;3>=%@ A'DG DKOF^   'I        ] 8,78 78 %(  @'?@?@?@J       "  @K?@>  +   ' +>: .   0/0>= 1 >!  XWX>                     >  HGH>      >      HCGHGH>             HDGHGH>         '('(4 32 <     @?@?@?@?@>N   x>#W    pYZUVU>)*9 *7 *STS    % 8 A   5 8 )F9  ;D/F?L7F?L7* >SB GLU*EF , -A.+ % & *+4 >$%;$(% '5( Eio'@%C!B'' W    ^>k %%0 P2OP! \3     f  Vk P [VIPG P[    lkN- K&1     z  '     1  ( '"!" /       $ 9 L#  '7<%[f  #   ('(i 8;8? @CW@CO  @?    0)/0     H0GH  .    *        (              x 7>=DCJ G       /JW -`'   . x3wx)wx 2 121 2$12 4 ' , (  hJgh gh~  1 0/0 )7O(& ('(  K)'2121 2$12 1   q=ql g 3k= qEJ    $ %"2 POPOP OPOP# WL  "G POPOP OPOP% Xj     $7<( POPOP!OPOPOP^0     B   =   : POPOPOPOPOPOPf      J;r% POPOP4OPOPOPOPP   "   QF 4N l$8#(     d\ a  #  chg     hghgh  Ny"L       &;)   NU B42123434$34 32K[` ` (('((((! `6!21234$34 1!  q=q[` `= oZH!      9       ./4387<;F      87<;$#(' +           F, nm  S,  C D D DB L V ` jt  01 *#7 1 '     ' HG  RQ\[pofe>=  [($(f}$(  ;0($@   # h>ghvghY]T   &*!// highgh|  Z+A  XWX KLK  e?    klefef_`_`                          . . .Zj'      %      %   k   w T@ !~} a@H  3   POP '   P 9@?    7 '      XWX KL    U@ ! b@  :M<?Z   :     uN<T/- "   fa %278  BGH$VU   61  %TO*      <  z   B B! f    ,              >    L '  %  G          h           Rgfa`[\ Rgnaf[b   *       .     . * PO_           % '  $ +  =   +  m                   %         EB?-7S0    *.  +=  +     \ Tg     !4#A  4Q34=34Dwxwxwxu$y.x  6=      @  6  c) Q=$y                   bVo   `"_`5)8  47)8   2 1b   76    %&    E  49  43('  *- @             >H#$ =     3   2 1b!K  PAOPOP 3%       PhOPS A   \i=  / 8>78     0  @?@?@         zc f ' @o       !  "%L ~8 % @  A    )  "n7Z   .  ('     *#q2 !n &  3     `_`)_`_`_`r:        -      ^O& r: popop 73  KL       7  | 73 `W  !   9 + W y   9)   "    Km {|/QRgfa`[/('* DX    POPF " U%%P/ \)  F))  ST QRgfa`[\   )Gy   h5  gh .=>   &Bu  ,    y3   ]gh X-.> < ,    EX     ZUVU '  > N.+n   qrmlgh !  8    K & &|K  Jl {|/QRgfa`[/('* CW    POPF   s%L* W%  N <,ba ^"_%%,'  7"<" X_  +    '    1 1UAMu'A  0u/0/0I/0>/0C ba^  _         X_LsB8& p  0 6J C*(('    Zn% gD.. X7WXG D X4WXF   5 ""  eh    7QORgfa`[\     4Nh+.   A  (F(:  $  0  +. $((,  n( 2B &  7eh     8RORgfa`[\   E   b}h+.!  'p +!  *F*    -  $ ' )$ :   8H7878? 878  Q=* \  ?6D?=@9;6565656     Q=* l x      >D   $*  >D   HSGH     FF  WZ  }  v P      NK , :7 ;*' 7 {4^C$?d  q  Y  PW !  b_ 8X78B l bW   bv I/0-       878   vdba .  J > df(    (! !     # X)WXWXWXWXWX  gx     ( '('((    B   V b n vux lk ba HDGHGH  Xuvkl QRQRabMNM 4 #         0-.-.- 4/0!mvl 8  9  A qY6?1             ('('( #('*),  1436587:9>   KHMNGJOPILQRKNSTMPUVOR     "   *D:  A    $#* )0/     6   @ ?@ ?FE    & V&U $ D    N 34    P OPOP OPOPOPOP OPOPOPOP OPOPOPOP3OPOPOPOPOP\          .-&    /6  [b    %Y   "D  -& 3<   u "h3n  >I po5lkD% "   6D  4  (B'(0  @ ?   @ KR3    1;d    l=;     *     S                     p     ,     *     <2         DCDCDC    D-0=>=         .                  %  &,^*  S(&8*Q)7*;p5 ,  * ( * S                 A  , * <  )%   |yzyxu tstsxwxuv k    bT>G  C #    2 rqrqrqrqr q r qr qrqr qrqrqrqrqr qrqrqrqr q'rqrqrqrqrqrqrqrqr qrqrqrqr qrqrqrqrqr qrqrqrqrqr q rqrqrqrqrqrqrqrq               FCDGHG                 ,+*)*I !$-.3"+E9                              hghghJrqrqrqr q r qr qrqr q#rqrqrqrqrqrqrqr qrqrqrqrq x       "G&"G(!" (!"  +*)zyz%2BbDD                          (, .    d   .=;L,  , * ; K&        %         (&#G**;"  , * ; K fn  *   F V UV UVUV UVUVUVUV U V UV UVUV UVUVUVUV UVUVUVUV~          & 2 Vml@          9A>i  "$ 0 - &                ,)d0-F) $ 0 -  @?@$"T ST STST STSTSTSTSTSTST STSTl      &G5     hgh"|       "h 3>W $ - y"             )<  -<! - y hdgh$qR    4 0V/0$R QR QRQR QRQRQRQRd    &<h     @r?@?@$$R QR QRQR QRQRQRQR QRQRn       &-:     popopop$R QR QRQR QRQRQRQR -   0/0   $S&a^k(i     p,opop& )    % )&?,   05/0&POPOPOP O P8   ! G    x@wxTwx wx+ t.        9 9!+ t pcop`  " ', 0K/0/0"nmnmnmn mn|    4)c "  nmnmnm   H5GHGH GH /"F   O52 /" a** fe #*!n  HG BA     =J         '  e @?! FE!P B\!,&)-*0('     #      *!  8V78  jijiji 9: ;: VU\[ba  C  popop  vS   4      $*  *Q xwxwx 9fefe$fefe&fefeI :?<?2747  )& 9$&I  2+  ;     E M  u  P DCDA     &&    #  < 9      6 ' 3;EMu pAopop   , , x[wx wx  O    F 2  -O h>gh ghU   * , 8 7 8 7: 9 : 9 &% PUHMDILQ <A@E05498=:9.(-,1 (% $!$)3B      )Q ; /      Zj &" xNwx wx wx wxBwx wx wx- G-ji (), +    :C  H;; 4 @ G- `U_`_`_`_`T      F- "4< b a"34   " x!wx6wx3wxwxwx      4  /9 %  P OP+OPF   3  *     { x   b a ryDz y      f)     9B   GVUX      O ` _7  QGB&7:!bG     D  H6GH GHGH   #$ ,   PJOPOP#bab a4  j# 48# 8$ :565!$  [  #656G56#!$#6   \U8  87  A/>CCC [= 4=2W3^A_ bCc m 6A7:W;LCCQZ[h>g x   :    "    ( / #                  #     # D T     X).'?    o H  ,   B   ,    Z 1./!$?![  G  !   `3_` _`<-.-.- .    # /0/0/ 0(/0/0/ 0<        $8(" ( <>LD    >8 78 7878 78787878 7 878T      &2t      p "      N S  =  7+ a   hWghDdD   'D212121 V   hHghFU0  * 'FHUJ2   .==@?#VGHGHG H,GHGHG H,GHGHG H/GHGHG H(         .      ((+**/- , , /  HgGHVtt      K POPFV                             ,'S@        ZKLKLK L)Z?,   Z  :    XKWX WXWXWXWXWX\rU V U V!      N U V [ :;3BAr   ! q\=343463^  XWZWV,I'9=6^OPOPO P(OPOPO P<"         @b?@$^     J      ^LR     .9 `QRQRQ R(QRQRQ R6      $2( ( 6`LB    `     R       .EK   0!"!"! "4!"!"! ":!"!"! "k R) *1 .   Hwdc"<; 3f#4343" Y `    eh        `_`_# &   # (e: 06V4:DFI 4 : k G     1  xwxwx0) * 1 4    *' " 8I \8 878$0F EF EFEF EFEFEFEF EFEFEFEFEF \ [b ahgn kZW^]dcj iDQXW^]     vwx&#V         @?@?@50F EF EFEF E FEFEFEF E$FEFEFEF EFEFEF 8 7> =DCJ I63:9@?F E  $#*)0 / <QRST&&AK/     $  POPOPOP0/ I8    # (Di{(/ I8  0      b'STSTS TJbib   X7WXWXdJ  % "    *>35[d;<; <;<; <;<;<; <;<; <;<7;<; <;<;<;<;<] ^1] ^.] ^] ^] ^] ^[;< ;<;<      .$#> k[\qryz PMi>W MU"j } t 1|yV yMN63  +v  !    B       J   w#+ 0  !  zC 8q : Y TqDhXJR1!O0 @ +j    7  1 .    [   w)   d) $ 0   9 P;<;<;<      "    )    ) + 6&8 Z00':'*)$ 09 P       n]72F,-, .d      4! ' ''7H 'sh m! -*q6wf-VNI#0.   Zd;<;<;()* CB?B9 . :r%'D '9#$   @#? ]  ,<ON"9C  D 3hX^L5          &  !R$ #$#=&%A( ' ('6* )*),+,+ ,+E /'  m8,:73CNBE +;4    lcdq  yz `YZe, # #+BG  $ |" * >"? !& A R t'!#(2!(S=HFU- 4&8xYVN  ` 9      $      u"  8C782  XWXWXbWX&    <   *: <   "   A ,?/ Z  1. 30 52  96 ;: ?<  # ,      <    *    G~  UR   YR [X ]Z  _^   e^ gd if  kj ol   ,/  !      !               ,d<  _6      #   "825 ,l0K& #                     .-&    /6       O$          !B $ * # 0 $ *##$$ !&?!!(! ,/   #    "!$#&%('*),+.- 0/21&4365 87 :9<;>= @?BA DC FE              +   ,5 !!  ,= #                   +             ,`<                     )  ,^|                 )  ,^>=               ,                            #0'0$0$0! ' " ,           "!$# &% ('         ,n              ,3>6     S              <0 ,                )     G ,/     5              '     L  E ,/:  3      "!"  "  !$ $"!" -&         }  y   q=q    ]  [     TS  O  O  G  G     <;  7  3  /  +  '  #                            c   q=q    c c=] y  w  '  o  k   q=q   k  k=]=  "#J%0&!' *0'"&!&!&!&!% %!' ,!  & Hy# -#p*, qj+Q        "!$# &%('*) ,+.-0/21436587:9<;>=@?BADCFEHGJI6LK NMPO RQ TSVU X  aba dcb]bG fehg'jilk n mn wx!s zyx]   4<    *    H"$                      q=q   &       =   F8 E,k   !      !     "  + .- 0/&21 43,',                          </+ ,\                  ,?/              " ,/             C((#$+#$  ut  ~  / +'+ (*'('('('('('('('('('('(!'('('('('('('('('('('( ( JK  *+./ 2367&'>?VWRSNO "#:;BCF - (#$ #$ #$ #$        ,o    G((#$/#$      3 +'/ (#$ #$#$ #$        & ,x   (#$ #$ #$#$#$ #$#$6#$#$#$#$#$#$ #$              )1 H!     ,6      6  (#$ #$#$#$#$#$#$#$#$#$#$#$ #$               )" ! !  )  ,/        (#$ #$ #$ #$#$#$#$ #$         !   ,/         (#$ #$ #$ #$#$#$#$ #$         !   ,/         (#$ #$ #$ #$#$         ,r5      (#$ #$ #$ #$#$#$#$#$#$#$ #$ #$            ! !  "  ,P          (#$ #$ #$ #$#$ #$                 (#$ #$ #$ #$#$#$#$ #$             ,/         (#$ #$ #$ #$#$ #$#$ #$         0  ,/                        (#$ #$ #$ #$#$ #$#$ #$                     (#$ #$ #$ #$#$#$#$ #$  #$#$  ) #$ #$5 #$ #$             q=q       =  !   jR ',qM             !! $# &%(# ' ,+ .-*        (#$ #$ #$ #$5 #$ #$             F ,M    #               (#$ #$ #$ #$#$  #$#$ #$#$#$#$#$ #$ #$ #$        .-&6           )     , /                                        (#$ #$ #$ #$#$#$#$ #$#$ #$ #$#$ #$               1  ,/                   M         :  h ,nM  !     (   F $          !$ $ F  X= X; !X9):9 'X3 )X3 /,.- 1X' 7X# RQ 9X# PO =X# ^ ]d q=q*' EX DC GX BA KX P  q=q(x SXEFABUX [X eb MX y=] y ?X=  X!(56L R1"% $|,M4*.   F     $    %&% ('*) ,+ .- 0/ 2  ;8;>=@?@?BADC!FEHG<7<!JI&   <      9      $  {x }z | ~  }~cdL  O    Ck\  [ GW   { M M,.%W             "# &% ('$$  POPOPOPOP# d     "T 4 8  4 7  4 4 4 4 4 4 X%WX 4 h)gh 4 %""  " 4     U0      ('(  &     0/0   30GJ"J  `_` /    /  0. /\ufE/ u 0   F 0/0 % %  '        %KF    &  0/0/0"  " hgh      [ || q|]  q    7 P$OP/OPO  3636 l@!   `_`_`}wF   KR 30GJ# M |J`/! $   xwxwxwx>wx       )< qKyz    + - 1J 1 6g   #  7  ! 6 )7   v              `&_`5-8  4;8JZ HGHGHj %$   7U1CR|i l "V, T =   1"*2   "6N   $ HiGH#GH"b !,+,   H.'s- `L_`_`"_     8"h   V+Mh  @"?@ $ -   (Y'(N ('(  l+   (5(  ##    2%'*R>+    5 " * 2 : B J R Z  b  j  r  z ( 0 8 @ H P X ` h  p  x    POPcOPOP+       ! v# P!OP OPOP&h   % B 8 78Q78787878y   R A hKghghghggh$gh$gh$ghgh`  )* &~}vuvy    A\kl + ) ) - 'lkrorc   ?)f2 +  <  /  POOPXa> 0 7' `(_`X5X %X Z X&d    @?@?@X0f   xwxwxiwxXMNMN65656<56x   )*%y T0< + @L   @ @@~    @9  !@: ( /A3#DF   -  "@ J* P(OP#DW    "+GD 0/0/0/0/0/0/0DQ   0< U5-+D         @ T8 \0 78 5 > GF g     xowxwxN*@     !fE  jL   h  fcdabcdcdcbadc Zf  T,    +L    @?@?@?@L2AB+ABK   -u#e2+K @O?@?@L`  , 3   (,'('(L 0 01/0/0/0/0/0L+(    >+( HGGHGHGHGH;GHL  1 ! ,#k% ' 878G7878LABABAB!ABAB    @(+I! POPOPOPOPOPOPOPOPT8         l R 93b  ; D?  ,l  !V 93 RR56565656  * p}     Q%<   R/R  3HR7 5   5*     * Y R YN"-  JS{x =a# 5   " RG K      C  R ]`   gR(s;? 784} N   uv       - "; 0KN_K @<:    #: 0 B  $9  +)`5D21-   s   "   ?   4v  E  R "!!!!!!!!/ vv65,+ll    ! f      !)$#$#*) 1R&          F      !GH!! 34! GHGH    b  vl A  $#*/    G# hlk!   l[V T lQ b  45 &% $# 545 3 * +R ^V#,#-49/E    F            lR -GHGHGH1GH(GH 01     3<%3<% m=! $' BMCR, , +               +  (  #      :     C  ,       *          +@--,A/0$  !$  #$   4.4 N?VaM N%N?VaNM   A z  6=~`#* %tK'- <                 + &        9     @  RGHGHGHGHGHGH                  `_`A_`_`_`RGH5GHGH4GHGHGHGH5GHGHGHBGHGH L;  -     Y<              YL         A     1  , , -"#&%('*)*++,+ RIGH;GHGH;          N ;X I;; P!OPZOP2OP OPOPOPR"GHGHGHGH!GHGHGHGHGH% GD    ,                 7+`/S    !% 2RGLGLGLKH #KH)  ~  ~      tu   " s            de[ "          R(!! .GH)*    v           )+    .  )*   R6GH! GHGHGHGHv      , F&%   [X                   (   , &&)     KR      b.)    qqqY1W  Ef9, oU 4 6!  g        v !  ,R1GH, +GH     ,       4    "5    G*E$(f#Jqy 1     LBR!! R*   (N'( R.=>=>=>        6)8     hogh R        , O!) X  hghghgh[ghgh=ghGghR     ji   0  L 0CV 5( : %& 4%  5R#   R  @S?@?@3R% > 78         y 7!?       0P/0 Rf     @  &= R KH KHGHGH!! GH  M  m  vl A   r '  &,C-4p         pop!R+     ! ###B"    R   +,'4    8g78R    *  "  `_` Vf87E87 f       . 7 # ;06! <E  PSOP Vi| +.- ",1 7 ;+ 6  PaOP V^78 9<; 04KNA 5 9; 4   XWX V ILK @<:M ?   -25 z   P.OPOP  +  87878V.  V78 V V,  V PjOPOOPV978 lepovwba x  qzw BJ6\s  G,& @L?@ Va  IVV S?V778d QTMNGF[\=*C :10@#!  &VO  ('(o  h3ghQgh      %a p x:wxwxYwx:wxwx 0 '  !" %  34  6   G    g J,5'%+%C  '  j  L K J IH GHKLM& %%  +LKL  P.+21  b l ~  PEOPOPX    = +! +     v   Wv)  .+`    bT*!05  +  h #6   bX, p^opop *z!0     S"#, (~ y !0 6 R##Gy  popopop9<'!0     43 ,.'('  b1!W9<% @Q?@?@?@* )$O!0D klQ T  V#&, $M gbmw"   qd  9 88 <;@?@98 3U W b r  '  1 < L $ q h|gh"  (  M!"BAy O  J!S  (  "   _!"!"Ta  !  "    "    yz' "   +21    "!0  C%    ? N&45%" i ^ ] z +21 MTU   z y  h i 6      h;ghgh4 ^      ("#       ! %*4  PIOP <  :    < Z  W3 <$P $= $Z b <;G] RMLGB  :B 2 POPOPOP% w6  $< X@WXP       ' $  @Y?@ 5<t !.!     @    <   m !  CP.IOPOPOPO POPOP O                &#. $  C.H    KP,IOPOPOPO    h       '    &#.K,H  i+L !     g/ #]?i+L} "  K\  .    P, 1 G B A 878POP OP O 43: ;< A    @?@?@   ( #  ' p; $5POPOP O     52 B jg ".5 8  5 8  E?  = 0/ ! !$5KK        @B?@?@Z  xXWu  K !  />u H)GHGH    X#WXWX9WX   4&- >'    ( ! "  r55  5     *   4 I:! 0$+5  55  XWXWXWXWX9WXRQRgQp           4" gp XbWX  BV ;       nmnm       XW   7  7  58  1 6*J9$' (   "   ;                 8 ;       nmnmK          5   5   #  5( Q 6${G$ " / @ "  }; GK M               8 0 QO  $*+3.T= 8?78L    0*?     .-?                  s  9     0$h >P O nmnm nm        2    X9WX(WX"1   )'   ! "1"( `-_`_`&t8 %d0#  _ B"p` !. +,x   @>?@X  /  9F        "  ;  O PO I7a 6QQR  300"  '  &%&% ") ! ,#   F ! < % J    1 "   ##n R<~}~{|{|y x+    +S"# Q^|   N2^  @?@4*  # 1?<N/0/0/0+/0/0/0=/u R "7  ^] fe         +#H   /  `&>)N      +      =  /0`?<V.3&     xIwx%wxwxwx  2   %D K6 a     x  '' -+*MD((  pRop_,(  !( @   ){3|'  r  @=>;         2  5 m!)  '    /{A|              ?o!/       +}~}~{|{:|AH}~       yput{ruv   M3 '% TcM30 3+# A    H   pCop@op  7A %  h  >   H   3 + tX   ' !+  {   C   <  p -          "   MC   <   1 2,     pop G      j 5 hlgh4UVUV6  - ) !< 46 p*op        *    H{GH  C   XIWX&{  %  ;-G  f  !    " W*"2  S  UVUV21ST  1  rq    #  -[^  5 ># -  a s](^+ 1 ?") * h921+   (i9+ `S_` _`  A * & @A?@^?@^?@?@?@N121212S121212] FF%@< Q8 8 $S] yxST  T%xx%       [    "    0F/0 gh  ;6 `Y_`_`"   7 &   %    @C)" 7 `  ! ]     $!           .TB 8O7878 788  gj   ! ,38 XWWX* "  ";(* "       " @X?@    %F    _                 n    8'787878" b ab        E      p   HmGHGH"L %  # (*L"4 @_?@?@"A ! +,%& # $&A H#GH"  mno p q            8t19&      F      7p09P `w_`#_`_`  /  RO)$    1+% Q#0/ # 3;-:Q# H_GH GHGHKR  $!! "1K g9 "^&=@7 65"8$;&)9 " HGHGHGHj i j i8 J G D A     XWX1WXWXWXWXj iPj iR 0 -       O2%+ P  @?@?@?@j i j i   9    H7GHGH1j i%  -  >   1 %   j ixu       j i ts         xwxwxwxwxxtsts xwj i j i j i! 8  &8  )         @ G qA=U       !     -:     hFgh       "+   (        X'WX$WX$WXWX.    !"',W  Z;  1AIH    7  0  #8C7NB9+B        AI     hHghZgh}ghPgh$ghgh @  ? Y @ C      $#%   rqE .   vu vurq rq%I  @b=('# +i@  ? Y @ C   [  I     !    %2 1*%0.  `_`u x u xuvu x u x.-.-  w +{ 4FAX~  + 4PKX " $:8          POPu x u xuvu x u x   + 4hcz  + 4rmz            H GH2.   LB   p+opT   Jz9/D-.-. -.-.-.-.-.- .-.-.m-.-.f    !6- 0   4, ;D        m     XWXBWX"WXWX      %%#y/ 5X <  9 !  "L e  D b_       3>i!      Ziv     <!  `%_`"_`_` #  X&WXWX "' #  POPOPOPOPOP       P(OPOPOPOP      HGHGH + POPOPOPOPOPOPOPOPOPOPOPOPOPOP#OPOPOP "!        21*    /(' (     POP!OP!OPj    "") #  `-_`_`'_`_`_`(_`_`+_`_`_`_`    "    #    POPOPOPOPOPOPOP&OPOPOPOP      "      y%    +   POOP!OP~      "_ '++!+:+  ,,",4,*04$  F99 ?::            P)OP!OP!OPz    ""9 ('( H$GH       8!78     H%GH                   @&?@    !      8 78             . 0/02                          878 2                %                h : !"!"W eh C  G  8 W  C   Mf J & XWXWX> )   v    # *4,)    popopopG            . -4 3  , )0 /  ( %, +  $ !( '  "1   ,!8G                {d'-  `    ('"% PBOP:   (   #$!F(      (6'(HF     XMWX?WX;WX  GJIVSLKT  *!A.?1/        0   H$GH  jgnm    0%/0 /0 /0 8 PM     " 8 0%/0 /0 /0 6: 63     6 0$/0 /0 /0 7T     " 7 H1GH GH GH uvu vn  =>A B     0&/0 /0 /0 /0 C      - C 9<    P4OP OP OP OP O ad    - ( O      H     -uv.       A 2 -.                          @)?@ ?@ ?@ uvuvu v         @(?@ ?@ ?@ u v     !   878 78]^v GH  HGH GH]^# YZ # kl  }~    ]^    8D78W & - $ 7 ,)     " 0$/0 /0 /0 5,      5 8D     6^ "         b _     0/0/0   . $#R?B $#^CF $#hEB $#r?@ 'OQ P  1    1787878788KLKL7878( +c  4 (-I  & '*)( I I*Q7F 9 <K=3 & 66 > N;  3+ 1 C 1 1       8    P W7878K&LE ]`  %   $0  , +   > /? W&E 0/0 /0&+$   X'WX WXWX&LH     ) ) HGH GHGH GH&Uj   !"3 X-WXWXWXWX&      ) @7?@4UF '"+ @(?@6:$    8+,+ ,:" :CD %    &&   : PiOP8+,+,:H  )*    2&&  : L C + L C 4 L C    L CDC 4                 Y   h    Gdr QR|*% QR a>A F B% QXgHK P      )ef   [\  =R&#i4c   h('"%   0/*-    0]/0    dy  ^    ('"%  (   "!    0/0(:  B   T  xwx;      \ ~    4:x        (7'(Iz  , LIPO (:'(  !/ ^+ F    '0P      _"mkI   I4$   $  6 w u    q=qu   q=qq     ,  &+.   9>  "  1A1 q=  u=  $    B >    )       6  7   =, 7   >\F!(#1  *" #,#.7-. '0P        _ "   m"k!"!"!"!H$%( '('('(' * )*)*)*)I('('4    XWX%%%    0ADT"mkZ  $  ,    q=q8 '(  xw        ,  '). !" 7:    r    N =  A 3    )         .  = %&   6/ \X.GF !(#&d&"}'3 (,7:      0ADT"mkY   %%.8  J  \ !$#$#  p   t     $  W+hghg hg HQHI    P!    XcWXWX  F@  1*(1  FrtZ0  PHOPOP)OPZ[  4   +,>f)]V]  ;9 [   Zx ej&   )h   m +80  <   1>H  0/0,/0/0\    Tu(   )  +   B G 3  #- ,< ' (,4"X< \f       " N-DSQ .;     (  WZ       #  Q; 1   $        + '  (W4- '0#               -% RK:E$- c"  &   !  G+ "/z #  ('('('(8     cb  # 6  0      +   ;/'-TeB -T na         !   !!$) jT POP      !"  1      5#e     # (*)    09/0W   1-  1 G   )-    "~y "   ^    #(Y   f h LG !   H   ''F  _  (!]   51            O 'R.QRQR QRQ% I o&%&%&%&%X$             .#                  $"$  - 598*(& -'. % I       o          X$   )V&%CA DKLK  P)Jv.   G     nm   $$$$!&`S   "<;    `,                                              _       )-     H  e    #    5   '     ?`9  GJ : (4     "  Kr% (  - %    &)CA  !"!$#*)*)P,+,+).-.-J2343v6565-87>;B?FC@JG   43 > !0 .6! 6 ,  9#z!  9   03  s43\  !0     )R \    :*       v  l .    d$!. *. x    u  )4* 878278E  '  " /E `_`"_` _`LC       &K &       S  J%                 nm      nm      nm   !    $#$#"!('('&% wR.QRQR QRQ   /           95#  A   -  w.      m ''$G,5                ,     ( v    MPON MPO   MPO   [ 5$ d,2M%   "'$G,5    (  % 8A787878   2 E4034330333 03= !"g  . R:7"  :.  :  0      & $   C"(/'      = 81 !"  2   bDuVk$%&%&)@ H/ ?RO9!  *jgH    A' *+5.D F Y  &( F (#fg"2#3  X m 3 4  ?#@  1            O  3  $  7      #TOTSTST STS" !          8O g"     +4$           E  O     #8 u   ID & k9g]&1'g"5 A N.4Yc \~+ * 50   # GOZ=          " t  ? C2(r  ?     !  G[ &&   W          K         "s  Ac:   |p2>3> ?] ]A'nN&0    &  TJ   )   "    5   5 M  3   )  <)  5 N4 G s G- @ $~ -q   -     W^w                -  E1!Q(5 ( $-EF A6S *j,  5yFYa l,+4,+9 +w  ) *  4. V)) -sv* l# A_4_53  :4" $8 ! /  !=Z l    0  9  w d5 \[  - 56 $# "       .'W   2r DP:5  4$P   !    Q. 4$P H   G+!    )+   d  *)     *      po3W_f(`fa e} PO3w?F(FA ] 0/ 1&(C&!>? 39}(B  G1%e   ,  %        ^?$jxk:l#< # <#E#< U$% d        | '  >  G2 3     6 7 (G&% " # :;. /z  MGB,-VS   1    I0p(-N  5  R 5  ' e-4%430303  !"g  B "/        @?@!?@?@Q  4  E, $!" 1*,. <   1&12), S 9XE.R9E, 0*/0  MPO!  (''('( M (3*-   6 "   #   # 8=7878A  v% -)A H0GH:GHGHGHI      ! UI  U    .    2&O  .# !     !!   $ ! %  $  ">!     !    t3y! '    85NIFE   2 '   qr 2)  (  *  '' &b 0o *    $0(T'K'  0."%?$c& " " (6'('([#     "  430343 03#  %, #  )2 ###"!"  #! L !    O'$#1s/430343 03.$ $$ !       ##$"!"  #!5*   #1s/   . popop opop-opop-op  j$  % ,$ $ $ $.. <3C     j I E%    "" #### %&$$###  # L  -EEI E     XWXWXWXWX!WX#WXWXWX{S%    <1 %%   sME{. afwK9F& %%('P ' %% "/  && &&&&MPO&&  ((    &.@2-! "B   ZC    W ~ 2J  ?    0   / =    ]430 0 343"9' & &    &&'"!"Q '&$$$((  &u  "83 G   :     0   S%+*430 0 343/( & +  ''2# XUV((Y ''''''''   ''("!"Q ('%%%' &j]Z'S3` 3#!$c$  7  ; "       *  / oQK)  /  (( +  F*wY=  = \M 8 1D^ B) 4-    ()! 4l 2N ! "B =QE?* ))0 )))) %*(U E? ><2-* ))**''''''*  E8 2-  X+%+/ +  :7**)*'' )***))****** -. ***Q+(( #''(  + *  *_(!:I%      +       /    ;, &-$?") ;#7  ++ "  W * ( " 7 .;, , , - - -  "!"! T- ++,, ,- -,, f k @ T g - ,- ,-,--,-- @5 K*M 5   V&00n. UVUV &. [^]`.  ehgj.    POPOPOP#  V . " "- -- -,,    - --C3OfC    V '  / . . &'  // X|WXWXWX?\&A / ....-  ...    #?&  @A?@?@?@?@V    / !. . . . !B:V    g/      0#00 > 0 $$$$+,    :0  0  0 w+# !nmnmnmDj$ B C   *  G )!&7NN2j |          ,++&%.+ %&%3   5   !IJ  : ; Y!5523 &O W W  e 3W   # #  *)-,)$#$#24 DC '  .  7 8 :!<) , % 8 /0p W A J],C  $,A# 8 6W  &  -,@'<J @],C  (#   9:   Vz_  %#qrqrq r  *qrq"rq rqr6 qr }{    xe   kl6    vJ6'  ?#    *   6     Sqrqr6q r( qrqrqrqrqrqr qr ' -,&     ,         ;)4@&ES6(            4#AF    # .C  X`9   7>5<;<;<*  + R>9 in o@! 5   7  ( ~"Q#! 8'  >K L     #a    ).-68=.^&  POPOPOPOPc: +  I>>#        )V           "#""(      ) ('('(#r    P,OP*OP#  +     "%a+ xywx$wx   ` "g@;:56  g8$   $" o      8A78 7878 7" [^]P     K!'!    @R?@?@ $I" o.6 A "* 4  -&?   C!"L Q -! % 'J-&? n5`   g!"!"\ q    k   [( 5`     % ,)  J,W  ?%    "+> .+,) #+ `/_`_`DP    DD aT/h g[f   7      6-  FTS   F> h  h ajF>g   *.I 16.I  -.+ "- "- "!87 .-$% ?  (  .I M<A^l+/wb$#3 / [E       " X;WX WXU     '   8p7878784        0p"Q : !0     6!V       04   xkwxwxAwx wxwx4  !0   +  2  6* !+& * 34      -.-.-. r    D A!"6o"D5#$ LY>$ ab#O 4 W   ,G[\   '  *9./:7 6G!$?651  ,+ @=> Q   6  W W   2 )  M[ &KA   }"&O(#ZEh 8? )/                   rD 4  BGH72121&7 6!&    7 43 4+  '5   0TV(;$&4 8`784  9   "  < /  I 9 HXGH4 -   !" L #  !#-4    "  `     4    I  .      Ni5U'   I  4     7! "  !0         xwxw ~    D $['!/#             7 !    ` _`_`M_`L' !  (v^]^^ !< _"             hPgh/ /2 = 2+,1 & B:N>*y p h*gh/ghm       .S 5S  . h(gh?gh ~   %eQ  R     3     88t ^          a4Oqt x0wx %  1  % x wx- !     u  D    h O   y  %    LYFE   0+ 0/  0; 0;K  xI rqrop   Cuvu)w,h o    LKLKx +f.*NQXS  Q-   0/ @? <? 0+   0+  [ " 47/3L& )X:*L-Js$6ML/W#'&  d G        u       B   J            z         Y W4     & #87S tststmts21.1    DC"   C6*= *   1    *  -" T )*,%   )cT 'JIJG&%4 "!)> ) JIU|{    hg#t Q` U/+ Hb("$,9,"I+j@HWF.X>H?SK92i[B=)3L54=[5  ? R  -         N 7 %8#&7 DR>' *(  S0    DC" Z / ),!Wd5 0  6 G      6 J    +     "  &    bI"         =     +         *$G&,p  $X( 0 #W3G6J           + "& Mk  %J " O\ .4!# v    1 #)P - T  I   ""3 !   $% !     +34O h-    m1 Y@  Y` / W + V,H B ( I  !PWA   &  $   -R+        ^! le!E A4 6< :    Gx@ x    C /0    %"T  6,' -+ }EN` @ x M"J[         C <  %0e-# /J(  J"$             CY  ~#O-)o[K$e  r   %'E -         .aL M4aR  03     4 %4   < `U2'I2 $&@ <;  .+,+ ,+ ,#$!"     1 11M+N 3EE @ u) & #   0F& 4  2'Op    %   8  9   .A!+$ :  v     T DJ  $WCD} " '* %    %&L. W} gD &  #  ) $'++  7$        "%%"aO =' hIghgh]    ! 3#(EFEFCDx |{|{         # )$& |K( 92x n6bIaKL  <LKG YL 42vw vu w n >M\LK     ' 4 9'Y  $  61  !     '$ -7l;S"`EV"1C "Ia bU   %$   X|WXb    C  1 -$5b  b;J    DCHGR3S Jm2,3;J   `:_`!_`_`bn  " 4       jxABAB N $ x lk587: t  )8=  @C?@ ?@ ?@?@?@j7AB6  op    176 0/0 /0/0j9   xPwxUwxwxj'(!0   )#  "" & j+( pdopj'('(*'(+(  !".5*.51 #!,*  0/0 /0j)   X\WX WXWXWXj'(O !0        s#96O  XRWXWXWXWXj'(^!0    #  #6*^  XbWXWXj'(Q!0      '" ' Q, j'(!0     (   3#!   ) +  T.'2@L k2j'(6  !0  )    67 "7 6   0;/0 /0/0j'(4!0    #4 #9 K Y","( '01:;9   R&?6  #     K '. +# ROhgJI6, 12"x%<   ;< KQp.  Z[>= ..nmnm 1  UZ%  "GHD {.(N  F -  @K#M\<   U      +#FEF mhk  hrgh"0 M JM BP #="0 878 b , ""!()0 zs  03           , PuOP 3  "    & 9       `Z_` _`_`_`i  )  6 5$7N 3  "     9       H{GHGHGHGHGH   hefc  f&a!{ `P_`/_`_`_`z"    &1!z  "!"         @    "    !    =    X9WX:WXWXWX WXWX    O"4c P#OP#R   "&B' `_`  *7)  -3, C7  *7 POP  5 8   !c  \ 9:34 `      6"%+   2j\34 "&! %   JP( X Y\f %# pop \"  @1?@\434 {  4 @>?@\34)34  } + )\34 3 `If    &`" `    `x A    q t! = q# &  x A` uz:      [ popopLopop$<6  Q $        $  ! .#26  2 $      878#78 9 4 31 2 4. % - R      4    - 7C/ l"!]$#$#f$#0&%('p !! dqEVj 3 W  k      9       9       _QM0 A0  M T } E&3 W     k 9 f +        ^     *              -+2        -K/DcU+^  * hrghghghghgh  GPOPOPO   '      "3Q/ G Y        u  :  &    C  7  -  3             w *)w")k)$#w"# xq NM  ( @5           -  %C* ,  ?C'  (Q (%M    X  %h$ N3  # " "  S  . #   !D .LH%  ";(w) #&'%)% #, -!0 + - 6S  3 6  87878 -        3 A  2G  ""    2G A N *  %    +   -       -    ) '  $V (  g+I3>2>(5 k0 8/2+           '   $!* ' !  4# J3/% 11 B %! 8/2+ {  *   2 %   '               ? = 8 ~4DtKM ZJ  Z  *   * #*" z 8%1 A' %  Z ~             f      3  (; I J' 2I J I J3I J (          J Q    pi&1  I B A z A T 3Z[ o r D[p s          c 59I;  '    2  3    rS,    7     r30 kl=k D"E ts n  8'P  = r30H<X  .^`   .'     %!  %;  HGHG@G>         #'M)=  8'  . .   =!"<-2-)?  "   #!""-)%. -..!  .            .%  HGHGH.@   .#  .0       JV      3 % A       N E       8 /     I     *)*)*)*                 ($X&$ 4%ANE8 h\ghE/  *6    1E1### P  !^ /;=A:7)/)K L   X _2  ,8*3     o$T,&T  "  & ) )M N"   T [2  ,8*3      HGHGH !"+H &    :  0./0/0DB   F V  Z  3% j  B =)%   4R34>34`B   o7to>pi.  +  R>B  X"WX  `?_`<  "  < 8F7878X  3 0  8D7878V  1 +h       8878 78 QR !  X h ! n   R>` ~  a7fa>b[   R>  bK<  X     ! +] ` s v  efK)`  787 :!' X6;J   B +ED ]J#  5 X   ~         !    % J   :  DH OH OPO*)       Or       43 `SB!! `*    OP U    7 `k  % #} Z *  GV.BdvoJ :D     *         Or  $ #(  hYghO ; J $#.+ " [    qN :4 J     -VU       '  )&   =0/   `X_` 8      " 9 8 high ;        #  O ; l3l6>  #lN H&GHGHl;     H'GHGHl<       l)* !0 #  /    7  ;,ZR l-* popl) l*  el        (P ! ) lY)*] D-*)*-*% &%&[-*;]^]^%  %# "      <"!"   $ 0'$ **/ 0!       5 ! 4     /"P#    <ER $/&&=Y       [;  p7op oplP    ;     lCH  `   `-_`_`_`l ,+     c,)!          $0q:T l X(WXWX    popop   !  x     7'  7" cl}   BLl 0O/0/0l)*?!0     !0? nl&)*)*6- *)* -*-*Q-*$!"      "" 3     $  *N / & &6    Ql! lRQ   lQ)*)*)*- *)*m &  !"!" *!  //2 Q ml5   jlLKLK`]^[\'LK)*)*>]^ [\U]^q 5  !0 -     5 < GRO %D? " D# &I0)$!0#H$D>C`'    > ) q  ol  #5 Q "5     ] !!0&5) 0  lLK)*- *)*n    !"   -"    #=#"   nl# # AlCD]^&       7#  &  lCDCDCDi                :R%!-i  H'GHGHGHGHlg    0l   `d_`R_`_`l)*  !0  - - /' !"     P     *        : !P230 U  57- P;OPH   !% .  ( .  P#OPOP6  &   P$OPOP   !  PNOPOP OPOP"OP OPOP #  !      '0 % < @ + !&(~  1 %   =         IV BE@C    Z]X[   pop *|& .L\  %   2  ; + .PT!        !18!     +    n      =)& < . 2?  1 @_?@?@?@z  4/0 ? <-PJ `  B * # xpwx$wx3 .343.K3 .-. y +{| }4L  4VQV/   %  K     05/0/0 #  U X, # jO  S   LO .       %   A 4o  M 5/  1:D % ?,,D! 8-78N78        O &,2 m `:_`:_` _`_`  hk L '! J, FS   1! hMgh$ghggh gh9   !     7!` ;L) Y 9 hKgh ghghi  -  q[`7 278727 212 72 + +V-.  S4 M 4/4) 0   !%=  4 '   $+         X$  "      ) I    POPF T]^ _ ^ o%L& W!  hghF T]^c ^ F!&D@  O;  `_`F T]^c^ C !&B4  M/ / ($ (Q'(?  *:   7MP   3Mh+.    @  "F"0$"  GW      ; A YMP   &N     oh+.!  '  } 8!  * #3  ! MP  .    .Hh+.   ;  $F$ a9|  (%,% <  HG  / '1 M ghk<)  { |y)   7MJS ^ !  popop" %$   "  %$       PwDX  pop   &#     rB A9  ?+ 036#256 )6#  #6#  uS7  hgh %  ._)    ('(C  qnqr ~}e tN       xwxwx*      (  W6  `_` LOP K J IH GHKLM (' 44 x   ~          O>  xw A#'#. -0#'#: 9 =-FE&$-    (      u 331 &3 hYgh/?./2  2+,1& BCN, p[op/$./2  2+,1' BEN(y 'y   B% (( C& )( p-op.   &'  .MPO-#nm ; "&  --B  =: '    / ,000,  " 0 0      D "          hgh = = =T #=* #=, #=.             = = =     dQef=efklklkli ,n `  G6JE=F?    9  Q= ,  xwx fe=4= =z KN)#=P-#4Z 1#=Z 5#=\"  + "          =4  = = R$    :  xXwx0wxwx8wxwx wxwxE`  _V  ;U VUV P          $#4'  7  ;   `      Q 66  .z  >   E`U V  _V _V  5U VUV        "       ?  L.:  =     5  ` <AB;BAHG:9@?FE    Q 6 "`  `     HGHGH` z      +,)* -*kD#     z  xwxLwx wxwxwxwxwxwx `x  l       0  E#d x  l POPOP+OPFOPW`     $<(&    XKWX 9.9 '92-} 8   @  p!opH   P  X  b lr  z & :  N63T 5^ 5 P-OPh ( r |       &#?/0 - "    |m    $ #$#$#$#$.#$##$#$#$,#H$   #,  C 1 / ", . #,H 1 ! jS g   `/$  Y*!U/$ iI y$#$\[#$+#"$#$#$#*$#$#$ #$#(?@?FA@?    ?FAFAD1   ,56 +  T     B  q 9 U 'W7P+T(/ !  V     +               i$#$#$,#$4#9$#$#$+#$#$#$#$#  $#$#$#$#$#$#$#$ #$  ,4TS   +             &4 )   5 - $ I*(i1C;>( ,42     +        $ #$  E m !"D $#$#$#    # $4#$#$#$# $#$#$#H  4  /. +  #'!7+4 H U$!    " =     $# $#,$#$#$#$#.$#$#& D          (4+   >+, eji  higj  |W  BARQ       v 4  <  A)R) 9$!    " =                    D   $#$#$,#)$#$#$#$#$#$# ,- @#"! !-4,) $#$#!$#$#$H#lk H%2 !#%   $#$#$#$#$ #$4#l klk   4   ; "%$' 4  ; $  ( x@wxwxT  STS) &-F?VS-. 2   ) $    4  W`  b a *  9 @]^]`_`)aba d6 +/$  *  yX %^]^]^]  P7%&_!      !    !       + $+  H]  \]X]P].+"!)8^&]^  O   Q+>2    1 DIVtC'+&*!  !     P7&_ p Z YZY XWXWXW PW,X j e  $, ^ +"   ,   ^cX] 8/,:/,):/, !:/$%:/( :/ 0/ 8/2 1 4343 :/.5456565 :/:,';d# EFEFELKJI"LC^cPm^cv5$efefelmjilklk nmnmpgd{|{|{ ? N+H1 '                "    `2_`/_`1_`._`x      $!       XW  ^]   878783  D 8 (   p>opxopopopj i           $! m'  h9ghF /- 0B/0*%!&f d h   ! @>?@?@*Q #  . 837878*F 9< #*' W^]^  *$    *% *#        *- 2      Z -         0+   4, 0}Z jiU jijijijiji,{b f e(      L           ? ?   BL      @? )         R9 &   aE )I". ! , 0! Z     U    "       ,!  b          WM}  'Y   `L  %      ZY + Z^*\)M! Ew   D:57+ (]"y   ! - 1am.+ (]"  / C L        $+!*>Z) / C  L hF          !%F  \. !     T2B ABABABAHGHGHG+*BA       "$!   -.-.-.+$      Q  a   ) #(     T2  + * hghbghgh.('*)*)* )*)   '------F?VS-+ \!42 @ ?@T?@?@?@.   ) D8  0#/0/0/0/0/0 /0/0          6 33  o + @  8-  *      4       (  ( +@  &%& %&    ?           L   ?      j"0)<""   " 9 !    U       x*wxwxwxwxwxwxwxwxwxwx&wx+wxwxwxwx#wxwxwxwxwxwx * +& ' N O    " #> ? BCJK: ;  F G. /2 36 7 P    j*!!     $!"li !  ),    2/ "$&      & !    e  !  / & XWXWX L  0 `j_`C    )      `|      5    ) `l_`C    )      b~      .    )    ) H   ))     (O(    Y *$ @  %c       WZ        %<$6  c (#'(6 *# ($'(G ,  9AIf e f0ghg hghe        "B  +9 pst sts/(4#"   &     H ?~)  @6 !       +z  0    #  !Q}?BO`(_`%_ji !   #     &%  %    {x$ .P&   L    9"1(~ J - :  ( !    (%   !     2   ?~ &    D         6 ( \9! =  T :;! V~ .-.-      !73%l-#  pCop+++ p@op( '' 8378 , 0p/0            4     01/0 1 x=wx"     K+(+(8 +( 6! ! )) !  m"U"  I) "U 4))  ) """ &:  @  ! %" '"  -* /. 30  "& ,     Sn  OT QT ST=> WT  a^  if   %3 ,5   !       st                 ,p5            %!     " # $ $(     V  74 96 ;8 =:                          |  ]X _X aX eX  gX  }z kX  mX  oX   qX  sX  uX   yt    $  $ &&''   ,5PRX                                          !                        1   $                                $  $  $  $*  *  4  4  4  4:  :   E@ EB ED E F I H I J  L    !!  "%%) % &)&)   '*') 5  ( $'*,,-  ,1     ! "!$#&%('*),+.-10/ 21$436587:9<;>=@?BA                           6565 xPwx wxwx      B   RK  PW"/    @?@$    -25: UZ]badcfkpor} )! ! ! { 0  0 ! ! ? ! l 0  ! ? 0 ! ! 0 ? ! ! 0 ! ! ! ! ! ! 0 " " " | 7  1 " " @ " m 7  " @ 1 " " 1 @ " " 1 " " " " " " =  8H78R&   !       Z  "3       )     "!lN+4A   `9_`_`_`_`     bf !F xOwxwxwxwxwxwx   zqrng   b4,99 ! | x>wxwxwx wx       Q H @&            i)$Y  '    H$$6    n g  b .- Y  H ab   op  !MJg;o!<!% &      -   $$~  -  6$$  `_ ^]bc`   fejkh a  `c\]ZY  X[TURdaA!)!( -  6$$ M - 7$ yxw|{xwxsts xurs  rspmnmjij   ~}zy y  x{xwturqriP#!' - 7$  M9  N      7 O8 N 9   3R    1,&3 XIWXWXWX p   '   X&WX %  xuvu `nir   4  hgh:) *)*)*)*v  ~~         .'F: v x>wx(=> 6(&   O~}~ }A~     7   5 <    O A  =>  * **)# >9!    ,>?  bF=> O@ F h4gh 8 8#$ #$       S!#$6#$$#$>)(* #$     .*,,   "(     $    I \O3-  '   !6> (     #$!   %"! 0/6(!! :     # :     \=  !  3        "6=  Q \= M #$   =>   &         ?   $-     3$ . K      &     ? d+  =    B&, + hghH z ////// +F      Q. H ++H  + +  ++ + +H -- --H.. ,H:& `f_`_`H%&V!0x    \!GVH)& aH%&%&) &%&%&M)&--)&3=&> !"NUSF= #"}-}- +   )3 !   /!\37) 2   M  3& `)_`_`H-+-    +H-y- cH"  'N \ Ad  p ; <;6 :/  $#B3^[+\#^K %^7$ K^ ># f#  ##S3  I\5   pBF<+$G2 4    = 4  -    .    > V  !L " *0 6        mp ^>     FC 0Q& Q(CL Q$G! ! !"M b    %   ,()    " *0 6 5'   )                        3<,"!Qk/'   )     xSwxwxwx`       '   `  XXWX $    ,8D $??0     L *** J^#G.&&(&&R5& W8  .%&6%&)C&)=&A  d "snm;  ~  &;<# ;< ;<  ;< ;<En-  !?)  ##=$6<!"('' ')1'L'  )6'L   6Y   30 4; / .  6  C  = A  .%&M78)D&W 4!@  (  + !   6,"MDW R%Sg)=&#     ( #=        +.       -J  F "%, "Uc I g=#     s)  ' !   G:"  -*SE"!|{|*|*     x* )$ # 3* .AE    p%   = 4  40 ^ YX S%&  %&  %&%& 9 8 %&%&/  s'&           h,     1;   XXWXeT     .8   heghghgh*  JIV 36(' ,* K#N r"    "!   %72 T %  #      N zjmxv !!!ZRQ R  {SRQ1 @I  _RQRQ1   D <;<3.    -1$(  J  "  /#$f<    D>  ?      $     1_1 /J'IF  !?2 ' +H/'F        NMNM LE"" B5   =  +50 0   =Q j9" {H3GH4      D#"         %B!+=(+ ,+,GGH+(;    WZ #={ |{~ ~Q35 $& &  'Z  B =   ; pqop+ ,+=(   #=E    = `&_`1_`C_`_`_`      +.5 !:R#    N!      "   OVUT e fm n } p oh  5S^NN!      " mq9po1 op oq{/0 /0 /0/0/0/0/00/0y       PG$212121 0-(%&!  y !"!  +  FB (51$C   q    y $    p4opop(GH  * ('GH ,' /8<= @GH     =$ <  ( | ?1 25{,/0 /0 /0/0/0/0/00 /0   &% ,  ##  !    y   1! 1!&1$!39(  '  5   ,       &   Q_l $  ('('(+z  !! hghghghG   y 8    (  <Q hghghghI  \     F       XWX*WXWX0!   7 0! x;wx"wxwxq(   G  PZOP OP>*  @,>* E4;<,4    ',#    #E2   !6 @ X(WXWXWXvuvuvuvu dYZWXUVQ ,5 J *-  >L$ !$  #&%J0?Q^%U&-.LJ  2;;<  ; 3 v     H{2 @S #' V F 4 9! )))))) &&&&&&&&       '''''' ''''''   XWXEX-(QXgOVUP    )2/ n( =RK$LW ,9!    ,  (/< $ $%        4  9!  h/ghgh* -& * x-wxwx@%    b                z & )/ 0.d 1B  $ A;!"!("" C   '=]! % ?0 -  %* -     sr - (%    !-%%%      h       8n  (   #= !     -\{Y L  j7J  >$% :. $     CE*C;.$41 #  #g &  ) d 1B"!$% "! "   A(),+,(+./"2C143'6=7],  P"OPOP5  " $ J;';<     ' r,!J'  h6gh  +,    U/ !     G/!  h/gh;     P8OPOP  k!"!"`k %!   ppopopopopp!0 6 "  ,  &!Q!J{ j50 #   !"!"<] C  KRM  U\U   7 ($50    #   XWX j     !    )30  G("    ] F   A bijh : .++ &  1$)a&>z.& 2# G1    ] a  *!"% Y_ /J   %  @?@?@ %      %    @?@?@ $     $                (,'( '( &     &  xwxwx .   : =     %4S9 .   "  - !8Mu [ S B     K,' ) k )H        /     !  F            33 ;  !  ! P4~d"? ! 8 %&"I6 A(,  R S B  )  ' ) k   "! )!H   #  # 68:<>@..B.. g0     b         )9(% 19= (0     b (  HGHGH4    X"5'X6-VU   , STS7TSTS/VUVUT U `      #  "     -   8,7  =  $-   , S7/   ##     #  L C$ LKL%K  (          & /  c\ 1#   N      $   %  phop8opopopopop      {'  L '5!0 .- ,  **  C  1  L %> '/  .'5 =#t    &(5 pjopop  & $9D $    LKL KLK LKLKL KLKLK   }422$            |>   ' (<> H6GHGHGH.!0    4!.> X2WX^WX      c '$59 }  (  *1 1     !! - ! !--              FEF E    2(Q'   , I 6       "w/S  P"X ,,-VSS,-VSQ,-VSOS\[^]^,-VS;gjil A   !$!k!%?P  &#*),+6 ( 4)     (('('(H     &(  P0OP     PPOP!r HG L"K  HG            7&1        *                  *   c   WR       &"        N"  g   WR XyWXWXWX?WXZ    $3  ",AHI ! 0)/0 /0 /0X      '&  '       %"            /0 %E }< $   : 5/) 0 G%  ' h.ghgh  # 0#/0/0POPOPO ******   bNH.,0POPO8POPO zyzy  ,,,,   ,+,,   Jol ktsj  IRQH w  26,  + -% 8  J          0/0 /0     @(?@?@?@   $      m       H GHGH      8!7878          F     Kb  (*'('(@4    8:787878TN    $, :'    !"      G"& +    !#"+      X%WXWXV    )% @?@?@P     ) @9?@ ?@?@2c!0X  8# 2a (#'('(?H   %  $ aDj     .I *   "%   I      H(GHGH;    Re jkn kU   < X>WXWXWX z9A +l   A  9y z3 4      # '8    &  )! X3WXWXF  5 " z  + (    }3 4z! $,  8! @     $$ @;"$C ( 84, t 5  , l dN   @MX     % G[b 7(     +''%      _/ :   W L   Fj +J   + "')4 2` C? 3 4 f   G +rK 4JK  .*" =   ' %)     F   fs   H   P  \! k  l kl6kl k  !  6lklk  p od    > *) *u  ABA \  >=>       ; 'vuvuC8`/ 7O /'       !  6    `d_`_`popo p"o9p QR   (0C 9   b sts       $$ ' 'I# "2C     ,            444 J     0 #4#4#4    bg   < * * Y#j #G    - 2   M     4 44  J  h/gh !  ('(  333333333   "# XKWX   3@ A 1 K=1 #=1S  1  &K=1    H$GHGHGHT  #$ @;?@?@j ?B;<+" $fG |x   d  CLEF$ #2G G ehab G,nm  - ,   !,,$      "0  D!0K   "        9 5//" `9_`_`$T*+,+ 05   -&$>F @?@ ?@1f    87878v  #   8f78      !3& C<Q    L   "+:3(J  !)Q x    3r &! # $  ]"0 A q"D U '   U   9E""'x  3! HbGHGH! At!"      W !A     , +  ^,+    "py   '  M26'    ^ 01/0/0 !"   &! !e 09/0 /0/0 3"     3W 9 "   3PMNMNSNS        *$J*W] a?"   3        /         1# 0        @ ?@ ?@?@   > ?#  S!9 !9 F3# !9  HGH! !    h"gh2ghgh<  $ R *Z   l      "" Y D! ? 1* +VUVU  (    r ) P+OPOP@   " hghgh(ghghghgh  `mDhg hgj i hg hg, h ef0!HE FEq v BI JI    + 1  "6  D     , N " P%OP OP OPV       " P/OP-OP/OPOPr    .,0@f+&  popopopopfU VUlz2 ck ! !    & 'K zf'<f0V $    f X   f#b   f d  n $ .</ f  ] ^  L% "+p   >9 :5        P       L % "+fX    0/04                               B Co|>+=>=>=    \H$d'?            @1?@A>  *   @?@+>  +     @3?@C>  1, " @?@%>  %      `\_` (6> 56 ";:9 (4   $ a$<  #1$ P5OP  &$ $^$` !'-5&$ =k>+=>+)     \% % 6'*        H-GHGH4 h B    HGH%GH4  0x   $  0  popop4  0b&_b&_    F!0!  0& & # xwxwx4  6bNa   N0'  6&(  U POPOOP4  %b$_     ;$C  %$  XWXRWX4  &b&a    \Y>$#B  &&  HGHGH4  '   #  '  HGHGH4  )   %  )      HGHGH4  (   $  (     vq V4  "4     4Z  &  "4  HC4  &   "  &         ;@    gl   6In 56Ex 5      7j6Df  _f eM  sts!v {|{|{+~#e '`!    +6(   HHGH6    6   ! ; :      8V786 ) URO TQ       8^786 ) % $$$$$$$$$$$gda f$Y       XmWX6  `$_`_`_   .JW  $  xwx6 "`H_`_`_! z  ' JX!  "$$   xrwx6   _ rqv s 4_       4 xqwx6  _ $!! ! 4a      4 6      6         T#S EC6+   gh6           q ## A06 0            #F ' 7##x +,6 *  )*)   1 6X:   . 1     X!F$6 $"  " 6 V     B  4WI     +)  +          4  4 +    2       &   A   $ &.o )'r !'C K  #%        4  4+  "$#& *),-*) b6      $          ?@4    }  2 eO :6       #" 4    $  :6 +     \;<9!HG-F(oL  K!^] #:   8  ", "4W)B 1 + %  4  @+?@6"   xnwxwx66 Z 6'  hdghgh6 (-    @I?@ 6+ ,1+ ,  !  ,&  ,  1  P56T ,     ' % 6 +          3 B     R $F 3 91 9?%I  8786    & z6"#$ 0  !0           dE  " 06'$   h[ghgh6.(   %%%   ^. ( !8  +1 2   ;<;<;+>9<!   ?$    7$ 34        +      )K8M   QNK R ,-VSq     'H".]  C"  `"_` _`%_`_`_`8}  (&# $"8    ,-F?VS-,  hIghghgh8r   =  ) B     ;8    )   MK%1 2   "  """%" """" +2   ]VU?BAD      """"& 1$  ?t>e(@(4m   +"% 8)&>F    "~. -.-.-f.-.-.-\             5FEHGHo, "?  D: )%d f @ ?@/?@&?@?@?@ S        % !%S    @?@,  PROPOPc  =    S 9  O ?65:E 65@    <    O65J&U 65P   XWX*       l ' ' ' ' ' ' '  -      l"    pjopop   657 &D0  ) @           65 65 . &IS )  E "/     PZOPOPp   65' &40) 0 8v      ; 650 A  /   /I%&'%,n S(8d    65 65 65 65 65R# 65yhc bop~]K 65A>? 65XS&LGF 9,%   E   ; :   b   E/        en  +0 .   K  0) (   :.!6          vc " !#$# &%(''*), + .-   z yzy    0/0*/0/0       pIop op   !  * u 'M]  + c*   '    )   4&# P.  hQghgh21A      XC!   #   :2121:9:9y:94  " 1   */ 0 65  -- 65834          A   (    q )   B   m&b+   g  *      Ly4   @?@  .     .--.-.-#0 /w ''           7 7 6 -# w    '    $  &                                *J      8^78786(   T 0/0 0-              &'&'''''''                                      ,  &%,+ (%'('( ( '('(>$>8 u2 ? # B:'#u( a \ [\[J    ( b    : Q''#      l ; oR ( 1#   $ \ [\ [\ [#\[\[\ [\[\ [\ [?-\[\[\[            #  >  H  9   bO '3   //R   #   ? -       r  (!(     "  :8  !$#I  (! Vr<n   *9<    r   I?        C     4 `Y    #$(@|    I?   r   #   ?-            #  >  H  9   r l ;         rT      _     = J~v[lC#M T c#| m0nm nmnmnP  mnmnmn  0 G)  (@i1I 0 P       x |   "   78 ^[`_  \e # ' "  OP FCHG  DM  gh .+0/  ,5>   8!78/7878 78R      !   (  x)wx=wx7wxwxXwxwx&wxXBtstststs  [\ QR  *!$      3M 8  4 5B     $$ 'X$G2C  ,       ]v uvuN  | ots   #X3 & +&=8IDWP  3uHE$!] N ,     A)      pop|     $, CDC:B  D ".|  tststst st"sts ts:9 ,)  :(&  69-8   "  ?ts1 ,1 :f erst/sts9fe  */%+,/9   C        V8  0(/0/0 GF       %^ l  jr# z  Q V$? K   A$ 6 LKc^ WSyUTHACC3NP  <  B  r  #FEX9  9    9 > >    #   C>>>0 Q ; H 39 J I  ; 8 8 =# 2 C. +  *  #  "   1  # # &-NP    <  Br  # !'0\ [\ [ \#[\ [\[r\[\[ jSfEx  ~}    PsPw6QjT     r     !6\ [\ [\[\[ . ,9; z     ire lCDWCDWCD CDjCD CD,  P U U  U  U 7 + K C c _ )  @% 5 5! 5 5!WW j l@ P  l;x       0/0/0/92 .# +IrqJIp#. Ij" % ' 5rB&( & 2Z )     GD^aVaOGHC&lC DC D > >>#&   C>. =4 9 8 V K V D  = 0 # )- + ,  +   %  !1   &   <D    B   k  N   '0l   # j ZCV5h  nm  ! @c@g6IjT     j    l     )+  z  z  &8,   ! B!6 J    $$ ];" (C (,\ [\[\[ z r\ "  -*$n:        O  $`   * )  b$& -    l$y N$(j  $w  & ,$ M  W $v  "H ' > $W '$) C?$ >@   4    h ghf  $   ####$#V %< ! hghZ     &' 6765"#"!2321:;:9*+ ./.-  RM  D CBK DC@?H $*$">G!V      8&78L         / VUfYX     /YV.e .12"    /*  ?,A10   f9:9:)e         -5*YM%  4/.2!'" ") + ,   -1 7P#,P  FAD9:9:(G% *E ).  #, P OP"OPOPI  t    GDC J GF "1 3   C    7X` 5K1v  $"    _!5SgK1v xwxAwx /  ,.      :/  , P OPOP OPOPOPOP OPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOPOP OPOPOPOPOPOPOPOPOP OPOPOPOP OPOPOPOP OPOPOPOPOPOPOPOPOP OPOPOPOP OPOPOPOP OPOPOPOP'OPOPOPOP >=         .-&    +6    ;^]NMF    KV    [nmf    ov     {                                  % #%&.  ++ 3G 7 0/0/0   "&  J        )D=C)8 % / 'C%    !        ,% e*!&(       B  f8NMNM  \    :3!0 ' / )  '- k $pyvk^]^] D]^]JUZU*bFG   B        ?G7   # &F+%LMY, P 4 <8   \  / -xJM\[  `S_`_`_`_`  V UB     + 5 #   B\[   #       \ UVD  xq   *    ! 6  .##!&; O +    @?@?@?@    +7`         G /% y           *8Y8arV 0 /0/0r%klklr  % X2WX>r@kl$kl kl        69'&@$  6tm/n6 Gr         B /6 G K(t m/n !          :IB,0& / I(t m/n QZ          8L@)/& / z6tm/n& F    |      oO /& Fb     hHghghj <> 1 $ < A` STSR>    !D  1`QZYZYZYQRQRQRQRQRY ZYZYZQRQ!RQRQRQR Y ZYZYZQRQRQ!RQ5R&Q RQ5R5QSR2QR Q!RQ5RQRQ!RQURQRYZYZYRY yzyE:|>=x   &.5 )       ) "@*0 +3    E  '   <   [|,a,:1>*,=,7 *-      !$#$%('*'(  '&,-.-50.12 4565878!7:;87"        bH   O b\ -MbbbA                    0/0/0/0b    !  0/0/0/0/0/0b5       :5 b[ \[\       POPOPbC    Z*   wxwxwvuvuvu3v     .'6  8) .  wxwxwvuvuvuvu3vu vu3v     TQR.M EF.A'3     8,1) .   .  ,.|     / % wxwvu vu3v u!vu8vuvuvu vu3vEF )  #:   !  f7&  6  I   A  i hijij kle B KL [\[F GH cd WX 3 N_`A ?@STQbghM    &34787NOP CD!#$'(F3;<% V opE +, FC/ (    qh  <G     #0+    ,*N~    /i"SS +   ;A&A&WU @&1 1   . R 5lklk+lk (   B5+ S wxwvu vu3v u!vu3vw    - .          ! 0   > B' ,*-+ -   . w'.-,+0%  ""$$     *$?'0 popUdcg.-,+%   &5TSTSJ+(]TS^/2iSn aTSbQ. ##%%=:+& Gj!'>!&1$'% 6 -0 &MZ$Rg @?@`&  21    "!* )(-,%$! NM>=<;FIHMLQPOZWb a`ed    6$4 (%;uL^ 2}~} ~/}~}~A}~'   ###$ ###& $#[<$C=$?2/A   878&'      !     >(;ds$ 8278L(   "1  @H?@e(       #2$(        (  ' $%-0/( -, !  F# 45x0/ @j?@Z.+0*     ')   ,,A7Z0 @?@/-.+ .+ . + . +d.+ .+<+  "!(*(*( * ( *%.1*)2/ (* 5*)6(*% f&%WM--     d <,  *,*,) , ) , &)"!*'.*,-"!.*,   p!opmop-            B( 9G @?@!.+ .+3.   *)+"(-.)* +-+- '2 * 1^R 3 @?@3.+ .+U/  " %&,.-//()*   ' #(8G~1 U @?@-.+ .+O0  -/-/' !"  % 68AL+ O d (. + . +:1  . 0. 0 Er(   : @/?@I1    /  `_`1         +   . ? @o?@ 2      3P  2   F !   /48.- 4ts ts tstststs ts tsYt2  ..----,,"++,,++++K.?>++X++/.!J4       Y @A?@ X3     /& @a?@5          >4< @V?@ m5     28 XWXQ5 BA(%-.)*!0 AB12783FED =>9J!  )!v=@N @Z?@%.-.-,.- 7  4444  44 D"X%, 44   $ h*   #7 7       73 k",#$ #$ #$#$ #$#$ #$ #$(j         z,       ( , & DBB  BBLJHu tur> :F+l:===@ A@0D> 8 +)-200" % " > "   "   (  ( *(#"  ,q $  &  CC N F+DG=0>+%;9#&A" 'q @?@ (( %\  Dl  . &W @?@?@D?@3 2 :: ) "d:     : xFwxS  - 2! ;    @??@ R343 4    6   !b+i +$2" M" XUWXWXWXWX ! (O/5  RQRQR3434QY4     /8 Y F.2% Y !b" hYghghghgh  %    ,O/5 mz   1  =% ZYZYX ! Y*` f++29X P!OPOPOPOPOP,OPOP{  f hghgh  21  $1)%(+%     3$ # /6+    ba   &LKLI $>=>;  (  %&%&# &% $    $ 5     / f  E  k  E  lA$ 5  = (5% !'   XWXWXWX WXWX WXWX WXWXWPWP  &.   $ %212/K,+,)KKKK    ;<  cdH FI FIIc Z)) " )  "  B-2&  !    PWP POPOPOPOP OP,OP>OPOPOP  $  oT hFghghghw 2 -*# POPOP3 ! bKX/    560   )   _ J1- & /  /= JGOM   #%&!#%&!" 2,     O "4   */)-# /=         OM   $# #  G # G # g#DsTuF@##2,  0/0/0$/0/0Q    A @'?@?@?@?  p9opF :     pOop op opETST     ?0E P.OPOPOPOPOP  a@   N      r  .A   K        +A   )   !@R3434*).M1)-)[)+)()# )))))))))))))0' (! 3",9,E9Y)8" +$%) %)           )0/   ,  +  )     T     ) x     )!"   )    )    )|{  )t}xs  )lupk  )dmhc  )\e`[  )T]XS  )LUPK  )DMHC  )<E@;  )4=83   ),50+    )$-(#    )%     )    '         $  .2 _dMJ_         ,2M`#(+   /  ,M`  .$  )       4     H9)`7<;  $      4    )     4     )    :   4    "x   A  !  2    {  G!  !  !  5 9  .  .  .  .  .  .  .  .  .  .  .  .  K  .  "  &     %! ! '  9  >  z(  %  y3  |3  - [*3"% .% G  =!.F(.7"8)8&82' *4.%.%.%.%.%.%.%.%.%.%.%.%./%-%-%W+Z;1D71)G .3 G!.0. .AZ#,#]<.a<.u@   * )  .M1)  -"!)  [$#)  +&%)  ((')  #*)  ,+)  .-)  0/)  21)  43)  65)  87)  :9)  <;)  >=)  @?)  BA)  DC)  FEFEFEHG0  JI'  LKNMNMNMNMNM(            POPOPOPOPOPO!RST.SFE  "VUXY,\[9  ,^]E`_9  baYdc)  8VU"f ijknm+  po$h  eZ  9%r uvw  zy)  t  q  %|   )  ~  {              W       .          `S # #R9'R5+R1/R-3R)7R%;R!?R%, CR),GR  A@MR WRKRQRQRQRQRst _RQR_`C H i! A A~L . MP2<4+0  $'+,)*/'4731o cb_\Y'! f    &%  5wpi  ba z  [6587" -0 %00CD! A     !".-6ABA  => 569:7&%&)*-.12O2/  Ev\:1(2* & B  /?5'eL  .( 2 ( B9c A@13 ]  )J3     +0 0/0/0 /0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0f e!   JIB   %<  +>   $ K( 3.-R; < #   7"   6 + ? , % ! <  .       H      = -- E3( 4  4  4  4  4  4# 4 4TT 4 3!3!3!3R 54gtst  3& !     M&   'DA /Y1 /Y' /xY /nY /dY  /XY /NM /BA.<;.65 /*) . . .   .H.I %  6%#                     '  '               Jt*S_ "Y-,D4131313131 31 6!$12%$15' *+4+ .+1/$121$1,3 6,,7 :,, ,*7F     -- E3 ("!"!"!"!"!"!$%&/% ()*/) ,-./- 012/1 456/5 89:/9#<=>/=@AB/AD.EH.ILMN/MPQR.QTUV.UXYZ.Y\]^.]      $             3,>>.D  /.D  #; 5 , #; A >A  a.     j <   (# <"  #( '(+,+(  &%JI  #      ? @     #      ? @    - M0K0/!0Q4 I,) '"!^/0) aD/1") Y<) ]@U8S2 C$ 93 %0 '07 /,A2 t . s$ B%  %  +!&E$$PB*>GKxlG&< .,     >  >             /"   !&%( '(    '( '      #        ;2 1    54 3  ,6 5    #        ;  Xe #$ " !   #   ` "1u/  J*  2  . .  X         F     0o  !      >    /       /        M       /  !        1 $ _ A H 2 1 # H 2 v P 1 # H 2 "3! $## &m% /0 8278/mmR I` _`_`_`_`_`_ V  @ 67<;@?DCHG  0 0 (`_`_                                 VUZY 0,/0`_`_`   C    ('(?W  6 , (G'('('('('('('('('('('('(p\   EF          3 &  3 . - ROPMNM5 8 9G#   P*OP-OP OP7*R  IT    7*     Ow J) (/'( '('(   1.!A J h!gh  y w    0     @*?@ ?@  , '  P0OP OP   2'$ ' P0OP OPOP      2"+$6 P,OP OP!     . )!  _      ?2%#I 09/0   35!          0/0 /0            !9 (-'( '(J  / , : @%?@      p op;R :' p op= <'       H%GHGHGH    !"%! $6    )        (4'( L  # 8 <>@BDFJNP   \ 2 $!" %NS* ' 2 8"78.  .  6   >     {#-F  !ru   . EZ   #-Z   1 b  3    hghghj   K(#  T $(# U(-  j  $((-   t 0 ")*)  c ^a b   R3     " h>gh            ,{/s      3  -   H C^     ` Uv !    ) @  7*o(' N Qu@?&  0" 3BP Y} !  8" fR H2GH ;!   !n sp o  > !    S !  !   f!      & ` _`!!XW!! !, !4  p0op!  !<   !   F!!` 3 W K !   H @*?@=L      -% @'?@ gfghk'"  @1?@  !#$!6, (('(     w&    (%'(   \ST@=    @+?@t .&  )<  j  J ()*)*)   Ropopo     P:=>>=>: .     w:       ^ ( ^. 6 ^  >  ^` \[\[$#$#\[,+43\[^_ Ar( 4O+21, 8  RG# #,$/ !  @%( +,  r  "      * 9 HRGHD $(  'H  J !> &     ('    50N"= 4 J  !  > 26?p 3$ 6 z  @56     8  "' hgh   04/0/0    >&    66     g     l4      dtsts ? ^43  43   "S    /CV:"84> Yy#  *   } ,!1D#      87878 popopopKopopJ I JI5JI  !%M! .2    6 <5  5  VUVkl1UV klklkNMNM  &  G5 1   87878   popopopKopop  !%  O  . 1   6 ;5 x#wx 878M          N     OU) <       : ;@ )              ; 3,k &  i     ,*:3= 6  k#) < @ y+          @-?@ ORUR W^]ZYZ &    $` WXW           FE :9 ,' 6545- /  5YZ *A %* 7?    hghgh!ghXW`!*_XW`  *                   $  t1)^       [  %       '  +  Y:   jijij         POPOPxzy   zy        *?51 x     (;'('('(/zyzy     z        L-/      `_`_`_`_`        3        =&5:'        3         3        2+ %2 / *%&%$ #   B Q V-PD* D <S 5| Mz yQz yzyz  #      '+W M Q   v :('(! \,/.[    bp$popo p o p o    NMXMN U  N +)*!21 ?   -" ' * ER  Z   ',0/ P b    `d_` _`_` _`_`43dcdcdc[.   NM[ L\ z* po\o(\ [ |_|[U` _` }xj str$  [UU $  r o&\ - +KT    8)4IE ( (    U x    P OPl7JIJI     ) !%  7 `-_`    b)*ab)*ab)"Yb)"Ybabab!*ab!*aba babYbY d) Y [ d) Y[  SS H1GH(GH(GH(GHGHAGH/GHGH@,   &%"! ! $         B "! * @#  $"-KLZFEH +9 $! 3/#  $"@@  @ D  12 121212f(1,R!0](%    ' 2'% d ! 6$P*,  #        f  ( POPP  D2D1 : + P         12  KmR-iO   1O &  Y  #-!   ,     '!5 GNx6EO :G! + XuWX: 9h   6  J h _+ %'  2-_+ YR  @O'0  %'  BO 0w  hgghgh , ;  A sJ         81>J { O V +2!  212k1N21 2     + - )!  ' <1 )8' / !+-N    I1e C ' :&  :'inD/   &" H7/.C'   :  )m    `      ;? . m k,5;")H       -    1    35;"     H     + BBA5 . 7 87   !!!CC B 6B     887+#IDG' & %    7-% B     . D@  % B X   V U (' O O -7  < ;   !1  7 Qd0 /  /  )?d    %   TS bchgbchg vu| vu|   !0     %   F%# RQX# 2 %# :   1?  3 ? an     40  b  fefe41 P !"ZY 7 NM-. xU:   ( JIJIJIJG - J1 ,$I&5J5J+> G3 $  & !uT;U: =Q C `]_`j J       +} %:.D  cd    ? @      3%:       i    # Y bY d3  J            # *&8      z/ j\# v   A k ]  01#  v4 .   a   -< -: K#- HZGH  JnoD  0 X2WX & x#wx! !  . 0 S   ;( -! ! .!  (! !  G1#      %&%&%   Rmnmnm$ RMNMNM# Rqrqrq& Rwxwxw  & & &             @*?@?@?@4?@?@  "  M#  P&/")! )"!)l    ; DE 7  U-L#/         @?@?@?@B   ).  v  v    p          % 0 _ R  % 0 m R   y R(           ' 3 q3 P v v    .  $      /  c         #   U U    ( @ =11&1 o / c   !!! POPOPA$   O\(4 & # ,<2 3  & L & [     3&  &"' 1  J  F0! ;3    3&L&[ D & -    & L    D&- y 3 . & L &     ! 4+$#3(&  $ & /$#4- !%*  " (8  J  x   ): "3 = 0y3.&L& 9 H   R %A %  ' 9 H F              R  " " D 4      #    0 V , ,F       C       { C  V%5%VUu UVU u UVU u UVUV %K  o]^MN o]^MN o]^MN  > 8W+ %%     xwxwx X%WXWXWX tsWX tsWX tsW!X %       %=| %    ! & V%5:r   V5:rqr  O  V 56UVU qrV 56UVUZY ZY  +V 56UVUZr V 56UZYqrZYZY.Zruvu  %7  K{  .             R        //0C 8?    *   $#c")5S>  .g9  3 %    O  !$ #$  #*) ,/.- 214 5+8 78 7>=>=<= @ %& ?*)FE('( ).*   X&r   X% rqr  O  X 7 8WXW qrX 7 8WXWZY ZY  +X 7 8WXWZr X 7 8WZYqrZYZYZrsts &I  %C   .              R      +!# *   "!F'UV"):G-  .<3* & &   %    O      &% (+*) .-0 1+4  343:9:989 <  ;&%BA$#$ %& ,,,# V UVvuU\po[V#5o[  V#5o[ !o[\[    m   \  [\#7| #K| 0           B+  R R R  E4] 9 9  - ! ! *>"$ $ !  #  # !&!$ !( ),-, + 010 /m4 58 9< ="  poopVUVUVUbV     2#!Kb , \po[X%to[  X$to[ "o[\[    s \ [\% $ 0           H+  R> / " 9 % - 5PLD" %  $ "  "#" ! &'& %s* + pop \[\pco     B#1Kc $ ^]^] ^UV5 V#5 V 56UV 56UV 7  #K      P9P9+   #       `_`_ `&W X%W X 7 8W X 7 8WX  ?& %       H9#@>/C*   & %       Y  $ D vuCDUV5 V 56#CDv V 56 CDvuUVUVpop\popJ p\[\[VU JpopuvuC$    S7 N7  N7o^MN     mHP #j0 i         !$' * $'(& /238'* ;<;>=> ? $ABABAB U  $F ts EXtsW X 7 8,W X 7 8WX tsW\pop\pop\ p\[\W JpopstsE$        *          NE^0C9fe           ,   " !(),-214 5878 !<=>=>=>2 "  >% DNWF   NJ" - N`   *  ;?*/j paopN# & # &0| @ + > 4otq 2   0 N# &# & , +( 4]b[        %< ?  "&O    RxU vNMNMNM2N% 'u( 'U^  2  2    ' ,  , ,#2 u Uv  <vw    !> XWXWXWXvH   vOPOP    POPOPO  ;>=@     " 8"          v  ^v W!0 )   ]$6#Wv# _ K7  v !0       #/-  v8h78hW    / 0.=>C       3837hh v (     ( Xv  V       z    V /r5Fk:vN MNM\817k%l8'78W7GNMNMNM.k%lED CDC87kl& ,       %         4 % %       c&    9SE.   +</ +. &0 f ! ##+Y \1%'WG      . % E  & , v'dcA A;  ! 'A v/ABABAB9:A:$9:  rsxw   8! P;/$ $vdcd c d$cdcdcdcdc     # ; @"/  $  Kvk     '\ 1  F     v434 343FEKFEF E(FEFE FEF EtFEFE4FEFE7FEFE3FEFE5FEF ELFEF EKFEFE%FEFE)FEAB AsE A BdFE FE*FE FE-FEFECFEA BABUFEFEABApE A BUFE)ArB A BnFEA BAB{FEA BABgFEFE5FEFECFEFE6FEFE6FEFE*FE@FEFE*FE9    + 2     "  &" `d 5$U .O 61.  '  $AG   >=        MN   ? @        J              7 8?43!       !*        ? @         "  ? @     $ C `uzy        !+ `AN_ R5      !*   O  Aw              )o     )V > "/  oDOH1 ". EH 4 "E9C"  ! "  &    "  !    ! + #' #5 #( #O . O .  ),2*.*T#.#1$.%/* + * *$+#1!$!'$=AF%" >"AF+D.;F/023/35=8303;0#$#,6#5$#" K (      t  4735 L K%  )"!$% (     ! ( 'd21 21*43 43-6565C87: ;:9U>=>=@?B     = B AULK)N       M N MnXWZ [ZY{^]` a`_gdcdc5fefeChghg6jiji6lklk*nm@popo*rq9 av9DCDCDCk%l   % '2,  %9% yv!HGHGHG+k%l       + % I  %!+% @?@?@?@vNMNMNM  % v.DCDC   QTSR! . kvHFEHGHGHG%k%lFEHGHGHGk%l           % %  7         %  -!I,2 !A  I  ,H%%       %  d   %"!" !"  " ( + a  (  &! 1  %   haghgh  &8  hI VO&   & *  & h 0 j  P *"  "0  f 0    O %"  0  g2121 2121 21212121 tqtu rors  pqrs%:wg   1Z   :8  ;212121w21   dadu  heB?@ ;8Gbc4V ZG; B  8V78'7878O78787878787878787878787878CL<;<;   @K          M 'R    TBL hPghj   < )   /. &56",;F ab'!" % -9qA8 >NI C%' <L[75212121M212 121 2121      , e$D#$ p             :Y [{g3k5M c  !   *D212121 2121212121+21 ZYfeXWTWXK     !-.$#KL!  WX )  8'/|\w9BjQ !    e          G8 7V      %"'&%&'(  *(CTXFN *DI P vA212 121 21212121 212121"21@2 1212121 2121212121   a `eD]D'%(6534TO D)""    )@   =@  CD $G`!  f   uA        " @        @B?@21!21 21   @ !  *%0T%*)%8 7h          *  &*& +*  &E0   !9%7~ e 434 3'      2    234 34 34 32 3     "  $#$ H          0/0i/0/0|/[ ;0/0!/0[/[ ;0                    .$      :5          -   .- "! U R            -     w R&            l"  a  a :555 '(D (##("'"*<2  '& *<2 ! $#%&??]i|[    !  [ [   G  "% u v u[vu vduvuvuXvu v%%  + :   ? @   `_+F"%: ? @    #    % 5Y +F?@M% +  X   Y  2L  f .(  $ 0 "   "     d        %%  HGH b 9  m %    >V     ,    POP b 9  } '   @Z   0    8i78 b~ 9cdc pa    +P0 0c/0 bx yzw9W dU     )L, X  F& " $Q  $   A! ?)1$  F PX]    * + ppopX}    5  H .X< +  6X% 0X>Z -  8X:\&  x_wx`'. 9     F &. U$`/GHGJIH    5l/    `   !0   /!!   `  `     !" z  !    `  BGHGHGHA$GHG!0     i d[\[\Wf ef]    } x   8      ="H B       @ $G \`   !0     !!2    `    1. !0  !0 $       "A* !  1    .  `  AGHGH GHGHGHGHGHGH6!0     t    8%  -      $ '!:  @   6! `0GHG H)   %    n0 ) P5OPOP`  $!0   *"$A x?wx wx`)GH   ) `  EGHGHGHA$GH=A'GH'GHti!0^ 0) r wy  zy    b g dQl    L QH U7$ ;      A       $1H  h@z E       @ $=@''$!tg `  A'GH(GHt#!0         C      /  7$ 2      D       $(I  hAz <       @ $>@'($!t POPOP`.  nnn~nx 8?. "   R!'6  FUV        ;# D      :$%""    -4  5Mf9 nP  @ pVn"" [nh      >nk      C Wnd     ~   > Zng     h   C (b'( nw  "   $P0 0d/0 ny yzy |m$   &P0n$$$ ;nH3:9 4  $n nn `)_`4p"$@ @=DE      F)"  =p$.   $  p p  xX*: < C      *&  D 4`> /<  < 1Z> XT`  `**"" x)wx`66  0`,, , C`PP!  2`44`00 X!WX.bdb"bhbkbdbgbwbyb$b bb+d"$d$dd+ba++ X$WX+ba+   ++nm+nm 87878`       HAGH   /%-/  V0 G# & @ GP G` Gp G G G     ,   , h ,  %"    GN        !"-% :'   n'mQL !   ,     $$   ) KX'C*,,       ,    $*$&  i AX!C*  ,Z1' ('('"('( '-( 4      ,N" 7- ' " -   ,g   ('-  a a ` @  "$`$ g  -   0/0/0  ('( '(  FGJ X  <   0 <   0    7H    O     &(  ZS 3TWF 3<ETWF-1<   }   }  }  }   @_L/(                ($#  *+78                       (  (  R   C                      GG [      #J9 Ggb 1       &#                  0 WF  5 * G<       &  S  X/ g   h CD  A        !B ) &%  :!    n'"?           +                           p            0  %o        }                         }     %&      /0  }  " Q   Q         M  Q &  }   U       }           i)40T;%9 -,+ ) !m              !$#&  ), -,+, +"!" &!2 321216 565: ;:9:9> =>AB    (#             C  ) , D 0   2    8        }         &  }       F@ 2?  6?%#          &          J  ^g >=>=LKNKLKLK;LK LK LR-0   ,ns B9 l  p+B& #@4/     ;   DCf;6  2    J  `_`   N  !,* +.  ,   @?@  (          ~ D  X.WX WXWX    !(  XWXWX WXWXWXWXWX?WX WXWXWX     ,AD    .UH?o 8(787878   1 pop  ~}   rq          dc          TS          BA          .-           V5MQ%                              6.   8/787878     < @!?@)?@   2 ?   @ ?  878  0          # POPOPOPOP    3 POPOPOP   0         POPOP OPOPOPOPOPOPOPOPOP OPOPOPOP&OPOPOPOP :9*   !  2' ( # 8  'B   + "   2/ % :9*   !  2' ( # 8  'B   + "   2/   ('(#'('('(   =     % !"      !"   2  P OPOP   |& " c=  hoghigh  V\"()7R U  UVnfVcVV   / * # ; DQ\T2//k*%*:d* 4 * 5UVnfV M V V  xwx wx Ujfu Z t ul]+(/ ~ D/Wh*%Ujfu xwx wx UfF  : ;27 D @j]+W*%TUfF xwx wx Uf,      <TC'%:Uf,  .UVVVU VVfVVV-    4 4'4# &4!4#( %4)4 14 37DQTT7UTQ_TTF04*4*14* 1 * % *4*4*5+UVVV U V V fVVV  R"TTTTT TTTTTTTTTT TTTTd/Q *)GSKO[? OKQ;"c7g3k/SGo++:9.WCs'w#{;F WT[ =Q`RRROVRRRRZRRRRVRRRR4(4(4(4(1( 8 ( 4 (4 (4(4(<(4(4(4(4(8( 4("4!($4#(&4%((%"TTTT T T T TTTTTTTT T"T!$T#&T%(d'/(  VRf        V:Q4'*4%+VRf pop op Uf      <Q-'%$Uf  TTT TTd/    # XRRVRRV+(4(4(8(4( 4 ( %MTTT T T  d /  pop op VR       V:'*4XVRUVf      <QT1'4*%(UVf  TTTd/   XRRRN+(4(4(4(%ETTTd/        UVVfVV     @QTT_T2+4*4*%* 4 * 5UVVf V  V     Td/     TRF'(4(%=Td/   .VVV UVUV VV&f!f5- 73#  /  '&'. ;8 ? -^TT>Q:QXTr{p0*4*4*84 8 * 4 */#*%8*%gVVV U V  U V VV&f!f5  TTTTTT     XRRRRR2+(4(4(4(4( 4 ( 5TTTT T  T    TT"TTTT    # [RlORR2.(4(. (1( 4 ( 4 (5TT"TT T  T     GTT0     R9)0(4(4GTT0   Td/     [hF.(.(%=Td/ pop opd/   TB'(%9d/  TdT2    XR]?+(4(%(6#TdT2TTd/     XRRJ+(4(4(%ATTd/   TT     TR"'(4(5TT  TTTT    XRRR*+(4(4(4(5TTTT      VVUVV    ZT:QT.+*4*44*5VVUV V   P%OPOP ;   "T  aN0W  ))4_8      \     *wN1 XW XW ZY Z 9 666   HeNM26H    _ 8       !$ %&    p!opbop%opop    &: >  /)   CP#  !5j  ,8 0D/0/0V  " (T '  #     0  0w V  %#2##  HDGH GH&GHGHGHGHGH GHGH GHGHGHQ     F!Q hOghghghghghghghghghghghgh(ghghghD             <   ,DD 8    HGH  , HGH  '+     HGHGH "   ?- "  H$GH*   L'  H GH  X/WX G ( G   H)GHR  *              PBOP        P)OP   $! "%  !  . $! "% !<         =     HGH+4 X4WX)  N-&  HGH&/RQ HGH%5  H5GH&K , HGH %6       @.?@?@6?@?@L &j   PO : b$ *   &      pPopopop      R @A?@ $b i    ?0 P#``  #  +4> =Yb$aqhg "b$ahg l ghghki #  $   $  % / D      1 P IU t C / Q*, # '/.   #- *&0 $4L $q " $    i &  `babababaE. m   (`E Ofjijihihgji      >&4 $Y*$f      BW&%'&&1R  cAhg l kh  + NG R ?DE>,? B 7( ('    * 0   &''''%''    J,;:)  !  % %  A   d c3 4 2  "            $ (>'(hi:  8: TC R  cWb$a% +    $ 'M  ,#   W$%3 4 @:?@?@?@R  c' +  0)  '3 4 C R  cg +      p(    g3 4 PTOP OPOPOPR  cO +  X)7  O3 4 `U_`_`_` _`_`R  co +     x(   o3 4        *: **8 (  X      }+%       (~C~b$a   $   '   ~ e !  ),, &3 /*  ~$ Ab$af   $ N     !A$f ` 3Q3R  cb$aG  +      $  3m G,@!    ]  $ 3 4  +      $  3 4 AK3Q:R  chk lkb$aDl  +         $    =x N,G4! !    P     $        3 4  +  83 2?   $  3 4 P\OPOP OPOPR  cb  +   D ,J  b  3 4   +    3 4  B. R  c~  +          (1!   ~  3 4   +    3 4   +           3 4   +    3 4   +           3 4  PNOPOPOPR  c;  +  " D)#  ;  3 4  O R  ce  +       n("  e  3 4  3Odb$a    # $ q  #  d$ H=GHGHz        )5! 8378   . (''( '((    $  6B *)   $#             #$   %$-Y*+i #        :    ("-"  pop T  +03&#&0/0e87f+ 1 #3!8,  `k_` p   '  eHGf* 1, ' `m_`J_`_`_`,           ;1  3      ] H*GH'GH GHh !      XLWX:WX.WX2WX           8  8  8           888 "              s- D   /.  / =7  & 0!/03n  & f 8%)6-V      s1    /.  / =;  * P(OP   - b 7)-5    4 (4    2  XWX(        #$  ('('(  ('( '( ('"4   " +_/4H   ^ $(2 w        _ $4 h*ghJgh.ghgh?\   *  & ![ -.      /53vr       $)2121213"F   "  P& FK +)3"F Y   ?X WXW$!" o$YXWXWX    Y"pS     C C'   : K,$  f   !G c/  L +#5#$ $<5  $ E  " o $ Y  }*l&    V ao  "?l   ^    lF  ' ,3~       tu   z[ l klWli   FW*<1z ;v%(&* *)    ;  R uv      ULVS@^ _C+!'0J(O4O     ,3g      R ,!%: - )CC2I %)>   &)  #   ?  :  A    $   /   \ / ` ; R J  A     $  = = ).  6 9 @; ] w " pg    9 >9       }$ JI*       M}  | <7 2   2 e E  )    "  7  *  "  ?9   /    C   "  &  ;        Q  < )# ?  :  A $ /\ $!`&#;*'R.+J0/A21434 365$8787:9=<==@A) Q +    $ 9 , 4  I?  ]  I  O   $ ( =    B@QC=9E@S=88ES&-  D     [  U  ^  >  E   Q   u / `!"!"`!"!"m G  _  >   E  ] \ J A A  $   $  ?  ?'      $  $  ?  >  @     $                  ^              _f_ b            }$                      -4- 0                            wzsv    yx              KNG J           c     }y |   H (   ! 6 ) "==  {gA ! % : &'<,&%A+<&$$*<XS@<GZOC&! E +/ -GJ`IK@+ +"I!$8#&+%(+' *A),8+.I-0+/2+14+3 6D58I7-D  [  U  ^ >E Qu $!`$#$#`&%&%m*'G,+_.->0/0 /21E434365]89\<=J@AADEAHGJIJI$LKNMN M$PO?RQ?TS'TUVUXWZYZ Y$\[^]^]$`_?ba>dc@fefehgh g$jilklk p5opop*K          `'_` _`*@   *,   sS E*        F9'(  ? X[=3%)      s .*.21%!"$2 12 &  ")>   3 C D$! ## H .%"   ?*L/'($ ?W-*hS   .  % .Qt*h  S >**^  sq     $  '   %   '"$$. * H   hgh*&P . = *)  21 2-.- 253 $"[7'")   6g*  < 9>;     # 7 .   L@% :     : #4/+"!"! "!"!"!"!"!  -  #  :   '$ R  :9*       A VU NM2' ba      E%ji8  }$f ++AH      ZY-'E"fe I     !  ^]    R $lf ='(6(7B6C.h W/B K ?.l   '!& G  !(~<+% :     : #4 $+   "!"!$#$#&%$# ( '*-- 0/2 #3 6 :7: 9<;>  ?'B$A>  >k4   $2           H2GHGHGH4_T   * xwxywx44  ]`_b   F+35 [   4 2 0D$C .        $y 4 "     4  ! & XKWX*4     p 9 o <5*'     0@/0(M$"  %# HGGH(=& (= F  ('('(8L"    "  hcgh482    !3G E 8J ('('(*  `"_`!_`_`,    (B to f]< ( 8U7878,0/H0 /0 l  "    . H?. H  ,-t X;WX7WX!WX,J B  " ""JB D,          )' #  ,    #    '   1    # pWop,M 1 M  POPOP"OPOP&OPOP OPOPOP=OP*OPOP3OP!OPOP,OP(OPOPOP.1 " "  ! " !"!".!"!"  "" ! " !" "Q  :9*   !  2'  ( #8  'B   ?"        06f ='&$:%!1      .   " #&) .-0 /2 14 58   ;8 1  " 5%(' % $2% * P@OP4 =  }b    ]  : e Z     .-F?VS. .,-VS}  F#  YFY>)>=   @       HS        HX  ,-VS    D!O h  I .-F?VS/ .%%%%1.-F?VS/ / %%%%;Cp IN"1 !r  R T5 !-i" " &C*  2!   ( b     $#$#]&'& % .-.- PAOP >    --F?VSS- - $$$$     1 / /    #td#-                        .0- I*  ")  6    6 0"- 6662 Z%0;    ]#rOm=?e M4U-8- $ -,a5",;),C/X,B/m>&1, #C C#   A A MG#QTP       D $D _AAA; "      ;< ;<;<;ni<;  &.    !! WZ" """""""""     IL    ?st        &!!.! ! *0G(;= D# /  <"             ;" ! !"!ni"!    .  f8 7187   _      12H  C   Dl N P =2/)D,    ILU @?@?@ :96 7, 6 P*OPOPOP % 5 pop  . ^ 5   h ZT!" ] [ z %)$  %  $  A    %)$ c)!+ ,+        @#!    HWGHGH=,    B*=, &% & &% -! D   ?f  C"    " QRQ  F5NKLK&   # #$  ' '(  ; 0;<p  +  +,   / $/0| N7 3 (34x 6   .   i 7 ,78t ghG \B "32  H'J& ' '@& " ,3A KG!/U3Ki<4X0;3337*7C*)5I  #[     ?     #  `r_`*_`*_` " " r   m"f e"R    &   Y " " "  X3WX@ *  0 `}_` 16$1 ]7< P(OP5  8 f eLKLKLKLI      -0 KF 3KL  )=/CG)G(W   `4_`7_`:_`_`  , , /  * * -&22'  , , /   uL  _   '( '*+,+'9'7 0,8 0 %0 4H_3+B+'L_ | 2" &%1$4*/$Iv   1    $  %  .  $  0  (  /  #  $"$!N X   dc ni 9WX >=~{ K     |"! Om Wi ; FE|y /  `s9H  VUxu  NMzw L$n1  $%.'0)0$< `=  *P v 1   $  % . $0(/# $"$! r(   4  <  F      ! !E             /        &    )"$!             .-*  !!   )XU    : '6$ 5 #)M*D 3 %   !  ! E  /&)$        $# #        ! ># 12    8                 xewxy     9&C  xwx    170O R 13/X  &B:s t      &)                .-.-.-,- !"bi\c_  !!   "!                           21   $%  "#  !        #     !   #            78 &  ( '('(  " 0'/0 .' H%GHGH     6,      ZY   HI   FG       DE    ? )*                           H7GH'GHVGHGHGH  )# %)!&+   ! . *%&%  ` c-vuB:{,|s t{9v'uv.u              S =Z(] U-, 9. p  e U/!e jR  B:{U|s  1t     )   13=V4 %X*R U    1 x7wx wxwx wxwx wx wx/wx wxwx wxDwxwxS5          -           rqrqC      &%"  -  *         EB, -    -   " \55    -    C  8 *- b[\_hq    '']"11[: @"!X""!"!"C! ""!"!"C! "!    $P^ XUvq(' #   ^]% e /PP    ^]% e +PP  T   $ d   ]{5H#4Q[D ]a1'  ]W#!?X  >X  |w z ;X  w GOXP  '                   !      e6/fefJ1 +1 (B58U87[ 9%9'9)9v #X % %    }     ,   *K> ;   .  "Q  OS#)K> ; "!  "! 0/43 % 4!           n3 (-D "?3   "!~ "!   6>Lcji`8ct[3BSR $e' ts6L RQ L u2$U)R !!0[L <Ets6L Q  $[L E                  )?= :(:+:;v                   *   .#$   +$!$%  F  a3'C  * !"!"!"L!"! L"!    /0 *  e+,  '@  -&129, f1 y(*%&7+ K  *    L   *   .    '  TK ! F  X3':  * u"! "!  ;  b/9  u   (    &= 6  0/  &#% &#$=>;2/ &< K 28QZ2+=  *&t@ v       5   2 347W4't@  xwxV&      ' M- ;/&             2-&               2& E    JID I>5 3892  % ef  )*)-2 )2 ?2  E2IF   GFW2;( CF f/ ? <15A68_ Xj 69 %q ) O _6+  X%WX&2   r& F  L2/)&   A&"F    0+ 8    %  -+  #&%   )  ( e  !,     (   f  h/ ' 1PD4I?2699 4 %"K) (  ; 6 9   xfwx&W   :W  &!    &34% &  !&   # " &( )"EC: >5) 3   6   &"C     , Y&kZYVY@k&%/". Y37 -= (" "DC'C.'. Y&! ]  % e RQQ,NM M9Y(+ 5#(  (    f%y % ]B0 ' 9M]IM@g9[79AG !,;^86%  *  [6   xowx&L     EL     & G $#$#$! $  !$#$$%  (7@ _   G A&! '!G#"J 5 "!"!H !   ~_l}lk.  41  ?l=$5 *A  ) e l9 l+  #O M I  E%@#&  -  _loR    &  e   ( fNfe5 -/  b2 $ D)=+ Z87=6>'   )*  5 & #7   6$   & *   .'(   /(%JGFCB?()$ F  j3'L  * &!  _  #$-    ( $C:  5 )    6  $&+!G! "B / "!"H !    :9LK:9 4#'  /  ) e  A:+:  ) /0:=,9    &  e (f (fh 2/ 2 % '3c6Xb 8769!+)  )  / & 66    :&   0// $!~  rqx({ x  {=5EI!"L ) 76: 2& "!"M"! R "!"M *[ !"!   0 => / +  e '0  #0 *O0 +  e +0   -( !0"!((+ 3, f f2  l2 T5CA8+ <  * 8+"L 51 +  " )  +  *  "!"6!484 4$L$  4   R +`38' `"_`,4ZT  3& ]4>>$=n ! I$JK  >$ 4" 8478784K  RQ ='# `4/< xQwx4^9. !) 4( # {;4\>$=>$=    $$ i 0 7 " -%$$ +/   ) $)" 8578784L   >' `9  ;7:4w>$=>$=>$=>$=   T/#R1LMJIHG $$PO $RQ $ 0 , / Q "  ! .   %$$  $  $  4>$=       $  V  ;     )$  ,0   ) # )44    `   @"?@  "       4#  ` XgWX4  !!!             n !2  n4~#  ) *  96) 1HHoJf4  ('('( & *( Sb( ( {( (    {|{|r efefijijmnmn@\ STSTWXWXW&&    ?@?@CDCDj: -.-.12125656x&  ) ()'$  *F3%`++R*:-< 9#91 )x ` 14  0   H% 2<00&V  0&/0!/0/0 !9: ".@  L  R" T -`16 X#WX"?B:]  B:s ^stst]V  8   =  8 X *EO?         ('('(    `&!@ X:WX"UB:]  B:] ^s tst]          Y 4 [zU            `xs               ` h"B:]  B:{     !    ^s tst] 43                      u 4 < /  4       !"!$ %*)( )"! "! ,+         `           `            `            `       :l(     W hZgh):o6    # I0.9o +:V ( 96+   '6#(/V l2#Ds `U_`#:   "*t :  .+,% #, /#`  )  &F pbop+:    #S P3OP%:d   $ ,/<D<HJLN<R<\^`b<ftv (< :s 0 /tx    5   z~          2     H   /B:s  t         2121:9 XW    ZY TS VU   :9 @?  \[ ^]  2 : :s  t}t  !? ~}  |{   ! :9      !     &   $*+     (k]   * )*    +m4 +0k] )H+4(  /W"    * 0/ "$5  M,F .M;B/    /W"  >(Q6 (/** 0/ ++( _x   '# ,,C  ,*"!/ _x -("  "?/>  ": 8  "!x s  {   PMjgji    }$@&Q \ o  O5L 3h c@*-8 ='<7%o " 1S $S   9    "J"  "? $ > ": 8  ( _2   '#&C "!, _2 HcGH( T$ # 0&A   (_/ S3`U'#* $  .(#.  ? )14 ' "!;]#!!_/ S3`U* )(L[ ;" ;/"/P @?  '5 .- 5%**  "5n | y #)W#,"!O  "= "4 5(L[ ;"  ;  / "/ P =?(n+*`((     GHG  '#  bIJ N   1+ "![ $n+*`(    ( 6   &  4ZYZY:(abab'9ZY&ZYZYZY[ZYZYZYba:(aZYba:(a :,e ZY:(a:(a2ZYZYNZY$ZY)ZY)ZYZYZYZYbaZY:9ZYba)fC !ZKY<YZY <;<;ZY"De B  /ts -i -e -a    -]H#+H##$$#$# '2  -,-(--  -*  -w !   -&   -;N   -!`   -3 r   -; z   -C+   -.- ;8-.           :!"  ,+  - }F 5 1k14  &[     2N$))&%$  !"!$#) &%-*' *)*)   6 565        $*** *   :.- .-7(# $#F"  ( 8 *  25G "     9( " " . ^bM= A. s{! )  :  , !! $   HGH  M # "!"!"!44:79:AM UXUX YXh_!"!"!487          s,-VSu,-VS                           M#      7"Y        #$ @?@1?@ ?@~1qrqrb  '  ,1|  '   0/0/0~*b a  S X* ~~!  ~ `_`2_`_`_`~    ,B POP OP"OPOP~x     e?) H%GHGHGH~qp '#~qr' ''  ('( t     . Wxt      65/6      5/64 \YZY DA87n $0-  *7J $<g s =  >   &  6 $   $ UtDAJ  * $'*D `$_`1_`_`t !W XWZYZi"< , (7 !tE 'O U t m nm     _!  t     8078 78l,*)*)(2  !  ,( lcdc dcdaN      )1,`& a h/l  -.-.-.- O!0D 8A F    '     5  n $ ## t8" l   l9       02 LD  "!+Flk$  !!5   )    --)f2`   xwxwx Le=>=>-  8$$$$q(JCH = $>(e- L@     popopop0L=>=>=> =>=>=>  =>= > Y'7( %%% % 'ov!)        0L$=>=>=>=>=>=>=>=>=>* <Y'r8765%%%%  (  'lBp;$    *   < 878 dS   U   '~ 4L  , ;    3N   D    ,;  L ,-  ! 7   !  & ,- C 4L h  ! 3 . h 34L Q   3  QL<"]`xL1  PEOPmOPL  ,%'4       )dL2  L=>=>=>E=&@"ELAL5L CD      xUwx wxL'      .'  b   L >      3 -40 >L    L  CD        ` L B      . B  \   L$[       J%2$[  p/opL< LF L*    LH  XMWXoWXL  ,%'<      $)f  L!=>=>=>G=(@"!GL  p>opL+  + xQwx wxL+ % ! $5+L    L"+    "+ ^   L&[       L%2&[  "!L CD G H   n L V     , % V    L4=>=> *      g'`4 *L !    !L 'CD   &: '     L y    7 % y    L66 '-   "   a1 +G66 "- P1OPOPL 4    4L $CD         P $   Ly          $  %y  |#L@        f:  % 6@ XDWXWXLW ;L 6       B 6 Lr          r ~#LB        h:  % 6B   <        % # !  `H_`L :     &+ : mL F&            F&   L86 '-         "    c1 +G86 "-L "     " xKwxwxL Q           Q s L"=>=>               Y(V"  @?@?@L = >4=>     4 (2    8:78 78 78GB     # 04+G H'GH GH    %    PYOP OP OPW!      = 4JW!         f  CRdcd)cF*d J     I      +BAB('   eM>i 7G7CR)F*      h&gh;gh53       =53 HGH & %&  4   H/GH&%&%&    >* 8E787878;"%&%+    3  4>;+ pFop$&%&%&%&  OTvuSTSZM:&A$ d,&%-&% &   ij  ip iU+,-  f"eO"%&%"%&%/  4  3 $   G K09JIO/ pop=op+&%&%&!&  12 a?7W+  7o4D&%&%&%&%&%&% &%&  QR  [:C7*)D  &% & w x  &%&     8* 88787878E&%    !*   /5E pFop% &%&%&   ;&B%  ^Z&% &       O+Z  L"X[&%&%1  4  #3 $   >D,#)F@[1 pop=op, &%&! &     @7X,    7i6E &%&%.&%&% &%&     \4D8%*E .         8478 78 78    # */(       POP%OP    (        HOGH GH GH     6  /E             `  dcd*cd J    I          ('    F?c 2C7*        h&ghCgh6 4        E6 4 H GH & % &   59    H.GH& %&      7*      ! pKop% &%& %&       ;%G%   cZ& % &      O*$Z    4    #3 $      popBop, &%& ! &         @6],     7s6E &%& %.&%& % &%&            \3C8%$*E  .    !   !! 8478 78 78A    # */,A     POP,OP/    /   P/OP"   " HSGH GH GHO!         6 /IO!       '      '' d  <udcd*cAAd J          I      ('       J?g 2C!7<u*AA         h&ghQgh6           S6  H'GH & %&    <@    H5GH& %&       >*  88787878E"%     !*  /9E pRop%&%& %&     B%N%   j+/& % &         V*$+/   L "\["%"%1  4   #3 $    >H,')FD[1 popIop,&%& ! &       G6d,     76E&%& %&%& % &%&          c:C?,$*E             #    POP$OP                 `  dcd+cd J     I       ('   F@c 2C7*          HGH & !&  .   H-GH& %&      6*  8878 7878E&%    !*   /4E pDop$&%& %&   4%@$  bY& % &        N*$Y   L"W[&%&%1  4  #3 $   >D,")F?[1 pop;op+&%& ! &    96V+    7k6D&%& %-&%& % &%&       U2C1$$*D -       8:78 78 78     # 04*      XWX&WX         PXOP OP OP     = 4I       h  dcd*cd J      I      ('   M?k 7G9*             & !&          8>78 7878K&%    !0   45K pKop$ &%& %&!    :$F$  !         Q"\`&%&%1!  4    #3 $   CI0#)J@`1 popBop+ &%& !&"     ?5\+    7s4D &%& %-&%& % &%&"        [2A7$$)D  -  # ! #    !!  8:7878 78G#     # 042G $    XWX-WX0 $     +!0 $ " $    !"  P`OP OP OPW"$      = 4QW"% ' %     "''  p  Bvdcd*cFCd% J     I      "###('    #U?s 7G'9Bv*FC&   &      !   & !&' "   !"    & % &'  " "   "   8>787878K"%'   % !0  4=K pRop$&%& %&'   "### ##A$M$  ) /& % &(       # # #) /   Q#"d`"%"%1(  4   &#3 $   & CQ0+)JH`1 popIop+&%& !&)    #$$$  "$F5c+    74D&%& %&%& % &%&)  ! #%%% % !! %%% % %%$b9A>+$)D      )# #)   )     # *$ $*    *% %+   +     +% %+      h  dcd+cd, J      I      ))) )('   )M@k 7G9*- ' '& &-     ' '  - ) ')-  ) )  )-   ++ !.  ( ())) )).      ) * ).  4  --#3 $  ,, /  ) )+++  (+/  * *+++ +  +++ + +++0 0  ****   0*** *   0 X9WX WX 0 ++++  6 1 1  ++++ *  (?'( '( '( ?1 +++ +     '   ?1  1  ,, ,,,, 5"   Q  YK cdcd*c Jd2 ,,,, ,"   +  ////  ,,, ,   07B H ;ZT6 c* J 2+ +   x3wx0wx@   2  ------- --- @@   3 P?OP&%& % &3  .// /---- . GB   &%3--- -11     3   x& )&%& % &3   ..      /// /.... /N?'& )   p9opopop$opEopop  &%[ &%14   ... .22#  ... . 22 + !2 ;+K)  [ 1%4  - -%  @PM &%&!  &4   ./000 /// 0aE=!M   55  //// 5/// /  55 0000  66  0000 6 000 0     66  11 1111  Q  ZK cdcd+c Jd7 ,111 1"   +  444 4  111 1  57C H ;[T6 c* J70 07  2222222 222 88  333 32222 3 &%8222 266     8  8   33      444 43333 4 p9opopop$opDopop  &%[ &%19   333 377#  333 3 77 + !2  :+J)  [ 19  2 29   34555 444 5::  4444 :444 4  :  :: XGWX WX:  ::5555  C6;;  5555 ; 555 5     ;;  66 6666 < ,666 6"   +  9999  666 6   :<5 5<  7777777 777 = pOop& %  &=  8 8777777 8 X5    (*'('('( &%= 777 7;;  8# =   & )& %  &=   88    9 9888888 9MQ&& )    p;op!opop opIopop" &%&%V &%&%2>   888 8<<<< 888 8;;;; -4 5)?7" V 2>  7 7 @TM &%&% &>   89::::999999 :`H<'M  ? xOwx  ( ? 999   9  (  ?8988  , ? xRwx wx# (? 999   9  L# (@! ( @ :::   : @! (  0T/0 /0 /0C@ 9:99     9 A8C@ b   @  :   :  :::: :5    e  Y_fdcd*cMdA ,:;:;$   +  >>>>  ::::   >IB \ M\f8f*MA: : 3F@  A  ;   ;;;;;; ;;; R@  B hUgh&%& % ( &B  =>> ><<<   < = ]X  ( &%B;<;<@@ ,   B   & )&%& %  &B   <   <    >>> ><<<< >QR*,!& )    pJopopop$opUopop &%[&%1C   <<<<AA#  <<<< AA < !C  K+[) [1C  < < @eM &%&! &C   =   =???=== ?dU@/"M  DD >>>   > D=>==  DD >>>   >  EE ???   ? E >?>>     EE  ?   ?  ????  e  Z_fdcd+cMdF ,?@?@$   +  CCC C  ????   CIC \ M]f8f*MF? ?F  @   @@@@@@ @@@ GG  BBB BAAA   A BG@A@AEE G  G   A   A    CCC CAAAA CH   AAAAFF#  AAAA EE H  A AM &%&! &H   B   BDDDBBB DM  II CCC   C IBCBB   @?@?@I  II xwxJwx ( I  II CCC   C Y!@ ( JJ DDD   D J CDCC     JJ  D   D  DDDD K ,DEDE$   +  HHHH  DDDD  HKD D@   K  E   EEEEEEEE EEE @   LL  GGG GFFF   F GLEFEFJJ L  L   F   F    HHH HFFFF HM   FFFFKK#  FFFF JJ M  F FM   G   GIIIGGG ING G  M* N GG G*G .*  H.GH GH GHN      < V*%N GG G*G  .!*% X;WX WX WX WXN      * = OH H   xMwx wx#(O HHH(H  .#( xVwxwx wx#(1O HHH(H   .-#(1PI I  N* P II I*I .*  XKWX WX WXP            2 W*%P II I*I  .!*% XTWX WX WX WXP      )  ">  QJ J    [  " Q  J JJJ J"J 1  "  hXgh gh ghQ  =   4  !E i$ *"R   JJ J*K  -.$ *" xewx wx wx wxR  ?   A  QR  K K  W*+ R  KKK+K !*+  HGHGHGH6(%R   QP  @6 j*+/S  LLL+L ! '*+/ X7WXWXWXWX3(%=S   RP (   E3= `K_`8S   L L<8  & :# S   L L    LLL#L $& :#  X-WX(WXWXF(%)S    SQ +#F)TM MT MM M*M  xSwx wx wxxT  .   >  6 Z*'T NN N*N   .!*' x]wx wx wx wxU  7    H 'BUN NU NNN(N   xPwx wx wxU  ,   ;  6 Z %(3V OOO(O   .-%(3 xZwx wx wx wxV  4    E $BVO OV  P PPP P"P  z  W  U   P   ] m$*$W   PP P*P  /.$*$    W  ^   Z  'i P5OP* &#( W RPV ]%'   k*&%&'('- ( X  RRRVVVQ-Q V  !'-   pFopopop@(%.X     WU5   5@. c'$&%&'('( X  RQSSSWWWW =LA$$  *& (&%&'('% ( X   Q Q    SSSWWWQ%Q W M|&'& (%   bP(%:X   WV E   3P: :           F?%. A /  +  <~#U"  )"{|{|{ |{|`{x 21..** A "" `:r*l" 3 {|{ twt _`_`&!"!"_      qvuv  _~=      &  ?    >!8       `K.-   KhgXghgT9hgX+7hgX 0  /*Y\ / 5  J6 ;5HHLCK&M!8 I    )!"!"/)|       n]:U   :):="!:A-. 9>=. -> 9>=.-. 9: =:#  C  X  I?D :  8L5t#Z/)|     2 _`_`!"!"]K L1_`_`K L!_1 $       3    1  / 2D4" i  ] 1     !   T X  {|{ t9:wts t   ,  6%          ,   7 3^mA.~{|{| {|{|{| { |{|{|{|{|{|{ |{|{|{|{|{ |{|{|{|{|{|{|{ |{|{|{|{|{|{|{| {|{ |{|{|{|{|{|{|} ~V ~{|{|{| #$ )*'$ " """""""""""" """""""""""          ""t7.                     "!  $ #& #  2@"-.-.{|wts t{|wt>!" {  s  .0!    > ,7{|{|{t{|{|{|{|{|stw ts t3{ Y ))RII\ K "B0 7           3  v7{|{|{t{|{|{|{|{|stw ts t0{|{|{|-y|{ ; ))4++> - -,-VS= B@(7           0-  ~7{|{|{t{|{|{|{|{|stw ts tB!"!"!"/0{ ))   r) 7           B   wr    =  iji j  ijij  'ijijPijiji j+ij+ij^]    ^ ]^]^]f /056     => ~} " MHAB    &=  -      6      7',,    +=0-     /U   8&C F   z,&lWY(\E =     '  P   + +   X9WXrL   , r+   "Cj"!I")-"!5"Cj"!++H"("!I"!j7+8"$+`NL    :9R  C  =bO N  I     #S   Z  C  ~ :9R  C  =bO N  I      S   Z  C  n :9R  C  =bO N  I     #S   Z  C  ,,} JI*@' &  m( ) L  M    ! Z  C   rq:9R  C  =bO N G n #) M"!,, k %B7 6 ?  > k,_!Bi! H!(,! 4!Bi!  H!'! H! i+ 8!# h   J{   $ !  & H?*YN  :9*   !2'( #>'H1"    " &%   7 & '  .  !  . <; ,   !!4'( #: =$)J1$    $X@>)`   8$787878l   / v[i__#b^7   "!* 7: 9:1 2, ?B AB9 :,#" /2 12) *,    ,T4GJ IJA B,% '* )*! ",&4OR QRI J,E @ =   , " !" ,D6(%%"%%5 % %) %?%%>1 ) 7 -  5 @ ( ! )@ 1 , )2  6  D  :  l    ,     `  a  9  b `B_`?   +  $#$ $<78##+$ $6F8     +    HG--VS  ;0(      ### #      hXghR   +  ### #\#+# #OZLH    +     ,-VS$9(    ### #   h\ghR  +  ### ##+# #TYPH    +     ,-VST 9(    ### #   h^ghR   +  """ "% ##########%$"+" "VYRH    +   }G,-VS  """ "   hdghR  +  """ "% ##########%#"+" "\YXH    +  P Mw,-VST  """ "   hMghS    +  """ ""+" "C\&d    +  H3GH    4 1 ,-VS8 9(     !!! !   hCghS   +  !!! !!+! !;Z&Z    +   ,-VS  !!! !   hPgh?  +  !!! !!!   $!!+! !&H!X   +  X3WX$WX F  ,-VS;%F  !!! !   hugh gh?  "+        stsrm  + L  G+d        +  HBGH* !"  C,-VS "F5          0 <   0% 1%0<    +  H(GH   ux,-VSq9(         _         +               + .2:          +   ,     + (      (((-F?VS-((-F?VS( (^ _           +       (    X. ?6E %  ,        !"!+" !#&'('((  #  '% ,           (((-F?VS-((-F?VS( (. /         X  ,            H/GH"GH _  %#  J   pYop;op7  6<6A*>. # # xrwx?  \+ < %%% %%% .%%+% %NH%T  \+  @N?@?@# N ^] ;:#  8=7878^ %%%%.  n %%% %Gv ;  + HDGH 9 ~  9  29  `R_`?  <+  %%% %%%.%%+% %.Hg  <+  878 1 % 877878 $$%%(  $$$ $/ #)  @I?@?@   +,12?0  8 ,F 6^ N P$OP :       `4_`A 1  (4'( efD     j7(  6O;     & `]_`? }~} ~}~G}~+} ~> %%% %%%9%%+% %.Hr  G+ 1L %}~}~T %%%%}~} ~d %%% %}~l .. )t }~}~}~ $#+}~   +M  I   pFop abab7  "  ;) % z}~wvuvu vabab*a #$  2 F8 * }~}~}~}~} =>} ~  <@ <\   x*wx <('(x  ( '   c ,<  34 ,+,+,+34,+34,+,+,+,+,+,+34 ,+!34,+ 34,+34 ,+3j    56  56 +3 43 434.,+ZH), + !$#~Y AsKmW/b    WX )  X\&    \\& XK  '*R. EX\&&>r\&  <,+%L# ef+Q38 3 2 34+WX QB  i  G<  \g ^ # ,&  '3UD5Y<C#51)          !          .ZH)     <+0/P$#0 /0/0A;0 /A  ?B *$  m*b  " 5 J  -O  ! -9#:+P$# ; AP, P>PD    ($'( '('(P    ^ 2/0)#*'(*'   @g?@*P"  !" )x GH$  VU cdmn!*3)?L$7#       `'_` P%  $% > 1@P    : "  !" / SVUf.-eh   }!"u lkp! k>>< :     / ZPG       (' '@-G n lP1 %&    &  763612-.  U?3&# , ! 1 PIOP & ,-VS %   ) 4787   .121   (--F?VS-.#  (  "%&%    +     @2?@    --F?VS-. #      34{!0p  , B "74y Yz8xwx3C3,      ' 8 3 xpwxwx wxz   3       \       5n') 3  paopopz    2     )*), #  +,* @62z zz+k l     +  ^vz   k l kl      \kl                "  P   (    \ xwxwx$wxz         $       $     0   s8;4) $ z.klk l DCDC   ,-F?VS\, ,7    ('\" .      =V UVU[VU^|  .721    v3=8 =[^ ^<  3[&8] Y^   &*    *'  >/ ,!& f     k    >=     ax$+> :  < 3 [ Y    & S 87%8 787878  '   R       '         8     R$> *% ^G =S        %     8  &8      $$ +  4 %B+X      W    + + 0 D( B+   hEgh#gh| mnm n(lJ2B  0"   C    v  "!r$ #K#  X~WX|=QR(QRQR +*U =(|2 & r0"|=$>, (   $   ,& 0+ +$, pdopop"|D=$>= ( $  Q =&  "D$= XZWX9WXIWXWXWXWXWXN| '           $1 :!  -   H+GHGH  " :|( |   `l_`_`| m n mnmnmnmnmnm n1mn        C      1  | mnm n  $  | mnm n     HQGH-GH| mnm n mnm n mnm n      R        @)|4 (" @?@)|QR< (= 6< ( ( ( (|mnmnm n | m n  Z&   v   Z         0     #8{#          Z          %          Z(   /0 %  J FCD7 0-('(#$7-.$! &_`73          5% ):   1    9O( $,*"37#*         %Z(   "! "!$#$# &%('('('('*+%Z  Z /. -0 -   +   hLghZY   / 'Z:-0/0/.-.'-   Oo 658 = /k %5$:'  hkghZg/0    pi Ng ZF & 2  Z    KLKLKLKLKL?K #$#$kj ( J            3  Z   (  5 %  '* $ .- 2 %     (,  ZK ;. ZB +%   uZ  VH  1Avv ".   vI> 9, !(LT`   vKp ;!*~    ;v,    ;    ;     ;v#      ;v   v3  vR B5 !1 H5GH GHGH/\M NWMN p      Q  W  (\!0    ) FF" 7\ u\  C  ^  I  O a1O POP.OPOP,OPOPO aMNMNO P#     FE  BE <;  8;      ('  $' ( .1  !   !    '  "   $   '           -? % @   :1 % TF |'G 3=E! ! C^I  1  ., "!"! # H2GH GH\M N MN'MN     $'   '\M N     \F 8 . c  5    * \ ($'('(\7   d8RT  0     $87A @,?@?@ dF & - d - n  0/ "N 6 6  66'!; -  HH  ## +=0        9 I` ?    ! ))) =9A  !) 4 <)-  ('(d  ./ / L        !  (5'( d5     /5d  d st    d gh   dWX*UVUVW    "#89  *%$%     +0   :=; ) d'      *  dB Z  {|{|"(6B Z e2dH# .  "| H#d   Qd?  0"=$?  .d Z     )-{ &1 # Z x+ df= *0  IZ`f= p5op op(d WX^ ' '='2 ^ d$UVUVU VUVU V= )))-F?VS-.   3 $    =dd!   9ad    ' 14+HH,+2-)               f@ '            POP!f;<-p  .-f,jd^fXR f*Y Z;Y Zm    go20>8_`By C 58?# !  ! ) )    +5  * ; mf$ \fWXWXWX WXWX&WXWXW X0WXWXW X;<1W&Z-onohST $$$$UV[\VU&l+!Bj.3H &     0  1 - 0fWXWXWX WXWX&WXWXW XUW&Z ]^YX=> $$$$?@& Bj%5 &     U   (fWXWXWX WXWX%WXWXW XUW'IJ-. $$$$%/0'B'DW %     U  `_`_`fWXWXWX WXWXWXW XWZ 5612$$$$$$$ $ ?',&      `_`_`_`(fWXWXWX WXWX%WXWXW XW'#$$$$$%  'B'd %       9f8 I(&480K 8&    ) !  = 0 8 xrwxfWXWXWXWX WZ ,, B*   mIf "WXWXWX>WZ    , :+ ">  pAopopopfWXWXWX<  3< PAOP f WXWX  ####    8)7878fWXWXWX    Bf Y ZY Z8   C(&480E 80    ) !  F)0     8 X'WX f        oIf "WXWXWX@WZ    , 4+ "@  p>opopopfWXWXWX<   6< """"   f       w4.&6<"y%   + W 4  fWXW XFWXWX+    "(8  F    +  hjghghghfWXWXFW  MGF !!!!  P 2gfWXWXWXWXWX WXWXWX WXWX WXWX WXWO WXWXWX3W XW """" $ !!3! !-           3  f+  M(&480O    ) !     01+ f "WXWXWXWX8WZ    a* "8  |If :WXWX2WZ  , =+ :2  X/WXWXf55   X]WXWXWXfWXWXW XW  D"  fZ^J ' 8 D  ((59'GZ^J XWXWXWXWX(fWXWXWX WXWXWXWXWX(W' '?      ( P[OPOPOPfWXWXW X%W93 % pPop op4opop6opop,opNopop(opopf WXWXWXW XWXW XWXWXWXWXWX W XWXWXWXWXWX WXWX WXWX"WX1WXWX# & +          (bU                    "1#p      $   p   *        0*/0p=0 1 0/0 p  6       p     <  OPO      p  R     hghghgh p   Z   12+ !  !   %7e!3    P)OPOP p  0         0  XFWX p                    X/WXWX p  <        <  XLWX p  :    0/0    :    BAB   @-?@?@ p    3   TST  6 3  \Mp  Q*    fef' %    # Q  %    0#/0 p       vuv    v  t  pp  p      0/0/0pE  . p    p   p   hghghghp                 !  !   9_"5!        P&OPOPp        =   p        niA        X,WXWXp       I    XJWXp        G     @)?@?@p 3  ?- 3 Y7p 8    + '  &     8 (p          p h@    h Y Z Y  // /     hY Z   hh= -h    h8     n    V.e' 64 POPn                    HY < ?  jfN|7QR  '( 7|  0/0/0L  d    rd ('(' ' :9:9:9: 9XWXWX W :9:9PO@ENM87NM 8 /  :9X W$ # fef%e%')!%  fefe(fefe|{fe  fe fe<; @?@!ji!!ji ! |{ X!WX|{       &8    !          zy   z y    H'GHzy   "z y        zm      p op 0/0                     :9Z:\  -g     V:9     VUVSTS' ^]^[\[' 9 *,9    \STaW' 3vA3 "  %:  *  2  "  !& !"!8 (   $ 4      0   , %&%< D?'        :o % % % % % % % % ] Fj!&!{!;!!!!!!!!!r $         1   $ # #-&%g  (('('(  !"!"!"#@+ ()'('(  1212123A, #   0  @?@  L        >      _ G2 50t{  ? .!>  l  0/0x              '  (   @#?@?@  2   *   *   @&?@?@   1                                              v s  `             %      ~ }~}  jk      POPOPOPOP.    ! p?op\ @  p(op,opopop|opopopop opop 6g t          3       ,' ( 7) \6g t )P " _ " @ 3"W. 9; L/) K    #     #    #/  ?'' 5 @ !  4%2 %201&E 9    ; L/) K \ I TQRQRQ 1 ( I2 *B " 'P" 1 -T  =>=>>= >#9  1 - p$op8op opv    C f%  = !2       K" = !   0$/0/0/0b     Z6 L d1O~  $/ " !  #        3&  oVNE(--6 L dO#   s t )#   m n  %G0 ) (     >-B 0)   (   7    #D c    FE FCU XWd2# & 1,  uZ    !" )  %  ,+. 9,E,+87 @+: I @?@?LK|('H('%-&#  K, G D E 7    *   -  *$*" . xiwxwx J       E 1   pop of        D! \  $ ,'   T!: !Z:Y G, !:  PAOP .-2165<; 3  ,'  xdwx ,  livS    Vg -$K   MFEPOP ?6E>OF1>Y<  8w788   W ^]`781 2 afef 34- .-.-3T+#$FQ(     H@GHaGH. 3%&  1)(    9 c21$[,   < \       `A_`  4 , !$ hfgh    ;'?5 !  ('(  a< ! XEWXWX  !! @{?@     hr !  6' 0/0/0#    ( 8.7878787878       A 8L78     # @!? =   "   & * % T2GN'66   /6)        12]P  ,    wq p&6 J 0  L              '   + N @  ba"9 "   %     #9       '&      STcd =>  *)+   ('   :5    '& >1Q \2:G#     XWXA     6P0   I    !'   G:%8 ' Z ]\Y5 D  C   4B  /B  )B6  popopopopP  O  >        !    E88,1 1PO   Y*P    ~~zy jipodel idejk<CD C>#6%5          * & c | NMTSJKR OJKPQDELIDEJK$#>=D C " !       5    /I lS&     5        "& c    0&(*x   *                #< C #%$J /    POPOPOPx[x   3 H4GHGHGHzefij NMNML2!0=    $ 9# zif 0/0/0/0/0z@f     $ `3_`5_`_`z    ?6 ' z A@     %0##|Y2 it< zNMej efef NM)NMNMglP'  & a-,;!0        o)w'T %     )  hMghghz@  &! "!" '$    ( '( '(   P'OPOPz: ' m nT bab_ 2    1n oUE$/  < ;- v        itsx'(-4 lkn   *    #  /    <     ; -  hmghghghghghN O     ? @   C  "(IN O          , ba@       % qt   i\ @#A    @  )   ? . 0\/0 /0 /0      * T-2  7 M        !   x,A%e7 M  x0wxwx'          Z'  8.787878(    C      C+(        @   0[   8              vM.%)[    8 A 8  Y       F '&=6Y  , r}r,5 , R "B> H          !@?>= \ pklkjmh( G"K                   tyzyx{vs            ||FR           "!"!$#$#$#$#"&%&%('('*)*)*),+,+.-.-.-0/0/2121B 02/0/0 /0? n       I?  @?@ ,       2    2 popopop 4A           > $5qf     I sU !  4A     /   ?      L  @?@   $ . tq (U'(b0'  & &&  l /    | !"      6 !-(/      pbop*   !"!   1!'*          To    cR      rO& 5 /!B    , Y ZW    & X0&  / !  tV  !"%   4'     5!)%B 4 @ Xt   ?'<3    !! !!! *8 , 2121F    $  $ *:'.8  <?       ^  - pop#  <    p$op&" H " ! Kt sts<    R#Jzy z yz"^   >9 T 7 6 &;) R J  " 9 )"  Jd   E:   F/83,/  &    +)$  ,   4+% C.)  J! 7   -!.1n+"    <   ji} r pYopop?opVop     0       , =k,"  $N  /   ! V   }        b "  & pKopopop   M +  ' <"%* M     XJWX WXWX h    /   # + +! #3 4 hPghgh   @ + $!- @3 4 + $ + $3 4 `L_`A_`  6 /0 587 0 /074 5678 5 '       6 /0 587 0 /074 5678  XGWXWXWX   / , +   n#;  / ,3 4r    `_` @ G18    69L$#r     >= =44  C4 ]#= e#=m#4i#4r    / , $ # "  >= = 44 XIWXWXWX  KKL L  0>  L w+18LKL    6(2 7 8       1(4 %V3 D  !@'3 +(3 D  P1OPOPOPJ    "  Aw70  Lzy44==/; (fifiFF `  #$        &   #4#4#=3333#=#/ %  "     ;<Pw r  C%   ?2+ !@ 8?  "6#@?@?6 ! -   Yp  6   3*< @ B 7!'"Z) %    !  "! $#4& %(-'*  .   2 0 *  S=@?/<.-EHID KN 8." +_b q    C  44="#&'*=+.//;21 434(367:;> =R@?DCDCBFCHFGFE43` `8_`$_`_`fijiE"    L)Efi5  0!/0/0/0$ $ xZwx83       % 3    :U'<3     8M78|,{  * )$ #3  H       @/?@?@?@ 5    9 5 $     $ %.    ! .0      9'"03): $ % %        ('$      1Ux-popo ( `~_`_` _`_`ji  !0  +   >  '$K"   82787878ji*  !0   0!*   847878jivu v  !0    3!    @7?@?@zk   i     WJUZoyZxG!6B<   ( 5      )" (    $   $$$ %W>! RJm " F % J(! ,# C #& )! - 9 ! c o R  % %   2 .   . F E'  c            2   'c           v, X   !  l  (      @@?@        A  2@*      m #' ,Q* R  K' ,S*  :  M' X*fR  ?' QgV* 0 0 "03>]L &$D%W |*c /0'    ? (@c /+  2X  $C %%>& } Ss tx &     T2(A S x g    : $!G {)=W,+,+1 / " >#  0#&    * ,^( 9-1 =;= W e  '  G 2/  &J0"I  43. 12   0+,# #%  $ 4<  "+  N G n  P   _ r 0 #*9 [iR|  @ 12#& / LArSJ C *74G.R i}    .) d    &3  <3}0  !A  0 0/0/0  " % peop opop^9!0.     =#)77 v "b + +,H      2 5-B,9 0i @O6 5%    TO % pfopopopop_!0 2   * $I_ 00/0/0/00!0   6#0 =7 6X xwda       h B9d  C  nwx: )1P Q=1.  7  XI%%h  "+03    ,41  $ 6s    #      A  Z  e  H      S  = tklk G>#4ux  T  B^ Y   &eB Q24& o!   " 8  ,!k I O ), M :=.      G+"/    3  4 $ s#AZeHS @ ,=1&%       ,+,+3  P   #=e  a d c f j g he  ( ; "  &  rh 0X  $() =   3P =    %Z       -    -V&)% @-?@?@?@, + $       $ h>ghgh gh gh, +,+S  #  D  2 S   &r       *s " $    &   \ Y        !  X4 /"  5  { &. -.-]    < :   ?g\]\    0  L3 7 )2)6  @   ] p_opop&  &%%'        xHwx wx&a        *  (&        )1[(   4  9&       m} 1&G  7 ~eu v@0 &} ~   A  (Qe @ ?/|0 .  / &u vuv r  *)*)=u vuv1  %   0 ;lA H   '  . j z%  1   r-G`  r  =    X;WXWXWX:WX$WXWX  #7$- 4#+% +3  ) Q 4 55dt')    @Y?@f 5G  +8    ( ,0   ' , ( (! ! !  /! ! "2 !  7$  #-$ B  (u'(6A  ('(@[   P"3f      Q"  7#/? 0       $      #    :  $ }x{| '    -  + n9: ' 0I ^ z y-A0     5  N QC  ]& 8  -0MT&E:)\8'8:  '6  L! ai$  -!V$(+$)",3>3  0       #,  878787B "  &/0: 5 & 4d7 b- ),   I `   1<)7JyYPa  | & ! :   @5?@6w    P   Y )0 % #Xcd_`u #$  4      ,+-PF 1 $  X,  8,  8  5    Y -   1$#2  1 5    Y    !V >yU > C(HT2}GT+X          F          $Y     Y !!4@   >(W>2>@T a T.F       }=  Z  u    `    C   C   C % U    C ; +C)!C)C)I  &C)-5)>*)>& )>"B < *)>  =  Z  u      `  f ="     - "         2   U     p  #  # ad &G-(# .-.-&   +45f .    d 2 2 Ii2,   8   ff  S "K*- " ! 5LI    YHAB=      YF9  F{   C  + 5          W >!^>L C)R;BG(IT$PT=L)># (  0i2          Y  F$#$#& % ('S*)*)+%m E E @ hbgh  UVOP UVOP+,  `N_`_`_`j    %   1 . 6565H   `5 LUZ  '      ( B 3   -<     m9 "$ L!F5 m1       5  B -0  .   1  xowx  M   UV  OP UVOP   ,+.   ? *   *   & L*  @?@'$ $ $ $   @?@?@?@?@?@?@?@=\[+^     -4   B-=+  H G D C  adcd      ! 8*B/ #Y     hgh    9  \  mx  Z ]   @2 $     B       j@=              5>   < 1                 ,"/ , ) N      %GH   "x.   IYP 8K;V0$B %G |}   @        ! ; j @  < Tl      '.    1      !  -      ( "  / " mAP F  0 \Y    (X,,1P   HO   5  &9r HI @-?@?@   v  3KF&$D P OPOPN 2   WXWZY WX WZY !WXWZY $WXWZY EQc\    +  .  878"   $#  ) ,+  E @ %04 % $ _  ,                 9B S     878578787807878   7U H   #.7K .'*At7GN S  (,+    $9-4 "  N2L~cP ^..         <    "t              EF @ AJ KD E      F G    :               :::::  ::                                                                                                                                                          :  <  v 0::::/G",#&/'!*),099 9  9 9 9 999R"248:VX\^`bdfjlprtvxz~ POP b                         6 12121212                          0/0'('('('(                                     @                   HIGHRVV   $ 0J/0/0/0z*   '      enZnZ nm[   EB;   !  cAH5       [ "+ail $!%0'(   +,   $    & $2 2      !']B,A*         Qn     # 7-  9B      "         ~ i |}~{ d 9K0   p2op op0opopop1     : -.- 4-S $4   pFop op>    &&1 !  PCOPOPOP+rqrqK    " 7+K  )] $#.%w xwxwx#0  #st:  &D pqpmtsjJ8 >D-2' /V" 2  8 r7      !" )* J  N W8 6nZ%5Q +)&   i  5  5  5  5  5  XWXWXWXWXWXW`R XWXWXWXWXWXWXWXW^R XWXWXWX aXWXWXWX3WX.WX.WX.WX.WX.WX  ,+9('3*    1  $ - !  . (   < @5/++ + F*     $!"!"#" ',)*)*+* ).!&  ; JM %% !)JFD  7JIZ  5 > JPn KNM%>?& "+ 5J ~  9 XWX J       .   5 zJ 4 N*J; jg -/ $+; '  JE  ( 02/0/0JS  #( x}wxwxJ 9 k #2AJ'   0/0/0/0J+       2 +   @?@4?@?@Jc "-      ]~J b abababa  -  - $  2@[@N%     HGHGHJ% ,% X;WXWXJ1 .1 @?@?@0  : `u_`       :      z: 1 2h$         ZY B)S  h$@]@@@@@@ 3^   +2 3^ 4 qB$           % %    D  $> qB E    &6     W  Q 2 1?                      G L=B " +!%(  JQ  ? C j   hQ     * 7      ,   <?"hQ U W u          5                      # "  &  %      ' 1      `)MT | i  )!  5  XWXW X!W XW XW6   WZ     WZ         7    "6 WO              7454   F 9:9:9:98  7@' I+q -  %                  ` `  mn mlklklkjmnmnmnml%35 `)%-  %       HGHGHGH 6      * <  hXgh V    *V  v  h 9  2  @A 25 (+   !  JKDG  89 VW $%NO <= ./  RS              U       C  w-1 h 9 hghghghghghghghghgh 212 12121212 12121212 1212  2 1212  2 1212  2 1212 2 3 ? JI   : ? ? ? K   L!@?@?@;!d                     ? POPOPOPOPOP 2112 12121212 12121212 1<2 JIB     !^0   < !*K?          Q @(          ``   PO s K =  @* $=".  J   4 p opSopL   ,  A   L  887878)      $&)  y#U K8    36 #UO  -    `H_`-_`'$  $ " ! ' xwx wxwxwxwx1wx wxwx wx wx wx wxx w:          !    ; - I  k  .+  "*'3(' ( &/# "! % *3.3Cd, )/=/+%.+    l9       S:! l9  dR   >  '        -dR C%I N UX    >: ]%   "=ZGPO+"5K"     * * G'# !F 5   )5 ( '('('(N   -': '"& =>=> =>=>=>=>=>= >=>>=>='> HGFG$ -$}A 18     '1 ~=   >   ' ZH* )=*)*) ('*)*)*)*)*)*)*)*)*)Y* )* )*))* )4* >   Sl}               9X  Q *7 1 A  W'43  y'4'H =            Y   4               6D  .# 3&  " D6^  ST  % f*'.1 25 69 ! *- FI:= "% BE  >A &)NA)++0+++4++0+8+<  ,#'#  1   H 6  E HGHEF    6   6    @?@ ?@6,    x]wx 6 L   O** !(  C-6vuv vuv      vuKv vuvuCvuvu     1/      /  2      +!U!.          K C     @I?@?@l?@3?@?@ ?@6 vu  'vu <           7 \E,5*   '   <  H?6v u  Cvu    ( 8  C  60       (688! (8'(6(       1(  . 6      0 E 6     ;  6    @   o6}   q    /  6/0/0/0!6 /$0 !0 $ x\wx6H    C,  H * !   * !    *  ! ('('(6&    !& 6        u 6 )      )- 6/0/0/0, ,@ !.,  !  ('('(6     POPOP6& " & PAOP6N '  !   ! 06/0/0/0) )= !+)  ( p  $- g    6       0*/0 /06%    ! %   (   $(  %* P OPOPO%P,   % 8!7878 78K.    0  ?5V     .=     m5   O*# HGH@GHdGHRd      .( 1\<"  -_  VW DCheFUP cT XWXRWX    >; -( 9*#_1  POP  7* '   ;Q"K    2t)~U   VUVvw  },    &/ }k% }k% `Wk0=#kVE+kV= S7f-T/k (! +&c 7   /  " x #v)\Or&     70& "   /"+   `    !_T     VQ  Z%+  A  V ! g $ %(Q& RQ) (Q& RQ 1(Q& RQ%  (Q&rw7X# U C  u!_T  `_` _`&_`_`       8E ('(_'('('(   &% ~w  &  \?"B    \ `  &% <5FCDC!" & ] A    9r     Q )%$ @5?@?@     1    n   k@ -       U9>ck@ , " < #<  43O )    NT#"'T 6O             J !,$< popopL              C  L  POP  h0ghgh * ;   /--, . -         _  v           q uP  %||.-          ;   S#AC  ),c "  F  l$                  TONM 1 :           &% :9          $                h}gh h             ^ h @?@gJIJA%0                 hghghghghghghgh<6## #G  Kehi K]`a ? KQ    tL!@iLKL!m'           :<%-     !;% - h>gh<-    !' - 6  <  [XWXW\F 0  <  [PW\@ ANZ<56 565  " +$      , m,    ,m}t}t , mdS     ;I<R;$F7  W             +    8'7878   .&  & 74  H-GHGHGH<]       XWX WX      <+       ,    z [R(7+   /G W [ <   `] ' h ;0/ /(   ;6*%/(A</(GB/(MH#/("!$SN)/(('*YT//(.-0_Z//(5` -%P /     <  1$#.'   $ #    '*OS1(   <- '   &  I I  %%%%%%%%, & JIJ  ;3u                           < 5(6o"  %   K K    $LKL? t M (_    $W <9 % "X <       $> )2 x,wxwx<@    P%OPOP $  Z=<popo0 . p :   K   K      .        -LKL .4-:                         -  Q     <      '       #'6/; i6><+ po+popopo4    I                       +Jj],   s  +      .  94$  0 = T0KLMNMNMN<   "!%B  ('       3  %&1c 0 @0?@?@?@        #' J|{B5%   }  #    4     / B5  %  y`    #  ; pZopopopop}    8  FD VU>   s trtsv_`_^' w*9 9D  > ('('(  FN   - q  F 6  $    s fX=+LA  fFZ-Z    4   '  UV LL K          aV   V K4       +%   2      )             % !N': Tp>A ~]  !       !       3   z?B*  \K   1o3* Suc-  F HGHGHGHF2              G AxwxwxwxwxwxwxwXxw$           !             `'!EJ#G A      X  ^ 'R3G =:xw xw xw xwxwxwzxw@xwx w xwxwx wx(lxwxwxwxwxwxwxw      ~} |y $  |{  llk    TQ* PMP M LgjQR IJ ]  78     ,'    5 P &KLO&ST{|}~e  Jv&e+!:   z  @       (l     1  8%787878?.      @?@?@?@Bp  4   bt !+ *  } 5      !Z5 '  h(ghDgh " '      _5"" ' pPop) )> !+) a.Z YZYZY ZYZY"Z YZ&YZYZ YZYZ2Y Z2Y YZY Z1 }    }t  }t  }t  (  "(      1)G?+UA.  "        (  (     vm             #&2m    xwxwxy (        =   N 50y () )A !+)                       T3' (% '(         (-3%    NO  a    !  P1 ! 02 a q"D' (A'( !      +* <** 4DA   ~'=  B    - '=       ) ) $ !  x]wxwx 7' ('  '     17 '    Nf '(D'  '(           PH 3! G=   D   r!C' (B'( !       ++ ;*+ 3CB             &              ! ,       , q      <  *q 6=Z YZYZYZ%YZYZYZ YZYZYZY YZYZYZYZ   }      }t      }                  D3=             1 xwx-wx wxLL            ' A      p3opopop opL,~ cdcf  _XOPeED,  `+_` _`LE   -  H%GH GH   ' L#   X              S #  X   o [L'CDCDb  CD CDP$          efcf ]f  b  F"<-24''b  P       RL"  Y TKLKL   I "  pVopopopopopL~       N!GBBBBB BB BB L,    >9:9      $$$  ; <   ] .!+ " ,  B  5 S L1   #            !         U1  VL     WZ   Y   hghghghghghghghghghgh0LCD    3DCD C D-       CCDCD  K ?      E K K K     LKLKLNe@iL~          -        C   P     >U   ' > 4 53(  XEWXWXl  ](D   TI &$ y1. %<  (        , T                        H ,TT F   @U?@4 3436,5        ; ,              ( X 3       ' 3 a 3    `   .  3 7 9      '   4 7 9 ~B1     ' , B 1    /     [          6 [4 3436,5       > , t    0     s   / 0 *  W              R * W F* 6! *<         <     -!                J #   '#C3  +'#1  h T     g ( T- xt    .   :t <*        *    .    -- L4  4K  ( 4,  ,2 //! ^# ?  ]  # ?4 36*5      9 *          } `"="           ;<;#2  ) qt}}}t52}t5:  ( 5,) $-"h " #             !"!" '(    * () . /.-.-0  :      "\[,\[ \[     WZ      ",    ,         ^w popV U  #$, popV" V  #%, p{op8   7 1 %H Z  Pr  P pzop   7 0 %G   P U pvopV  :-  %D XWXWXP0  (V'('(P    XWX STSN M^ ]L3 -    hNghghghP 30  K  La." 3 lP   BH    "I)   Bp  X#WXWXP  P^OPOPOPOPP        "4*    POPOPOPOPOP P   <  K     -L.`6   <  Kkno   }  -L POPOPOPOPOPP    <  KCFG K;>? [Zibaba^ U  n-LKL.k9           <  h ghgh  X|WXWXWXWX P    7 p ?58=r IPWPKL C L!@1J/    7 POPOPP.  " K$! $         -L hghgh   K\YX <E.56569 DE6=>=>A J  1-L = K; dmV]^]^a lm^efefi r  Y-L  R  P -  /21,+   "/ 0)J -   9  P   w ?u v@D1   PUOPOPOPOPP $ #$!   4* P;OPOPOPP    # popopopopopopop P     w     K   L"F     w hbghghghghP O  K L}.* O  P    c      "k;    c      K     -L  K  L XKWXWXWXP 0  K  L^." 0 PIOPOPOPP .  K   L\." .         P              >     : ? ? ?  @?@?@; "F                    >  K  L     h8ghghghPT   hOghghghP 4  K  Lb. " 4 hghghghghghghgh P    K  K K     LKL.D               K  K   L     h3ghghgh  XWXLWXWXWXWXWXWXWXWXP        f    K       -L"R                     f  POPOPOPOPOPOPP      K    K     -L"A             K  (:'('(P    (        heghghghghP R  K     L.6* R   K                       -L h6ghghghPR  hghghghghghghghghghgh(P              w    K      ;        ;      :    ?        ?        ?        K     L!@?@?@;-L.u                       w   K      L   K      ;        ;      :    ?        ?        ?        K     L!@?@?@;-L POPOPOPOPOP P    <                         "^3    < hghghghghghghghghP=              @   ?        ?        ?        ?        ?        @?@?@?@?@H=                    @  hghghghghghP     A   K        K        K      LKLKL.{<           A  P_OPOPOPOPP   5                 y"<)   5   K     L   K                       -L  hghghghghghghghghghgh$P$            a   ?        ?        K        K        K      K      LKLKLKL!@?@r$                    a             hghghghghghghghghghgh/P$-          a           E K K   K K K     LKLKLKLKLN}$-                a       ? @ P!OPOPP      P~OPOPOPOP P      K K         LKL.H+                POPOPOPOPOP P    <  ? =    @1`6    < X]WXWXP 565J "   L/,  " paopopP 565J #   P/  ,  # PUOPOPOPOPP   D  I   JD$+2   D pyopopopopopopP      \     "c 2BI      \ X%WXWXP9   PkOPOPOPOPOPP   ,0       8+w   ,0 XWXWXWXWXWXWXWXWXP         d  I "*)     +JG+oN         d  I "*)     +J XWXWXWXWXWXWXWXWXP          d  I *)I     +JIJK+zN          d  P#OPOPP7  XWXWXWXWXWXWX P      T  =  I   J>~81MB      T X'WXWXP;   I "*)     +J   I "*)     +J  I "*)     +J  X  P 8    K! 8   <  P    =  >1   PaOPOPOPOPOPOPP  ,>? PBOPOPOPOPPd  1 `_`_`_`_`_`_`_`_`_`_`P             :9 ,+ I    JU_           XvWXWXWXWXWXWXP   s  I   JD2+:B   s popopopopopopopopopop P            >= 0/  "! #    Q\             I "*)     +J  I   J XWXWXWXWXP    565J 2  I    J++6<     2 PLOPOPOPOPP   ;  I   J+)   ;               P                     k      =  =  =   >=>=>;                        k  I   J         I   J POPOPOPOPOPOPOPOPOPOPOPOP P         I I   JIJvb+j         I   J ! ! !  XDWXWXWXWXPf!  3 XWXWXWXWXWXWXWXWXWXWXWXWXWXWXP             +   !    I       +J;w{             +    XWXWXWXWXWXWXWXWXWXWXP             q "        I          +JW\             q  8F7878P   !#   5$ *   !#  # # $  PtOPOPOPOPOPOPP   q$ !!! I!! !  !JD2+:@   q$ $ !!! I"! !"""*)""" """""" "   "+J%   XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX*P                       % """ I#" "";"po""# #";"ba### #""TS"= #" """FE"= #" """87"= #" ###*)#I## #  #J>=>=>;+J+'                      & ### I$# #  $J& #$$ I$# $#;$po$$$ $#;$ba$$$ $$#TS$= $$ $$$FE$= $$ $$$87$= $$ $$$*)$I%$ $  $J>=>=>;+J XWXWXWXWXWXWXWXWX P         d ' %%%%% %%%*)%%% %%%%%% %   % CmN         d POPOPOPOPOPOPOPOPOPOPOPOPOPOP!PL             k( % = %% %%%%= &% %%%%= &% %%%%= &% %%%%= &% % %>=>=>=>=> L              k)  POPOPOPOPOPOPOPOPP           `) &&& I'& &&&&I'& &&&&I'& &  'JIJIJL+N           `  XtWXWXWXWXWXWXP      V) ''''' '''''' '   'c2F@      V* ''' I'' '  (J* ''' I(' '"((*)((( (((((( (   (+J+   XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX(P-                ,  + ( = (( ((((= )( ((((I)( )(()I)) ))))I)) ) ) I)) )  )JIJIJIJ>=>G&-                ,  , ))))) )))*)))) *))*** *   )  XWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWXWX4P-8        ,          - ))) )** * I** ******I** *  * I+* ****I+* ****I+* *  *JIJIJIJIJ@3-8        ,           . . *++ = ++ ++>.  0/0/0/0/0/0P        0. +++ I,+ ++++I,+ +''''  'JIJz3+          0 .  XWXWXWXWXWXWXWXWXP        d/ +++ = ,+ ,",,*),,, ,,,,,, ,   ,>G1oN        dRR        R     R     R    R !    !R    R    R      R            R      R       R        R #    7.  # 8>78R     &      R                    R (  $  (    R                  R      pox   R &  "  &    65>   R       !                       R ,     ,        R                                        xcwxRKLKLKL=       =:!!?=       =RC 74RKLKLKLU        :  !WUR3 ' R=K5LK3LKLK LK LT                  1   K'H0=   T xgwxRKLKLKL=       =>!!?=RP   RO X _&  & d k&RG   8 52RKLKLKLH       ;  !JH 5 & -& 5     5 (+'(R8 ,) , * R[   RN B xwxRKLKLKL^         > !`^ 8578 RL @ 1 xwxRKLKLKLd         :  !fd B  & 7 xlwxRKLKLKLF       F: !HFR: .+RB 3 7 5 5 5 5 B 5 7Rl      ] . 5 = 5 5RKLKLKLK K;!MK xwxRKLKLKLb   ; !dbRI   : 5 pRKLKLKLI A#B&? !(##& 5 XlWXR|   1   . 5    5   B (O'(R\    7 N # & ! '&    I =  RE    X|WX     >   B (Z'(Rg    X   (\'(Ri     Z = * 5   5  J J~ )    5 #  1  3Q %  (e'(rW <  (a'(S 3    '53     6 !   !   $ C!$ pHop vOPOPO% vu8         H7GHJIJI   "   @(%7i       )   > @   ) & 6 * * <,i        83 m'  PyOP          =/      @?@6?@?@!8  0 !!8 U   <* H:'  (['(h6'   H  A!q,,52   :9:9: , $$               V%*  ! xR0 5( )#C   d    )  &'/ 'U C Z%` 0)' #bC Z . ,&) '#2 0_   =   0' HS!_ 3/^K# # /#0 9% 4+(O 0w   '<s ,T9 XWXWX25652 56565.25 252565252525 "   " $"8" >  B  *      ,,,!^ .   2    f L > ?  : 7  C 2=$?*     f ) 58;> (%  2K  L > ?   CVE"E  K "  $ 0   W   3     0 /0 /0/0  .   *  . G           (9$!"! +3x[O.;?$  8 Z!!  @-?@    L"132F    TM1LR Q RQRQOf  6508-.m"@K43     "!]"0; 000'J <+; *  1 A  9 H^"z*+ 0>e&!)7    O   @L/ w qw           SXW(`I -211:99POP$" *a&   d/ f  =) 7$ 'B6/,  8$" / R~   q        Lq  Z   f       Q TS NZ    c fe `Z  $  &5?2!5? *RUJUq   Z     f HGH R)  ts            '   B) ! ,IR  R811  "!  1  R 10! 811R"   "" RR"  p9op3opR  L     !%    L o# R      \1)\[*)*)* 2 1  ] 6  D R    !   C  M  v""   R    i+  ,xS>S         B       B!      B ) )w )$}'" Y=,E= / G=             iR(   KR,'         '& -,' popopop F8C   E      J: "  DC7  n#"     K 24="     &  %2&&&' "   7   DC %&% &% &% &FDC %&% &% &POPO 0?+NM     B ]    F 2 M   m %  @% /" 1=594S,X7 ))h?     F     HGH       % A/  -Q!  )       Z3     3        ! #  )    ' 8$ G  )  1 4 36^] cd 9       o N   Fi0    W&6!T 3 !a6 . ! 85jZ 3      3       " !$ %( ' jn3       !   )  u x wz 34 /  ;C -   W|%!)' n 3          7y   )C  )    *)*>7 y  r +  #. " )  r 3 4   +  *:  #-"$  3 4 Li  S VUn  &P 8Fn =J >  4 8 6     0   (  =  PE   8#78785    ]jW -= {1*," $   %( $3{1  *D " %G^   E,   $ :- $  >ZYa"  5,8 -  =' $> a"   D,    $ 9- $  -G   E =55 ]ZY {,    J $7" )  '/)!<3]    { f, +  .x u    %, @ @ @ > A _ O F G 5 /! ; A 8/  7` /  "/ 1  5/7 & .F !'()   0/0 \ [[\[ \[\[\ [             0/0&\\ \[\[\ [-\  2            -  ' UV       XaWXT,# HGFE=  # X"T6>=9 (%$ 5A+ <' 9T<     * /F?      c     W## $ "       (,,   $ '""!>\A 9_/D  G\ g\E Z"  z:',/D * _ '  '0+9 *''( A+P+83  Y\3:/ ' %'?:*$W3B ( [ FR>B" 5 *'#    'I'n3'')& cdU  3*%-(  q ;'*+8!  Ts  *9 -r5">   WO       %  & &. !   %  i   + !   - +  L" & ;&"? ,!b i sXv$9  8    j!_ T TU + +*       po   ,F=\E4' *  %NI        W !  -   - +  9%9  K+* K&  >    gR   ;3 && ( G$ %  BR&&# 58>5<&$K     8 U     ) $ E  j_d +    W (Z >0&HR$ E   d     0/  8-.i  U T-  +D/   -N  }    +! - +   T`& ; & 4N ,!b } 3hl(a  A       j!_  '   A    9 8     +  AZV)5@?@W4 %RM       W "%      -  - +  ')*G.; $ :)B)   )Y   >      qR    ?''1<,A&( Z<*-  BR&&# ),4)0&&$A! a  A       d      -  +   W  Q%O/P5b a ?DCT+(  N: 6        $( +=+  lI8   I:  ~ e5  -$[       6   *L.  B    -     # q     x.wxwx&  #     &  x # Q      n # G     , ` # 7 4 "!  , h\      -I  ! ;*  +( 1E  [ #      ?&% &  [   # $   '   Zt 2@J M@?>=>=        2  C. /7* @ V   $&* .  z'    2  M (" !  E           Z (   w  U( 0*/0/0>     !7B@?   K"B       _st~           A'Q g _~   FstH         3Z95FH U.        -    W.  jK jKLKY    \ !:9    X  &%     B    x  D  q > )xS<  *%?S >=6.i =.     Y     R\NMw%%>;,%   " %6, #" ! JO'=Dw       9 < :{L"K     LK.L"K     LK  r q+ x w+ %$h  A-  B ?     < 9 :E))  Z W     T Q R]?1C )/*4D}%*4D}   &!&@<^U,^U9 < :  {          .  "  #& % ( ' *) >    L -  #'  O  3     {NMNM~  3  jKc  3        $   ) - &n N$)  +('  4 + *iv  35   )  n 1   A   )  n          ( H.%  !T5$ _$ ##,  !T! . ).  !Tof:!3=i1SC ]13=iK<&3=i62 U#<O   3      {~   3   #c&( ) ,+, +3. -&0 /2 14 36  7 : 9& % <;<; B2LK'   ) W  '     >  -!LR^B 2 `&_` _`_`_`8_`"H$  !  !2 "H$ (55!XW ? IX "   "( )  "   +  I"   y!.  L9   08  : &  & J :&  'K5! " ^ ? '*!)  z1  jKO         ((n     A    ((n&      (((  @;@A    TO )/    T 0      i!     e(iL<b (i (()R@1     O        (P  [9 yXW$ 9  X ,   " '    B@  ) X  #J )      )  In"6  4*+   ?S9 0   2h*Y&4=#!;S /b MyS %"1   [ 9 y#g$ "  #9& %   $ $   ,      7 jKrLKLKN '   1,+li,  L  4-Y 4U 71 ), #& (43)Q<$)&=)& 7 r  N "      '  AO8$ '( JJ LK  8        W   6    )W   + d >  s    >$;ZR&+ *R1& J        8 >.   CD )   Y  ('('(,   9 H    BN)079 H h8ghgh+N M  +  /@ #   @?@?@1B   0H/0/0/0/0& JI(j z ZY s3   NX:! jGq (  : B<. )!'M=(:  q  %UCP!"! "! " ! "! "y  {!<;<    A :n  iT"!%) Qi  %C      y 7 RQ7&T  (       ? (6 )  + " ; F! ,>&  7  7  & QS\    DCB 8'*  G QS     RQD RQ_ w  F!'  RQ RQ    +<?{|&?&|{|{z& H&$  ,kP &Y]   A,2` _%&?M7  +P&)   A^& $, l&d 4X*?*?$x WZ m$    A&   A     A !G*E   )+ )). : )6* "   ()0' ) ", ) #&<#3<A< < "& A<"*B& U?<DA<)$A<       D  _ w F$!'(  ), +. / 236 7 :; =!'   #$ WZ $    Ac6;  ()!=  U?< Q  ='    e@!( E  #  WZ $    A0 &<  ))+ L J U@< "@(   E    RQV  ^ RQa  e RQQ  $  +CDDCDCDC ?@?   , ( %& / J    /   A6* 4ili       AGW  (X, o7      *(''   +5mV +''   A*< * ) )$ D ) ,     ?&5    ! 3 [ ' )&3\JA:A< RA<E;(S8 $*B"&?LA<     V ^  a" #& %('T&%&%&%* +. / 23Q =y jQa   RQ  )D   )B      W    AA>U.    */    *'-0 >Y  ) 0 !!*=+*=# TR 'D< 6, y    a   t           W >A3Rt     c18SQRQR[ \[V & *8[$"90 '3 0[ ~J   Y4 1<*$S  nV /] B3Z-K &F2Q R#QR(!    ! 6-49%lm Xab1*- O         LO B7    {  L  x$& #V( +  - #&  F2 #  (  !   &O(      95"   PtOPN@     9   &'  N*-3 5Bc"6,A  /B# &    ['C  )*-3     N1h    !0#  +  )o1= N6   p"   "        ,%2+Fj##t    R^] '''(t  &   3!  0R q"D          %% F9   3Bn -t +   "% ]"    f  -   ,             3!  (-0EYA! 3B  F  t +  =^]8    F(;=8!![ ` 3-d c ^]$^]      @@5-  $ "          %$ F8 y+.   -3 -  - a ;! ),  @   _. \[\[-t\[\[     .)  + X  - ; )% 9 ,5-t    $ 3F%  2+&&. , 7%% pop` !"K   $ !#>` !0    .  19+"2  !0 %     / "<(  |  1  +9$5 )S +,  _y + %25.\   .J(   .  0FR Q R Q^]K PO "    #:1R ]& F     K/    t*   " )    )+*  847878L   C  " B     ")- C )Q ),   "     !@  C$y     W8$ " `*_`7 +   ;H  2    2  2W    NZ1Y &%    1 g   E&N1 >! " x   % !!  "    !  T@^]    I " @        @@?    @RQp    N@    '  " !!~} & 9" "  ,6"  ( ' C         (G   6 :  L,,"(P ,    (h'(:0           {4 q) %#4     L E !5%? ( Z{4q  ^4 UV3#4D  \ E ! '%  ( >^4U 5)333| 3  3  3 9   %      x!   )333   7         Z3#!0  3 '  , 80    *  \q+T  ).  ]Z3 _;;+= dcdc#dc`_#=      << 4   9 ,%  '"#7+=# 2'|    ,   s +16++'      |  @ &) } O K&$T@      u  8 *#    "  G ^4   ) o) ;n *       /M    o=2 ;h  *  FEFEFE /F 6 /  N& +FE, 1 J%&  $-  j v\R #3 ;$  *  HGHG )"/6(.I#$+/F$#   %  H ( !     ^T<":=L=D2 ('(Gm  ('(N  (o'(=4  d'~1L~}&X!0c     :9 +,+,+ +  , $ %,#,  s 32&' !GQ6: E 1L*Z  %)!0 2##   , E  $ '  T$5"'  m 83363,fefefejiji  Kji#ji     3  3 $   3        >   4     6    " "[ B 83363,      K    #   HZGHGHGH  @ L  S   @  XWX WX(     <      3  &L3 Z      3  'M3x      3 F  !   PAj4 E`!0k F87 )     ! #$ ' 8 /#4X   {h E -$'%'%$D ( !8PAj 4 E"b T ` 4 *!0 F  %J9  P#4       8lk  { gX .$')'  ! >$, (  4  * !0v   + !   & V9+ 9 )G &3@HP= 4 `_`_5`_`_dcvdcL/!#=#4    A 5  *  c O- L  5 '   8P=4    5      v L {  i, *       =8$* . 9? t *  !  !Z *  !   *  !  -'     N' '~}bonF4popo2tsts9po tsXtststs~V/"ZWXWS    ?!?b/#4Xknmv   KVGJd  rZ'VWWXV'6p@ 9kl}$ *       & /( 0 ;+    V ? ' l  F4    29   X $     .%7u~}lyp}~y~}~}~}~}~ }ly~}zy1FCpopo2tsIpo "t }~} p}~}~}~}~}~}~ } d~ }tststs~ %Z YZYZY         1    !?!< 3$  2I<43 4>   4    *    9#%- ".r 0) .7,5   )  7u        1$#$#&F'*C+.-.-20/I.- $#"2:#69:94  98   =4;4343^@210/0/"  1  % /(%1  c   ["7W~}~} ~}~}~} 6FCpopo2tspo tsetststs~}%~} p}~}~}~}~}~}~}~ }~} ~}~} ~% XK  6 3463/    !?!<  "  24    v4C$! *   #% 0f;' 0' +   !$#& %!(+M'7W        2FC2  "!e"!  %      (' $#$ %       ( p?op9opM     !  6)+ s_     2"   , ! 0B/0/0    $, RR3       .!%]0    87878F      Z 14   `_`5 . Q R     5   QR "1  5 . h S ( Pw     7   .7 XYWXP   !1)  H    . 0&/0  ! !   " ! H8GH (    (  0//0  !  ! `*_`_`>.   i$ qji xwv~} B<!0G  (&3< %%  A_    l  '4!o"  v   fiF> BK" jixwP~}~}k #!0 }g)  (( (#   h <-+#  ,X P   k  qK" jixw|~}\x wI~}j m!0b )  ne( *  (#'    <,+#  + $7W |  \ Ij k|  X[WXWX$|{ ts/ CD  ! / &$ / pZopopopop=!0  4 =!0 [ @      &O!'E[@  @=?@  & h0gh vu    T#jq9ts     E 6 3  ((9 ,     @      33   "R-2 `   3,   "R-5~      33  zy   (m'(z;4 V1  Q4bF   J POP8OPOPOP4BX WXWXWXW     ,(B   `%_`9_` 4  +      5 0+ X9WXWX4 ("   -"(4 K PJOPOP4 ;"    );; 4U\G4_45 ()A    #4  <) 3  3 Q G 0D       7 (   ;4   T3 3  4   ,+ $#       ;D+ lQ  4 J5)8KLKLKnOP OM / +   *Z Y%                                  :9>87              * NS%  G&])"-,g ? R%  )  M / +   * %  |14 &(2   ";  5  @ 3V)  &    ] Ui5@3 W ! `v          WZ 6     W` popT3)    3    ) ! ! T3) =/F    44 lkhghghg  z y  r vu    #4#4   K B   f[I + H * F < .   )  )# D^4 4    r %  3 RG<; 6'  %$   3 #$#  &#$           ! ,          #=    ` ! !I( y  3    3  3  3     $  3  3   3  1          W ! ! 333      3    3 5       !!  3 hghu 3 )  Q 3 !     ) ! u3) 8O78  ! ' @ (G'(   '    $ +      9   /"%,   H]GH GH GHGH   G!0      4,$@&  G HzGH GH|{^|{ +,+, +,;"    ## 8 07/0/0/0/0/0h    $= Y#=-    $=  hghJghghghgh*d        '    *d 3s {  dYl   _- {  0`    .    G"%WE; &(2  B  >O$ +V=E"%- AE * ' & 2N U%H    [`   ( (d'("O&04  . - @  # pAop#opopop    F --F?VS--c   #'   F 3# T * )*) O      c' 6(C'D(C'%&& ?('('0/0B'0'S(C' #### # $#$#      -, * # <##"# "    l,""4### #->, #### #### #   /6 , "4   %#Z""    C    C  43   /   ,+      &        B       $* C    B ]@.  6.  ~  r. '# .E>9KA-&"'42 :*@ *h/%(8 # T     O        "!" !$ # $#J!(%* ) +,+6.C-D0C/21 2+,543876/05:9 :349< ;478743?>=>=@?>=>=>=@?BABB?BC8743438747812743SDC 7874781 #\vf%1   %  B  9 3> 3 J !"! z 3   wxu   v srqro   p m        z ! !K%l 5  9  #C9 2(CU"M:               "  * %. -.-.-5  H;GHGH6GHGH]GHGHGHGH    "      EB" """""""""""                      "    0   )  9 8{78 | j"   7       r 0S/0 VUV)U$V      )')$   h1gh gh ghgh( &      8( & HTGHGH   #"'     ,, X"WXWX#WX31                 k%1   '- B  $        +L6& B$  -}4; NWb TS L< E  %     &58:7o0   +e 2 "0L%'0,$4;   !  \J(    -          - *8 (  -     ) @3?@                H+GHGH     " p9opopop     "    0R/0 9       6 9  `  XWXWX!       ,! 87878         /X2WX QX3WX QX3WX QX3WX Qx  233 3  :#CHHH'%%%%%%%l23 3 3x `)_`Q_`< A    h< A  _  (. +$&#1 " <2L    "TSTU TS&VUVUVU        `   D~          :4-  i  &%     X  ,)(%$     &!J9F=:      ?Sg5r:\:,F:x:  "7,;:r:S:E:Ma:E:M%  K@.1  />?=<?I@? P.   +   - ."'=P;J$ )=BB!F Ts D! (4[*3), .- ,4/L  " &              o-         ),  _ " ,0" $'-      k*Z=_  #= 3     =        P7OPOP*OP   L %`9>7 9 H1 :9B5 <56 i2      XW  XW XWXWXWXWX W  X WXWX W  XWX W H4GH,XWXWX+7 678 ?6?6"   XWXWXWX+XW  XWX [ a X [ HcGH,XWWX+%$%& -$-    /> L XVWX+ aX W  X WXWX W<;>=  x # +  #  #  #   b ,5 6 )  , , #   ^   #   * o %* B 6)  %*  #    A #   %*             t    r        DN ,:_   t    x9wxwx[   x6wxwxX +         %    7   xpwxwx wx wx      .  H "; xSwx wxwxs   + /" " s  :  K / " Nh 6 $    7     N  H "; ~  E  V / "   H  Y /  " \v D  $  g7D8!7D8] #  D  D  + E    /B)"gD!D] d  (   9 </ a  (  9 /" l         ?N ,: x[wxwx wx wx        x>wx wxwx_   | #   ^  #  ` #  #   ^  #    . #   i  1   " l  1    " Ln 1  + 1   #    #   1   1  ]  #     \   #    & `  #     * #   #   #  #   #  [ { #  ! #   #   _  #    2 #   1   1   1  #     a  #     . #     _   #     &p 9   j  D   Oq G   n D 7    _   | 6   ~ =9   W  ` 6       6   9  6   _j   t   [  X        W w|    " &  "c &+  t        FN ,: hghr       !$    # 66 r& -[FT[CT[CT    L G  !?!<!< { * *   0-D& -FC  C  ;j -%r   ) Th Z Y ZYZYZH&  gpet   *        g KD 541#3   ) T   H  &r*   0/0/0r/      r( r! r  r I5=r  6 ,<#  "  _   | #   #   #        # # # #   , , , Bf #   \{ #   #   #     %*  %*  #     %*  %* #     c #  %*  #   p %* B 9)  ? # , #   #    %!  9 R ) " #     n 1  #     # #   1 # %* #   #  _   t   X   xSwx wxwxt   + 0" # p  7  H 0#      c 9 ` 6 6 9   7      ~  E  V 0 # m  G  n D  Wy :     +  :    7   xPwx wxwxp   ( / " r  7   H 8+ 9 t   | #  c # ` #       #   1   #     n 1  1   #     H #    _   | #   %*` #          N    S * "t    g * : 6)          x?wxwx wxh     .   L        6OCPa      C  !  N  N )%:6Ca       \       HQBRH  B  %_  5  )%!HBH_    #   #  ` #        P p    " %* #_z   tX       _f   t   [  X       _t   | #  c # ` #      _x   | #  c # ` #       _r   | #   %* ` #      _   | #   %* ` #       #     c #  # !%  (V'(&2  (z'(0L   (t'(!U 2  (W'(2'   ('(;N  ('('(  64  (w'('("T (c'(14  (p'(1A  (Q'('(6!'  (C'('(6  ('('(  ('( 1'  ('(E[ 6  5N ;'  HGH*@%*      ' *@% zpo@>!0I  *' '         ( %'/,R4 no po Bs  !0  g hdhghgji (   }   #+6e) B s  pZopopoppoV7!0,   0*!!V5 po Br S!0H    (     '+6e$ B r Q vKpo}!0r  "      $  $ &+,+! { `0_` _` %6     $ +J  %0 %$      ###$  . 3 5  8  "S,:3+j  EP ED      CCCD  . 3 U *   klol      e{iij . , {  8  "S,:6* HGH GH     '         X          Z* q    @(?@?@    " h&ghgh   POPOP    @I?@       P<   `U_`_`_` _`D|      @ %$ 878DH  44& &c  G>DZ2  )D  SD/Jkl I!"\  5" / L2  )N  Dmt  $$ C D,    x F<      & `a_`_`_`Z    %I'+ %C     f    DA --  K . h rb!0  -,     78  ,,    {  x  f A bAdA/#5r hghz =%D;<;<A:A   =(+ z } ( '(<'('(^     wnJEmn mnmnmnjmnm nmnmn_mnmn%mnmn=D           , ++   3** ** 5-#  j  B T7$:#N*X0! % *. E j _      %  =D##m n    0#/0i j     P8OPOPOPb         D# H8GHGHGH    J  ' @?@?@<    )) )) r">b U D     !( 2"> 00/0)/0   !"!   !      `%H       N  %H ?8i(  c m!"do r       i  3   !"#$   c  N[      1"0  %(  > N[ @E   .M    "& hZghghm  ;-M     de r d  +'     +      4 76*J)+p;)  e   r    XWX d% d  +" 465     "%  %  @*?@7    h7gh,ghq(    I!  d  + c d3 4 0/0/0 6X   $  0/0/0 9X   % 0+/0 /0 KX   (6 k  @Mj) 8 )XN +#P  $ X^WX '<>#  ' "p# 'j (X('P  05/0 !>     3 .j $X$   02/0 >      0      ?*  I2 1%   c    c  .-'  x?wxwx >&    # > 0U/0 l<    1 r/   !n         'T . ! @6?@ ?@     ('( '(x."   dzq. #   `9_`_`_`zTB      XWXWXz  Z     R"P     '*  8T78VN OPU^a LMT  +#8    o1=  %1#=X :      1=  @3?@ :'  (-'('(     Q" pop\  H%GH;GH         e_ 6 X1WX;WX         qk6                            $   "!&    / 3)$ +)+"             )(         E A k      - !" 3   (#%52V     ! *)   ,hc         +JE+TO+^Y>  61+@;            +"UX   ,+ , 7 )#b&&3#2.%#)6 )( 2n0 0 : " 9 $-" 05J2_            d # ) #          S :41$ $  % 1!      !!!!       !!!!       !!!!       !!!"      !       !XJJJKa== =    =   > f H%****+0% )      )&) ) ) ) )/. ,-***3       ?% 7/m              pEop:op&  . ' #       ####       ####           # QKM O:=  = F ( (  ) %       %%% %P +:8 89)   ) %%) "!  !                   # $ $   s    'n "%P  -   D*    +  #"  "  "   nW9i31Xb6T>!rwn mnmnmn mnmdnmvq04  h0p o  nnmknmnmx (HS   . 0    00    0  '#4 ' ('( ) *440 U j5  4 5    25)k F ?  I  z   \{17& +- ( *   ' !&  0  !  d 04  h0  n k    Z         +"C5         ," ^OPOPO    " ,$ 878t   @#?@?@v    HBGHGH&  &  hc   # '    '          2+   'F  I     ! POPOP       + 4AF/    +$ 47</                 D    V $!  ?    $ x]wx wxwxwx Z5S \U5e $ HGHGH "   I49|n M     )    '(# ('L#  KvRwL>K 3>=@2/ ' (%    (JG O|{R >=  #opmL$  (>Q)         -   t 1 . .  t $ + 0 ) B  . , i)       KR"!"!w.#$WR ++&+#g h*ghghghghghghghgh         ,,;6#  ,  O$   O ,?7(, # )   !!*   `^_`y_`8_` _`p   _ &HE Y    +39,p_ O9    ('$9 h=ghgh#gh     $ , 3i ji jijijT  .      Zdk;H Oopi jsijt( TS> LE"*ba)   !jM KKK "!"!"!"!     "!        1/      &    0    7    Eo . K&/dM 8 7" 7"73Z_, ?0D HO                               Y  @$ S       ) )& .1%  A    3# Y ""  ## P]  .   =op FEFE %.-E    ! 8  ?:78CR,;  U /  !  ,1Z##99 6,%  iji jiji.ji jiji ji jiji0jijijijijij 4  opu  o7#G  %!B     5      !    /+ to^]^+opopopF @  "6]    ` " o1.-0-+       <WVt&%&%/b  $ '*"   '  X+G/t_~z5  xwwxwx 0,6"% +  S 9*    psopop .,6 # )  O 5(     1zT"3&   9  6     U]M "Q#0 '$   qH      + L L  + 1n2!J  7  H      Q]:#03  +     K @    2     pPopop op op op ' 6 L         2/ ' 6 $    v     $            LMNM   X3WXWX WX    )!      HKFI   !$      * K# 0 T 2   $  _ 0 T 4 p6op+opop#opop-V  /.-0 52   &-(8M 6.@+F           E#W- k(4*6 kJ  : ;  - `_`"_`d !# popQIt !$.  *   & "  $=AQI jc^0 /]0/      & / #;8<^]           7XWXW\,  dc  fS     8   ",9 7\ X   .     A# !;  Q x/wx<|  l '   ]4 fa    %CbH RK   *Hw^ <5     /] `E_`_`"~   #'"#   $'# L 0N N l       OV U   N y5 N 9$   L NN M g             {[K M  9   .     M >K     .     '   *9q.  " $ ''D N  XKWX WXWX fef  fBd X +,'-VUV4}     , + B   f  f  f f8          0 +.-,4af(_' + ~{ 4QV(w nijg    !  ':    ; #$ &N T       @ X@WXWX WX fef  f-  +,'4XUb   6  - pjop opopop/ fc- + S\[\    +!2/  ;w3 4t- + u~}~  3 4- +   3 4 fef`    `A_`_`_``   ! ( #  pZopopopop      !  % # 6 `&_`_`<    `E_`_`_`   ! * )'1   xwxwxwx7wxNwx  I--  $          '  e b  O L T        )=/)&&[ !/ *I -  -    $     *Q  !"   $ ? x5wxwxwxwxwxwxwxwx wxwx wx wxwx       G! sd  $ "$$ " E^      ]:   "   "'  "$ "      XWXWX  &&    #!&  "   xwx,     K6   3  '6 `F_` _`2_` _`6_`,_`2_`,_`1_`,_`2_` _`1_` _` _`_`            '6:%+%*%+5F $9   gh  : ,       )  [1    d wJ, 02/0/0F  !$-  + `K_`_`_`h  # *!  4   0/0 /0 J 8 5  H[GHGHGH  vqJZ  cC#     Jf +@  ASvui jiji!jijvu+vuv urf ,    )  776!E##8' hS ! +   r q}~}~}~6}~  ;8, )6  jijdxF{    !?i /  +/ dF *i 0At s`tsts 6 .   4yts    ;   y  > po T        )   G sc .W  3 8"A `  .     4    y   "9    4   `x_`D  *a  )`" )Yb  Y ;       mf ',- .  -       " s .    b  Y O% - ;       U38   13 * z|   %$ 13 1D *     %$  1D `L_`_`a     % x-wx %   E&  % `M_`_`_`o     #  "  >=<=@ ?@ KD(&c';1  "    vua/bababababababab /?B;j  A\'(+[8[4hQ>CJ/        pop/a ba0bab*ab iO  KL  ^(_ 4FK # *           8%78 78>6   !F      e)/ 5< /      1h/5  "K  feff  +,'@4s    hgh f3 f   +   ] 4  +  W     3   f  f   +  4       fef f +,' klef4  %H            .    #. Q {;        4 3*!M.+` u     ,.3   , qpor    % .$:3,    ST   ..$13  k f  f' +R +*),  ) 45.   ( %0    `@_` f f  +@) 4E,   DQ- "      .3 r9x %$#.     0 .&!F.+Y x]wx!2   ='!2      0B/0  yv):  (4'('(,YZST  %%, 0/0/0.    0u/0/0$Dzy?    Q#  l$C ID{f ?        y8 C{ oiP     )  Bi  mnk/KHX    <yH0  ab_/?HL     9yH0 l'   Y=b-  \& /+]-- != X WXWXWX?~  & 7 +8( p#op0~0""&&& JWW) (/W$$** ^kk)  :16 S``- 00*` h'gh44 , $$ XeWX'3    4 #O3&&2klef%"  %WW* ^k#-/  38#--%`4f4g ?    $>> 44 0X/0e  $ ~+fH  <"<0xc/d#  ( '43    /& 3(= =  =&# V&' 1  1 !* ] # ## $ )x/# XWXp "D  !N -6  )     !0$,  " R"> 1;4"r -~}   v  v  >=  21  0>/0* :9  )*  xpwx p&%&% 6125 g p 366 8  U #&6  * #$#$ !$# "#"#"# $#$#$#$ #$Ir    <OP  I *#B 1 #B #B9#!*#$PMLM  A'+]         I    > ),: A #    h  h = ddhhp  |~6 6  nB+g  "#&'*+./4167:;@=BCFGLINORSXUZ[^_dafglinorsxuz{~   $ ~vtxpqpfgf\]\OTJKJ@A@38+0&(#   "#&',)./2385:;@=BCFGLINORSXUZ[`]bchejkno HGH        7                                g     @                ~|zx            HGHgg18    b    YX       {FQDOBM@K     "  )$ #&%( '* ) HGHgg58    *    !        C    "  )$ #&%( '* )     ooF9HyMyMo'     $%                            FH)M,;M> M' ogLj!                     g         'L* 5! HGHg7            w       Lw$7               L   #  " !$ #< )<  XOPe  B  0 /01   "       21   _,l: 9V         &!H l )"  p^op op" =           b " %  ]$q65   b5))? 70 A65  ((  "   %     *    #T {6U   )< =  9!f  "    :'m  ! &   tN0 A2 1        #     AB  H9  '   @z?@   A 0FEFEFEFEFE4  XA0 _DCCD9CNDCDCD9     x:wxwxwx[N    >"% 4 " R?R ?R?R?RQRQ R? n  SPW VOR/ 2r v| $6 JE  SVSF  ) "     #&% R?R?R?R?R?R?R?R?R?R?R?R?R?  T    "#&'*+./23@? @?  $R?R?R?R?R?R?R?R?R?R?R?R?R? x|t)  2  $  "#&'*+./23 A    06 h-gh-R? 4-RQRQR?R?RQR? (D"   RQR ?R? N  #    @(?@RQRQR? %   02  5 B: 62  D &" B     F,&"  x3wx #`   5# 3      3 0)/0 /0   +    VUVC<C   XOPe  0!/0      * @0?@  "   (0'(LKL K *)* )2   "    D *a:4 ;#   X D    _  x| ",        ,    |~|txtjnj`db`X\XNRNDHFD<@<26+0&#  "%(),-2589<=BEHILORUX[^_bchknorsx{~               o    "                                        )  "!$#&%('* )           X        oV qTmT oRkR mPiP kNgN iLeL gJcJ eX             0R]P[NYLWJUHSFOBM@K>I<G:E8C6A        7   "!$#&%('*),+.-0/2143658 7 p"                           9!#%')+ -"         S"H GJ ILKNMPORQT S p"    C       RS               *z|~    S"H GJ ILKNMPORQT S "   c ,                                 4 )*), E FE, Mp                  M            I> =@ ?BADCFEHGJ I #!  !  !   nh      Mv ! $1     >#      4  '?!-] M2Q      i  A  d1C #.     2b $ )C #.@     ' p opop<{X 7@ #       7     9#    * F9 F; F; F; F9 F; F9 F9 F9 F9 F9 F9 F9 F9     "   R  *   "#&'*+./2367:;>?* F9 F; F; F; F9 F 9 F; F9 F9 F9 F9 F9 F9 F9 F9B  :B BFHLLNLNP   V  *   "%(),-014589<=@ADE W>   3 6  F= F ; F; F; F;   F;  'X $ ! 3: '     bhj "at   -.  2Mn # #P]E       "%('# FEF;c\ P}OP. FEF; F; F; * fkm   > W.   * U ^ q t@ J  ^*            >             Q "   R   _ "    R "   r   ` "    hbgh$2       ^$  2 I 0". <d ?BADA 7 D= LJr!    MT 101)^_ $2B 8Z' z |-OY      -v %$%     $#  sABE   .- #    +-/-"=n.  = `& T K,  7 F?FEF ?F?0 8"b &. /   F?FAFAFAF?F?FAF?F?F?F?F?F?B  >FHJLNLNP\     #&'*+./2367:; @?n ]`  $F?F?F?F?F?F?F?F?F?F?F?F?F?z rx|xz| - -F? 9 + FEF ?F? v` n FEFEF? b @? t +     5> FEFEF?F?FEF? $:&     69 69F& H E    X g X _%&  #.B<a       Fh"  j1 4   l EDABE  D !  04/0 #:5"p  O6 . #" A   hEDABE  # +-$  ! fefe( ji     d cdc                         (>'( w ~}~$     @I?@     3#B! hgh       2%  /(  .r^M XXWXk ',  bs #/`4 %  \  d 63   B ' $  +P'  2:  *       XOPeB          @657 x       "  ! #   *   , + " =           l  $     1X*3)<0   7F D Y  2#   0          )o%.  O<F ( Y    ,        "    9,       C^ %2  !C   Y  A R ++ B   ! T1 ++ B )! b  ! D,)!  3    $#$ # *)* )    0/0- -   XOPe  *   *  >v  s H X '  # b nmn $ # nUX xQ"T   MP #  $!  MH  n    ( '\ H  ,L! (   "  8y ! (  b%    nq" U0 ,+.-       R Ur &%,+   R X%      lg" G 1   UV. N ;   q#   Q :      .    "%14D     7  #$ '(ORYZ   ?DIm(6W   5  *4 F. @&?@2?@?@     36     EBETMGo    3"   (/'( _b     %/   U'3   g (Z'(%E       /0#H$E 0'/0/0/0/0+   YRQ0%TU8S-'+ s      '     @        H; hghl          76 N&   l     > )            76 HCDC 9:>#$7     )t>;A" .     #   )@I@@  U) 0 $   `      )         76$SVv;U#&oM    @ `  Y! 0W$X       "!& ), +)*    ߥG-      (         .              76OPUoMv%vq0%v>oM% oM*  Er  E `  {-  @       !   " ((   G-      %('* "!$3658) ,+.ADCF3 65 87 :9<WX OL   A>  &%& %30 656 5> =DC!@C@@    (   % % %&%&%&% 1X          1 %(h       %]0?;9  '-)     j  3v?+4> m;)  z-  * -d       * &$V &   04" &"s      L' 5 & /43          43U A2 5 $#('       0/    Q2 Hq    VW k  D  ?     5   9' , zwx \K  43:7       1 ~(BY F/9' N  , <    9@?H0TS+ N  F ^    ahg   C0jSE   H       .0  n  $4  I    &/0/.-.#*' C8'u4I  $RQ"     4NM    B    N 76  b 0%    z " Q :    %       8,78 >  #      kQ"oM  % Q : %*'   ! 343 434     *                        $     U      .+,  +     ,   #        ,   %    0    "0   adq h7!$  '"''''  mp ~ H%GHGH &    !             !   X%WX WX Z   %   C,Wx     587    9WY    .$   5$CW V% 9F X # % xDwxwxwx ED   P' A'$  _^       '$ (H(('  e       ' C  " ;+, 87 >   +  " (B(( mp ; < ; 6$   pUop 2 Y,  X2T%2 L % mO N%MO  % W 4 Y,  X( % (   !/    6!/  (!((((      $#$!$ 34XOPe1  0A/0/0"%&%&  $#"   H%GHGH %       % `i_`": :  8":2 :  P0OPB    2" H&GHd   (+ `'_`    ) ,    .!  (,(( ((   k   /0#   YRQ4%PQ4       (i'(\9    )  )     i {  zYa9 )) hghb9    !   ,  ,     q E   32   Dlx\-?9!      ,, )() > )            32 HCDC 9:>#$7     )o>;B" .     #   )`K``  U)   0 $            , %       32$SVv;U#&kMc n   @ `  * . 0f,`       "!& ) ,14 3,2%  &%& % ߵG -!          (       %  4              32OPUkM nv{%vu4%v:kM{% kM*  Er  E `   -  $            " ((  G 2G   -    !" "-0/2% ('*;>=@/ 21 4ILKN9 <; >= @?B_` WT   IF  &%& %;8 656 5%% D CJI#`C``   X     %)j         %^2@;: f  /vC'0B m &          Y B   -)h S| 8     9b \j  D  ?(    *( ~{| `O  43>;       1  <    9@? N  : ^    ahg "C0^S9   H           &/0/.-.#*'  VQ"0RM> J 32^ 4%#v &!$Q : !      / &   )    {z=K&) 2 &   ,    ELG D@N&,    gQ"kM  {% Q : %*'   343 434                  $ %   n:H$%   $ U *'(  ' (    (    " >">>>>  C,Xx     '*)    ?XY    .$   5%CX a&% +8 c! &% V! 98 !  b! A'$  UT   ?H??'  [   C  " 5'( 21 8  ?B?? cf 9 : 9 2 S(  R2 L % c|M L%K 4 S(  R(   !/     ?!????   "!"" )*XOPe"#$#$   %    ": 2  '  ,  ?,?? ?? K L *     T>  $    /& 7* 4 & # )          .    > J*    TQ     #; 34  !34$   !,J#; }         3>*+6eh  21   &    ol)     !) 8  !44)$  @?@?@  6    [        (        )          r  s  Ds fg8   $     !   =_6[  (   ) q5    M        !     N  O  ,OBC      NPk5M  !    A$   9   `]  %*  &%         '#+%?c  $ 9t *)0     !  8 ' x  1(       }      z}z z}z z}z ! :(           ` 8.7878z78(         C         C+(        @      0[  6           uJ.%([  6 A 8 jG        < 4(G   _      !                                                                            S8   b]\_Z )Q6                tyx{vs fkjmhe             :N!              "!$#$# &%('(' *),+,+ .-0/0/ 214343 658787 :9<;<; >=@?@?S 03/0/0 /0@ f      J@      ' ),     ' hghghjghk2 8            > &7WV<7:A   wv      U sZ N . (  (    @ ?@z  0%m r   f^       ! f" Er f&&& 4   ,  ,      B , ,  ,,     TQ     TQ   m     2 J d M@?P I. ?L C4z r   4T 4 'e" "  L M   (  @#c5" "  d'&   6       d}flxz+.-6   :     BJ    " C   6        HGH   $     "C   +    wr#  HGH              %1           v P  0$/0 $    |  M   4@        P "~M 4 rK   -     FAB CN  "tK -    >0   %('  C@ j c eh /8-3 !(GF/>0       " . =H-   H+l ('(  >  (.I . ?2+  0?/0 ( V  .I  . ?X'  ( 000i    0    f      SR#.IB  SR IP K.Ih M. ?/H'&. ? \ ci      0   000"D    MSRP KM@? CI. ?N OR eG,wD   xxxcH 4      ( 0  ySR|2M2M-,  M@?# $    .II. ? . ? "@?@? u=E8L{hH  4   "!$ #&'*+. 145(2    0/87 .eF "+      .F? "E 3<5 .LTEFW 2       "    .,>   5 .+!0, X2M @?  j.I . ?  v -, SR  |y )5#/   456361>  = A^ #/ 7%1  HCF IDT %1 @H?@  &%*).-214 >  1    X"WX  ) @?@   0 /0        ('(      ('(       6 =8   %1>z     I J     %S, ! %1> X%WXWX     (     T                7 k$x'% T ---  j$%$%3           Xp    C +&   j  3 HNGH '      =! ' @a?@ *%           1+ *% 8"78     $   E & -         9 & -     (-'('('('($'($"!$%&%  XO4 d(Y$     (#'('('('($"! ($        0/0    h9ghgh   ;  " h@ghghgh   B   2 H,GH GH GH    .  ' 0/0/0    #      :  (2I. ?R  2I. ?   wi     &    b      ON#2I>  ON EL K2Id   I. ?/H'&. ? Z ci     &     "  MONP GM@? ?I. ?R SV iHHHc yON|6M6M)(  M@?      2II. ? . ? "@?@? "+      .F? "E 3<5   (A        :  $!1 *'T6M@?f2I. ?r )( ON  xu   89:7:5B  A  LGJ M &%*).-214        2 94   z     M N                  XO0  (((i    1    f      SR#.IB  SR IP K.Ih M. ?/H'&. ? \ di      1   ((("```cH 5      ( 0  ySR|2M2M-,  M@?# $    .II. ? . ? "@?@? u>E8M{hH  5   "!$ #&'*+. 145(2    0/87 .gG "+      .F? "E 3<5 .MUFGX 3N          %%%      ;   > ;<9 :-)&  32!PFN  ;   Y    T   UN  %J     x cf    S          0             .  $&""&$&*,   "#  %                H  <>>@DNPFHLLNV\XZ(@0 %  "#&'*+./2367:;>?  D7 $v lmnm jc    RaPKLOBi.#T D  8     0  RQ  C    D !    =T  7876      !     7    8 5 6 #?6  IH   KPJ!   7 `     j    kd    Q      y|  W          4    @\?@          .  $&""&*,[#   "#&'  &                H  <>>@DNPLV\XZ)B4 &  !$'*+.147:;>?BCFG  s"v lmnm je       4C2-.1$i.#S s   +".-.-.- =    0 Da" RQ C        - :T  5654       N I. `F                  <   ) L T  \  d  l %( t -  |       dcd%= d% sXOPe     '      X"WXWX u    3 (     K((  %   ! ? `a_`,A  ('      % ?  xRwxwxwx        T  ; v PJOP OP OP OP  0/         V (<  g PHOP OP $ ,  - D 8K78 78     $-  B  82@    Z^8d83h   80/0% 0%v_`_^ QXOPe 8 &    8` (!'('('(8     85     58\ ux   * Z 8t $     1 )' e 7 8h  ! * Y VH8       ! !! xLwxwxwx 8       N ) ; u ^  8  $#$    *`  A, , 0B/0 /08[      " M      ppppnnL VL      /      t>e#           "5  4Hc,:UJ  Rf !  0 !   >  /  0  / ! !       >  $   3 $ L 3 3 $ e AL 2L 3 L 23 $ 3 $ ~ e A3 #3 #  &  =0 `   6,)0/*)0/  .    `   X5WX.B$   2^)0/*)0/3 `        |    ~ u 0/0 ` _` [ `c 2` / 9                  H2"6 <"HHB  P  d     p #      #"   H !%  $   ). M  Hn    '  "H?   %HJ !  % K  Hl   '  "    H       ''& $    ! hbghghghH   H! 3   D   F      O '# V # "0%+'#  NMNMj   ,!   NMNMNM         --    ,,   9   -')  9 ,(   5   )#%  5 - .$6 *$ :,t   Q%+            ,(  ;       G     ; 7 e  B%"        !    ," /       S     !,&  (  *,.6 HOGH GH+G8 "&%   Q(,(+G kZ 1 . !  3 UTMN k bab   :*&67#P<B  F2      ~  ",@#' ,=     |{   .'& B.   XVWX WX WX ,   "#  *(    2 2!  2    8S78  "  !  8    T, 80 Z   3J%& 3 8I78DK3 K  "XOPe! /D   PNOP 1 (  8 [C   +&.   k^F8     %  c[@4'  Fp CJ IJ5 UV     ">! ?%-  eA WFN3 434  kl2   )0#6  k  F  }     & !44B % h  F     0 -  # !14? %F00 CFP  7=7F      +  0  7FTSTKTK XOPe  F ; % Jb" "%  \ e   t      z   ~ }    v,c                         )    <%93 B!"!"!" 85 >!!'!                   0" ; "82" " (-"  A "  "  (8 " !!& %/!  7  2.  $)  =     $4   1!!* -!  0!" -!( '!$ - 69 !2 - @?@!DC!*) 2!.-!&%!,+!(' !DCD,CD)C! }&  &  >4&! +  !DCD*CD(C! , 0 - #  >1&! )  6!21FEFERQZY 8fe >!FE !:9  4  t' "  -$'     3 (0 @ -:   ( r ]  6 r WD r QR #r K  Z   ,---,---,---,---T           lslslsrsrqpqpoloXQRQRQPQPONONMLMLSLS8-.-.-,-,3,3,32321.1        IBIBIBCBCDEDEFIF]dcdcdedefgfghihibib}  ,          --  "!"!$#$#&%&%-('('*)*),+,+.-.-0/0/2121434365658787,:9:9<;<;>=>=@?@?BABA-DCDCFEFEHGHGJIJILKLK-NMNMPOPORQRQTSTSVUVU-XWXWZYZY\[\[^]^]`_`_babadcdcfefehghg,jijilklknmnmpoporqrq-tstsvuvuxwxwzyzy|{|{-~}~}-,---z    -." !  V . 9     UF 7.  @V?@ }    5.6 [ z /  c8% _ 0j/0     "%     'SF   pop       "  popopopopopop               c        EH \   yF-nM     K y% a  > ?,`,+`@?`TS  Da . 3`WHGH QN    *a j] (#!A$=X S0&# M      K y% a 8-78 7878<v w       =<            ``st`]^) ! ;z $  ;          0T  ;2 = >=@?@   /0/212  B Z &/ ;2\ //        I{  \C    \%  \T G\ \\D '\H +\\i \m !  PCOP\e      ' ') XCWX      \!? .      \# # # \       @?@?@?@Vg   +                 9:-.    K      "hU Vg 3 4 ! Vg#] I     4   L  'hU Vg , +  E*Vg  Vghg  Vghg  Vgy Vg + 4   R 4   ^G + :2) 4  nu:\Y  .):AB `Y `c%C   0 5  # 5 6$! gr 0 5DE/        K !B e, + 3 4    / i      )* ) "N> 0/0/0=   - Br1*I7v u@v u'v u&     bv u TSTSTSv uTSTS   )*D        W  0 1 3 :0O` ` ` ('   FC%/&$\' v"$#1Q<^  6  @ '          T  ! #( '&   HGH#GHGH-GHGH9ETSTSTSTSTSTSTSTS     3c/ 7   v u    +       P#OP OPOP ]  A vNMNMN M4   vNMNE FE FCM/N 6   3) vJ v@9?@5?@X !ba\E#ba\ED  vN E FMN E FMNMNMN MNE FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNMNM NMN E FMNMNMNMNMNM*N 7   9L 9O   4 'a   c" w   y         $   ) :    ? L           [ p                     ej  kqr u ej  kqr q _d  eklk  MR  SYZY  ?D  EKLK      7  Q,GD                      !"  ! !"!( '*  +,  +*+,+2 14  56  54565< ;>  ?@  ?>?@?F EH  GJ  IHGJ IP OR  ST  SRST SZ  [\  [Z[\ [b  cd  cbcdcj il  mn  mlmn mt  uv  utuv u|  }~  }|}~}                                        *                vNMNE FMNMN E FMNMNMNMN MN MN M N MN             )&W(         vNMNE FE FCMN  !    3  vNMNE FE FCMN      7 vNMNMNE FMN E FMNMNMN              3 vN MN M  vN M        &   31 v N M   '   >CJ   3UD vN M   NSZ   3eT     vNMNM NMN E FMN E F&MNMN  ts    p D#&t       nsz   3t       3          ] lvN M   k j   vNMNE FE FCMN     3  K R    3  + 6                  3       3     gji   n  J =vNMNE FMN E FMNMNMNMN  G   FF?     3  _>zZ_SebVt%v0@?@!?@? @%?@?@ ?'@?@ ?6@?@ ?6@!?@ ?2@"?@ ? @ ?@? @ ?@ ? @ ?@?@?@ ? @ ? @?@ ? @?@?@$?@?@ ?n@?@ ?@ ?J@? @?@?@?@?'@? @?@ ?-@? @ ?@/?@?O@ ?@ ?F@? @?@?@?@?'@?@ ?U@?@?@?@?'@?@?@ ?$   65 0      "65 0 &     65 0    rqfe856    C D WIJ K XJI#jiO w i () '.zV~ - \;dxI[g{+m 65 0  9j 65 0 65 0 %6;  ba \<   9IB 65 0  >V[m 65 0        4`  WR OWj ,  U5  F\ HIT\ sN=!@ KD !  d!/ 9 0       '  5 6   " !2&  '* ) , +./ 2 14 3 6 5:7:7< ; > = @AD C FGJKP MNMR QnV ST  YJTS ^ [\[\[\['\[ bab  _-`_d ej ghgOl kn oFhg t qrqrqrq'rqv uUz wxwxwxw'xw~ {| $W     vNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN E FMN E FMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMN MN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNE FMN E FMNMNMN MNMNM NMN E FMNMNMNMNMNM*N                                                                                                          +  y . GD                         "  #$  #"#$#* ),  -.  -,-. -4  56  5456 5<  =>  =<=>=D CF  GH  GFGHGN MP  QR  QPQRQX WZ  Y\  [ZY\ [b ad  ef  edefel kn  op  onopov ux  yz  yxyzy          *         vNMNE FMNMN E FMNMNMNMN MNE FMN E FMNMNMNE FE F7M NMN                  &        3    3      3 vNE FE F8MN     (      3     ( vN MNE FMN E FMNMNMNMN         3     (          3        3      3  kv0@?@!?@? @#?@?@?@!?@?@ ?6@!?@ ?1@?@ ? @ ?@ ?.@!?@"?@?@ ?@?@?@? @?R@?@ ?F@     65 0          65 0           65 0    "!  k   9VOz 65 0 / 65 0 T    -0  6- 0   ujU  @  @ Q  \- _Hk     9IB `,  "VIZ$J0          6   0"#& % ( '* )..  +2 /6543: 7<=@A DER8+H IF v@ ?@ ?@ ?O@!?@ ? @? @?@ ?%@ ?H@     8^Y65 0       @) #4  1 @C?@ ?@v[      2% -           7vN           &   FlXE FWXWX WX E FWX E FWXWX WX E FWX E FWXWXWXE FWX E FWXWX W X WX WX E FWX E FWXWX WX E FWX E FWXWXWX E FWX E FWXWX WX E FWX E FWXWXW N WX WX WXWXW XWXA 1  3 ?   GDC   G=   ? : 3H 9a   ife   ik   upo   uFEFEFCFGH !GFI   " AA $);O6#E                     " !$  %&  %$%&#,  -.  -,-.-4  56  54563<  =>  =<=>=DCDCDCDCD CD0CDCF GJ IL KNMNM N   lXWXE FE FCWX     3 lX W     P,OPOPl XW X W       +     lXWXE FE FCWX     3 "'  !$'  3  IvV  @1'/ Xvi  -"&E  v-    v         D E lXWXE FE FCWX     3  ^0??G l'J!IJIJ I @IJ IJIJI  @ I: &   J I J I^    @ I/ J0I       J I @ Ix  J 65 0      65 0   fI L         ^8        +5     0+ 8    *      ba \                 )  Y "  "$   F"  9x@i4S  %+3 +Gx7 " .'           :" !&$ # & %( '* ), +^. - 0 /2 3/6 5: 7< ; > =@ ? B A 8 7 D ExH G   l@   l&cd[ \>\[\        < /    -   lD   !b:lt   L     dOP   0G 1 t  Ll   tz B ! )  D C pxop C 3'X XWXWXWX d&    >  v           62}/    >   POP"fE@  ! ' 8    f         X  ZUE       % N|HK        n 6  5                 ;,  /   6B& % 87878n.     n n   n<    )  n'         v NE FE F0  %        5      $`;U4 #  0 / "1 /&    ^* ("  % Q 6 @"  hF@ ?@?    q&3F  xiwxUwx   34  &% F ;'! / `t_`_`_`j       A <=,"  Z     @!?@?@  $ H`GH.GH:GH1GH3GHGHGH  ijijij/!#" "/ M7!_&)   Q= dy dyzyzy=4!$  6=    [ + _ 4*%6   +    #4   < - #     Q=       =4$   dy!4!5u +   #4  P 5    !45zc dyC3 4@  +(                 ))U7%*!n ) +  (              B.  0%$              . i$  ;#. y: dyH d0  h  4!^4!   +  4   #4@#4  1Kc I / T%5 C+  5   C' H      4^4  XUWX%WX$e    !  -*  $e XsWXWXWXWX   .+, )  'P     m +  tR  w"E qnqr   ~}      !. "E   ('(Q[   , Ph8e,        > l-&A.  $& %3  #cz j  z]^t  ^#z      < A M/  ># z/!  p #    (' (' ('    $        wL)H ( E  2'19/!  p #z z=+   #z_JI 1 >= ('       " B( "    $B!9_ 1   pz'5      nK+' #   X7WXWXWXzr  $" z=*33* 3  5  *33*3u xwz$  M      !   * !2 ' #' =*33* 3    5 7 zL % ?R>Z  '        7> +N0M  + L %    R  >     Szg E  z<Zah g-%f  5    5  5   ,}|srih_^UTO      6   %  &  $                 +'-   +'&'F'%'&66666663 &&!4 < Z a -%'2 2 2 2 2 2! "2# $2#& 'f hghz& #z0!z! #! #!z <z    2   >  T('4 z#    #zh gT        ,# *!Y"D'F T  !  #zh gT        ,) *-Y,F'F T  ! ##zRh gh g  (  ,+  B;  (X) n  2='"X R    (   h>ghzK "  ##z_h g hg  (   .-    B"  *N)n'2=/"X _    (z%  zO &  x#z@h gR     ,  W -'F@ R  |#zDh gR     ,  #W 1'FD R     ,  #z' h g8a@bh g~   )       , &.'$#  ))0$$$$ , O  Z!    :('6)>'t'  8@ ~  `O_`_`z#      \#z         z  p|opopopz$RYQ)        8 + -0$Y) zhgh g hge     X: >OS    e qzh gh gG   C4**>  G z h gh Fsh gh gG    c  CJ >B*KS*>   s  G Hzh g0  ,!' 0 z h F^h g0   N ,9 )/:= '  ^ 0   C   c  C   C   c  C  ,  N ,  ,  N , xzh gh gG   C;*>  G z h gh Fth gh gG   d  CR >I*:S>   t  G   C   d  C   C   d  Czh gh gF   B,)2=  F zh gh Fjh gh gF   c  BB >:)WS*=  j  F Azh g0  ,!' 0 zh FTh g0  M ,1 )(F=' T 0 * $,   1<?CJ   I J  ]  ; 4   5 5  5  5    B , )    C    ,  # % - 1 4)&,@* ?+&'&''' + '5='07>7' 1 < ? C J   I J  " !]$ #& %;$       popCC  C"!C$ '' %.CC hgh ^ ]\ [,,%&  0 # , `_`  \      \       IA!   \  2Gk 2+E O`      $ &   B#( 42G k  Q=Y    6=/>0/ 03  Q=  l  [1|v .HTG\         I jNF' *4 ;v .T\ ##g#####l @? 1    ]  '  1            !     p         ~ &E 0 '   %     $          "    N    o / . ( ' L Z    #/%$  & B& R G>8 q U $ 4- + C71l  1    ]  '  1   A1$@ez4} z=}<S#4 #= !   %A&   f   O @&# *, # %   e4 =   < +/%r?0@ ?0@  ! % ;    /0<  ;0<      y%8]33r0 0  ! % ;  `'_`_` -  5 - X\WX#WX#WXi      !N,Ei   tmMj### 9I  C ` <5-   &< 7 $ liv3   -$D? .+   , /@?  ?   '  ]C%j35    y xy      fi&'I C ?   jQ'J$8 5-K$>  ( E b G; (  ;B ,9I  C ` <  5 -    < 7 $r   PkOP#OP;OP#OP-OP#OP4OP#OP#OP#OPx U G N      , #           ]JHCrN. &('2ix U G N    xLwxj5y    %D#  A0 5y# # #Mm##O  C c      ,2   3 V )      ,  L '!   ] Q@?8'%8: 0 $ AAPO  C c   %% !~}z=}-    #=  +  -   !=-        s d <?AC^ ]5^ ]@9     5 5 5  5 . ,  5  % - / +) ( +'&'+')'''&' < ? A C 5 @ 9 ^ ]:9  , 51 !' %' : 9 m9  " "  5&  &&'m 9 Y^ ]B , #''  B p^ ],!  ,!  ''  ,!  r4!C&   ^ ]^ ]F   B9 5 3'9 ^ ]^ ]^ ]]    YG?<T   ] ^ ]^ F$e    aS >WS   e    Y  ^ ]^ ]^ F^ ]^ ]^ ]]    y   YZSU?[i<T        ] ^ ]^ ]^ ]^ ]s     oYTMj    s  ^ ]^ ]^ F^ ]^ ]^ ]]    y   YZST?[i;T        ] ^ ] ^] ^] ^ ] ^ ]      hhC)        HGHGHGH.  4 ijij> &#$!  <>L #H  5 5  5  T I Z % ,    &'&'*' +   < > L # N  PfOPklklklX    d <?CJZ Y Z Yf  5 51 5 ; $5   B        % - 1 4)-  +'&''' + '5=!6 < ? C J   0   E7lQ j7n5  5  @ *  !   4'(' &' E7l  Q Z YZ YPZ Y@Z YZ Y\   B @  X")/<$>)=0S   P @  \ 75  5    B @  X  oDp (   9  D4  X W XW XW XW~  BX W XWX Wk<      n 5   * /X S @ N>\i) ''=S     ~  B   k x7wx n 3*(3   z$[z  *  '9$["r (X W XW XW XWvDX W XWX Wi &!     n O 67    XS+ P>  Qi)'?S(    v  D  i$  ,     d $A  5( <'  A @z8 Yr     $$   ? @    3??  ;    @*8 Y       +      " p9op$ $ $ $  ,   $ ,          xw x,w   xw < 24 0 &= ##             p[opopH % kL > ; $ d 0  % k    $ @l?@ t$      J  tj   $ b                                 T    NI5IJ GJG7GH EHE9EF CFC;CD ADA=AB ?B???@ =@=A=> ;>;C;< 9<9 :9/l  uli !""O(&b                    T$ #$# @   :                             .1 4            U :=-:       " ( %. +2 / 878 5 : 9    XrWXR: @              U  ,5W": @   K-  .. c 1  E                  $    #,&ctE   $#$  D              RQ 6Q     6)      i         L Ir9i   POPOP#     (   )   F   1     E V#    (       0C/0/06$  H*6 POP'OP+. "*)41  *)41:3 *)41:72/6A<-*+*= :9   4^8P>                           ,                    -                    -                    -                                    ,                    -                    -                    -                                    ,                    -                    -                    -                                    ,                    -                    -                    -                    X (          JQJQJQPQPONONMJM6/0/0/./.-,-,+*+*1*1              )212123234545.5.5.1.   kdkdkdedefgfghkh  x~       "  !"# !       X S&    I< 7R$ @W?@ /8 q    5.6        ^ 6E .  l<$ E 0j/0     "%    -S F  pop       " &%%%t'&#                6  ($  ! ! 0G/0 ) J     #:) hghf    .!./ $1 & 1 ! .00  y z     XWXWX    u   ^[\[\[ L Ij7q )u   ,   &3&                       T  "                                 ""!  " $!$#  $ &#& %&/)  * , &%%%((4               T$#$"#     g                        s u w y { }       -6f  &#,)0- 656 3 8 7: 9< ;     XWX9 "&         W.5( 9 "& V  8 < :  I                  $ )2#gI        $ #$          @              * @!"   3:9   ('6UVO     L/  E   0  #&3  $"'@      *        D A9    & `_`3(`    %  W1 (  pIopNopopopopXop               +$w"9A `J_`!_`._`_` _`c            Q%zM/P  |    dab _`]  H Ei )|  hgh             " M"; H%GHGH8 "    ,a    G   Qn #  XWc[^u   /D`S/%-<( fa      G    Q t +. ('( '(   y         @3?@,  / IL $;+1  / gj  & )   )V X)oO Z # 01c1e/g-i+ %      ) & )   ) )  # -,,.02 %      ) t $    pm n  * /.  3op#$       @ H&GHGH,   /6  ";> )?*1/  X   ^> .f  EHG P    1;<)> . s    @ I         FW,;@ I U 5!:   Gg ! P*OP% T  %  .     %         *A S?p   v>=fk=@?V"# #J>  #(B93  %     ! #(# &+0+ .3*4343A /     "       7OU/   "  x         DAB;    DC % (( +, 36?'c O?=@x      $  D. q   (,   0   P Z ^ IL   = +   O(  Qv   1!@($(   # # #D   Y SqQ    '4    jJ   (    1ul /  J  ?? D       #!& tb! POP OP+  +.    "  + POPOP+  GJ "  +   & ```     ; >  &    9  4 %   I  2 HPGH  J>  RQ JIH,)E  K 5   O R    < N M0    00 k,%B#5   O   rB% 93       @ < 9 ( ? $";    * & & & >0             G p  qv   x },e8      &   >4       f  2             - : G F0B+8    E # p   |-  ! # p # P " 6     '( %XOP; g4- 80!# P"   U-  d  B-   8     k nja} ,++C/ 8       s> 6 A!`h  >  )  b, f   &  G7 f ,9 +)   m,s qr & R7s + 8 B?    "3!{"  !" !N   ;8,+8! M  ~Q;           1     X 0q/0 !"!" !"!!"!" !"!" 0/.+,+,./0-.-.5r      #   F+ &   B?@Q 0 36=' $  /TqF+  <   0-F ,+,QRQ(XOP;#   #"T QRQ6'XOP-" d n  | zw  !# l(';   2  e  Y . Ny " !  j K 10=&!                f4ESL.NCRQ.SCRQ.S@VF      0             2     %        2     %        j c\ RU^UE % fE   L  #C& '*1Q4 7:ACD EHOQR UX_@b cf mr    zy|{~}  c4ESL.NCRQ.SCRQ.S@VF /  <   0 `g    X        2     %        2     %          RU^U       " cE   L  #C& '*1Q4 7:ACD EHOQR UX_@b cf mr    zy|{~} 878V> RU^U^UV         ~5$          M H;G;DPD   ( e   (    e  (    e    RU^U^U    M   H  #G& '*/2 5D8 9< AH S NMPORQ  _4BAR.ACAR.ACAR.ACG E              ]                  ]                  ]         ]      RU^U  # _B   R C" #&+R. 149C< =@ERH KNSCV WZ _ d  q lknmpo b]`[^Y\UXSVQTQTORMPILGJEHEHCFAD=@;>9<9<7:58  ,+$!      *  | xqz{j spq` ifgV _\]L URSB KHI>7@A0u J  9     !$#&'*),-0/236587:9< =  <    0 - # "  9 q( ' ;   2  e  Y . Ny " !  j K 60=& !      f4; UK.N9 TP.S9 TP.S6 ^E     *           ,           ,            RU^U^Um %f;  K  !9$ #& -P0 36=9@ ?B IPL ORY6\ [^    el  w rqtsvu   c4; UK.N9 TP.S9 TP.S6 ^E     *W.5    ,i  v}    h ,           ,            RU^U^U"c;  K  !9$ #& -P0 36=9@ ?B IPL ORY6\ [^    el  w rqtsvu 878 R> RU^U^UV           5          C  9 ;; ;8 MB  1  "   U  "   U    RU       C   9   ;  !$ '8* ),   18 C >=@?BA   a48 UG.A> UG.A> UG.A> mC    ?                W                   W                   W    RU^U^U^UV   $ a8  G >" !$ +G. 149>< ;> EGH KNS>V UX     q lknmpo rmpknilehcfadad_b]`Y\WZUXUXSVQTMPKNILILGJEHAD?B=@   43,)('    *  ~ zs|}livsh qnod]fg\U^_TMVWLENOD=FG6u D  2    "!$#&%('*),+.-0/2143658 9< 0- #" x,wx u(' ;  2  eY . Ny " !  j K :0=& !   !  Z { P  s w P  p { P  r | P  u { P  r | P  u { P  r | P  u { P  r | P  u x P    m       N                      P          C    yr        P/           "CM    fm      L  P          C            P          C                 RU^U^U^U(             - {  !w$ +. 9{< CF Q|T [^i{l sv | {  | {  | x             Z { P  s w P  p { P  r | P  u { P  r | P  u { P  r | P  u { P  r | P  u x P    m       N                      P              C                P              C                P              C                P          C                 RU^U^U^U(* {  !w$ +. 9{< CF Q|T [^i{l sv | {  | {  | x            xwx&  ` RU^U^U^U^UV(&              % "!$#&% Q  =  lT          P  d  P    P    P    P    P   k   L      L            L            L            L                 RU^U^U^U^UV'     #& -0  GJ QT  kn ux                    g H p P  e L  { P  s L  { P  s L  { P  s L  { P  s L  { P   k!                                                                                   !        "  !    ""      ! "        #  #    ## RU^U^UV'( ))))))))))))+gp    L"  3{6 =@ KLN  _{b il wLz  {  L  {  L  {           hygh* ))))))))))))    +}y|wzuxuxsvqtmpknililgjehad_b]` - POHEDC<9870-,+$!     0 ~ t }z{j spqf_hiXUb_TQ^[P YVWF OLM< EBC81:;0)23(!*+ "#u h ! @     "!$#&%(),+./214587:9<;>=@?BADCFEHGJ K<33 0.      F ,+,QRQ(XOP;B#  ##      T QRQ6'XOP- "  , j(';   2  e32Y . Ny " !  j K /0=&!   ! UGUUG                                       G<= UGUUG                                       G9=  ?1 +  RU^UVF0000000000000000001?              7 ('*),+.-0/21436587( hgh>c2 ,    22,>         % 3,33,4 &&&&&&&&  ,$ .'..(B &&&&&&&  '  P OOOOOOOOOOOOOOOOOO     (Q T nmfcbaZWVUNKJIB?>=6321*'&%   .   v |}l ursb khiXUb S\]LIV GPQ@=J ;DE:3<=,u N   +     "!$#&'*),+./214367:9<;>=@ A 8=78 &:   & & xwx L @A  JT ^  MF&# P   T   . -. - r 9    3 65 8_        YNMN,'e hg j  K 2 % R .Wd4Is ^9.0   P   T   " #& %( '    ``  "9<;>16AB.       9" . - ),  ("     - /  cdcf ej  !%&#- /  h,$. -   $   T$%,$     - 0     !m%?- 0                        !!)4              "!$# &%('*),+.-0/21436587:9<;>=@?BADCFEHGJILKNMPORQTSVUXWX WZ Y\ [                    YP; V          "!$#&%('*),+.-0/2143658787:9<;>=@?BADCFEF EH GJ I         $    k   0/0/ 0/     + `     E ; i                               4        )0/"?& wm[        & %, +2 18 7> =D CJ IP OV U5\ a-d cj or ui ` F ' . -Y        &      W:2r?     Y (     /         " ``[\YNKXUJ SPQ@=J ;DE4 =:;* 301&() !     * +     %       !$#&%('*+.-0/21436587:9< ?B AF G JIJ ILK  B       P II  AdS^    `      DF+    O  T      ~ ?    " ;@? BADk       YZYZ rq ts v  W > 1 ^ "  Y g5 Kj c920    O T  " #& %( '    `l  ).EHGJ=BMN"   58     . /  s vuz  &#./  g-$    $  T%-$     . 0     ~?.0         ]    4   $^"      "!$# &%('*),+.-0/21436587:9<;>=@?BADCFEHGJILKNMPORQTSVY\ [X WZ Y           ]    YY   ?Y      "!$#&%('*),+.-0/21436587:9<;>=@?BADGJ IF EH G+     -+          :/%O         "!$#&%('*),+.-0/21436587:9<;>=@?BADCFEHGJILG L KN M     6&         $$$$   50        $   !   F       0 d                  W      @W?@    8       <J    8 Q J  cT"  'J' QJYTn  # B /    %   $#     XCWX     j   6 )       (  '        10WP_\[ )$K\!# #  '. $#  "      "         {"                "    l i $&: +& $L ffp~$ VF+$#  P  T     r 9  3 65 8_      YNMN,'e hg jK 2 % R 7Wi4N| c930    P  T   "#& %( ' $  $  9$"    $- /$# h$,$    $- 0 $           $        $    t$        4 i      +++$               E <   i 4    )0/"?& m[              &  %,  +2  18  7>  =D  CJ  IP  OV  U5\ a.d  cj  or ui F $'    Y    &      h:2?       Y ($   $"  0      )"      "!$%('*+.-01436587:9<;>=@?BADC ,&: 330& ,L 33, K  F  0              ,# P  T     r 933  3 65 8_32      YNMN,'e hg j32K 2 % R ,Wn4Sq h980   P  T   "#& %( ' ,   >,  9,#   ),  (#    ,- / h,,$    ,- 0   ,           ,        ,    i,        33  ) ^     ???,E ; i 3333333333333333333333333333334   3333 )0/"?& sm{[        & %, +2 18 7> =D CJ IP OV U5\ a-d cj or ui F ,'  Y 3333   &      S:2n?     Y (,!    / ! ,         ,   r,-A#-F 33 33'( 33% s7  8%Y'   !   !% }$ zo { m$- A#-F  '( % y2  C%Y'    !   !% ]j ZO [ ru8   B pu xUwxb RG S h-A #- F      '(   % k-  :%Y'    !    !% ('( ,           "  2 8    O j ,  F    $   "\ _ )*)2$ ! ?G3 @ Z  %N:    -,-0      #N 0 PVOPOP OPOPOPOP& % & % & %             \       a  b J  # _0Xp       .   0X5C        7  5 -SC         S - N ?RM  "#&+./27:;>CFGJORSV[^_bgjknorsvwz{~                               4#!!!              =6                """"=      - ;:9XOP ! U p  ;ME       > mV 8      T8DB    $ ACESUKYSc]mgwq{(#  "#&+./27:;>CFGJORSV[^_bgjknorsv{ (O       P    xd [v  " !$%*A' .     * J   $%     . Z   (%     r F ~pr ~f  Z  N ) `bgg ,<8 MX  \   \Y    F  80 G(   )  P:;AA ,1- )2 6   63     `_`[_`_`& %*)*)1   )` $3 1 xwxwx& %C*')O    $7  $ F   2'O o   " M : P?OPOPOP-*)*)& %    %- \       @a?@     4<'*   0?/0.  /1  6 @e?@?@?@^            1B$*  '   @[?@,?@ ?@  !          1g$*6     T   7        d 7  (='(     /    %   @?@?@   a K A@I  i2)      #$ !       . #89   D         $          \[6       !%? C)$>U# )   q  8478                E /y" (y#     C    (P'('(%I 4 I  MD S ,#1            HoGH  K BA@IL -'3  {/          ^w #^1X.          8}78 J           1Q$f K 8Q78        D%#) u  x  BA@I L  0.'       ~  x   uA@I m  (0#    Z   ba          +"    [            r+"   z   #Y  #U  #U0  *  5              #      >           #                 #        &   *)*  %Z[&               'CCxT9 7T97T9=B z   !          !   !0""!$#$#$#$#$#,$#      Z  Y  Y  F    ! ! !W *I   2; x     A@I     ! ! !  BU3 '' '6u       !       !     !  WEEE*  K    BA@I                  ( '             Sg7 "rF               ,  #&'()*)*), -. /0/j214187870/(!   x   A@I    K  DA@IL    j4) i#      =  HeGHGHGH  K  DA@IL N H\GHGH K  DA@IL9)3 <5   2           xK BA@ILo xK + A@I # o          +  +    +                       <)*        % #    '        272?0 9*O?,,W ,X ,)%t5o %M??)1[    )      !  !$ #&!&%& !( '*!*)* ! , +  !.-.-U0 !0/012143436589:9<;<;>=@?BA 8A >=D !"!FEFEHGJILGNM*  `A_`"              F4    POP A,J,a,|,,0/0/0/,0/0/0   [878788 \[\[\6  8  ZYZYZi2    8    O    j          ]d{   M,J,a,|, ,      ,           J 6121@  ?21@     C   .         I F\ ' # ,_q            : 612$121@  ?@       x   ,$+.- (` + #,x$       ('(6"     F   6T   < DV  H(GH:   adcf o t   XWX":3 D  % F         %4V , m W3 D  % F -L   /(    p9op     BAB56AA   \Q Nw %  "   #(X]|=F3)     L"    i E F*E FE F  &               #  v"    i  *   H*GHGH  )'  L#    tE FE F!     ?      O%!     %E#    t  !   2Z    !BAB#A  h   #        $ \ *  25  #   & Qr   ," "   ( 7   j         # &%(' *) ,   -0/B  G J7:9 6+  " "JQDKX  6+o  7r    ,    " "    ( 7   t   '      & $             |M#'   $ P#OP OPLE F  '   H*GHGH LT   # p9opL%&;   \Q Nw %  "   #(X]|=@3#       @4?@?@LI # 0 `$_`E_`LE F6   $(B(  6 2IL  "#     W  #        $ ] *  -)  #   &) hghA            # #M";   oL! _ 7  E     ?! _ $LE Fu     J(;<1 u nLd   <!    1d Ntp'P    H    "&K  1      e   'uEFE D4P+!  C-      *# G                     .+!]?#z (*#  7        (    3     H2GH /  &   mnmn  & Q*   pnlj8   *   b '  U/.' V0 * ,    ,5(?   2V0 U0 *     ?   2U0 T1 * %    ,+(?  ,T 1 S1 * KE    ?  ,S 1 v/, _e   .*3  / , tT( '    +  -   M<2                  8 2 2 mW          ZgB D )             W  a [ ^  ADCFE)p G)v8 $  (   `&_` B     (!'('('( .          : % |            p   %    '# 0 =       ,  =        `C_` %    95% : NABABKT 71'0CF 5)A   e #Td\  f4N UK.NL TP.SL TP.SI m$E    *          ,          ,          |{t R U^  U]   O%fN  K  !L$ #& -P0 36=L@ ?B IPL ORYI\ [^      ej w rqtsvu 878t> R   U^ U^UV2F   5)    ~H        )( s   3           V  L ;N ;K iB 5 "   Y "   Y  R   U^ U       JV   L   N  !$ 'K* ),    18C >=@?BA  j4K A].AL A].AL A].AL i C       W           W           W      W   R   U^ U           K& jK  ] L " ']* -05L8 7: ?]B EHMLP OR    W ^ i dcfehgrmpknilehcfadad_b]`Y\WZUXUXSVQTMPKNILILGJEHAD?B=@ 43,)('    `_   4.mD , Fk  -)   #  )Y 4   .   m `| ***$ -g   * '   $#  :/'& C> CD)'P   #::@)=+" !# " !-g *     ;d :    I~ H     @R?@       cv_ _^Yf    "K         S , *     , '  ,   ,1  ' , 0/0/0   ,\  <         $^  # $ A b ;@ }<3     1H       V  `    POP/OP *    ib %& 1  *     = ;     &%&% ,G = ; 5v   r  ab      "    $9   r P3OP OPOP  *            3"  *     A"1  .     #  ) I  1$ .   @#  /   $( /2 / $  P *- 6        9 :         !    #7o 6* " P *-     6 /   >.  '    ) B .  '  =  (   ( (/  (         .      Z,                     (] : G    Z,      0/0  7   ,  'P               9    ,     '6  l                      M ,   XWX4 %%"%"% ! % " %" %"%#%#%!%#?*B 2 9 9 8 9 9 9 : : 8 :  /.)00/00011/19   "                 ? l )             ? D     $    9 \     "          *  6 ,> M'    ' '    & -  )   % A   =$  NCT [   K ?A@I 5    '  K ?A@I 5 (      = %          "   )Y 6 !  F,, =  *+@,-W# !$#i M        & " %( ') +*+,+,+A. -0 / , Xe[Y e     6    )    (    '     $#   $#         B  K JA@I TK A@I      56    * $1+)-6. 4              ! $#& %( 'B"  P+OPIOP OP " i     $ O \- L " i 'E $   &     K A@I  "*)*      V3 4&E  &           Q  !'     &       $# F   K A@I idc^K B@I L _    KZr   *+?) A @ !             F  o  7      +      -   : <     %  ,  NE'++/  - : <^ 7     `_`_`Bn    X6WX>WXHWX$     u   [ klkl    `g6? $    u  J7    J  popQopop op op op   %    0  WM    g ;? %    0  `b_`j    1( ":S     $         g 3 ( h747  %-(       c o  @ f8      E8    &             /   +  !` "Pl<   ;o  @ f8 (A'( '( '( D      +$.$!D n6s;       ^             U3P-'     ^ pQop$op0opopop;  U D BAM   %&   F-7D '    U n[ 1;  +-  k           - * XOP  ,   ;9u ;)d0' +-    !   ,    hZghghghghgh 3Dj        : D   $3D & ( & &$Ea % K 7zA@I -zy K +lA@I +lkK A@I ?K RA@I RQ) K  BA@I BO    S 4 2 l-_1+',1',1416+8F            %$ %$#( /. /.-a2 10      3    a h i p        : " ->     3=3 haghghghgh O       &  %O  '!$%            ` K SA@I STK  _j@I  _ji`K Dj@I Ljab    - 2+11./ (R  !         `M"MMMM MMMMMMMMMMMMMMMMMMMMMMFMM8MMMM %&&&'%(  *%( F&4]@% 3%           &         K /A@I /      K A@I K A@I      K A@I          K A@I K A@I  K A@I      K A@I                  ,,,, o&.1/#,-.+,E .+,V  6+ 6+P"+ # 4) # %         !"! '& '&%%* /. /.-2 14 36 ;<;> CB CBAF EJ MNMP  WV WVUZ   _f   ml mlkpqpqrqrq t  {z {zy~~                      y= &          K A@I )     .-      ]4)                 )   ) &*     S%,          ,    12&2 ?+         K A@I         7 ,@ 4' ?7-G" S     1)  ) ?  "    "     J Gm) n   %    S8  $ 8S H;<;< A B ?@ =    `&%    S PQOP(  \ukl g  ( %    S(   L PhOP          X!@ "   8l78  [^]    T )U !Z ! N   1  ') 878     ! #  A         #  n8[    q         +c   :  ) '-T'1V 17p (      *r  18!  yg    In 18:G 1F8u& L         - A             +   -     A    Y g   (3(            &  =         56          O        N. - %&/  >:Z4NJ0& N! "!a  - ' 4   V  P       D#/ P ?R ;            /   )* MM&-BJ  ߸ 'w1P 8  +, S1               f    ' #!"     ((  2    '+))3sY'w1   P    0/0/0     %   ! 5    .   &      k   XOP  hu & :9 ! 5 .    ``` 2"    l2          & -!-~2 " %   @ @ @        -,+434   hD%%   1V $ K  3      '$ +    3 8S78 TQR   [    X !A #:  * S  :  "  7 " Z   .       "   B ?r!)    Mvd <   :  *  !ps` s  %' 6S" : h3ghn@V   !   !  ,    "   @ = 3$j      $  > B 3$ xJwxZ$               : ^[\ Y JID A TOP M ;      w<$j      $$? C <$Z    n] 0/0n;;$ ` D0LhdTd@|`\D, |P<lp \  4 <H  , $@ lx 4 H T` `  <$t < XTt(<,|8Xl| X0@Dl(pX p  T ""D8"`"|"4"""$$#t<#T#h#X#$$@$%$%(<%tP%x% &\&','LH'`''<'''((p((8)L)Xt)))@))*$d+t+++d+,,,TT,l,,@,,-(-p .@.T.X./$/<L/00,0|11P1lh11 1\112@02@3T3(|3x33h4`444D6,6H64p666$6t 747L7d`778L88949|49H9p9`:::P$;@;t;@;;;0<|<,<T<dd==DL D E  E$ `El E E FH DF F F, 8T?9xDT9I9LR9SD:S:XT:U;Wh;\;]<`T<,c<c<cT=Ld=d=g(>gt>h>j?k`?k?Pn?o@@t@t@DwAwhAxA\xBxLByB${B{0C$||C}C}D}\D~D$~DX~4E~|E$EF<`F FF$DGGG,0HlH HI0TIlIIl(JxJJܐKdKKK8L<LМLd MԢpM4MM DNdNN`(OxO OPPPlPDPسld>,h>i4?Hk?n?p$@tqp@Tr@vAwTAdxAyAy8BzBP{B{Ch|hC|CT}D}LD~D~D~0El|EE4F@dFFGЃPGԅGG@H0HHH<0III JpJܜJKXKK\K@0L4xLLp M\MMMDN(NN(OtOO P\XP4PP @Q Q$Q$RtRHRHSH`SS0STDTT T$UPtU UVdVV W8 TW Wt W( DX XD XL 4Y YL Y Z `Z Z0 Zl 8[ [ [$ (\ d\ \ ] @]l ]d ]" 0^L# l^h& ^|) _0+ \_d/ _`0 _4 L`6 `< `< aA $bdD tbE bF c0G Lc$ T>$ >% >( 4?\) ?* ?+ @, l@x- @- A- DA . A. A/ ,B/ xB 0 B0 C(1 `C1 CH2 C2 DD<3 D3 D,4 4E4 E$6 E@6 ,F6 F7 F9 G4; lG< G? H? dH@ HTA HB @I(D IF I@G 0JH JH JdI KI \KXJ K(K K@L LLM LN LN 0M`O MO M|S NS lNU NV O4W POW O\Y OY 0PLZ P[ P|\ Q@` pQxe Qj Rm `R$n Rs Ss `Sv S| TT} XTt T TH PUĂ U U 0V Vp Vx W dWP WЎ WX @X< X Xt ,Y xYԒ Y Z, `Z Z Z H[ [$ [D 8\ԗ \\ \ܘ (] x] ] ^ h^ ^ؚ ^ H_ _М _ `؝ h` ` `d ><? Bܳ C,4DxDдpH HlxIJ J\JKK0LlLLxM@TNNظNO`OxPQDSlTV4WWȻX YXH[D\$]D^_xa0c|cľijd,rtwLxyz0{|ȅlDTD( 4ȭ$DppHlX<pH,4(X lp\HDP( t|8H8T<t  d "L$PP&(4)@),-$5t(5888P4::T<DBHCC<F@JK$Nt|OO(PLPpQ0R,RlW(YYTl[]],^TH^`^^,^|_P__lD``aDbhccg`4ijkHm,o@o,px8rrrXrsLt4tuhvwdxy0{H|}~,||lԄpPЉx@008 p4L`tPd@0D` p`ܰ$P$@hػ0$Hl p$`(P\(@,HxL\$\H lD`X@X0( tpDLht(x`$T+ 2H\45749,ux |{px`(D |  `( t < Ğ p\  | D \ P , |  $lpĮ \hDT4 $tH`T<\H|4x\,P@H,(xhtXH@d0tPL l8X`$D0< , |  X!l!!"X"P#"$",D#/#6#C0$F$DI$I%4Lh%Da%b&oT&o&`q&4wH'Dz'z'40(x($($) T))`) @**H*0+l|++,`,,(,(H---,.x../\///D0h0@0t0111$ 2l2\2 3X3X33D444h(5x5 56hh667XT7077t888|8X(9x99\:h::<;P;;;@<T<<=\X==t=H @>>>(?`??X?t@@@@A`AAA4F$?F`KF\L$GMtGNGOHpPhHQHQIPRXI|SITI4VHJWJWJY0K([lK[K\L]LL^LH_L `M`LM`M`Me$NhtNhNpiOi`OiOiOi,PipPiPkQkXQlQnQo|H?|@0}D|}H}H~Id~I~I~J@TN,ODP0QLR̀R\SdLTT,UPUTV W<,WhW܃W,W|0\̄D\d_`_X`dcLpdgDhD\i|iЇjj`knoPDpqs<uhw܊w(xxxzȋz{`8|~H,xȎh \D؋H(088<ܑؒ<(@xHȓPXhTܥԧ0DX4̰xȗ Xd\p<Dؙ(xȚ p@țh@8t؝<(dxО pp$ XD`@,`Xh8hX8<ThĤ T @Pܦ<,dxȧ`P\<8̩X%%X&$''D,(L((4\)t)̬**l$+<++T, -$-<H-l-ܯ.(@.t.4/ /X/00<P1h1Բ2 <2l33 4\5h6@7L77p808|9̶:T;h|; <P<L=D=D>4P??й@@l,ADAAT`BB C<C`DܼD(DtEĽ>>8?|?8?@(l@@@dHAAA0BlB(BԞChCDC DTDDDD@EEXE,F|FtF$GlGGHPH$HH8IXIIJhJJ<K`PKKK<8LLLD$M̹tMpMN`NN<NPHO OпOt,PxPPXQhQxQRPRR0R4SS,STdT@TTHU<UU,VPxVVWL\WWWx@XDXX(YxY$YZ$dZZZ H[@[T[l,\p\\]`]4]\^xP^^^@_ _8_P,`dp``aTaa a n?n@HoLAoFo4I0p JpXKp4U q(VhqdWqWqW|>ȯ@Ad`LMNLO PQ4SUв|W YpZ[ t\X ]l^dbDLfgpl0|m|,r̶r$(spsu z\ ȅLȈ$<Tpܺآ,hԻh$|̼HlĽdX \L0 L0<  4 !4(\))4(//3,t46H8 h>p>\DDpI\JShdfLiXTj\k\l,LmpLnoDpD,qqr,4sxsptt\lu vv@|wxx($yty}`4X<xؐ8\H̕@Ĝ,|dH0x|H0dlT|$8$lh,P|444h,L404d4H|(p,X,@H0|`|H8\T`|8X( 8h8,P T  <p(t`h X!%H,*1H^8(_`c$Lkt`ppppTpqq(rt4sPt tXwxy@z{4$tȅ|Tx@lؕ,|l`T <4 (tl`` 4H88@ xl`X,Hh 0tp<P(x4`  @ 8 d 0     p x" $ (T h* + +@ , 4- 30X79; >p|@@ DAX(B CG0hOQtS T\UW[Hl_aa0b|clhihm8rwX0yy{D؃ԅ40$̐ttdTة@@ԬȲlXTD(Ը8dH h ؾ !@!0!h!H"$h"(""@#|##$T$H$($0%l%%&D&(&&H4'''$(`t(8()d)l)(*T**\*D++t+(,t,D, -`X---4<...L /l//80P0d00p4111p2(d22T2( <3 3 3 4 \4 4P 4855x5$64t667(`777xH8!8$8$49X)9)9*:(+`:+:x,:-H;.;P0;P18<L2<2<3=<3\= 4= 4=`<8>D>I>O(?Sx?V?X@\h@\^@aAldTA fAfA`g@BgBPiB Y> PYB Y0G Y8L @ZN ZO ZPT 8[T [hW [\ 0\l] \(_ \Da (]a ]c ]d ^g p^`j ^j _hk X_k _l _m @`m `hn `o $ao ta`p aq bq \br br br LcHs cs cPt !8~t@!~B!~E!$\I!tJ!(N!tP!dlU!U!LV!TPZ!Z![!,\!|]!̂_!`!la!b!c!P d!d!8e!<e!e!܅hf!,f!|pg!̆g! h!lh!8i! i!\i!Dm!@n!Lhn!o!o!<Hp!p!Ԋq! 0r!l@s!Ht!Hu!Tv!w!x!8y!z!ԍp{!$|!tp}!ĎH~!$!`!ԁ!!D!\!ܐ!,!|!̑!܉!d (&> 8*&> +&$? -&t? 8/&? 0& @ 2&X@ D4&@ 4&@ 6&&`C C&C E&C F&LD LG&D H&D lI&0E J&E N&E O&F P&hF R&F S&G `T&LG Y&G Z&G \&8H (^&H x_&H a&(I a&lI d&I e&J h&TJ i&J j&J j&8K k&K `m&K 'Xr A'r C'r D'Ds E's tF's F'(t G'tt H't H' u pI'\u I'u I'u I'Dv J'v @J'v J',w J'xw J'w J'x 0K'\x `K'x xK'x K'@y K'y K'y L'(z HL'xz L'z L'{ L'\{ L'{ 8M'{ hM'@| M'| M'| M'$} M't} N'} PN'~ N'\~ N'~ N'~ O'@ @O' pO' O'$ O'p O' O' P'X XP' P' P'@ P' Q'؂ HQ'$ xQ'p Q' R' R'T hS' S' hT'< T' |U'؅ U'$ V'p 4V' V' V'T `W' |W' W'< W' |X'؈ X'$ ( A(\ A( LB( \B(4 lB(x $E( pF( |I(d X( Y( T,D> d,> ,> , ? ,l? ,? ,? `,H@ @,@ ,@ ,4A ,A @-A -B X-dB -B -B h-@C -C -C -D -`D -D 8-D L -DE -E -E D-@F -F p-F -1؞ t@1( B1x C1ȟ H1 N1` Q1 S1 V1P W1 X1 ,Z14 Z1 Z1Ģ `\1 `^1\ c1 |i1 x1H 1 Ȋ1 @14 ؒ1 Ԝ1ԥ P1$ P1t 81Ħ Ƚ1 1` 1 1 `1L t1 ,1 18 1| 1̩ 1 41h 2 2 <2X .2 :2 8B2H E2 lK2 V28 X2 X2̭ [2 (\2l _2 `2 c2\ $f2 q2 Ts2H 02 2 028 2 2Ա 82$ ؆2p 2 82 42\ X2 2 А2D x2 42 2, 2| 2ȵ t2 2d ԝ2 2 ̢2L 2 D2 P20 2| d2ȸ H2 \2` 2 \2 x2L 2 x2 L2< d2 2 24 2 p2м d2 ,2h 2 2 2P D2 2 42H 2 t2 28 ,2 |2 2 2l x2 2 2P 2 2 @28 2 $2 3( 43x 43 t3 3` P 3 3 <3D 43 83 H30 X(3 *3 P,3 ,3l $-3 33 43X p43 P63 63< 73 83 `93 t;3p `@3 C3 E3` $H3 J3 XL3P M3 `O3 P3< Q3 T3 T3( V3x W3 `X3 ^3` ^3 _3 ``3< `3 a3 4b3$ b3p lc3 d3 d3X Te3 e3 hf3H Hg3 0h3 h30 i3| Pj3 k3 k3d (l3 l3 Dm3H m3 n3 o30 o3 p3 p3 p3T Ht3 u3 Xv3L |3 3 H3D 3 3 t3 3< 3 Ԇ3 3 $3d ܈3 D3 3P 3 3 p38 (3 3 3 Ԑ3p D3 3 D3P 3 В3 30 3| 3 t3 3d 3 3 3P ܜ3 3 p3, 3p 3 3 3D Ԡ3 3 43 H3d ̡3 h3 3D 3 3 ԧ3( X3x H3 l3 3T 3 3 038 3| 3 3 H3T 3 3 43D 3 3 34 3 P3 3$ 3t 3 @3 3d 3 D3 3P 3 3 `38 |3 t3 3$ x3p 3 43 L3H 3 ,3 3 @3l (3 3 x3X 3 3 ,3@ 3 $3 3 3X ,3 3 3D 3 3 34 3 3 43 P3\ 3 D4 $4H @4 ` 4 $44 D4 X4 4 4\ 4 @4 T40 4 4 4 4p X!4 ,4 p.4` .4 .4 `/4P 04 04 048 D14 \14 24 24h 24 24 x34L 34 444 L440 44| 54 54 54` h64 64 $74D <74 74 74( 94x :4 |:4 :4h ;4 ;4 D<4L \<4 <4 =40 =4| =4 p>4 >4` A4 A4 B4< G4 _4 Te4( $g4x g4 Th4 i4\ 8j4 8k4 o4< 59 ?5L: @5: A5: PB54; B5; B5; C5< lD5`< pE5< F5< F5L= G5= XH5= J5<> K5> pM5> N5? P5l? Q5? S5 @ T5X@ U5@ W5@ W5DA X5A [5A [5,B h\5xB \5B _5C _5XC |a5C a5C Tb56D~ >6~ >6~ ?6  @6l XA6 A6 B6\ C6 D6 D6< D6 `E6ԁ XF6 F6p G6 XH6 I6` I6 I6 8J6< K6 L6Ԅ L6$ dM6t ,N6ą N6 |O6` O6 P6 P6< Q6 pR6؇ S6( S6x T6Ȉ W6 :P: |?:: A:: ,B:@; B:; C:; G:(< G:t< I:< I:= L:l= P:= R:> R:T> S:> V:> Y:@? \:? `^:? c:(@ 8d:t@ f:@ g: A h:\A xi:A i:B `j:LB j:B Pk:B (l:4C m:C m:C n:$D To:tD o:D p:E q:`E q:E r:E |r:DF r:F r:F s:G Ht:tG u:G v: H {:\H :H @:H X:@I :I :I ؄:,J :xJ P:J :K p:\K $:K ,:K :DL Ċ:L L:L :M X:@M h:M :M :8N H:N :N : O |:lO D:O :P :lP (:P :P D: >P > > >4 > >̮ > |>d P> 0> T>H l> p>ذ >$ (>p |> $> >X > 8 > #>< T&> &>ܳ L->, |K>| lP>̴ @Q> R>h hT> d> te>T f> Tg>@ h> i> j>0 pn>| |≯ l> x>l > t> >\ $> t> <>L X> 4> 0>8 ȴ>p t> > >\ > > >< > >о > >l > > >\ > > >0 >| > h> >` > > ,>< > t> >$ |>p > > >< > > t> >d > > >P h> `> $?4 ? ? ?  ?h ? ? ?L L? ? ? `?h H? ? x?L \? ? ?0 `?| &? *? +?l $.? /? 0?X 1? 4? 4?< 6? x7? 9? p:?l ,@ >@< ?@ @@ A@ B # >BX# >B# ?B# ?B<$ 0AB$ tBB$ BB,% BB|% CB% LDB& DB`& FB& HB& JB<' KB' LQB' TSB ( (VBp( 8VB( VB) WBL) WB) XXB) YB(* YBt* ZB* x`B+ bB\+ DeB+ eB+ mBD, xB, }B, B4- B- ̅B- B$. Bl. ̍B. B / БBH/ B/ B/ pB(0 XBx0 ܔB0 ԕB1 Bd1 B1 DB2 BL2 B2 PB2 (B3 ĝBP3 |B3 TB3 ԠB4 PBh4 B4 pB4 УB@5 lB5 B5 @B,6 B|6 B6 B7 BD7 B7 DB7 B48 (B8 DB8 xB9 Bh9 B9 B: pBP: XB: B: hB@; B; B; 0B< Bl< B< dB< 8B@= @B= B= 0B0> B> B> LB ? TBl? B? B@ @BT@ dB@ 0B@ C8A CA CA <C B hClB CB C C  CPC CC CC (C@D `-CD .CD (8C0E =CE ?CE ACF DChF xHCF JCG LCTG MCG RCG 8YC@H 4]CH 0aCH aC$I fCpI $jCI jCJ \lCTJ EP \?E DE LE< tME HOEЄ PE PEd QE TE UED VE LYE [E4 [Ex ,\Eć \E \ET \]E ]E gE< gE jE؉ ~E( Ep EȊ 8E Eh E ܎E EX dE ęE XEH E dE xE8 Et dE E tE8 \E ıE؏ ̴E( 4Ex EȐ \E PE\ E E 4E@ E XE dE0 E TEԓ LE$ (Et E̔ lE Et E (E E` dE E Il>I8@I4AILDIEIGI8hGIxGIGI 0HIXHIIIJI4JIJItKIKIXLI,LILI4LIxMIMITNITlNIPIPI4PIxhTIUIUIXYIxZI[ID\I,\I\IPaIhaI(bI`bID`fIiILjI0mI4pIrI rIdwIyI ~IT I $I I@!DI!I!4I0"I|"$I"@I#Id#ؑI#tI$IH$ДI$I$,I,%DIp%I%ԗI&XI\&I&I&hID'I'I'I(ОIX(xI(I(̲I8)lI)DI)|I(*Ix*dI*I+TIh+8I+TI+IH,HI,`I,I(-4Il-I- I.IT.I.I.I@/`I/I/DI,0Ix0J0J1lJL1PJ1J1J<2L J2,"J2 $J3%Jd3&J3(J4)JT4+J4+J4p,J<5<-Jx5-J5 .J6$1J`61J6|6J6=JL7BJ7CJ7DJ48xFJ8HJ8\JJ$9(KJt9$LJ9MJ:NJd:OJ:(PJ;XJP; YJ;cJ;dJ4<fJ<hJ<`nJ$=(oJp=xJ`>t|J>J?JP?J?4J?̇J,@Jx@pJ@JAJlAܗJAJB(JdB JBĝJ CġJ\CJC$JC@JDDئJDpJDJ EJpEJE`JF\J`FdJF$JG$JXGJGxJG$JLHĺJH8JHJDIJIJIHJ8JJJ8JJJ$KtJtKJKJLJPLJL|JLTJ8MPJM KM K$N,KpNKN@KO,KXOPKO,!KO|!KDPD"KP4#KP#K(Q$KtQ'KQ'KR)K\RGKRJKRJK0SKK|SKKSPKT\QK`T\SKTTKUUKXUlVKUWKVXXKXVYKV[KVX\KM?M<P@M@MȐAMBMd|EMPFMGMHJMKMLM8LMMMOM0OM0QMؔQM0UMfMЕhMhMXhM|jMjMdnMloM$tMuMXvMwMLzM8{Mp|Mԙ|M~M\<MXMhM<xMM̛MMP@MMM4MTMܝ0M(ܕMxMȞpMMpM0MMhM,MN>NHP?N?NAN0lDNENEN FNp8HNHN|IN` JNJNTKNPKN|LNMN<NNNNxON(8PNtlQNQN@RNPRNSNSN8SN|hTNTNUN\UNVNXNLYNpZNZN0D[Nx[N\N\N`X]N]N]NH`^Nx^N0_N0$`N|`NaNTbNh cNcN|dNPeNeNfN0fNx4gNgNgN`8hNhN\iN8jNjN`jNjN`kN0lNDlNHlNmNmN XnNllnNnN nN\8oNoN|pN<0qNLqNlqN,qN|qNTrNsNdsN(sNlsNHsN\tNtN0TuN|vNvNvNh0wN`xNxNTlyNyNzN8 {N{N0|N}Nl~NNNTHNNN8`NTNЄN LNlN؆N\NT,NNxN@HN0NN,N|܍N̎NNlNNNHNNԒN0NtNOD%>O%>O%?O&@O`&0@O&`@O&AO4'GO'0MO'MO (xNOp(OO(OO )PO\)QO)RO)hSOD*HTO*UO*UO(+VOt+WO+D\O,]O`,4_O,`O-aOP-aO-,bO-|bO(.cOt.cO.8dO/4eOT/eO/fO/mO<0\nO0nO0doO 1$pOl1TrO1sO2xOX2|O2ԂO2OH3O3O3O04̌O|4O4O5Oh5O5 O6̗OX6O6O6xO@7ܝO7\O7O88$O8O8ԯO 9Ox9O9̽O:xOp:O:@O;Oh;O;DO<Oh<O<O=xOP=4O=LO=O0>Ot>(O>O?8OL?hO?O?O @Ol@O@XO AO\AOAOAOHBhOBOBO,CpOxCPO>PO@PR>RЇX?RlDRh,ERERGRLGRHRMR0NR||QR̊SRlWRdxXRYR`RL`bRcReR0gR iR̍iRoRhuRdxRyRTyR|zR{R<\|RRؐxR$@RtxRđTx?TȷCTXDThQTZTfTXgTjTlTHpmTmT̺qTvTlDT$T T\TdTTLtTtTT$PTtTľ(TTdTдTжTTкT TPT@TThT0tTTTTThTlT0TLpT,TT0T|TLTDT\TTT@TtT0T,dT|TLTTlTpT T\\TTTLU8UU@< U UhU0UUh6U 7Up>UQURU\eUkUlUHnUqUsU0uUwU{UUlLULU UXU0UXUHV@VBV@HDV4GV8KV0KVfVLgVmVh|nVltVvVPtVVV@VХV$V0V|еVVXD>XEXFX@GXGXHX8IXTJXKXPXh|RXSXjXPrXsXuX8wXxXDyX yXl<{X{X<|XD }X}Xl~X,xX|8X X Xh X  X XT X hX X< ܆X |X X$ lXp hX HX ,X\ X \X DX0XlXXXT0X`XاX@hXܬX\X,X|XX`XdxXܽXTXLXX4X8,X@X0X$\XtXXXdXXXPTXYY<Y, Y Y  YlX Y Y YP\ YYY8$YYXYYT YYY<Y YY("YxD"Y#Y#Y`%Y%Y&YD X'Y (Y )Y0!)Yt!)Y!*Y!*YH"*Y"+Y",Y(#-Yx#.Y#d.Y $4/Y\$@0Y$0Y$1Y$%2Yl%2Y%2Y%,3Y@&`3Y&3Y&3Y0'4Yx'44Y'd4Y(4YT(5Y(P6Y(6Y@)(7Y)7Y)8Y(*8Yx* 9Y*9Y+9Y`+`:Y+;Y+;YL,|Y->Y .4?Yp.?Y.@Y/@YT/8AY/BY/BYD0CY0DY0`EY0EY410FYp1@HY1IY1xIYD2JY28TY2YY03tZYx3ZY3ZY4ZYD4ZY4ZY48[Y5]Yh5_Y5,aY6aYT6bY6LcY6cY<7eY7 gY7hY(84jYx8kY8,mY9mY`9TnY9nY9rYD:xY:xY:(yY,;yYx;PzY;zY<H{Y\<8|Y<l~Y<YD=Y=Y=Y$>Yl>\Y>܃Y?YP?XY?(Y?Y@@Y@Y@Y(AYtAYAPY B̜YXB\YBYBY@CYCYCY$DYtDYDY EYXEZL\?Z\P@Z\(AZ0]AZ|]BZ]CZ^\DZ`^4EZ^FZ^FZD_GZ_|HZ_4IZ(`JZt`JZ`KZ a@MZXa OZa0PZaXQZ@bRZbSZbUZ$cHVZpc|WZcXZdYZTd[Zd4\Zd`]Z8e^Ze_Ze`Zf$bZhfXcZfdZgeZLgfZghZghZ4h|kZhkZhkZi@mZdi0nZioZiprZLjsZjtZjtZ0kvZ|kvZkwZl,yZ`l@zZl{Zl|ZDm}ZmX~ZmlZ0nZ|nZnPZoZhôZoZpZPplZplZpZ4qZq4ZqZrPZdr܉ZrlZr8ZHsZsZsZ,tZxtZtLZutZ\uZuPZuZ@v]#\?],$@]|$@]$A]%P]h%U]%`]&e]X&8e]&e]&0f]4'g]',h]' m](n]d(s](Xs](|x]H)p{]) ~])]4*p]*D]*] +D]p+]+] ,؏]\,],\],]H-]-]-]8.]|.0].]/]h/d]/]0]T0ܷ]0]0]41]x1T]1]2X]L2l]2]2],3`]|3]3]4]h4]4H]4]H5]5D]5X](6]x6^6 ^7\^d7^7^8X^P8d ^8 ^8X ^<9`^94^9^,:8^|:^:p^;^d;^;,!^;@!^8<"^<"^<"^=<(^P= *^=H.^=/^<>0^>1^>4^(?6^x?@9^?;^@<^d@$?^@T@^AB^PAI^AL^AO^@BO^BS^BV^$CxW^tCY^C([^Dx\^`D]^Dr^Dz^LEx^E̛^E^8FĠ^F\^F<^G(^XG,^G^G^DHH^H^H^I^`Id^ID^I^HJ(^J^Jd^4K^K^KH^L@^TL,^L^L^@M<^M^M^0N^|N^N^O^PO^O^O0^,P^xP _P8 _Q_PQ_Q_Q_@R_R _R<_S#_hS#_Sd8_S8_@T?_T?_TF_$UF_hUJ_UJ_UbP@b@b Ab0AbtBbtDb Hb\Kb`ObTQbHQbUbVb0pWb|Xbbb dbdcL>ct?c@c 4Bcp@DcHIc PPc\hUcUcXcLT[c\cL]c4,^c,cc\hchchdic@jcpjcDHwcwcyc,zcx|c@}cc\`ccDc@cc c$cpcccLcԕcc pclcDccHcXcܙc,ԛcx$c@cdcTܥccc0ԦctLcpccPЩcd&>d&|?dL'@d'@d'TAd<(Bd(@Bd(\Bd$)Bdp)Bd)Cd*,CdT*hCd*Cd*Dd8+Dd+Dd+Dd,Ddh,Ed,Ed-tFdP-Fd-Fd-Gd4.,Gd.HGd.dGd/Gdd/Gd/Gd/GdH0Gd0Gd0hHd01Hd|1Hd1Hd2Id`2,Jd2Jd2QdH3DSd3Td3,Ud44tVd4Wd4HZd 5l[dl54\d5d]d6]dD6,^d|6vd6(wd7wdd7d7Pd8dL8d8xd8ԏd(9dx9d9Đd:dL:0d:d:̕d$;ܕdh;d;d;d<<(d<d<ԝd$=dp=d=d>ddT>d>`d>Ld@?d?4d?ܵd0@(d|@d@ĹdAddAdA$dBdLB\dBdBd,Cd|CdCdDd`DdDdD dg{|?g{$Bg|Bgd|Bg|Bg|Bg0}XCg|}Gg}hIg~Lgd~tPg~Tg~VgHZghg,jg4Plg`lgĀHogqg`sgugxvgLvgvgԂyg$(zg|{g̃|g~gh|gg,ghgglg`ggdg`ȏglg|gLggԈ̓g$$g`g$g gXg g(gHgg g8İgg4g0(gtgdg gPg@gPg(gxgg g\\gggD$ggHg0xggĒg@g\ggg<DgxgĔDg`gTggܕXg,ggܖjd>8j>Dj?jL?@j?dj?j<@Tj@ j@j,Aj|AjAjB`klBkBkB4k@CHkClkCk(DxktDkDkEdkPE,kE kE k$F@ kpF kFkGXkdGLkGHkH`kPHkH`'kH*kDI4+kI.kI=k4J>kJ$BkJ\Fk KJkpKLKkKLkLNkPL|PkLnܞ4?n(H@nxHAnȟCndKnhKnKntLnD MnNnܡ4On(OntPnPQnTn`TnUn4VnTWn\XnYn@8Zn[nx\n4<^n_nЦ`n$cnthdnȧ|endjnh8nnononHpn|n~n8~nnتn0xnnԫn nhԚnnnH nhnԭܠn(nxnȮĪn HnpЬnLnn`n,nnXn̳nnHnn`n8n,n@n$lnpnn0n\nHn,nDn|nn0\n|nȷXlqX>lq>lq>mqD?0nq?Dnq?`nq$@xnqt@nq@nqAnqXAnqAnqAoqrg>r8h ?rthCrhDriFrPiPGriDHriHrjxJrPjJrjPNrj4Pr,kPrhkRrkTrkUr4l$XrlYrlZrmZrLmX\rmermfr0nfrtngrnjrokrToqroptrovrDpdwrpxrpxrqxrXq}rq~rq~r@rrr0rrȎr srlsАrsr trXtDrtrulrXuLruru8rDvrvԬrv`r0wxr|wrwXrxhr`xrxdrxTrHyrydryr8zrz8rzr {r\{lr{r{rL|r| r|4r$}Prh}dr}r}r<~r~r~r rTr$r@r$\rhprrr<rrȁr rTr0rLr$`rl|rrr<rrԄr rlrrrPrrr0rtrćr rXtܩt,t|Tt̪t tl0tt 0t\ptttDuluح u$upDuuuTuuu8puu԰ u$ "ut@#uıt$u%ud&u(uD)uT*u,*u*u8L+u<,uԴ,u d-ul-ux0u1u@1u|08u̶>u?ul<@u@uBuPBuBuظDu(EutFuĹGuHudIutKuLuTNuOuQuDQuRuPSu4HTupUuнLVu lVudWuYu$Yu@DYuxYuYu0 [up[u[u[uT[u[ul\u(]ut]ul^u ^uX_u_u_u,_up,auaubuD|bubuLcucu4dupduduTeu$eu`$fufuphu ,iuliujujuHxp$0Ax$Cx%Ex`%|Gx%Lx&TNx<&HPxx&8Qx&Qx'Rx\'Sx'\Ux'pWxH(Xx(Yx(Zx@)h`x) ax)bx8*lcx*fx*@gx8+gx+mx+Lnx8,px,qx,Hrx0-sx-D~x-~x(.dxx.x.x/xl/x/x 0x\0`x0x0$xD1ܚx1\x1`x(2xt2x2dx 3xX3Tx3x3xH4,x4x4Tx05x5x5,x 6xp6x6|x 7 xX7,x7\x7xH8x8Px8x89x9Dx9x(: xx:4x:x;x\; x;(x;x0<x|<x<x =xX=8x=x=Hx<> x>x>x ?xl?x?Px@xP@@x@xx@x@AxAxA@x(BxxB|xBxCxhCxChxDxPDxDHxDxx@ExEIP>I>(I>0J,?LJ|?J?J@Jd@J@K@K@A LAm,?@n@n@npB,oD|o$EoEpGlpJpJqKTqLqpMq N8rOr0PrXSs ThsVsWtXPtYtDZt[@u\u]u`0vc|vcvLdwe`wewfwhLxkxHlxml>>?P???@h@@A PAAXA@BB B!0C)C,C\/ D/lD1D5 E8\E:E0=EL=@F=F|FF4I$GHJlGJGKGXL@HLHMHW(I(XdIXIl_Id@JiJlJp0KvK4wKy L|\Lt~LLLMMM(NxN\NOhOO8OhDP(PP4QQQQLRLR|Rر>,d?x?č@A\ABB@4CC؏PD$DplEEFTGG$H8H@IВI\JhJxKLLLMM0,N|NȕHWD>W>X>X>X4?PYp?Y? Z?Z$@Z`@X[@[@(\A\PA\A`]A]B0^@B^|B_Bh_B_0C8`lC`CaCpa Da\D@bDbDcExcLEcEHdEdFeHBGP8P|S̍(Z^lT`a c\dd4otpLrPst4LwxБyt}lԍXDࠌܔġ( xĕгdxоPČnjɌ88ʌt͌Ę͌ΌTό4Ҍ<̚hp40P8   ,| x ȝdpd <ܟL , p" "@"Hd"t"С"$#d4#D##8($$ԣ|%$%h%'*LX-//0(0<0ĦL12d334<869ܨ<,>|>d? x?P?@,A4@AxAīBBXDEGHMDN@O0R|T̮UVdY`(bT djo@\q4yz0|}̲~~dX8H,xx4ĵ`|HL0|ȸt<d|p$TX<8ܻ\,xļdXHÍōƍ4hȍ|ɍԿ\ˍ$h̍p͍ύҍ`0ԍՍ֍L\ٍڍ܍<|ߍ,`|Xh,(T$D,xP\D4$p(|T$ x"$8'l)x+8,h-/1X223858;( ?x?BPC``F,G`@GPKMN<OP\Q TpTX PZXce oHrz{4$́|$Lt܉h`ؠ,L즏4Ԫ誏\$8L4`|t Tīث,쫏t(L<Pd$xlDȬܬd,@<Th| \   ̭4 ୏|   T 0 D X, lt   L  Ю 䮏$l  4DH\pd<ԯ诏\$8L4`|t Tİذ,찏t (\ȳHLD<d0,й|8ȻlHȼ H\住x̿LT<hÏÏ,ď||ŏHƏǏlǏȏ ɏ\ ʏ pˏ ˏL!̏!4͏!Ώ<"Ώ"XϏ"Ϗ,#Џ|#я#ҏ$(ӏl$ԏ$Տ %0֏\%֏%׏%؏L&Tُ&ڏ&ڏ<'ۏ'd܏'tݏ,(Xޏ|(ޏ(ߏ)l)) *\**4*L+++8,,4,$-Dp--.\...D/ //,,0Hx0L0,1 \11P1@22 2h ,3 x3 3 4d444H555,6x667 \777@88 8!(9#x9%9 ':(`:*:+:,H;-;:>;><,?(?x?D@?|A@C\@4D@E@GDAHAIAJ(BKtBLBLCLHCMCXPCLQ,DRxDTSDSET\E UE VEV@FXWFDXFX$GYpGZGZHd[TH\H\H@]8I^Ix_Ip`J`hJaJLbKXcLKdKdK|e0L,f|LfLgMh`MHiMjMkDN`lNmNm(OntOpoO p PpXPqPrPs\x>xBy OTy8OyOyR0z SzxSzT{el{n{q |%(DT%`F%dH%J8&0M&N&P'Rh'T'V((XL($Z(L\(^0)8`|)lb)d*f`*h*hj*xlD+xn+p+r(,tt,v,w -|yX-h{-d}-`<... /臗l//0썗P00041,112ld2蝗2؟2XH3أ33 ,4x44$5\5`55@6ൗ6ܷ6h$7 p7<˗7З8ח`8ח8ؗ8 ٗ49ٗ|9$ڗ9<ڗ:@ޗT:ߗ::8;(;l;<lh<<=L===0>|>>L?`???D@ @ @p (AtAA BXBpBBHH@HA,IHCxIDEI\HJJ\J MJNJP@KRKTKV$LXpL|ZLL\M<^TM_MHaMc8NeNhNkOlhOnOrP$tLPuPwPy0QT{|Q}QLR`R@RR䇘DSSTS(TxTDTܕU$`UUUDV VPV(WTtWԧWP X̪XXXX@$u@puAu\CvDTvEvFv$H8w|IwdJwKxTMhxOxPyQLyRyTy`V0z4W|zXzY{Z`{[{]{_D|4`|a|lc(},et}f}g ~i\~$n~nsThtpvwT ||LDX ԍ0|$ԔX̕<Ѕ<hD8ĥxԇX8dP|H<غ콙Ԋ`(|̋ `͙p͙XΙϙDЙ(ҙ܍ә(әtTԙĎՙיdؙڙHޙTޙD, tPDhp4P<DܕD(|tl P<Xܘ(xșt d   T  0 8L  Ԝ $hpd 8\h@(؟$tĠ\P@$آ@$p4< H\$@8$إ$@pp<  T4!P!"8#@%Ԩ)$)`*+H-D./0,01x1ī3l4LX6H8`98 ;;Эx<<h=0>>Ld??@0HA|`AȰHBhIPOQܱS,dU|`W̲]`hadkTnLru@,y{h~0Ȁ̶́臚ThДL D0<lع(x8ĺ$``$Ě ǚLʚ(К՚<T֚֚ԽTٚ$dۚp Xp <D$p,H(h($h,<(  $(x`` HT4\(()4*h*$15`t689L<NO,U|V$WWL$YY\b$bpgjm\qqvLwH{|8,~xP̄P p` P0ЖxPė \ܚL $8|ئhTD<@p,|0X\Û@|ělśƛ ƛXțɛ|˛H̛PΛtқ8֛TڛۛܛTHݛݛߛ8D ptDl8hd (\\\dDd(llLd@  (xTD<,% %l@+X,-P.d/@1@12(9,D;|X?GGdJJLLUhY[8^P``(bxc4ii`mpqLtrsv84wdx@yzhT|D}}L~xp4Ђ셜$ȈpЋ \hH|L4$ࠜ$(tP$`ȮP\<((Dx œĜŜdƜǜ ȜHȜ<ɜʜ,˜x̜,͜Μ\Ϝ0ќќ@XӜ(ԜԜ$ 8՜p T՜ (ל ל\ ٜ pڜ ۜD ܜ xݜ ޜ0 ߜ| H  d  @pP4l@$`0dThpP8x$phT@@4$pdT0t8|$$<pT8 <   h <  L  l4 d 4  H!T! !,"xx"$"#`#P##HL$$$$0%`|%%T!&%l&&&`/ '4\',:'DB'HL(lO((P(_8)li)n)s(*tx*u*Lv+lvX+v+w+w8,`x,{,t}(-x- -.X`. .(.L/С//<00$0з,1,|1Ƚ1H2h2ĝ2 ǝ3ǝX3ȝ3ʝ3˝D4̝4Ν4Ν45ϝ5ϝ5ϝ 6НP6Н6(Н68Н7HН`7Н7ѝ7xӝH8ԝ8,֝84ם49<؝9؝90ڝ:ڝl:Lܝ:ܝ;ݝX;ޝ;ߝ;D<@<<,=@|==> l>X> ?\??x?(0H@9@p:@x@8ABACAE B|FpBGBpJC`M`CRC SDHUPD0WDPZD\@El^E`Ea0FDc|FdFgG`hhGjGlHoXHuHvHwDIyI\zI|4J}J~J$KtKLKL`LLLT?$@pxABB\HCCFHGKO8QRS(@Ux\UlU|UDUUUUTUUV0XYXZZh[H\]LT_`|a0Xb|Xcdjln u yX@zz|<|4}},4~|~plx XЇpD4, |ܕllH (\ě4ԛx䛡D4T蜡d잡쟡PDܡ4ԧd<쬡P@칡0x 迡p¡á`ơPΡϡPHС0ѡxԡ8`աաX֡$֡pססء`lءءء8x١PڡPۡ HܡlܡݡXtH08 P `@ @h(xHXddT`0X< T , x  L l @ p< L =  > >h ? @ 4AH A B dC, Dx  E E8F`FxG HDHII X>>>H???@h@ @8@TW> X?lX8@XAYATYBY0CYC>lE0hMx,NĖNO\(PP\RDSHTؘU(\x]ș^8_hflgoXqruDHx}4TXН܎l HH4,ĩ̠8 Hl `DP켥lĥƥD@̥եLإ4ڥ<ԥ8 lPXX @بHTlܩ,%|X&ȪL'.dl.0t2L9\BC8YTZȭZ[X\\Ю] ]H ^^_`8c@dذd$hti0no\|tu,vL{p|}<ăܴȆ,4|䔦̵l(ț \`L <Dܹ,L|̺ĦlƦ˦ ͦ\|ҦPԦئL٦ݦݦ8ݦ|pަ (H̿p\d,<| %%`/06<7:@N,PxWZX[lij m`n$p|yL |~4||܄0h̊ЍlXD|PHH$l`Dh($`hħħ<ʧ4ЧЧԧh<էܧݧ@,@l \HT0|ldd|(LHp80 PlhT <@`Ph(4  x d< d@$p T(0X|`  D!"t#(h$tD%%%(%t&&&<)d,.$ /`t/ 088;<==T >0>pA,CxLGJhM`xQ@SWPX dP؀L(<HTl,<x4앨`d$TT$PpT\̹๨ Pp콨tè ʨ\pΨΨLҨ0Ҩ|<ӨӨר`ب4بܨ8ߨ4hT4|D Td,T\0tdP``0  @ |0!"h8##H$,$hl&')X*,d/@/L010L39D;;L@=@B8 D $D 8D E` |H xL NP Q S U@ ,V ,X 8Y, HYp XY [\P]]]$d`tHaae`Dg`ijHmmo0pPppqdtutuLuPvv08X Pp\өtԩ`թةީ<\ީߩ,tH,`xDd,|x\&l<8> ?PCH`H8IJJ LKl 0L 0O !OX!P!P!P<"xQ"$"̪(#Ъx#Ӫ#t$,h$.$0$<6D%<%,=%d>4&l?&?& @'Ah'C'LD(DP(4E(E( F4)|Fx)ի)Xe*\l`*q*\ʬ*H+x+d +'$,,-t,T.,0 -X1\-7-h8-9D.:.@;.\>0/>|/A/A0LDh0L0R1$SX1TU1(b1bH2Lf2dg2dn83n3q3`r 4xp4py4z5{X5H|5`5@666H,7Ȍ|778Ll8l8 9\9d99LL:ة:L:,$;t;в;p<d<4<츭<xL=H==­4>0í>í>ƭ ?Tǭl?ɭ?ʭ@̭X@tԭ@lڭ@ۭHAݭAAl8BHB`B,(C|pC`CD`DDDpDHE E< E 0FFtF,GlGG! H,#\Hx/H0H3LI4ID5I8(J4=pJ\?JDJ4g I|gIgtJhLK@hKhLhxMi$NDiOiOiPjQPjpRjSjTkTPkUkVkhWl(XPlXlYltZmZ@m`bmbmi ndmHnononoopTodpoDqou0plvp(zp qlqqЇr@Tr$rrp@sss0tttl uluHulvXvvhvDww\w,x¯|x,ɯx|ʯyίhy,ϯyѯzѯPz֯zPׯzܯ<{ݯ{{,(|xt|X||L}}X}8~~~$tdP  L<܂,!|#̃|%%T()X*,d,|4..0T23܆08$P;t?ć@AdBCTETPGILDOQS4UXԋZ$[t(\\ ]Xx]]_<`b؎g(\hxhďij`prPؒ@P$ll,Lɰ4ʰ˰4̰hΰЕϰ0а`LѰѰҰ0xӰlӰذdٰ<ٰڰԘ۰$ްtęl`4PT<|Ԝ@\ԝ X:GI8LQS؟Y(_xPdȠlgthdkoqTs4x,~D\P4X@ԤTl \б\ձLDֱױhر<4Ȩ \L ت(xȫ`hTXP  D X(0Я( )p@-2@9X<X>>4@@A̲PCF`xHLMHhOOдP*K #Td X,;dx*|*** * #0 +s-7:=IL\+>\j7:SIL\+>_besv*?}\+_b8sv*? A\+$?P|\+4?!\+D?<A \+T?p^.\+d?}<\+t?J\+? X[^b* X[eb*4 X[ib*H mps\+u 8%(8EJ*r, WX[Ub*@ _bYsv\+?x  gps*r4 X[b*H *`  *d?`  \+? 1#03Q^c\+rSr*wvy|,*?V+?C \*? a*)< f*)Xk*)t$q*r(A}',*?)[ ANQ\+)r \++ )CPT sT 4=Lcpu\+? *$s8+Ds8 *?X)*F*@|f*@  &\++4?`mr*? &\+0XX[b*D\+$@l*4@BXX[b\+d  \+D@X  \+p XX[b* ! \+T@ * 3 < L Y ` +d@s" i p y *t@"? i y *@8"e  \+@`" i y *@|"  \+@"   *@"  *@"  \+@$#8  *<#]   *@T# XX[b*h#  \+A#   k n \+ds$ XX[b*$ \+A$5 *$A%Z XX[b\+$%~  \+<% XX[b*P% ! \+4Ax% * 3 < L Y ` +DAs& i p y *TA&C i y *dA'k  \+tA,' i y *AH'   *A`'  *A'  \+A')  *'P   *A'v XX[b*(  \+A((   k n \+s8) XX[b*L)\+At)**A)LXX[b\+)m \+)XX[b*)! \+B** 3 < L Y ` +Bsd+i p y *$B+#i y *4B+H \+DB+pi y *TB+ \+dB,  *tB,, \+BT, *l,  *B,>XX[b*,] \+B,  k n \+s-XX[b*-\+B .*B@.XX[b\+T.(  \+B.F \+/oXX[b*$/! \+BL/* 3 < L Y ` +Bs0i p y *C0i y *C0 \+$C1Bi y *4C1i \+DCP1  *TCh1 *dC1 \+tC1 *1  *C1'XX[b*2E \+C02i  k n \+s@3XX[b*T3\+C|3*C3XX[b\+3"  \+Ch4E \+4sXX[b*4! \+C4* 3 < L Y ` +Cs6i p y *C,6i y *DH68 \+Dp6di y *$D6 \+4D6  *DD6 *TD 7 \+dD47  *tDL7DXX[b*`7g \+D7  k n \+s8XX[b*8\+D8*D9XX[b\+96 \+49^XX[b*H9! \+Dp9* 3 < L Y ` +Ds:i p y *D:i y *D: \+D$;+i y *E@;Q \+Et;m  *$E; *4E; \+DE; *<  *TE< XX[b*,<& \+dET<I  k n \+td=j  *=  F T l %T*$t;D  D  *E  * E5  $ *s`Ee  , *E   7*E  I *F  P *DF  Y *F-  a  *FS  l  *" z d*@Q^" n*% KKN VO% KKu'HWg% h)4W% x)@#W%2*;HZ% @ILYf\54Z%ktw/~854s[&;\544 \"& @IFYf\54\A&( O <]c&  M8EJ@G$L^& Yd L;4EG$c& /3Wd#G$De'i$f6'*G$g\' !.#Li' 3^bo RG$l'(0 ,DtFo'()GRZ||6dtFq'0sYgxLd<t1vo(854G$\x($8FYqĒvF{(,p,<t1T($%2TUFd)7:*;|2) =[_R*]) \+p) %LVdq0gCH*%,:Fܓԝ\vt$Аf*eos%g08t$+ %*4+&)%/<4/sU+ARU%y.@s +%4/As+ 3%86D t$,%8TGt$@, %cq~Ԣ`ts-% $ 4  t$.y %RY (6tx. %\[!h!s!ěg. !!!%!" "$>s/'"5"n"%"##$ t$7/V#c#f#%###0aQuZ/###%$$$(64$ut/ $'$3$% }$$$$ED/$$$%?:%H%S%o[E/. ^%a%%~8 #)/ e%n%q%%~u%\+)8/0z%%%%L&Z&_&HA49 t$_0&&&%'''8:4: %0''<(%I(((PH4x; t$ػ01)Q)i)%>*L*Y*D T Tإ8п)1***%s+++oQ(p Z1+++%J,",+,l74E$y1 2,;,N,%f,,,*v1 ,%*2,,,%H,Ht$TA2,,2-%---H6D t$ 31.D..%/%/+/PH4T t$M3//"0% Q1_1q1,,ě&7t322\2%}:%22o Rh< 7L3A3T33%444T 7l3 -5G55%666ooesP4q7~77%V77764ThP4 !8.818%S8`8(=4s5e8%*,5X[i8%b\+N5X[m8%b\+(p5X[q8%b\+<5u888%888+Dus5889%;;;=|6h[6 <<<%^<<P+s6 <<<%u===P`ě s@6===%t>>>ooěX, %6 >>>%? ??Xco@DA7 #?1?Y?%T???dhs,T7.@Y@@%jAxAAl* s 8ABcB%V C.C6Cl*8 s,8CCD%TEbEtE 0ěl sDE8E FoF%NGGG4D(̞ sa8 H-H4H%$FHKH*Es<z8RH}HH% CII+  !8I&JyJ%V6KDKLK+ %8KK5L%jMxMM@0ě, ,8 H NN%$FHKH*EH-8&NQNN%g]OkOuO\HhHd 828OONP% QQ#Q\HhHt 879QQR%sSSSd t x 8>09 H,T3T%$FHKHP+LE8T?J9CThTT%(UUUtHHLs sxD]9V5VV%raWoWyWtHHt sIp9WWX%ZZ,ZqrdPsLR9 ZZZ%ZZZ\+FS9[ [[%[[*S9 $[$['[%*[*XT: -[-[0[7*U8: 3[mpn8<[*WX:C[}[[o3\A\L\D+vm\:$`\m\p\ol|\\p,m]:\\\oE']]=F`;h']5]H]s8]]]2tA,c=;]]]sA]]]$FX cf;]]s?]4F\ c;]]]sC^^Ld;^v5*d;$"^,^3^v?m^{^^*+(g<$^^^vI^*+qg:<^^^vT^^*h_<^p^vp8(_-_*+duj<@_I_\_v___x94uk< _v#k=___v9`G`N`<9u4PnL= ma`d`v;*sog= ```v-b;bAb5@ st=. . abz #4t=dbnbb{2bwDw= bbb{bb*w> bbb{bb*x> bc c{&cc*\x)> c"c{Y ) *xA> (c9c=c{cMcZc*yQ> acrcvc{occ*${a> ]cc{{cc*{q> ]cc{cc*$|> ccc{cdd*DF}> dd{#}> ddd{d*}> dd"d{d*~> dd&d{ d*$~> *d.d{*X~? K2d6d{:d*~? bb=d{bb*$,? CdLdPd{Vdcd*=? hdqdud{{d*<N? ddd{dd* `? ddd{ $d*q? ddd{#$d*$? ddd{($d*?ddd{-ceeP+TFs?e-e7e{=Qe^eceP+dFs,?jeseve{$e?eee{Ueee*u  @eef{f,f1f\w@@fCfNf{ofrfu0@ fff{ff54l@fff{-,g@ggg{U&glA+g4gCg{mkgxg}gtF4BA ggg{Kg hh<[WwyA.h7h:h{BhIh*ܐANhlhh{iij $ B]jfjoj{ {jjv$Bjjj{>jjjH[ZA7ABjk k{kk\B$k1kDk{fwkkk54i<sB kkk{kk(=4sМB kkk{kk(=4sdBkk/l{LmZmhm$u ԢCjk k{kk4%Cmmm{mm*3Cmnn{nn* EC n7h$n{Bh,n*dWC1nWnn{ p!p@pK(K hC]jfjp{_ {jj$v`Cppp{ qq'qx7Cjk k{kk C BqKq\q{^yq~q*wC qqq{ ) *C qq{$ q*lCqqq{2qqq*FDCr r.r{j\rirrr4=xسDrrr{rrr,Dv4h1Drss{?sMs54PDVsnss{Fsss cDy t t{YtHvD#t,t?t{ot|tt*ATDttt{ tt76F;D. ^%t{*8 #мD ttt{,5uCud`L E. ^%Vu{Y8 #;+EZucufu{[clu*;hEE . ^%qu{d8 # 9xmEZucuuu{fclu + 9E{u~u{o* 9E. ^%u{x8 #;Euu{z*;0E. ^%u{8 V=@Fuuu{vvv̀@\xV=DFwww{x'x,;ZF-x:x>x{xx ;uFy yy{D/yNlz{V[x[$ `BN{Vx[ FN$.q{H=KY@x- J0O{@ OoOOY{O]f@$Ę RO {fіޖX,TO {^kt54 sU@P{$#hV[Pŗ̗{,G,bzQ ՚ޚ{/d=sbQ{΄*bQ {,*DcQ1:>{ *cQ nFJ{BhIhP+scQR[e{=G7dQ{iƛ͛*$GeQԛ{v $\ysfsR 5H{T**\gS͜{0-$Csg2S(*{ov{[yiwS(ĝ{LT[[0 /lS{ʟҟߟd t$@qT,>a{ȠѠ[,Syt$\s5T{"/4wtST?BM{gj#tihtT {Iz8uTšΡ{p_fkL/it$vT{3/~ww!Uɢޢ{E8z@U=CT{TCt$|SUУ{^\cj[\X7~mUͤ{CKXP\\zt$U{zUҥۥޥ{46U {\jp*X= ĈVç{W|\#4GЉV{Y3:*0VMWb{:%ɨ6x IVԨݨ{!<E*0V\it{ Oҩ٩*$xHV{B0=D*DxVWkת{R ؛yW{Ѭ֬dx0W{qDGW%({&;*W@IL{FcXW]n~{P­ЭխL/z\d$X{~&3<854{\9XKX|{&4Ut4jPX}{^z d/\{sX(18{NS*TG8XZgr{*#54dG Y Ȱް*{߱5(r \YGT`{jt54xԷYز{zm^]jpD DY{9FSR0[ 2Zô{,R \. Z{Q/4*{ZIV{-6R,\H> TZ}{3~*CZѷ{? 857 X[2;G{cerw*tG$E[ȸ{yGU`= [{1Ź̹ӹ=G8D[ڹ{D8*G[ {S*7>*GsD[ EN^{ypw~5xs[ڹ{8*GX\{8=\{ٺ;|6#$'\{*4B*;\IVY{Ywkq*M\x{gf*xhc\{tf*{\ɻл{޻54G\ {&8\Q8`\-6:{Ta(88d\p{= \{, ]{eJX_p/H7]r{{Yx+] {,C<C] {%27{]]FM{{8? ]{'*]{ltp0 mH"]{`*GP#^{~|/G#<^$-1{8c^/7%U^cpt{Jh:|6&M} {h *&o^{G'~^ {*,)^%.1{5B<)^%.G{5B@*^KXm{4H+^{^ls* -/_{+# % ,/D_Li{h|$\1[_ {f&Q$d;_~{4Mc+<_{c*=`.{(x=(`{w$4& AL`{+2:yCe`ENU{dot`*HhD`{{c*D`{C5E`{ 2,L0A=`a{C5jfU^a{ys#f{*yl*g {==j;g{#&\\yXRg/<C{q_dX/DH70hgkx{- *< Ȣg=Ib{OR \ g (3{OV-ys|g a{|pDRS,Ehjgj{Dkkahru{(}h {FT^854TkTh{ h1{# $h:{ =i "{Xě Sj {Ċskj#R{n|57 j{'O]e54ت j{z /TH7j,{>4H0 Dk>G^{ / 7h^k{l"$+*dH lk2G{|)7>-(@ !k{+9JR$R K6knw{ Pl7@C{]j:@.lqz{s*Czl +{ff Dlmz{ffA Tl!5{XKK $m;Th{[!*D?mA{ $ X m JS{Z$ l Dmcl{p85|6\}$n{mz54 PHn{s5ylwn&{V[*zn r{$0Ԋ(n^o{k*tHn$j{ D ` o1BL{8`eHp!Polu{.d854$z@"|o{M*#o${dFMV54Dz$oenx{Bh*H<%o{54dz&$p{Qe'54z'Wp6?{{*0 )rp${49z\*pFTt{kH.p {d8 ? *+Hx0pJ S ` {y   *DD@1p2  {e  * 2q # 6 v {  54= l7Iq7 @ O {4Vdi p *}7tq   {@?s  *}t:q   {  *H|;q' 0 3 {G D+T*؛b$<qL U X {$` *=q e o  {   x?q  _ {$54 t$,Drm{{7l$0Hr{~-b54tlt$LMs{"D+lM4s#H{654 Ps %.1{lMcA*sQtHQj{{*ȫt$lSJt{m*tDTkt{6=*HUt#HO{$_d*zUt#mt{$*z4V0u {$,*HsWOu {5#*HsXu(+?{_*t> %^u {854_u *.{b5 >Tav ktx{S8D+Hsb4v{7s0dMv#{`ot hfv {$*~%div?HW{*\~jw{z '*+ m!wJ[^{U|\p*nCwu{f"08* rwiv{Dsw U{Kh& ,yS\_{au*46yS\_{au*<ky~{]~,y{Z=|  /@ ly  !{!!!5 `y3">"]"{"""` y"""{"#*y ###{E#R#*\ zY#f#j#{#(644+z###{Mc#*Gz$ $${.0J$O$*IazV$g$j${V8$*{z$$${G)%2%-$ zW%`%c%{Vdk%*(zp%y%|%{%%%Izp%y%%{%%%$I@{%%%{Yt%4I{%%%{ &&{&&0&{j&w&|& (|{&&&{&'' 0{%'.'1'{^K'*{P'Y'\'{$[!'6<7Ȓ{'''{''Ԧ{''({'5(;(DI|C(V(({@))) ||y***{F++h\t\(s г:|),,,{"6,$tQ|;,D,O,{y f,k,*D<n|v,,,{H,,TIԵ|,,,{|\,,{t$|,,,{0$-1-6-dIs\|=-J-Q-{#y--+tI}-- .{///4<>%Y}V0`0{0{-1;1D1+B l}111{ C2Q2[2*l} |222{$-3 3*ĝ } 93C3_3{3 44*4? l} [U4`4{44${s~4Y'4{![!4-~444{:4(I~45%5{55R \| t~ 556{$}666Ԉ, ~667{i777? 7<~788{G8L8*h$~a8j88{888 4m ~9909{p9}99\pTm>p~999{j99D{(~ ::J:{ :;;5(t b;k;;{V &;;RpTm6;;&<{ c<<+|/d hS<<{  s<=8={ (==,<@ = >/>{I >>W\h1  >>>{ 6?=? 74~0P?Y?h?{ ???54 ??B@{ cAqAwA,Ts( BB2B{i BBBtA T1C:CIC{ sCCC\rCCC{ CC*CCC{S8DDd{L݀&D/D3D{4%QD$>b$\ ZDdDD{hEE'ERpT sT/bEoEE{EEE*h+TnlYEEE{FGGU\@! /> sGGG{=@HNHiH|4B s' HHH{fII*IK I'I0I{JJK , ߂KKK{#LL*np &L7L>L{kLLL*! #4 LM(M{MMM54 s'sN|NN{NNN*E6)NOO{?TO]O544E , pOyOO{cOOO*dEs-AOOO{zkgPP5{l0/b"P3P6P{%S8WP*0}\P`PuP{9PP*{4PPQ{NQQQ(6 6˄QQ\R{w>SLSYSRR6 |}͊p%b"b{!$W}+b8bCb{f[b`b*|(~kbxbb{mbb*|~$ bbb{(bb*DJLBbbb{}c*] ccc{ E#Wc\c*\Xmccc{6cc*$F‹ ccc{PWdedqd54 " Yddd{d*>dd7e{See <[flff{qgxg54 gg8h{hhԈ$ Xhi i{Ai\+  i#i3i{8EiJi*TJ:. UiXi{Q8 ,I \ieihi{zii*ciii{iii\+ijj{%?jFjKj*TFԖ`jmjj{kkk*" IԚЏOk{N*Ykfkjk{|k{jkdJLkkk{-llU\D ' lll{m mFl؟Gm&m?m{dmim# bmmm{)S8#n,n56B Dinrnn{*!o* sxȐ `ocojo{{o~o*|ooo{/oo*L,tJ`jk k{kk<ooo{$c;pBp*<   {ppp{nqqq\ %ܬNrWrZr{dr,_>|4NrWrir{dr,_>PNrWrsr{dr,_>m}rrr{rs s*p# 0)s5scs{Gss*F̲ sss{1ss*}stt{9Ht!t*J(.(t9tCt{CetjtJCqttt{c>uLuVu*FȺSjuwuu{Euuu*$}huuu{Xuv*L, vvv{ay "v*Ƚ)v@vDv{hfvsvԓxvvv{vvv57DG vvv{v!vw%w{www\5|6Twwx{L\r0x5xJd}{kg|}}57X,}}|}{}[*}}}{]~h~9l># x~~~{`k\P\P$ L{{C}]dʙ{[t]dٙd{o2@\P]@K\_{_* {##. {8 # I {)D++}sa /{VzWRDGd{k**Ёׁ{_ +Jޚ$O{E94 5. ?36{gP$ @BKN{@<Z*Tajy{R*L,tG;XbBK{V<Z*vɃك{rHV]54}mvy{${Ą*J˄Ԅۄ{*T*Jԛ{)0x>J7HU{J|*G{9<7C t$p 8v{* P0{$ aˇ{yx*s| {|kT  ${t+s |04{|sŜ  ;{t+s BGK{#RsT  W{'t+s$ BG^{-Rs@  e{1t+s] BGl{7Rs\}  s{;t+sz{'T:1 = +{ii skx{u=Ջ](]0% 3%# {. '*#,59{=O\,%a{k85|6 t$p*9 &{',_j*܀G$8,P}{AH*~,ja"Ž{K"֎ێ$~L-b {U(854JG$. /3{i {j/ /;{m {j\/CG{q$S/Xx}{yd6ǟ"&{}.7ܟ3?C{S8_8dmq{vT9{:ǐː{Ӑi* ;%ǐ{Ӑt;:{b **4K;;\ !{-4*KG$<o ;ES{ Ñ@=4s@dؑ {Ԓ4]ЏtD E7@C{qEMVY{]<F?qt{hӐF|{lyƓ˓# hH^{H({.5:$KI>AKu{9l>% LS&0]{ R@]& Ph,/{>΄ۄ#Py,5{B΄ۄ#$Q;q@{FӐFxQKTW{Lna#Qfkn{S!|*S֡{_a4KXSϖ{v 854& \T)'0K{854& V9З{%54`WJ{>KP54G$X cl{ƘӘژ+*oYf{@qL]xbϤ{s.3H4c@IL{eZd _i{ԛ*2 tg{;H\+ h5#,/{F/*|hT 7@~{]$\l Dlbo|{~Ý\tmy ҝܝ{lz sDsƞϞ{0 *4Hst 0{ɠѠݠ5 5T sybHK{bSy1X[{qczJ hqz{nt*D~{ {yyxޡ*dHs\|{ %*DKsd} ,5>{,[`d~~s|{",{kgآߢ*~=d{Vd܀0 {|\+0TKGe%7@{!~NSdK=x_ Zg{QN\s @4,\{0>O8|{M#ާ{w*D"%{c3Đ"8F{9GV N {dQ1Td<2 gkx{s~˫{| ڬ{ yl'{` 63  ʨԭݭ{  ~ܨ/8M{ >܁̥{ 6|3 B /{ qx}#4p i{ ̰Ӱذ#{ Ź"*\D3@k{. ϱܱT[Q3 d${_ kgLW858DtK^k{| kgIJɲ*Hԯة${ *C Tгٳ{ 8,76pXNQ{ bȲWi{ D =*{@ L]v*`0k߷{ _m|$ { ^ݸ854~x{ yU^* {{ c RpT d)x'{1 4B`,LL{]bg84 ]${6: |0E{27>|6 F| ({HmV 94Kr!7X{Y6>Ģ 8{ ~TN+4;{eUZK da{{8FSPX]l4x5{>d  xBK{Zgl, u{O|tD <{ċԋ3 Tq{Ӑi*Hf{"*K @{,*D{ G{<564E h{OsQZ*Hɭw@{_ *٭{dSaoP \d  {.yKs<  {[cl>H`' sP{q*H(;{PX{xu {@HUZ <s}{Iu=EP6 {Pͮ{{0 {'*H/DMP{~\*I,c{΄k(cp{T%85`9 { RU{/ ]* bkn{>85 5D; DM{E~*@!{PE* X"#}{eJXgRRl5%O{^ */K&k { #*8'~,({&/o**Ԛ'2;>{)"NL(S]{8KK />d.7JN{P1˰{*Ķ 4{X6<7E @6o,{/*6՚,{ /<* 7&{0?*$ 96{f%,1H9KB,E{[^K:{i"r{*K:,{΄ۄ:{K;{Ld;ұ{L;{$L;{4L<<{DL<={>7 BM{vTCJ*$Dku{O#Rp]4 (GŲy Z]{mYtGmv{*8Hz{fgpVB{85|60WS&5{%W\5<7DWakps{OYu{wk+*د,Z{7DM95TL[T]l{p\{#(u aƳ{NU54܂Hc޳ls {TDk AK{6, p{H}*q'4{_wk]b*dr"o{| (v 5{#^ [ B{7z#E {{[4 x{F d{Vd*dL܇{Wdi#pش{)%*' h\ev{FL,*( {bm"'P$tL< .?J{і~(64#{!*l# t$ؒ7$[BI{*[}*L{#*X5 ,^N_j{J^*Lb$4op{O<4hJ{ +HěTqtkt{E#856xȡ {9DP R\Ȣֵ Yfj{#54q?{!"54rs`e(=Vm{/%3F0@ nw{dr*{54H${(6H|]RԷ L{&hv|5 m {[*LG$%{yJRWȰn{h{O*+Lȷ{*LX޷$-J{gt{*@( {P] ޸3<G{sCov+܃t{*h{Cf,{I(1*$I|BKW{S${jSι{dܹ{ *L; { 2;*$QDPZ{|ԈPL;j {   TI$   { #<   {) L  4 {F<P U **Iƺd m  {Pyx  ]   0 {e8n u * 4   {"^  >6DF   {-#  +dFH" & / L {?  X64tr08   {zȜ)ܜy CdEH{Vd4CdEL{Vdz]Pb{Yx*L,ITĻjk k{kk{d >L. Q{˘ lR {0w(=9Lb$l{] \ {, *{, *LǼASc{]hV8M{(6>* ` O "+K{<Q|D+ sL! K{S:d*x6 s!  6{r+\$^{^$)&p6HL{9`L){ Ź){MfM$*${U,V](6tG p+A {$,?P`8 s.^gn{~M /{+>>Is1-{S3:A-$Mb$2^F {"""p8t$=###{GF$T$f$7 t$xA$$${$$PB$$${%%,ĀC'(%5%8%{%J%PE: O%T%W%{X[!c%-s8GPj%s%z%{n%%%,4MGb%%%{&#&(&<-s$DMM#','9'{DmV^'c'JNt'}''{R'''P$ȒTM O'''{'i'*L,ȒdMtO/''(({Gz((( HR?;(({ӐFRY;(({ ӐFRs((({&7),)P`t$TE)N)R){wyxg)l)t+DUu))){cQ)D+7V$))){]*<%|Y**!*{o*t$4[r***{{+++d|`+++{,,,DJld ,- -{ s+--,h ---{=7. .tMi, ...2.{Ji.n.MHkN...{W//n]L/P/U/{v//Mpn///{</tq ///{@ 0Tr(0"0'0{w0v }000{}0w }000{}0dx }000{}0y 000{0y 000{ 0z 000{0P{L 00{$S{L 00{$Sh|L 00{ $S|j01{%k 1T}2 b11{)b5}E j01{-k 1~Xb11{1b5~k$1(1{5/01~~ W%5191{:VdA1l F10O1{?k 11W1{Db54_1l1p1{I|\11tJ@ 111{S1111{]11ā 112{i2!2Ѓ,252D2{T22Jԅ4222{O"3'3h JJ3S3f3{kg33 c333{-44* 0}#4,4?4{@u4|4*XH 444{X556]5 <c6r66{]O77,{ ;48=8P8{9`88]$RJ888{}49=9|Q]KR9U9X9{"99*܄#999{PƘ :):sܜQD:Q:`:{/;;;*Ġ ;;;{<<= $7 J=M={S=\=h={y ==*M\==={'+>2>*(8 @ a>j>>{ ~>> 4$ ???{Z_[?`?MGk?x?|?{H^?*pd???{^M@b@r$@@#A{0B>BaBg0. BBB{E#!C&C=CRCWC{GCC]xXM4CCC{>"C.*Д($CCC{BtC/T*+,CDD{Fd D]/$A4DDD{J@%D^S_W*D7DFBF{+r\FgFlRhPMHpFyFF{DmFF>|6,H]G G1G{P7wGG>|6,\HrGGG{kMH*;HSHD`H{xHH854HH{GaM04HHH{_III`@ ) TJ0J4J{*pJ~JpTJJJ{JJJ*4K 8 KKK{;KBKWGKTK]K{<oKvKL,*NPv }KKK{"WKK\+4s KKK{/qLL*dK*L7L:L{<|\XL]L*KnLLL{iMNP\F ͌lNuNN{y0NNP$$; ,NNN{sNN**N$8 = NOO{;OBO*D; TUObOiO{}OOdK6t |UObOO{}OO͌( OOO{tOOK6 (OOO{:P?P/ĂD ZPgPqP{[PP*#$L PPP{+}60Q9QTZ) t$ [jk k{kkL "ZQiQ{o"QQ* QQQ{vQQ857 jk k{kk QRR{Mc'R\+0 5,R:R}R{}S%S6SLG Il S}SSS{\rSS854 SSS{s8ES\+$N T TT{dr T,L,4N_>$ jk k{kk 'T0T7T{%YT`T*DN b;gTT{TT**܅ !TTT{y FTTU{UUU*(w l UUV{!;VBV*TNd (MV[VV{<>SWW^$^D K" bWW{~bSL# WW:X{"XXԈ܌ h& A1YGYY{"Z0Z=Z |) ]ZZZ{;_ZZ H0+ t[)[Z[{ZC2 \\R0^d Id/ Z\c\n\{\\854$`0 $\\\{j]x]]<^ Waa#a{HWhama*KA ~aaa{`_ab*KdD b b#b{^*E 9bJbob{bbb678 F bb{ c0G  cc1c{ccc854 ppp{.pL/t$ 6ppq{7oq}qqT^h\C? Iqqq{7q* bqqRr{sss`&L E%H uttt{6t 9tEtQt{ttt54+h ttt{.L&u)u=Hs$4 LuXu\u{Ihuuu:( |uuu{Qy uu,5N uuu{YqL-Lȗ 0uuu{c:vCv*:L E ^vkv~v{vvv*$; ~vv7w{wwwRWp*  'x0xy-L,K6 EyIy{A]y + `yyy{WƘyy*( ̪ Eyz z{Kc-z\P`^P _6zDzZz{e!zz>4ds | zz{<P z*NL zzz{zz,*N4P 0{ {#{{J{{{QxX ({{{{ ||t+NI I |!|%|{/|6|+*lIp c;|D|V|{q|x|*܇ |||{c}q}y}+*lh: IH }}}{/y ~~*s -~6~:~{\Z~a~ f~o~}~{pQ~~ȵ 2~~~{M )7y{vĀ`** p  {^' *#,A{[`* Fo{uXH  ӂ߂<{(@HȃЃ + C: 7@U{3Qhm+ {Cm*$p ׄ{C!;D64\s clp{sT[ R> k{k\PQ( % ʅׅ{+S805*h+h GN[{? l^D o =e{j ԈhTt . Ç{88  OXLJʇ{b O·ۇއ{|k#Ox {fi#P+ bW XLJ{b*; P{ƈɈ*Ą;0 ڈ{|\854O$< {%6=854;D D JSV{.k^*$ aclo{8y*; ~~{C854$O; cl{Ny*; É҉{V$-\PQTL,$h JS{]k^*; #&{j84*; * 9BM{|irԈh$ J}{88544O; j7{]Ȋъ854DO; JS؊{k^*;@ {,x^ RL͌ )5@{_\ePR$; !JSp{k^*;P ; x{і856TO,$ Vċ͋܋{8856dOs: q){ FO,54DK6 \g{?ߌD+: K6 .{/yPY\P^d; lhk{ d{*,$ č{( 'D+ ? ^gj{:<r*$H ,ow{?ot*;T I ŎΎ{Phuގ,5$H mD{]~*; {c6=85<7ą LUd{kgP?L ɏ{ +:s JW[{H*4< gp{і* 0ϐܐ:{Xft,gx;  6Ӓ{,7L.tO4 NLBKO{k\?4h.` er{ s+AL^^HF  {XO( <{!pZH (&4O{2/+ L ,ʕ͕{Zߕ,@  {s18=O  ?CHL{dYD+T*8l _`im{"֎ t~Ŗ{5Q_ih?< H {U~×*L, ʗޗ{W"*܈|  \{OO]g0̝ % -^ęԙ{k & J{H*& h"+J{&pw*$' ${/ < X- eru{!\+O). ڜ{DNIN\+\)0 {gÝʝW^DO1 ѝڝݝ{ {jT2 f{g0D+K643 0 ANY{2̞Z^#$5 ]  {'Q_i 7|6t 9 {I, 7|6u= '8{sL&| 7|6tu? {,\+ )A L_g{ "0T `qOLH *e{~إ #8$ sX ;{-ӐFLY );{1ӐFY I{]΄kY e{dVdhZ {i΄kZ æ{pVd0[ ˦{<"*$,^ (=B{hx*6P` }{@O0a }{@Ob ҧ{_Oc *!.2{V]bPd ; irv{ Xf MX{Vblf mŨ{0, $g  )a{m8548= h *{, ., )l  {A5>54Lo ,P{΄ۄo V_{cܫ*= lq , { ΄ۄq {_q 1bH{bSHv ({LY^L|w qz{ Mx 4Xǭʭ{bx Yέѭ{*x x d٭{,P\y  {1#y -{TY**$Pz js{"*܉{ ?{/Ӑ{ :Ʈɮ{"ٮ*| S ޮ{| i{Zb,4} {a"54P}  {h"5DP|~ 0{o"5TP  @{v"5dP P{}"5tPh `{"5P /p{"5P I{"5PT c{"5P ~{"5P {"5P@  ï{ * ˯ί{* ˯֯{*Є ˯ޯ{* ˯{* ;˯{*H V˯{*p q {9B\pTP ˯M{*Ї ˯U{* ]{9B\pTP0 ˯{*X ˯{ * ˯{* .b{(,Q Iİ˰{װ,QP d} ް{& ,| ˯{-* ˯{4*̋  {: ,$Q  {@  ,X d!{Fd,| ),/{MG* !˯J{U* <˯R{\*< W˯Z{c*d r b{j *  j{q * ˯r{x*  z{ *L ˯{*t  { * ˯{*܎ /˯{* J˯{*, e{* ˯ٱ{,$ { ,D̐  {  ,(  #{  ,  +{  ,  3{  ,< 1 ;{  , L,CF{HV[,4Q0 gbkn{*hu$  {bDMT . {8 #_>d {#t {# {# A IJղ߲{mVzV*DQ V3@{Z[ds gbb³{bb*s xȳѳݳ{ 64`  {9'.3*TQ I:CG{B}QP+s8 |VZ{U/|fp64 mvz{d.=4 ^{t=6sx  {Z~Դ64 ۴޴{)(* #۴{.(D+ll 4 {U *ğ D {Z * a) {_G+* :={d΄*ܠ vEH{# L]v{,ӵ`p-  {q*P$ v/2{y @*;X EH{V +G$ [dg{Mc~[dQ5< [d{Mc~[tQ5\ X{b#p 8öζ{&;4Ćܫ Ib1{bb9\+QD ib@{bb\+ |bF{bb\+ LYh{kg*QL j{kg* j{kg* {/(+*Q Ƿзӷ{Bc۷8+s , j{kP+s` > {< *Q NW%{Vd%4/s `*з3{c=.8 zBE{8|=t$ ʁOR{$\=݉ jycf{ rP+Qsx b{bP+8 { *Q  {, θ*Qd ո{1*Q {F *;   {.y/6P+Rs 0 j=A{kP+s E jyIM{rP+Rsd g j=W{kP+sĶ _pt{=7 {WeŹʹ-$RSx  ѹչ{|,*и  ѹݹ{,*( {H54Rt$ 2{"/65DRsd !=FJ{'T* ;[p{'Һٺ޺- sD N{M/~#ؼ i 09B{er{54tM$ {c*d  {  \+ {  W$RX>  ռ޼{mVTR$( = &){F?$@ HDG{ m O]{­.9T>H h {wkʾϾ {COR>  {V=l$)*D x r{t#1ADq  -{h O x{/|s ]!.>{ xM; m {,*; x {,*;t  { ,*;  {,*;$ Z  {hu*;p  {,*; Z {$hu*; !*{= 4*L,;l ?q9{Q\ndR .CLg{*> = { N>I 0 Ke{7Bht `{t#+d] z0>^{ (1{=H*$< QZc{x*D {ŹdT {7tR| v{=R 2{CR Nv{IR l {Q03M DMP{bX_ dm}{%+R  { @f{of {zMc +* X{}b  {Mc +* D {X_ )%.5{IP* Ybm{d*N  } {1 # /{/*R; J {N\iR$ \ jqu{kg* s j{{kg*R  jq{kg*D  jq{kg*  j{{kg*R {*u !%{Kb*x  j-1{Yk*l 8 9={^/o*lH ^ 9E{c/o*l ~ 9M{h/o*l( ǷUY{mcc*  ѝhl{v θ*S  j-x{{k*ld _{;s*S {E?s#0- , D>Km{hvԈ@X@ e{gP]x? 4 {  {$St ?{Ӑ {/Ȓ@ $ -{|6;\@ CNWk{ a{4S y{y 2 6{ex} +܊st  {ppp` 7   {L@*1<4ć <Ec{V**< {PXh ! {rW RDS! 2 j{k*s8" B&48{g( 4N+ \4^{*66\0. n {YafdN`0 }{!$?1  {C T*l-$2 X!${Hb3 (+{(*|3 1:={,*3 9W%EH{VdN*L4 XS`c{ p*`5 hw{!8TS5 yX{*b5 {J688 $*36{QeR4x9 $g[^{kh* : ox{{*dS: {5pu%,s`; D{~tS; {QXAG {Dt,\|4@H  j {k\+H $X{ b#6H 7. . E H K FhH P4_=FtO,I XTF`I rhqFh{I {FJ 0F K . . FUxK dFXpK XXFb  K  Fx  4L hF{ \L F. M 3:FVP `M [ [`F M 0F M IF/ ``Q ]IRF}Va!p0R lfoF~Va!S {sFVa !S U{F0!T U{F@!xU U{FP!LV U{F`! W U{Fp!W fF!X fF!Y f%F!Z  )8F<c! [ " hwzF~!0] 4 F!@P^ G F!P_ Z F!`` m $F"p(b (:F"pc >PF "d TfF0"f j|F@"Hg FP"h F`"i Fp" k  F"hl ( F"m >  F"n U . . F o g  F[X'$o z hdFa{ o nnqFm o . . uFqh&lo  . . yFs&p  . . }Fux&p  . . Fw&$p F4p Fh' Dp   FTp    Fdp )   Ftp A   Fp Y   F p q   F p   Fp   Fp Fp Fp F#p F'q  F+ q & F/0$q > F3@4q R F7PDq g F;`Tq   F?pdq FCtq FKq %FS q -F[q  XX5Faq  XX?Ffq '  XXIFpq E  XXSFuq b  XX]Fz r  XXgF r  XXqF 0r  XX{F0 Dr  XXF@ Xr G s  H v forIhw 4Jw :. . J w L Jw QK."w ^} } K6"(x q} } /KC'Tx ~ddCKN'xx } } SKW'x } } gKbx'x { Kx"(y XXK&W`g$ ; DG܋ 7=4 Z:Я } 7l <4' ,58.;L QZ]*`q  Avy\+)ij l ,7\+@ )  ehk\+T)` \+)p 9\+)Է ?t*N)p d Xch\+)0  \+T)p 1?JO\+Dȼ  hk9w*$T)D = +Hh   E3>C*N) :T]hM*d) YT]U*)H }T]]*) e*N)t 0mjuz +4v 5B hkQB -7*) S 1q((4   hy*\`   64Ĉ *1?Kll|H  |sPn`4TG$ 5  \+DTT ^ "%3# ~ 8ADRe*\ nwz*D $+*vG$8 !? yP bm+G$ 3!tQ*`. G$ u!!"*f4*G$l !9<pTgGF !(p$O !;F !"[wT D"$-*TT)l e"4; *dT "} DKW\+) "} `gs\+ "|D+#$ #_*$) $#_*D J#\+) l#XX[\+ #*tT # &*< #d\+) $ \+ 6$-*T) \$4 *T $} D W\+d)< $} `s\+h $* %.>Y I +TN% $R[h~44Ts %v_*T)8 <%v*TX b%v_*T)x %v*T %|D+#$< %| + %} DW\+) $&} `s\+ĉ8 P&v_*U)X y&v*Ux & ;@*h &W^*$U) &gny *4U 'w*TOl ,'} DW\+) O'} `s\+ u' &\+` 'w*O, 'w*O '* (ԭ 5V[*܌` 0(| + R( &\+ x(Wr*DU) (g{y *TU (-*dU) (4 *tU ) &\+ +)} DW\+$) Q)} `s\+D z)6\+d) )c\+$ )%4\+ ) ^i^ *H *y +06O *;|^T@Z4 +; ** kI\+ F* o8h `*dH\+ {*,-m *+/5| *a5 F O `UlU mp *(|   t  0 v% *vyL * **  * O R *  + Y \ _ *T .+f P*p H+j S* c+ n q Vu * }+ Y | Y_ *s +  ^ *0 + jy  b * + jy  f * + jy  r  *\ , jy  u * ,  x *4 :,`[ {  * ^,   *$ w,   * ,   *  , *( , *D , n  u *t , Y  _ *s -   * 9- jy   *L S- jy   * l- jy    * - jy   *x -   * -`[   *h -   * -   *P . $  * 0.. ( + # K.. ( / # h. K3 6 *H . G T W /  D+#$ .   Z  0m#$x .   ; G 3 9BINUooD+U#$0 3 dT.,(1 3 j[t,1 3pdyq,H2 3vs*2 3-*U<3 4)6*U3 &4@ c*U,4 ;4(/4:EJ*V4 K4tQ^mI6COu$6 _4MVH @6 ~4KĊ6 4 c(9,5#$7 4 @ILr749 4ZWP4; 4 0=@X_\+$V< 4 fl@TЏDP? 5? *5?!(@ 65):MPD+#$TA S5p *$B o5(7[py 74D(D 5  (5$tP#$F M6P]h 744V@G 7<[TH 7&)50kH 7#;BCPc*DVdI 7)juW*dI 8r*TVXJ *8Y *dV(K F8)Dah*\@L [8w*M s8F_f*PN 8 wz*N 8#;~P*`O 8*O 8MP{*. |S : ,*S :$?J*@/ U :knx*V :<l-Џ4W :w֎tVLW ;\Y ;7)0:E*VY ,;BL[M xTQLZ =Mp84PP[ ? $/MHOP+Q|\ A0\ny(T @` QB *ypLI xe C  n 5:!u!!bbxJ 5$j C$!""Y"l"u"4T@T܍'m @Dd""M""""V$n D$""##$$|Ԥ /s ;Ed"r$M"""Vs E ~$$$M$-%>%Twv /G$a%%%X"'K'd'c (x 3| Gd"'M"""VT} 1H' (%(@y(((|87w5$t H(((M%8)W)f)Џ/  Hd")M'"""VH |;|) )*Ă "@ ))M:* 1I$)))J*]*f*LTXTG I ***M+$+-+dTQ85$ I,R+c++x;,Z,k,(A p +J(,,,M[|---<A x tJ * J 77:*P J--M -c*Ў J]--M. .*X K^.....3.\+V< K:.C.F.MpJ.U., K e%Z.].Mge.p.u.D+VWt ,L:.C.|.M5J..4,W rL ...M3.,ȁԒ L ...M3., L...M ..,V, 4M ...MX3., xM:.C..M@J..4,W M..MCGV.P+W O ]..M@.yq.+W 5Q..M=/c/*$W$ Rv//M:_\+4WD T..MCGV.P+DWԗ NU ]..M@.yq.+TW\ U..M=/c/*dWܘ 1Vv//M:_\+tW |V..MCGV.P+W W ]..M@.yq.+W LY..M=/c/*W Zv//M:_\+W \ dd<*ؚ :\ /'/* R\ ./7/Z:/* r\ 77:*М \ dd<M* \ ?/l^ML/W/*؝ ] \/e/Mh/s/* M] dd<M* ] M*d ] dd<M* 6^ * L^   *p d^ U{Rz/*D w^ KK * ^ \/e/Mh/s/* ^ dd<M*Ԣ 3_ ?/l^ML/W/* _ M* _ dd<M*< ` ?/l^ML/W/* a dd<M*D #ca/A//** 1c///A://dFm @c$///AI0604Ft Oc(?0L0Akl000@WċS oc,0~0A00i[ }c,000A\11[ c1p1A1194 c111A1294 c 2 2 2A %2, c$42E2H2Al222HXWܶ c 2A/* d222A5*L $d2At+K=d 5d2A+$| Ld2/2A22(ZpT$T `d2A#$d sd3A#$t d 3 33A3-^ d3&3*3AV3i3k$R; ddv3A y3#K= d333A340R R4 d444A,$4p,#$ d(+4>4B4A0o4449Il e444AS44<44 5e444Ac(595 О#$ Se 8B5S5^5As5558?6Џ#$h ie55A e 555A555076Џ$ e55AD e66 6A2C6N60Rl4h ecY6f6AC666?6d#$< e?66AH e666AL7"7-7TR$*<5o4H f577AR ,fcY6G7Ab666?6Č#$ Bf?6b7Ag ^f f7s7v7Al77* xf f7s77Au77* f777A77+4 f q77A7q7*W f78A 4,#$ f778A77+4| f q7 8A7q7*W g78A 4,#$\ .g 8pA#8.8* Hg38<8A?8J8p,#$ _gA+4X sgA@,#$ g %A4*h g O8{<AD$-M gX8a8Ad8o8+4 g %A4*H g O8{<AD$-M hX8a8Ad8o8+4 ht8}88A>88;4W#$ ?h8t,A8*4 Th888A888*@ ih)8 9A9* h&9/9A?9D9*$T h M9V9Y9A \9*| h a9j9Am9*< h r9{9~9A99* h jA9g* h jA9g* i %ME,;d i(?99N &i( 9N8 6i t,9N Fi999P!5:b:h:DX fit:::Pc:::4Q oi:; ;P;@;F;X iN;[;j;PD;;;dQ$ i;;;P;;<$ i<4<M<P<<<$ i<<<PX*=B=H=QL iX=e=p=P;==d jz==P={=X j ===P>>>$ j">>>P7?@@\  Jjd@u@@Pd@@A TjA:A>A~AA*G$ ljA:AA~AA*;L jAA BB*$XG$ j!B6B9B"gBrByB*4X; jBBB_BC*6" kC)C-C?CzC+6& #kCCCCD*G$( 6k CCDCD*;+ OkXD\DdD'D*Q;L. kDDDGkEwE}E*DX#$42 k EEE|FFF*Q;8 kFFF94GOG*= kWGtGxGGGB@ kGCG"HMHBC l,SHaHqHHII@gččALTI Dl#IYII5JDJaJhxx;P glJJJhlKKK tx;lX vlKLLELhLwLT$[ l Le/Lh/L4|6$ \ l LLL!LLMW0`^ l M%*|^ lM$M9M7UMlM{M0@$Rl` mM$MM;UMlM{M0@TR\b +m MM NIN)OGO^\ K60m =m OOO@PPPԍxK6s NmPPP1QbQqQ:4\;w [m QQQQ*$;dy pm QQQQRRR*TX{ m(R5R9RnRRR*dX4~ mRRR FSZS`S*D moSxS{S;SS* mSSSb TTT* Un >TKTNTtTT*tXȅ wnTTT6UJURU*dB n^UUU^ VV%V*B` n,1Vw]V;:WOWPRL n0bWoWsWWW^8 o8WXXCX^X^. odXXXCYOYYYh?R$, 5o8wYYY}YYQ.P Bo4Y ZZ]ZiZ Q%0 Oo,tZ}ZZZZ`cL` \o0ZZZ[[[p4X@ io \\\\\\*t$ o\\\ZN]b]j]*Ď$ o~]]]]^*s? o^8^<^@_d_s_,?ع$ p ___n`8`*( pD`R`V```*4 2p`````aXs `p aa*a hataya xpaa1?8a paaa~aa#X$ paaaa bb#X$| m bb"#b.b# p$3bEbIb(`blbub^RXe p$bbb2bbb^RXe< p0bbbXccc  RtL "q$dd dddD ;q ddd:dddt+XL oq deeDe:fOft+܎L|q lfffjf854;r$fffg;hDhXQ$,$ #rXhehhhvhht+;< 3r$hhh4j`jvj0 ,$brjjj Zkkkr k*$rkkkrkr kDlLllll#X$$rlltll$s llmm+m0mP$Y%s7m,@mFmYm&*s8^mnmrmmm)OR{+v *Y|w ?*ԩ1w %0[Pe Kw9BMs*Y Duwl7|6 wZu-۷+Fhw΀9~A6?k\SFw^{oāɁ+$Fȱ2xځÂӂ=|6\6 Zx9AEDSOx$045F xÄτބc$0;HA4Y4hxJ[_4|6G$xa E6xDžЅӅn,Y6 y6A+0yHUX+h1y *Ogy 6CFE4YOy Ӈׇ1"'*܏OHy HQTO*YOyLj܈_ +G$Xy4,0S %y!py EU`+ 0 F z4U}_Fz 6*8(z $*T=zċ'Ջ94Rz$2 7>ZizERUBk| +z M0*ZhzŒŌW+z  g+0*D8z ;LWt/{,dzЍ?#$pz׍*48{z a&*{ 1<:46U{ ˎώE;KR46$Z1H{ arv^ 464Z1H|jn,epr;*|!H*(P|%2MHM*DZ( |ZgjUS*TZ$ |^i dr,+G |4rL;@(G8 }$1>B Zh}œ]ғ.D+#$\}ܓ˔P` #$~$jDM94dZ$$Tam0[ gtSWt!-cT[*D G$/ &\+/*3H{Pf1Úƚ854tZ83 ..MCGV.P+Z3F ]..M@.yq.+ZP4..M=/c/*Z4v//M:_\+Z4 `o`o*h51 dd<M*5e 7/Z*X6~!*;yRel**S 7}~PRZ8 ˛X6<7\93<?Sdk*Đ0; v+P_4;> g͝ԝ 74Z;?۝"1>04-Iܐ%m BOX_uAZm CO 3-m4D6DY ž̞Ԟ .O^p@Z#$pHpfo1y0-4H..MCGV.P+[xI` ]..M@.yq.+[J..M=/c/*$[JIv//M:_\+4[J}% BK].D[Kȇ% BL *L dd<M*LG ^i^ *xMg d 5!{*TN .ğ\+NXɟ̟3*NXɟϟ8*Oшҟ՟;*OB(54xP1w:KRch*T[Q7qz}W84d[4SPĠ_֠ +t[ lTmgH_f+Vqz{p8:4[#$W *W $*X։'ϡ94Y$֡2  '[H[E.UBk| +D\! 1M0*[$]>8ILWfw+^Y ~g+0*$_v ;Wt/{,Dxaʢۢ?#$c *#$c $(,գLL[iݣ_ l**d#$j,0 ǂ,r. $.Aͥԥ:7[:tb :S;4G$w~\eh/p844x\e5p8:4#$yʋ>?^zJǦ^ R#${ ҦP[MD #$ȅ . ĩ_ _.?4#$Dތ 5KOު?<7[ !,_8_#$( ƫ׫۫&P`mD_P_[R 0 &QpTS;?HS46[$έ*w.7\_Ÿ޸ȹD1 ;NǺҺP:$dٺ<>8+$$,gS?D+?(FdĻ˻5P2 mP_d4,mX( 354\mlUؼܼ',4,\mgMe/V5h/pw4,$\m~E*;$ýݽ,y*6[TghgD$ 0H̿htt_]m ^i^ *ڐ}?44\#$*D\P= $['[*U * .85 '*|֑  #D8!*=Sz*T\l-Џ43:,'8R*r 7b:mvy5**TB 076Џd;<)I7Jx Ugp?<<Џ ђ7JĒx8$34 V& H>Rd3h@9 & KX\r~0G$";WVL$8q** P&܈484($b!B 4)J R854)d %26T_,SG$,i # -$4fIUvlMM2 F5X (5'Ax~l-Џħ 88)$8+@T l-ЏD4:CVd:f&/2+alq#d\sT<Dz<ayD \Dt\BӕUHCbAB C }"7>4G$FbNfjl76@J b%.*4TK0 =PX'L;dTG$N0*;|O} P*O՗  U*(P $g"%Z+*P $:=_C*pQVcnē0R+R<4ܑuW@|6u(Y '"t+6Y'EHsbm#l[$r6>]6]P ,^l)H^`^ \^_v\^ޙ2$'3\_2$:F\P_5MP`_3iru[`@t$D`A +`c{+a#+bO+hc̚7e+c%)m4Z RgE++4i ($j*8-E`T d k4&v}t  \ m ^/*\,o=X|*@o n-#pΛ2KOxe-#$8rߛ\r r . abr# -#s9. H0#$LtF.' H0#$tV/($uU 8#shvj( 25?Ie_w{$TfiK{0x$X0y82fI@0{8 s"1@|ќ<6BVa_}4fsvP%~0>_\0',_\| 7DOmx}T0]2 T0]F$/`SԄU`0ĕ&36BQ#spnVc @75 &_|@7$uЉVc*@7D5x 9_|@7du0 !>\t(@7uŝl 44$]ӝ$&6Sv xX9IWtl\T8Vc@7Ĕ5 >[d_xXul744]G$*6SZ4@6D]t$48 mvNP$T]LFX&CH#d]tR mv[P$t]a#]p ]z(@7d#]s mvP$]=F6SZ@4]4tb#]Vc@7$5˞4;d@6]t$ܞ=N6SZ@4]4D | 74]`=6SZ@4^4"?F@4^sY#$^$}K$4^s3U>[d_xXDuܰCd%BG$D^UZ#T^$d$~p4d^r$~p4t^ -Bg|\TI$~  Hel|@4^t$h#^$ 6^!ػßI6SZ86^t$$ӟFObT84^sHFO^84^slh84^#^sAJ%nG@6_s%Au%nG@6_s$9(7&$_LJ$#6`}64_LY"?F@4D_s(i"?F@4T_s\yHPmv8\xXd$W ;4d_(aPmv8\xX$$'.t_!,V^LZXZě_%à7.t$H֠(?M.Ipt$L( _M (+.pS:*M?H[s@6_7$+}L@4_7\> -<1("V4_H<AO'"p ^ 3g* a9j9n* &\+Dȡu,5_#$ܡ**`#*38*_[ [[w[*) &\+B?F*_bOX_d8jo*ĕXx3*?*_ *(ܢ38*_J.*$t e.*`:&;=F*TZU^e=nDds=E*t(=_`Oh .2=l7|6 t =NY^t+Dݣq~="@4r% =A . tȺr%f$MY=m|l0w4B=_$4Y=>`a T+=afy; 2 =8О\4 = ,d,$5: '*=Ra-m7R,n=Sh+m9]4,_=HP t dL,u=Zfl*$`;x5 x=*4`;|{mV=UKtJ ;x0= _4'=>N^g Q$UL(v=Sh+G$ XlI=\+(=4&"%=q./*|9 4==I\L,*Gclo=#8{*`[U=,S|_>i=@/$<x"=.,_>Ğ=+D`;p='0k#8K=+z@4| =$L,*ç=4:q*\ק =A*P !$'=Kd*Ėior=-Dr%,= PYܒ}I!,=PY}I2,69<= tPY\}I$D,-[=8PY}Ip =R@W\#T`Įؤ e=i@W\#d`T=Sgd=%*4yhܨMVa=y= 9 @ -Dr%*(U _ c =   .D$r%T;   =(  !-t`r%J !!!=-H![!`!-r%Y{!!!=4!!!-yr% i!!!=;"+"0"-ܓr%w@C"F"=BT"c"h"-Dr%jq"t"=P"""-dr% 3""=b"""-`r%""=q" #-r%H###=v"#1#-r%T˩6# ?#={E#T#-r%<,v/Y#=c#_-D`r%\ܩj#s#v#=###-`r%###=#P$###=$%%.%-Tz$|%%=,?%%=/%ZCd%%=2yu%%%=>b%%%%=E~%,%%%=L~%% %=T;%P̪%&&=gE&K&V&Y&=e&H0l&v&z&=&&&`DTU@,0&''=_'''PYh+h}I-'''='((-h+`r%8''%(=9(((-h+`r%C4\(h(k(=(((`h+DU((((=T()PDUr%tc( ))=Z3)P)PDUr%s,c)l)o)=d)))`DU@Sv/)=m).r% )))=w**!*.Dėr%<4*>*B*=***'zr%H**=++-Dr%&+/+2+=H+i+n+-DVr%ի}+++=+++-DDVr%d+)+=+,-DtVr%t4+,>,F,=,,,6DLP(-(-+-=;-J-Pr%L+Q-l-|-=&...@ 4 H(...=&/// 5`r%8\Cd%&/=+yN@,4s(,/>/E/=3o/// hP`r%///=@///@;`4</0 0=N#080A0 Va`4s H0=ZN0tYL$̬(]0h0k0=bq00Pr%000=h00<9;400#0=011-h+pVr%<  4+181<1=2s2|2(`SpHB M!0222=233`h+D@40(3@3D3=h333`h+DV@XD(333=444-D$@M444=[44\+Db ڬ55=g 55\+z5*585=pe5554`(]W$,555=H6T6lRhPP#a6v6y6=a66*a$8666=777[W$a@,777=p'838+;/ <8n8r8=9994W;6)(9<:@:=;;;;C8 <<=1=$=MFHQ=i=m==am=@DId===)=*;I}====N!>D>*\4L a>>>=vAB3B8'Da$C(C+C=o?CJC@`mb7$ OCCC=DD+E$a |8 WmobbEE=BE4ao$EEE=EE@`m`q E F!F=FFF !dW4w˯FG.G=?qG}GG d#;DzbEG=DBEDazGGG=HQHx044 ZHdHhH=wHHH*Ta HVIZI=JJJL84;$^K$K(K=?>KwK$$g,|KKK=RL1M@M 049 8 ԰(MMM=N#N(NL`da8/NO=wOOO@,aWH(OOP=R&QnQ}QH04: {% RRR=R;R,h+l$@RLR=ORnRXQh+t$sRR=RR.h+6$R R=RRHXh+44$R R=RR(/h+FN$RRR=RRRHXh+a4(fsRR=RR.h+6(zS=S!S*h+sRR=RR.h+6S=S!S*h+&S'=/S*h+ŲsRR=RR.h+6زBSNQ=KS^Sl*h+#$ cSf~=lS/n\+h+S=SSt+h+SSS=SSS*h+a+ cSf~=lS/n*h+@SSS=T5T:T+h+pܔhP&S'=/S*h+@cST\TcT=}TTT*h+pWtwTTT=TUUt+h+pU&U-U=:U>MU\+h+aTU`UkU=~UUUl75a$S=SSt+h+ԳUUU=UUUl75a\UUU=U VV*h+a&S'=/S*h+U&UV=$V>7V*h+pX, RRR=R;R,h+?@VIVPV=YVlVqV*h+bS cSf~=lS/n\+h+g xVe/=VV.h+6x RRR=R;R,h+hVVV=VVVt+h+p\ WWW=7WVW[W*h+pW  pWyWW=WWW*h+pȴ WWW=XYd`Vt[ CYNY]Y=YYY\+p CYYY=YY Z\+Ę| "Z+Z:Z=QZޡ`Z*bX oZzZZ=ZZ*$b ZZZ=d8ZZ*4bѵ 38ZZ=?8ZZ*Db\ oZzZZ=ZZ*Tb =*%38<8=?8Z*<< ZZZ=[[[*dbU ['[2[=E[P[U[\+tbm`[i[x[=[[*b [[[=V[[\+b b=3[*T =*ζ 77:=* 77:=*\ b=3[*  j=9g*t([[[[H<]H]T]7IH ;H w]]][^)^lRTG$4^E^N^[m^x^}^*b;^^^`^(^^^`<#_/_; D_Y_\_`6__*; ___`__#Xѷ_`_t_`_X[```` `' `R```\+@ &``*Z*`N3``A`85|6u `k* H`a`f`=aAaMa;BH$(gava{aab;4BH)$!b+b0bjbb;4BH,' bbbc>c;6X1$Kcdcicccc,$X3¼(ccc3 dd$dTX<6½IdRdfdddd0-8wddd&de,9 e"e'eXeme;6BHT<{ve`e*b<e`e*bt=eee`.ee*b=ƿ `&\+>߿ee`e*b$?ee fnAgggq(hK ;`KNh[hbhnphhht+b;\L4^hhnm^x^h*$;Mhhhni i*c;N"ii'is6iIiNil-ЏDO@Wi`isdpPi;|oivis2 .i*;Q;|oiis9 .i*;Q;|oiis@ .i*ę;PR3iiizii@|6c5|SR jj&jz6EjNj(@|6$cuTo$[jljyjz*jjj hV4c9I4V$jjjzj6!Wjjjz3k#sW k&k1kzXVkakx7|66Ylk~kkzkk([kkkz3{$[4kkkzk8H67\QM9k ll2l9l*Dc]HlQlTl9oK`-l^_lllol:;zl$<47H_l;* `lzle.`7. ablS`P. ll# `i$ll m mmm@4emnCn#nnn4o@o{sh%nn>B h%nn:B pinn#i  ni   niF n<#isnn=#ino>#i oo5o `ouo~opf@TЏ\7kDb.oB$ kioko5oo*loooG&pMp*nTpk]pfupo*o pppupp54 q ppq/qNq54 s Uqbqeqoq*@t.vqqqqq*tMbqq q*,umqqq&r r)r<XvBrOrVr@|rrr+$8xrrrPrss+Xz .s7s:s@s,6z .s7sOs@s,68{A .s7sUs@s,6{f$[szsssssPGX#5|~bttB$ ~8!t2tAt^tstzt$76ЏD@bttB$ ttt!tttf@TЏ7sh.btv%B$ ܂Tttu,tttf@TЏܖ7btDu0B$ 0GuXugu8uuuG6ЏdLbtu<B$ uuu7uc<9[:ȇ! uuuMv%v.vRpT~ 9vFvQv[mvvv 74 Hvvvyvvv076ЏĚ bvw}B$ w*wgwwxxDTЏ #4P%vYxB ď$]xjxxxxx4, Rt{Z$X,yJyyyyzzį`Џ{K4Xw%vAzB ̕ Ezczzz {{dTЏ4|U%vI{B p EzczM{z {{dTЏ|U%v{B =<{{ ||||د`Џ|sY%v|B h8|}J}2}}}|qTЏT}#%v*~6B |8|}.~M}}}|qTЏ}#%v~QB X~~hD,T,Џ03 /4%v lB t$L 1Hʀd,@TЏXUزbvB$ L  ,~dTЏUX%vȁB ̶A  ́~dTЏUعb%vB L$"FiтqTЏHUF`%vB Խ4< -PσqTЏr (%vB 04=qTЏ8%v߄"B \e048qTЏ8%v;<B  ?cR pЏK%v0VB h4EdtLo@TЏ71bv׆xB$ W4EۆXo@TЏ\74bvB$ $/S^gT**tdrŇ̇H6ЏbvۇB$ d ߇*Tc,)]r}tЏU4J%vB (sڈ+8Xo@TЏܗ'H%vWB [tωXo@TЏ'%vB L%2Raf2l-ЏY'/s~7J$xZ 0)uʊu076ЏDubъԊ-B$ X׊4pdo@TЏ~4bъ۴8B$ l hϋދIH6Џdbъ'MB$ `4+8;L<44LI$Sknjpo[\T(Ro;7%%25BB @,9<<CR$7W^7j|odc>\ q~#82XȎ   H6ЏDY't$jboB$ p0Cf{ H6ЏtYLbrB$ P܏,H6ЏYt$Lb "B$ |p2'[pw H6ЏY7s|b+B$ P ܏,H6ЏZt$X bÐƐB$ <Xɐڐ  H6Џ4Zb$<vb#oB$ P&9 ܏,H6ЏdZt$b oB$ P&\܏,H6ЏZt$Tb rB$ h$P!d,@TЏtcU%(&B( D .QV’TЏt~sX %(ZB %:̓TЏ~#sd >%(B b **|$14?8D*dKX[i#@]nq{*Ǖ " 4Џ3 =%YqB 4 7\_G$9$gJ`4K 1p՚e#b< = ze.\+ b-{*L!-{*! R*".dۘ*ܘ' 9?8*`-l'T*-:8I$<47(Pl;*)aS!//**X*ZXg(xnh*4+E* ,ZXaxnh*,$Йr|0<<<Џc;.]%,w-]]c /8 8c/3$`D`, s;z?|<,Ϝ#*Z6>UO8@K \a*cG$H?mj#lw3*cG$@}$D3PTH*Z;HǷe-*;HĞp.̞*;I Ӟܞߞ6d8\+I 8*I*`;A`85|6J u_Yæf7JxDhaѦڦǺ*+[\i v/0?\+|i 4@CnIT\+X0j )[r*j_l{94k$֧-HSxf`[n1fw~p,d#$oE;F#$Dp\Ų̃#8بߨ;9d#$qoZu~96\4s$ҩ9Dxf`D\ufwW p,$d#$hw;kF#$wŨq&#8بߨ;94d#$xx }/̪Ӫ,Ĝzު?@,#$z% V*K6{1.&.̞+;8|<.;?WT<4~O :44$b*. + 3.<BQ,6 3.VBQ,6 3.\BQ,6boz+(Ŭʬ*DdDXѬc; 0<l<Td;X]"h-]]ddo .;mG*} LYzy֭td$ (L]fȇdF qz,dK6D Ϯ*؋ԮX18 +t\(GX[m+ds0GXm+d8  ȯݯ*d<85<Qdcܑ78GTodmppd }I<v ȯݯ*d@ ͱԱ,h+6H ͱ,h+$6P ͱ%,h+D6X7UxmHU^Wv}*d#$Rڳ(Z RՇ]XȿK6ܥd;ԧ $32eL0= JڵL;4XM 7dtԅ$;޶0?4D; `c\+̰vgnx*eX*+( :q\+d@$ηշ$-We\Q4QG\ p}%Sռ4ZR $1:>_j+;D o˽ԽW@Z$e۽5*4e :[Tξ,"h f/#De,AXZZЏ\7 /#Te@Pɿ {LZXZ4 %)bB B "4:deJ)26=R@TW[>h\mz<9termz<9etmz$<9e<0sЏ\E;d]6-]]emBU|t #$U#s94#$;ǐvFP$;pzZQĝ#$$D  e.t+;De.t+;D ,J (6;\#$'9JMbw4ZZ`7p;,W*p;ybSx#`>H y/l-ЏeX]*-]]eDx#e8##mJJhmh @ ,$; w<\+d(=3:*D8A f C*T-XFJ*hU MQt+l d\`c*jZ R]  dT#$X`* *I-#$* 7P;|(4]#$PV Y)RYYR#$<ot|;dX8zd8ZQemp*#$ * j!*P (om\1*\ dd<*+ *? 8ADG*8VN`J> (L PX%xe9k%U d 5*&n.CGV.P+e$' ].@.yq.+f'.=/c/*f,(_v/:_\+$fL(*4f#$( %*\)  *t)d!(FH1 +Df$*8?e.H +Tf*k=+<$+8 +s<+X y OZefv*df+u  *tf, [[w * - *$- d\+fH- d\+fl-+A.# n +4@.B$<8?8HXK.`$ Y HX4/*$/ */*$0 *0*$P1' *h1N ^{<,<2j   ,<2 `!49,h+fP3 @IPYlq,h+f63 `x!49,h+fP4 @IYlq,h+f65# `!49,h+fPh6K @IYlq,h+f6@7vk+7 +7 %*p8  *8+d]9+0:4]:5k=+$T;U  +|;x+A < n +4P<$<8?8HXK=$ Y HXD=?HQ_f@,g-D>ox<4g#$P??p,-?^  p,#$@*$g#$@ %*,A  *DAd!(FH1 +4g$A8?e.H +Dg`Bk=+<B* +s CI y OZefv*TgCe  *dg`D [[w *D *D d\+tgE d\+gS\`4Hx/s+t+x'x2@,Ğ4\z; *0| "V6I*} vqNQ-Tc*}!jyhk0 5*} nq3:q*P~=vtw6z*~X՚9*(qjyh< 5*@*8I *؀Q )*T^L <I\*B $ ^**   e.*HG ^*܆a  !e.*l !+.8GL*dh |SV`ot*th{0 75S8 VD+s `  *h7 &,;r /8?HW\h  <8ct,;<  *؎  *|  f~0*\S kWh|t 2Mhu8`7hh X|M*| OpF7^S} #,n8*4 =Mhu8`7hx Xm* q'6ĒܙS@= #O8*4a [t)$ ZucuG-c-i KYe* ly`pF7^Sܫ   +:?+h;Ȭ  F[nB(@|6DK6N  &1.^K6xk X[@* X[D* @HUuPT, H>W4If4*4 ,PB8;h $NDWd`o d X oz_*3,d_T3I a9j9-*Hl]29#8BG-hS. . W ;NQzF#h;NU{F##YbsL"w**i,- **i,$59LS*ğG$(\hoA*G$H/T*0$i;, vt+T*04iG$6# vt+T*0DiG$M3>EUhm+T*0Tidt/T*0di; vt+T*0tiG$ vt+T*0iG$3>Uhm+T*0i/T*0i; vt+T*0iG$x3 vt+T*0iG$dK3>Uhm+T*0iXcD X64X 1RDxchD+D_#$ z[*w+i X64 DxchD+t_#$` *|?X\+c d*i \+6h\#$[QTkxp_4um[4 1sp #!#&7F%axm R$#$P1)|_4y8IXE94`4 R0G4Ds`$l[)MW|l I 7d 7|hlm+`5 7 ?H9i7"/E5 sd)_qu7*C?Fd.7wDD(y */47CRW +jt$8*/\7CRW +jt$ k178W0x.M"7;td m|1C7&Z G$@7l54A!7c%?FRԮdCUb{7[54tD 7S6EJ*E"er7J54tG:I7c"56\H~/27MX56II7c"56$K]jm7656pLG7?56MI7c"56 O/27MX56P I7c"56QL7>56(S7Dx 56TI7c"56U  ( 3 7(H Y d  $jHW! o x  7)   4|6ܚG$TX;    7|J y  X@4G$\N    7~  Ԯ^g   - 7u   R$R _    7 ' 0 R$RԁTa K X m 7   R$R44c  (  7~H Y d  4jd    7& 5 > 4|6G$e O [ ^ 7.  X$g    7`#0,4`0j.!AZ7$LyZ@6 m|s! b7Ib*s! 7b#2EL^mv"$^l7.nV FzT" ՚ c7#bd=szi"mp70*z}"x73B@6 G$}"ir7*d`~"7N@K<LX6"irj7,*`#7?N@K<L6H1# 7ZGRY*I#z7o=FDj4 7l*TjG$Ćb#$!?7@Xo++4 I  |#7*dj#X7L#\+# *G7,7\+hC )#,X72Z# 7#tjȏ#7]p\+,&$7?J\+`3$)47EZmr*`$$7P*$7[ *$a0$$7f;DI*Ta$XAm7q~*a %7}*C 5%9NQ7y~*aPN%7*D dd% 7I #j{%0")7 ^ip\ &8~7@Ġ#$5&8X78n&T&7yN4,mj& 7 Xd56m&<kt7Wл\ܨ&D7#6ph4&@?Rg7:Pq0\ H&D7  `G$#$ '  7E*;d2'U  7y& **;ܷA' / a  7!"-X z' """7_#j#q#* ' ###7$ $*'$-$8$7_\$k$|QpTT'$$U%7&'$'l|L,( X'(!(7%U(((l-pt6$.0(((7'D@Q($ (()7E *2*U*T6|D -`( ***7**+QpTܛ,u((+7|d( ,+9+`+7>,d,,ppE (,,-7<-C-85|60(N-g-n-7--85|6j\(---7  T--0jcD(..;.7...q44X6 ;(///7N-/;TR)=0O0R07^0q0l[$h)+~001777v8'p, \G$() :::7 ;;64)*#;.;E;7 m;~;;dpTa;+-*(;7 ġd,I*;;;7 F,g*H;;;7 ;<<T&H/*.<;<F<7 [|<<*b0*<<<7& =A>n>D #$;* >>>7{ /? ?64\<*l?0?H?7 ?? @P6\ C*ڬ9@<@7  5B@#8D* G@Z@b@7 AIAdA?sK +|AA7zPnxR8jG$L+ AAA7ABB\+N:+%B8BEB7BBB [PQR+8BB7Re*Rr+nBB7*T+BBB7 J.CC+jG$C7SCp6|6kG$V\CiClC7'.l*G$TW+vCCC7/HDPDl* G$Z+DDD7GD EEX@|6G$P\+;E>E7U*G$h\,BE7^*G$\',$FE`OE7jlEEEG|6$F]:,$FE`E7wlEEEG|6DFL_R,,EEF7JmKKr* 6@Xz,dMrMN7>PPP0 || t$,$hQuQQ7hQ RR F,ERSRR72TTT8  t$, (U5U8U7sG\+0,FUSUVU7~dUiU*kG$Ě-pUUU7cVoVuV*tM G$- VVV7W(W3Wp6|6G$`.- TWWW7iW*$kG$pW}WW7WWW*4kG$G-WWW7$7X>X+* G$D-iXrXX7bXX@,6-$XXY7 YYY\nhP 7 F-,YY3Z7#ZZ [q F- Z[l[o[79[[[hnDkOح-[[[7E[[G6. TW[7MiW*TkG$\\\\7X.\3\*dkG$\.>\O\n\7g\\\@, 6̲/. TW]7iW*tkG$ +]D]G]7/k]p]*kG$D.w]]]7*G$@y)Cd]]7yN+G$_.]]72]]]p6|6dG$$]^ ^7E;/^4^*kG$7X;^>^7^*G$.B^^^7d`#`7`*T G$.```7&a2a854G$. :aDaHa7aaa*G$;Eb7-*kG$FUSU b7dUiU*kG$.b2bub7'&c2c8c* G$,.ccc7>cc?4ks.ccc7Pd*d1d@,ܜ6\/Rd_dbd7eVpd*G$,/ uddd7xddG UO7/ddd7dddp6|6kG$N/ eee7AeTeYe*Db0l/leye|e7ede*#9/eee7`ee*Ģ#9/ef f76(f-f*#9h/k7~_kfk*d(0sk4|k7kk*#9L0kkk7m^kk*#90kll7%l8lClp6|6ģ60RlB[l7|lllp6|66l 1lInDeOJM7[rwjTl#$\+7@~7,nTlL7{:7 *lȄa7{:̐7*l{7ڐ7` +7{-47%F*ԇ7QZa7-sx*775 ϑԑ +hT77=*Ħ07'Ed7AŒDnZ9 ,8$-07yDS\5m#$"8clo7hkQm#$@8"7ȓϓ5$m#$_8u֓7*{8ړ7\t;88͔Д7,?|6;8M97Z3V[0ܝt$(8jKs B8jK B8 7a*d9 73*)9 Dž͕7\+@9 7&\+Z97?8ZZl*4m#$ls9]p7#8l*#$(9#,37<KP*TDmԞ938<87?8N*9W`o7#8854$D97˖ږߖ\+Tm 97/Z7+4 :7/Z7+4%:7*dmD>:O 7d8j#*DZ:38<87?8,D+#$v:O 17d8j#*dX:O A7d8j#*:QZe7v{*tm:7e.*mt:O 7d8j#*$:7m9՗*ħ ; 7*#; 7*:;|7*V;7`$)*$o;>$['[7G4,#$;38<87?8N*;]p7#8LP+4X;]p7#8 +;7/Z7@,4;$Q57ZHX4 <>$['[7G+#$(<]p7#8l*<I< _h{7*``<|7*v<]p7#8 +< ǘ7a#(*$<< 38GN7?8ZW*m< ^g7Vo*<js7Mę*DD<eۙ7.ee*m̹ =|7*p$=7*d:=7m9՗*O=7/Z714i=38<87?8N\+<= +7>OX66P=]p7#8 + =>$['[7G+#$п=|7*t=|7*>Zcr7*$(>̚՚7 *teXG>2;L7gBrw*ed>7M̛*ex>|7*>]p7#8*>38<87?8P+4>|7\+0>|7\+>38<87?8P+4?|7* , ?38<87?8*4:?|7*R?]p7#8B*$@n? {<7*? {<7*?|7*<?|7*?|7*?7/Z72SP@|7*+@ {<7*#$F@ {<7*L_@ 7*x@>$['[7G+s@7/Z7t+t$x@ 7-2\+ĨD@]p7#8*@]p7#8LP+4@ AJU7V[d*mA ox7l*$A$7F]b*9A|7\+$XAw,7<KP*SmuAXX[7*A7\+m A7*m@AXX[7#\+TA7 \+lBXX[7*!B! 7\+m=B* < 7>Y ` +nsXBgp 7y *nsBg 7y *$n4B 7\+4n\Bg 7y *DnxB 7\+TnB4 7 *dnC 7*tnC 7\+n 4C7 *8QC4 7 *nPmCXX[7*dC 7\+nC  7n \+$CXX[7*C7\+nC7*n DXX[7#\+ 6Dҝ7 \+nQD7 \+wDXX[7*D! 7\+nD* < 7>Y ` +nslDgp 7y *oDg 7y *oE 7\+$o8Eg 7y *4o\E 7\+DovE4 7 *To4E 7*dohE 7\+toE7 *E4 7 *oFXX[7*#F  7n \+DBF ^i^7 *^F 7*|F <8<87*F a9j97m9*XF {<7854F( 1s ԮG$VG<w HUHU\UP[F 8H  p/ԄFTH4Zuɥ >-۷ovd pHΥۥߥ O,XdI &AE z);BHlI  \c\./fBHJv9 #` Jv {#/J )Rkdd%cJ  ;\+%zJ { ?*%J  H\+&Jd L\+(&J BԪ54(J  ]fHH4T,J ԫ o-J_\#$0-Ke~ * 0CK ɬ 545YK  ,:HD>oK7DG U`q :4?K x h*o#$@Ke%ï ne.ͯ(64LAK ԯ t-uFK ʰٰ "7(64f#$4IL PYd |*o JL  ɱԱ*ĩXKgL߱5 TmHHdf+:4ULɳг #(VL ?\*dWL a *WL e *WM NQi *XM\ p84o4Y.M\ p8:4o#$ZDM( d([[PMɴgҴ VUpT\\M,g0[ 6]hM ^  L/8(^sM&j9/ =lRpTG$_~M$F GTF`M ^a .L/8(aM&j9o ?=lRpTG$hbM$} JGTFcM" U@,f6ddMʵص s)L[HX4hM }f÷XЏ oM },8 DS*lpN-X J.f*I0q!Nkuy *$$u6N !<*$8wINAKO *ey^NƹϹڹ !&*$5{N1E\ @$4 SN+<P %Ѽt @N]p KZHI({ IN #Y] mϿۿ(I)nȘN^   "(h O^   "(/O^  "(RO^  "(HuO>j Vd`$T 5O4^ I Hb4O **8F 6<O6 (/*D;O$>O Wi5Opz 54Ppz 54ܞ(PJX} ,<< 9I)Pz |QUЏ40;P Lcld4HOP V94phP  ymrP] -$o4 P  4M:4P 2TW _*Pfsv 85`9oP vq y*tP  -l-llP  *8Q  )2GoQRcj :E[ +p 3Q J;S`U$RbQ | q*p|}Q  484C:Q  6*JIQGT[ **\Q 9NUP:fl Qr (6[:X Q(+ GOV5#$ Rgps *$pX R  9Yi85`9N hLR L;+*ܟ[:aR Y '85`9ĪtR0IM gRov*4pPR~ ~!?Z $ sR 9R F s0%R z h:7XL )RS_c 0: ,R Zz,*45t0S *PLQfs3'S$ 8Nal 7`9$g5?S { J\+*(| \<mS@QX **: ?S  :KR\+*Tg@Sey P, bA8WSLUY !UUYSP .UU$g4\S%.% /B,\S 3[mp Dx1*]T d 5 *^T6O\ ?*cT$3@c  *gT 09L *hT =\a*g`kU | $*gmVU$ 5`,BHoU a ,$qU(+ (?CR*rUYfy *DtV  *Dp u:V ii^ *uMV f~0 *v^V !:__ 56 zV I_ %56O DV l&_ U#86*V  =_ `:q*l{VbA_ cMR*TpW ]jm_ f*dЃ'Wjy_ n 5*dp4?Wb_ q'p*tpUW_ x *hnW 1>A_ ?oz*W _ *\HW !$_ .*ԉV {36_ 0DI*pWPS_ mgl*Wy_ 74W P_ D+sX_ +4ȏX((1_ `4cX_ A;LpܔY ڬc_ jix#@Y ; }_ nF#Z _ r#9Z$_ v1Qܠ4YZ_ C`o\DhhZC_ w#īyZC_ #Zj_ 9xZj_ 9xXZ_ *PZj _ 9 ,ZZu_ -t+G$0Z (G_ *TܞZ _ "5<*|[ U^m_ *p:[_ +\l\[ f~_ !#4==|6pX[$DW_ *z1Q[ _ .3*thܦ(X NWZ_ v*pEX (-_ S*[  ?_ *8[ 77:_ *|\ ^ 3_ *6\ p `#O\p N t$(\wp Mܡ<\  p 4VC*$d]Ndp $8@*hTS]cl{p F;D*DG$b] p WAR[x] p  xd]#Thp %-=Kp l~\+ql5ap ?+q4{]`o p $ *$q<Oa) 2 G p -l q *pa%7 p 72t$pa   p ?v   <\C?la  A p mu   *+Ĭ 7aP Y d p    *Ĭa$   p 2<TGa0Ygbp x4qap @n4 d |= 7( b{p jHGDqs -bp zPp~; sHb +p `-~(} |bp n^TqsHbp >M`T d~sb{p  6 (~ s!cF_bp 0,B4st#bp Kl*sL$cp R<sh&-c !p cUhm*(Acp {:t$x*Xcp T s\.lca{p 0@s43c!p G s|7cp  s`;c !P.p @g9=c lRup 9>obp Ź*>c p D@Xb 0p '#8\+dqAcp B-9eT(  5`L*d p `<5M?dp 84;NQd7p  8!I!p 19V!c!dpq4|Wdn!w!!p 6!!HUhPY e!!!p ;!!!maq4Z;e!!!p G ""t+[We#"0"3"p O0%D@,4t\ue^"4p ,=" +G$ ]e B"O"R"p O6x"}"t+di#9l^e0"""p a#'#6#D$ܣI dbe0]#v#z#p {kE##\$I Lfe$O")$p 6M$+FgeDR$_$c$p $$ % qsZplf%'%*%p :%+F|mf,A%l%p%p &a%%t4ЏqKC,r7f%n%%p e.%%q rXf%%p &:E*(sof%%%p 9%*sf%&&p >_&x&&74quf(&&&p Z'f's'T`zf('''p h(t((T`tg,(((p ))) \ g0)* *p zA*H*P$I ȅ(g(_*m*q*p ***TȈ;g0!+*+.+p $+++QDI $Og0+++p $m ,,+pTdI _g0++*,p 7m ,,+pTI Tpg,,,,p L-%-0-xpppgDPY---p q0(0O0d6Џ$ p3آg%n%1p e.%%q hg@11'1p 111P!5Hp3h8L 122p 3.3Q3Pf\ =p3h4h333p ,W3r Zh@333p z5"5W53 p3wh$555p 666X8ܤFh(;6Z6^6p 7737̇Q; Hh%n%o7p e.%%r h4{777p ;7 88pԝ %h8+8?8Q8p m\:}::TуOi ::;p )<<-<$+4+Џ; Waki%m<t<p ge.%%$r Xi4~<<<p j={==4`4r|i$===p ==x-\ci ==N>p Y???D+T+XG 7i4?@@p A@L@S@p`GԕU'i3b@k@p W3Dr 0iLHx@@@p H6A$AdDtЏ8p3j%KARAp e.%%Tr !j,^AvAAp &B BBT03jEBQBnBp :BB*dr6Ej$BBBp CC0C=Ch?ĭUjL RCeCCp UDDDgd+ԕG Ap3 j3b@=Ep ]W3tr j(JE]EyEp 3F?FMFp a'j3b@mFp W3r k,PzFFGp HHHH$ Op3 k3b@iIp W3r !Hk4vIIIp JJJ`< m'(Yk3JJp 6W3r \)uk%JJp ,e.%%r )k($ K4KsKp IKLLЏ (/k%JgLp ae.%%r /ksLLLp qMM#Mԕ< ES3k3J;Mp xW3r t4k,HMUMrMp `bMM#Qܥ6l$MMMp NlG4I H8l(N5NaNp NN OTj F'h>(l3J;Op W3r >FlPHOaOOp OOPT-l iS\D\l3J.Pp #W3r D}l 8PVP^Pp PPPR@TЏs7Il%PPp Oe.%%s \JlPPQp XQ:RZR\$gp SlRRSp UTTTH tctP 6dm U*U5Up giUuUzU+f-m UUUp YUU+Lip 77+4DpKp [p`p*s,X[gp *,EX[kp *@copxpp pppL84H$q qq Pqqq4Qs4`[q  q@,4|3q q[b++Mqqq qqq##qqq qqq##$qqr qqq##D|=qq r qqq##dHX[r i#\+\ j 9g*΂r,&r /r*;To4rMr oppܦqr 1 **s|;|r < **s~r D **sr L **sLrhr T*G$X$rrr }r(s/sEsF(?6s@ss tztt* 8Zut +-lu*$Zut 2-lu*$8&ttt `)u*sG$,Z8u6BMu wgBsuxut+tG$ suuu v,v7vR RG$T ^vZkv yvv* v 2v vv+%pˈvv v+tFvv$w {wwXG$@ www cxL;4G$d x,x/x ,Wx,6`(\xuxyx Oxx33DG$h(xKx kxy $XG$(y5y8y  `yey*$tG$lyyyy yyyx744tG$!zz)z qz}zzx7|6$jG$%L,zzz *C{S{[{d`Dt6,*l0c{{{ xa|v||,DD1Ȋ@|r}} Qܛ  3H^(AR] 0{2Tjb(_ʋ p ~Dx\+`0̈́ Ohuld c ȅ ^Ɔ҆4;LkH?O ۇ,į;`py !pp %:,G9p +*G$p׌" //>Fq 6 7*;q9 ;/5r<FI C a854G$4s[for K%mQFPt}F U a854G$tˆш ]#8GTtFw%VY e._*xfor ~*4y8 V zW aωԉ-dtF{y߉ > *<ԇ4(JVZ ,X'X-0 *%ȅJ4=@ Reh?plu a*G$|ŌҌ֌ (x>\F֍ 7m^ t+tt;xϏ$%( p:Imr%$%P {:Imr% 4bpt SlE4ˎώ 09tSؕ,DX\ ޏp`@= S4i K$ $Tbx4eǕG @ڗ2n8 b$) Uhs(p9v+ mͮڮSQk4|@sT+  5*@T+  5*DA + L/ P+l-Џs(BG%2+ HY* C`s+ "5ąПk$GҢXw+ <qDlhO + aٱ*uQI + x@]D+stSpu{hTAXɲZ R$UԲY9Q D+#$Wݣq 5OL844 [ݤhZg l_е0*4Q ;aI vy*ak#D+#$b *3GfmT[Q4lc  5OL84D lhƥ4%EǺ/kui4NQ2]tE4> mm,Ź߹@ú4? O8r,Vx¼ټ)Q Fw.,<HU>lsSuF0y:.J.54yǽؽ߽E4D4{|RR  u!8<>4<i^ .s8^ :dU2>t,tP+sd%E2TQ@f].yq\+p(ZCXl  cJ.f@,470<8?8ldlCpZ }03co2(qzJ.\+v%M#T U{Rdm*(  a9j9-*  dd<* 2 U{Rdm* w dd<* %`,W !V %W -0-v4P CW B#<G|]pTwG$TRgW C $1`pt$d<8bxr 00TmOxe/r <h/:4G$<8br C0mO4r N344G$<-Hr _ThDvr bP R\( 4(/r `9@L,*w"(GT_r m;[r )plhr `8 %!$ r ')*%$Q:Fr -M\*+$w$c r J.Xhn;X)@x"r e9k) E%Yr Dm84w*l0r Ue.V\+Dw(+3r d8o842P+a ^i^r  *x,6?`r D+#$-6?r D+ܨ#$. r ?<[RTwP0'r 6?XRdwP1 4JR9gr SUkuL2.qZr J.\+tw2K dd<r *3h dd<r *<3IXe ~*w 4Xwz ,* 44} @DahR S`<, : * D@<R -@x= nPI0{ .?$o > &O.(" Y8o@Ԋ1SH "Ch *xH Vm < *4X,  *vLoO\, flO\^, &U > a,6q !) 4ldp A4O f N *fj9% S-D+#$`g vy/ w*g3rL }tD+#$Pi * fmT[QDnuk;4" VjIJuLp\  *+wtq~ D L,*r )< ISf*tnsy |fl $h}Xps */~(  "Q0Y? H( 9RuP`!I =e/ p;4V x$7 +Xp<M q*n "\PIR `bq܈#-Lzv q~a&##( -Sh'(0 chsq RSw,x 84w4 Of4H wt 74w<P  "*e%z /e.P$ 0  8 ȳ60 )4- RS<z KT Gr{84$#$x( *:AqDS @f]P ^e*w U{R p*T* w' j*K \++wn  *+w Z \+w(#,3 (lJQ*xG$`Xel <; +xG$  Y{ G$=\uy +4_  *La <eL5p? $  EX64$x% ' *G( ?66$)( $;htS  w( ,  Kd( ,exI ? |( $*n$( 59\m4T BHId( ddd,d ( (8M* 9Tg{( 0 a(( Qnw66o  /< H**0 $ WTUFl 0 x744x;X  &/6 /?FX6`7Dx@ MR W 5blp * Q  (/DgЏܩG$8 \im 5St+#  (MV0ܠ4o& Mu =l+x- qGTX dg1 R '.h+62  {< H\+`3  l^ W/\+D4  0  , \+05 +1 B M 1 &p   X6<7Ȓ`6 ?   1 8   54dos8 Z  # F 1 H   54s: tB [J xTQ@;   ' Je t { p84oP<   /JHOP+oh=  /  J   +D> LǷ  J c *Tx> ,  z J) L W T(T B U  >JpLadHM 80G XXJ5$_zdfb8N 8L   JH[dY@TP\'JN dy"J""""dxO   Jt|Pĭ 58PT "dyr$J"""txT  ~$^$J$-%>%ThW 4 Lz JX!2t( E8\ dy'J"""xl] HJ@)0.(_ UfJ% PЏ? Da dy)J'"""xa Z 5FzJYXT c JJ <4(d ($Jx (J Lg f$/oJ[J 8`j H-J -c*j ]L-J. .*hk =]LPJ.yq\+k TXJp ,5$l \LeJg. .m*xm jTtJ5 xl*m }Jd8V,hn }Jd8o8.5$o FiJ ,x5$o }JXd8o8.5$`p *TJ@ xl*q m.JCGV.P+xq O ].J@.yq.+xr .J=/c/*xr v/J:_\+xr .JCGV.P+yHs  ].J@.yq.+ys g.J=/c/*$yPt v/J:_\+4ypt .JCGV.P+Dyu  ].J@.yq.+Tyu .J=/c/*dyv v/J:_\+ty(v  dd<J*Lv N ?/l^JL/W/*0w  'J*x  dd<J*,x  J*x v dd<J*x  'J*y  dd<J*y } ?/l^JL/W/*z  ?/l^JL/W/*t{ T dd<J*{ "J| $ Jf.ij} $ )-JsCf;؀ % mJ0пd0 D$iJDY$U& ^$J(-XQh+y;H $4J   ffy; $!!!J]3!Z!_!,h+yG$< vyf!Jj!-\  ?o!J}!-  !!J!!.y c,!!!J;"z""PYh+P@ w  ,@"J"fPYw X vy"Jj!-x "'["J""-h+y< z Y "J"-| (# #J#B#PSĥ 0M#t^#Jt###6y9 #tG#J$c$-|  @ $$$J$/%-V Z R%h%l%J.%%-V ذ u &(&+&JBK&v&-V|T &^&JL&I'-| x'''Jg'>(F(-Pp ܺ o(((J(M)-| , & ))J)))-Sd%ot C 8))*J***XD _ $U{0+?+J+- +++J+++-S$ph  ,,),J,,,.Tp  (,,,J--Ph+ܪ I (-->-M-Jx--Ph+d v ---J.=.B..Sx ,Y.3w.J"...\YS$@ ,...J_///6   ,t000Jq000l 9 ,1"1*1J2(242(fL f c2v2~2J23%3hYp\( 4@T3JZ3i3tY (n3z3J333PSp 3N3J 4,4<9;4 414>4{4J*5F5Q5>>Pf,ДT ;@,!0.? 2:?JH?g?l?XT*zJ-!(0s???J?9@?@YT* @1!o4r@@@J@.A9AtL5!0UAnArAJA"B3BHK !);NBJ  4,4<9;4t@!8BwBJBCC @q B!4,=CJCRCJ!CCCXSJE!SCDDJ(vDDD8:pԍ4\I!w DEJ6E3EMW R@n!,OMSM? *{hn!G,8ZMaMJhM*{o!t,qoMJJ.\+${o!, i^J .<Hp!,ZJzM4,;p!, i^J .<q!.-ZJzM4,;0r!d-$R RJRRHXh+4@s!-$MMMJMMMHXh+4{4Ht!-sRRJMM+h+4Hu!-MmpJMM*h+v!-KMJNN*h+w!-SJS!S\+h+x!.N#N.NJ?N^VN*h+D{y!.sRRJRR.h+#z!5.UaNhNJqN>MU*h+T{p{!K.NNNJNNN*SD|!d.NNNJNNO*h+d{p}!z.&S'J/S*h+H~!.OOOJDOsOxO* X$!.&S'J/S*h+!.&S'J/S*h+ԁ!/&S'J/S*h+!1/&S'J/S*h+!O/&S'J/S*h+\!k/OOOJOOO85%\!/UaNOJqN>MU*h+t{!/OOPJP)P.P.S{#!/SJSSt+h+!/SJSSt+h+܉!/5PmpJMMt+h+HYRQY5 YYLC!/>bYoYvY5 jYYX,$;8!C> YY5 o\+!_>YYY5 %uZZZX+ O8!{>  Z5 T$$`!> $SZ5 XP$$p!>Z5 \#$!>Z,Z5 `Z<^!>,,Z5 dZX,$!?0[#[8[5 x[[[r5L!1?Cd[5 rS!Q?*[5 []D!q?0W \5 D!?% \5 !\B\!?52\5 8\t+!? C\P\Y\5 \\\XL$|H!?\\\5 !]>]G]dhVO(! @h]pt]5 ]]]0-S4|$!2@ ]]]5 ]]]0*4r !D@^^)^5 P^_^f^X,*dr;!V@ w^R^5 ;^W$#0\!q@^~^5 0^4,#$iii@|&Ql?"3N$ijjE 3jk*kat ZD"dOkNkE ckkt+E"O0kkkE Qlglrl@q̐ I"nP lllE .msm~m84nnn[pTA 6T"HQ,no oE ooTq["|Q oppE pp ``"Q,pqE j5qJqSq$,Tgc"QtqqE qq6w*"UCwPwwvz}}^qP""U~l-Џ":U~3:,'"TU~*|"pU0@~~J.Up$"U. ~#4"U. ~:D"U. ~T"U.  d"U*I$Џ$5L"U D<г" V((A]6Ը"V kx*G$p".VO\ą-|Fؽ"Vp},ځԅd|G$"WCFM::}4"WdTՂZxlI04 :"IW<&]dDU}P"bWl4-Sr@"tW$ )O:4d"W`U΅`-ԕ',"W\'*`"W.;>E[H. .78p"WMYhV$}"XIņ. .78"#XMYʆV4}"EXEX$84Dܭ8"Y JW ;E+*4"Y6ĉ*"Zɉމ[ĉ*".Z< KVS}I"AZ4ĊȊ֊deI"XZH 8@ nI@|rfD"lZ(Ћ+n~P"}Z@N" _@ #[Pg* #1[VYgn*D}  #j[ u-dT}m #[(ɏΏ Vdd}St #s[$@Տ؏J.i3T#[,( ޏ- `;B \#[ !:0#\44*JWIܒM\n@oY P!#P\]  x.'!#v\q/#t}@|"#\#O,m##\ 0<?Ym^[,VTX,$$#\%vdOB$#](h$_ Vķ9I-#9]$0ݔ7j|}5H4#U]L O4#w]g*45#]Vgn*} h5#],ŕ$@4$s;#$^,–IR D_}A#E^ ̗ؗۗ-S$mB#P^ ̗ؗ-S$mdC#a^ `!Ic}dp?8B ;M#}^ Ǚʙ 854G$N#^ 'UMT*}G$P# _ [ds54TsG$R#N_,Ě;i-8VLyYW#``ԛ`%8}YX#`dC\`mo$e`Ʊ\#`dŜnʝl^tƱd#`l0ž YoHWPq#`(q|x7`}$Pt#aؠ +$v#gaD/Jǡ͡*B ?hx# c\*F)?Yd_9Dy8#tcu~v*T*}#d dEI|T9#$#-ew֎}D#Xe ĤǤ,*#ze\ϤMn}_s#e h/*d;#e̥s~#$#e0٦ݦ56Ėؖǂ#eERlMçҧps;#f8 xaȪ۫ H p E \#PfL5ADJ]pDV}$8#{f bknxPPV}$̵#f"w֎HH#fج߬~ #gLI(<;}$#1g&-w֎$~Lh#gg,7CJ5Xkr|64~ǂ#g0yϭ;ޮ-$:Psǂ<#g 9)d ;#hFP  <#%h [lp95D~4#:h Gвx94p#Lh ٲܲ/.*#_hUT5$+44#h<EZCp\VQĸ48#h$IӳdhV4#h N-BItVQ#h \T-BItVQ$#h<vZƴʹthVD#h8`07Qd#i8Jf07Qx#1i<Edlp\VQ4#Di$?~rµɵQĹF#Yi ܵx-BItVQ #si ~-BItVQX#i4%@U\Q$r #i0o{ȶQD #i0o{۶ȶQd#i (-,h+T~6<#i 4(-,h+d~6#j >(-,h+t~6#-j,PH,Uo$ (#BjjǹD~#]j]6]hVЏ~$xj{Ox$~PP$jǺ ѻ`C $j\ir46~$k`P$; $k*; $-kżͼܼSV~ $:k"=o8eLeC 8$Hkݾ 7Ex:|6t$kѿlRV$k1*h+;$k6\4RAܚ x&$kjtL <('$k$9t$;+$l^jĺt,$:l{076Џ';.$Ol^8/$ol 'xF*6:0$l1>BXTql77t2$l1>zeTql77`4$lq6:5$l ?JV~X9$lUjo ;<$m5xI)Џ+$B$ m%B|B$GmMp}6:K XF$amZ,hL #$I$|mCv(DtN$m: :6~4pQ$m0<{d{l74$S$m$~4V$m'@nIJtt4[$m9EIM[8H\]$nf4MJЏ=$c$nU_ D<c$pU54T$Tp #p$ip 9[#X\$}phz*Vļ;$p ,&(?;$p n#"#$p fw$I\+($Z/*$pJ;4m`$p&/f;LQ:4D$q XehnzVhV4$(q$z4hV4 $?q4 8DhVS0$Wq ?LOe|VhV$q$ThVF$q007dhV$q>PTnh$$q;6;$q7/*$q-:=";Ft+x$q KX\-4x$(r4K8tVS$>r CX[Ws(;8$Tr0e$kr s+<G4;`9uT$r(qNQ=W^ $rWu|@;`95$r(qN=W^ $r 0@HW,;$r$~RW8x$s00CGS$#s+)J<$0st+$)J$=s FSL;4L ;\$gs0(TX<Qp$sl}x-)J$sd~?ܗt$sCBw֎$s@E[.M($t0 Ghoо|6D6$%tT~(5d:J$;t8L_uLJ]J$WtT0mܮ]Jt$stV!WVm$t$-E`e`e`$%t(6%t!36Zw~x7X;4;%t(" (W<%t04W %u0*<@htee%u;4,#$%7u01\i $4W %u'.dd8>E*8%v}PWbej%%vs|N**%Hv("%cv$(?Q$$%v@Hfz,D$,(%v( %Q+<Tt,%v('?SXDTd/%w(|(Wd/%Kw(B_D2%fw,l~,t4%{w@ (Q $=%w(8]u5El@tC%w(]+]kD0@uI%w(U\-T:TĽtQ%w0!:?8.mS%x(Zcp5(W\T%Nx0=XW\V%wx( F'.dW4u W%x$9BOWgv}pWܯ\X%x(Zcq(WY%x ;4G$]%y *$Snw-du_%-y =gD.uu<`%ayMP.\5la%y/:]x85|6e#%\ Bav#$ %i /!6`*%|;HPazT**s%gd8%")/l-ЏĿp%FP' <%Ճ@[ā.%(H\0W % $L)B E ǂ,&% pJJtG|&Aiv T**vb$<&X  #L,*T&w 2 #L,*$l&GY-l44D&G3l44d&G9l44 &̈́?  44&ۄ ' A V     XR#$t&   8!)!0!8|6$|&C!U!e! !!!t+Sԁ& !!*#&& !!!,1"="P"v!&Zk"o"7*"&<x"""T"";4m%&O"";LQ:4%&j"""#'#XQ#$(&"".##'#XQ#$8*& J#[#g#}###74+&Ʌ #####$74-&#$$##;48/&#$ $##;4 0&0.$?$C$Q$n$:42&R#$u$##;4 D4&l$$$$ +4&0$$$!$$$ Rڂ6&$%%b%%6%;%:4x7&߆H%Y%a%ky%;4 9&%%%x%%%:4$:& %%&!&8&?&74$8<&H vN&R&*X<&` V&c&q&&&&,h+w6L=&&&&&' ';4D>&'3'@'l'''4_$C&Ӈ'''' (486;E&7/(#(*dF&H(U(Y($b(t+LG&g(x(|(/(p,#$H&+(((90(p,#$lI&B (((@(((D.4uJ&v$() )NY)s)~)D$XDN&(q-g)Q=W^ O&҈)))|j)D+#$P&))))* +R& ***2*C*0X-P-m-ThV`m&$t----HX4<C<ă&XJ<N<* &4T<f<j<~<<XX5&R(q@vU6=W^  &v<<<<<<@;`9ԃ5t&(q@v<=W^ &<<==8=?=XQ&ّ<F=Z=o===XQ&?===p&  B===*&# i==>*`&u.>5>RE>L>5&C. ^%S>b&f . W>Z>#}$&^>a>9#;&Ò^>a>9#;$&^>a>9#;4&!^>a>9#;D&K^>a>9#;T&u^>a>9#;d&^>a>9#;t&ɓ^>a>9#;&^>a>9#;&!^>a>9#;&G^>a>9#;&m d>h>l>Y*;&~(>>>X?k?x?ԓ^ t&,????@S&@@)@8@=@\&Δ U{Rp*0& !NNNF@*& M@V@ÚMY@*`&  z*&) `@`@|*&; *&U U{Rp*&l d 5*& c@l@ o@*X& U{Rp*,& v@(@* &ϕ @@@=YA}AA;$BH'O(AAA%BRB;4BH`'x$]BgBlBBB;4BH ' BBBUCzC;64 'ږ$KcCicccc,dx'3(CCC3CCCx'D D!DQDfDkD0-D'~DDD&DD,l'ԗ DDDE(E;6BH' j9g*'1E>EߥO,d`'. CE^EEz);BHt(' cEpE\c\.XxBH-'Ț$<8uElX2X.'$Q5ZHX44/'38<8?8N\+/' ]p#8L*40'|*H1'7EEEl E*2'[|*2'z|*P3'|*3'|*4'›|*<5'֛|*5'EEEEEl74$ 7'7/Z+47' {<H\+8'$EEEF+F0F\+9'3=FFFQF NnF\+:'A }FFF~FF*P<'T FFF-G4GX64X>'i MGZG|GGGGXR4A' GGH)H(unnny Qnnn@,X 4A(+oy kq[b++A(y 3oy tJ.tJo#LB(Qoy z#\B(/Uoy |#lB(NYogoooy ~oooTjpT4$E(io0[oy op]Q4pF(p#pFpy ppp*|I(qq)ry tuu*4X(ww"w *wY(CdKwRw y\wawt+;)?p}J`Ýҝٝl77`DG$P)b"Jo`g*G$)JΞݞT9`9z6P )0)JZ[b`l9@ܲ"),yJ7FcG$d&) kJ .p)>XG$l+)?,OtJȡաcc$?d/)iD1tJ@2 mdmm, G$C) 0եJJ4TL4m p g$`)өJW4(h)%J~!otL T x)G$)BJ< t+G$)_'@CJx}*,$){ů0J6XtTHhH( G$()߱J8Ybx9,)jʲGJ&K| G$X)@Jjڶzhl ;)8$,9HJ_rw*l-ЏL)TJ!7Jx){0J%ָl-Џ<)%۸nJ'B|) ޸J Ĺ߹DcP-) JV/@TT;)IVeJf94Д\m)6J.E[Ϻֺt+)V$ݺ J9h4DԖ4)}ۻJHY+Xl):qJTDr,tY 4()Խ JJhCTTD)NyJo̿ 9,)N+7>JG`i9t5D<)vtJX,$)J*$,)J,<;)0JL\;\)0J cl]%)/$)GuJTT g)N(BFJx)p@J8Lx?( l-) OJqu$5  ( *JZf m48 *E J-8 *p J-<* J%-X*\CeJ5JP0n Dz;Y* PJ)4 pF 4 *$,sJiUP? "*K Jy,Ltz#$** 4J:857ܳ,$`-*Jk#_|m1*9XJr 5dtF m<6*lJ%: #$h;*YjnJ94F=*JDx49DG$P?*Jx98\C*T [J S .L (+Lxl*<-?CJ'N5Tm*S`dJzR Uo*L$JUx@\(O ;y*  J 5#9$z*0 <IRJd8`e#40{*V4l]J[4C ^؁*~Nh?J * G$*D]JZ+D G$*SJ'X,4Z ;* /LOJs**<*  UJ|#X*7 YfqJ#8 L*D*XJl**(LJU1<*JI 9t5D$#$\*0%J(n|Hx%8*9Jl*$UT|*f J #*D#Jq1XPtn4L|*lJ4`7;*4JA{h# ,$ȺFD*JJ5 5<*$JR.KXRR*$qJL.KXRRܴ$*ADJ Zf@)l)nL*g`J5w*L,*J6-:RR\*`SJ)w*L,*[J*-:RR* `Jw*L,D*3J.H|*`MJw*L,*UJ-:RRܵx*(J} S0U\X**<+>QJ dzF*h0J(CH$U-dz@*<S_pJDFp*J4d*!J-**t*4FJJbwЏ*J. .**`* J -54T*=NauJ Jf {  \dG$| +P    JC _ t pdG$%+o(  5 J ' e x_.t@N 8+ J l74G$9+ 2 b J H ] 9@@+өJW4H+ L J*I+] J xK+I J`e -L+ ^i^J *|M+ a9j9J ** *  j+ 2+ *ܶ,0M+ V+ a+  |}+ + dY,+ + +  , , , S. l,,FHE. W. ^.  Go. . . ,,. . .  . . *4$,G. . .  / / *,@&/ 3/ p/  / 0 0 d*PG ,,HY0 l0 0  51 1 *1 $D, ,1_bY1  \+ ,P_b`1  '\+ ,og1 ]p1  61 \+|!,X[1  B*!,} 1 1  E\+!,} 1 1  M\+!,1 N1  1 1 l*",m.82  @2 i2 n2 8+#$$,{2 Y_2  2 2 2 F4\#$4&,3 5y3  =3 `3 e3 F45',n3 {3  3 3 3 05<),3 5y3   4 ;4 **,CB4 (&O4  u4 4 *Ċ@,,e 4 .84  4 5 P+Ԋs-, 5 1'5  M5 ~5 P+sd/,5 5 5  5 6 "6 (67G 1,?6 H6  6 6 6 (660H 3, #  S*<4, U{R 6 *5,.6 7 7  7 27 77 d{5,F7 O7 X7  w7 7 7 FP7,7 a7  ;7 *G$8,jy    57 #|8,7 7 7  7 8 :X:, D!8 .8 28  A8 M8 ft*P=,9Hb8 o8 {8  &8 8 8 dTZA,08 (&8  Sa8 P4S(C,(8 9 "9  [^9 t9 9 3o{ >  ^[> `> $$b,4q> > >  *> > oDT|td,*`>  !**xe,> > ? MI&? -? 8|6D8Pg,48? E? M? MZ? a? м8D4h,*`h? M!**i, a9j9M-*Hj,(l? 3u?  ? ? +|O\k, \? ?   @ )@ \xm$l, B@ K@ b@  )@ @ \xmܷ$m,@ Ql@  2@ ,;@n,@ *G$Pn,@ y@  @ *o,,@ @  ;p*o, h@  w@ *G$hp, 7@ A  A *DG$p, 7@ A  A *TG$pq,vqA "A  yi ,;q,+i*A -A  E[FA *K6r,CKA XA [A  G|A *ƃ4t,VA A A  &%A *K6Pu,iA A A  =eB *ƃ y,{mB zB ~B  B B *ƃ{,B T B   C *ƃ},C 5R&C  R~C *K6,C C C  jC C *dK6x, C D D  NND UD *|K6,8pD yD |D  3D D G|F,ZD  ?e.D *K6H,q D T D  O D *$І,D E E  zE E *ƃd,E E E  F F *}ƃ(,F ,ƃ,F F F  &F ,K6,F F F  ={G G ,ƃ,G G G  :G ,ƃ,G G    H ,ƃ\,%H 6H :H  ^H ,K6,3H H H  ;H H ,K6,FI (I D  NND UD ,D}K6,k,I 5I 8I  36PI WI $Gt}F,{ofI iI  ?{I ,K6|, D I D  O D ,$,I I I  z&J 2J ,ƃ,;J DJ GJ  J J ,}ƃ,% 4*,J J J  SJ J *ds,38<8 ?8,*#$ȩ,K K K  3 |K *t,/ $K -K  ;Y DY KY MyY Y Y ԋF@,T  Y Y Y M?Y Y Z F,t ڬ`X Z MX 5*, ڬ`X Z MY 5*, ]j!Z $Z MZ(Z  *@- 3Z 6Z M[+4- 3Z :Z M\+4X- Pռ>Z AZ Mf_WZ >X-$  vfZ iZ MrP$ -5  ՚mZ Mv#bwZ P$ h-M  vq|Z Z M}yZ P$ -c Z Z M - 0DZ MH dQ@-   Z M*-   Z M*- XZ Z Z MZ Z Z pQ8-MZ [ [ Mw[ \ (\ 66ЏL -h6\ A\ M7Jx -Q\ j\ \ M\ 4] E] 8>T! -%n] MB|D-!r] }] M] ] ] $-c] ] $^ M_ _ _ Ԑklt p-%` M,B|-r] ` M*] ] ] D-6\ "` M7Jdx< -2` [>` MM\` ` |Q4"-.` ` ` Ml a ;a Ha   t%-?qa za Mra  %-Ta a a Mb &b /b QQ\ (-{Bb Kb `b Mb b b **~*-?qa b Ma  (+-k (b b M?8b b *^+-b b c M c %c ,5!,-2c bc rc Mc c d 01-d id d M(;f hf f Ft! <-g 0g Sg MGg g g @P;?- h Dh Xh Mh h h `pDB-Mh h h Mi 1i D-y,>i Qi hi Mi i i TܸY 8G-i i i M/;i +H-i i j MKj ^j ij 65$ I-Tjy|j M 5{R  \J- j j j Mj j k e(L- k k M>k Ck #(M- -IJk MJ.f\+*M-  Pk M*M-9 Tk lk {k Mk k k QQ\G$P-p l 1l 5l M)`l # S- el zl }l MW|l # DU- l l l Msml #tV- l l M:q*V- l l M:q*LW- ql Ml =,6W-' ql Ml =,6tX-J ql Ml =,6Y-n l l M*$Y- l l M:q\+Y- l l l M0 74pZ-ڬm m M 5*Z-  m m M#Z-m m M#m :m Q4\-DCm \m _m MUm 54]-lm m m Mm *G$,_-(m n En MTo o o dI 4j-8p (p 8p Mq q r !!(r y- Zu.\r MC-lu(,$@z-2`r %s s Mbx iz { <_  F -3} @} G} Ml} } } QQD -} } } M,} ~ QQ4-~ ~ ,~ M=U~ f~ o~ R Rd5`-0~ ~ ~ MK~   R$R -S& 3 > MbP c j $76Џ ȼ-pu ~ Mdl-    M  54 - # M3 D 0R] aD.* l u x M H7Џ.T hT MSˑ 8L`+4.w u MU. h   M[` } tD. , Mu ʒ ђ `4F.!ڒ M   66Џ.:!u ) M$.e!: S n M T76Џ#$@.!u ԓ MD.!  M;K f s d~ ".! MAk 854 %.!;ؕ M ( / `RTT'.8" 6 C G M>/P X6`7<(.Y"`W ME  8 X>$  G$6.# ˘  MV { Q^~G$l;.# M֙ lRxRG$=.# M7 F x7|6?.#Q ^ h M *4A.$ ͚ ߚ M # ( *\B.=$E d Mߛ  p$"XP 0G.]$. l Ɯ M Fh$ 4O.$% 2 d MB ؞ $^Tl R.% L Ɵ MM 7 J RX"L].<%  Mv2 O \ RR_.h%u  Mp̢ RRܺTb.%  MJ2 O \ RRd.% ; MG2 O \ RR\4g.% e MD2 O \ RRi.&0 MX  l< x.+   ! M[y G`.+ 3 Mx% ` z ,<Ա /j, M D4X/, M" 3 < RRD/, G X \ M ~ L\H /,- M4 R4\ /\-    MJ, ? X /t-D MX X6 J 4/- , 1 M l|7"/- X  M - RH$/- 8 I M MV] \+%/.b t | M 74;,'/2.$ M- / : Q~fp)/|. M  M/A { ,<ı h7/.  E M 74    P~x/4. k MY_ L>dL /4  , ME V (66x/W5 g z M LD/{5    M%#b */5 " 0 = M,f } *ܼT/5 X Mh @ % 5 ,/ 6k x M\ 1 ; Rl /86$x Mn.KXRRp/i6 Mi2 O \ RR\/6  ) Mdg 54t/6 M_ " / RRܽ/6H S MC?8e l 5 5/+7w ML 5 5d/\7$x MN.KXRR/7 MDS 57x/7 x  MF.+ X54\H/76 ? F M8R **/"8Y c M9 54d/S8Cd  M/y* **Č/8 1 M02 O \ RRܾL/8Cd [ My* **Ԍ/8g t M  ( RR/9 x e M!.+ X54t/F9Cd My* **/u9 M2 O \ RR\\/9Cd My* **/9  Mg 54h/:Cd My* **/5: M?80 57/f:7 L M-:RRܿ/:Cd v My* **$/:  Mg 54 0:Cd My* **40';  Mg 54\,0W;Cd  My* **D0;  % Mg 5480; l M2 O \ RR 0; M2 O \ RR 0<Cd My* **T 0?< M2 O \ RR\0o<  M2 O \ RRp0<Cd 2 Myy* **d0< < Mz2 O \ RRX0<Cd k Mmy* **t0)= u Mn 5<7h@0Y=) > Mpm RR0& Mww t+<0= M~ t+`0= M Y |o 4<0>dy | M\+=0J> A M  E < |G W0;@i }  My $ x \py0`@G T  MTb   RR 0@$x  M^.KXRR\ 0@ K MW2 O \ RR0@ z MD2 O \ RR0ACd  M<y* **x0?A  M=2 O \ RR0lA   M6( E L *\,0ACd c M.y* **0A o M/2 O \ RR0A   M'( E L *X0B   M; X _ 5<70EB  M 2 O \ RRP0rB   M( E L *\0BCd  M y* ** 0Bw  M  5 5č̚0B$x  M.KXRR@0$CCd , My* **ԍ0OCCd 8 My* **00|C) D Mm RR0CCd s My* **(0C  M2 O \ RR0D .  Mg   |bd9 \4ij0*Ddy  M\+0UD   M_#  R 0DCd $ My* **0D0 =  MP   57 h0D  M2 O \ RR\0!E  M2 O \ RR0XECd ) My* **h0ECd 5 My* **$0E) A Mm RR`0Fp   M   \> ] 402F  Mc% #P0ZF* - Mi,4h0F  1 Mq_#  RX0Fh r Mt ! ! * 0FC! T! a! M|! ! *L,Ȓ4X0F  ! M_#  R|0$G\! ! M" " 57 $0YG," 6" [" M" " " 5<740G " " M(Z  *0G " M2 O \ RR\0H *# M2 O \ RRp07HY# s# # M{$ $ $ S"( 4 0hH  % M_#  RHD0H u =% M 5<70H% % O& M' f( n( 57 j1 ICd i) My* **41DIw u) M 5 5DL1I$x ) M.KXRR1ICd ) My* **T81I  ) Mg 54 18JCd * My* **dD 1sJ  * Mg 54\ 1JX* * * M!+ , 0, $G, ( 41J, , , Mq- %- l77$1K.- G- K- M- - (644|1/K  - M_#  R1YK- - . M]. . . 5ܒt"1K. . . M. . 58G $1K. / / M!/ 4/ 5LG%13L;/ G/ J/ M<P *Sܒl&1|LR/ U/ Md8o855'1Lba/ M*'1Mi/ u/ x/ M/ / 5`GܒT(1]Mb/ M*(1Mb/ M*$)1M/ / / M/ / 0 S S@T4*1N 0 J0 s0 M1 C1 S1 l> $11N31 1 MC1 l74$21N1 1 1 MO1 *421O  1 M[_#  R851+O$2 ;2 M^2 2 2 5<7|71\O 2 M`2 O \ RR91O2 3 3 MhS3 b3 i3 (6<7Ȓԙ4;1O 3 Mw% #<<1O* 3 M},4T<1P31 3 M1 l74T=1;P3 3 3 M3 *4P>1hP  3 M_#  Rt@1P 4 M2 O \ RRB1PI4 R4 a4 M4 / 4 p6<7Ȓ(4C1 Q4 4 4 Mw% j5 R,SH15Qu5 5 5 Mx6 6 л4N1cQ  6 M>_#  RxQ1Q6 6 7 MAd7 7 7 5<7S1Q 7 ME2 O \ RRV1Q7 7 8 MMSP8 W8 p6<7Ȓ@K 4W1R|8 8 8 M_Ǻ8 l74X1IR8 8 8 Mo8 *4,Z1uR՚ 8 M#bwZ #Z1R* 8 M,4Z1R8 9 9 MN49 8S#$`^1R 9 : -: MB: : : RDS$c1,S,/ H M M p,@bF|i1sS: *; |; M= = = @#d #$x1S F> > > M7@ @ A 4,K 1 T,FA jA oA MNA A b-Ȋ1$T,A A A Mmm^B B 4tU@1=T #B t1W 6U ?U IU M3YU ^U ,1xW eU nU rU M|U + 1WU U M 1W U U MU d 1;X U V V MKX X X @x( 1vX,Y EY JY M|Y ؂$41X Y Y Y MhZ Z Z GG2XZ c[ [ M#\ \ !] l8<^ 2AY a] ] ] M ^ ^ * <2eY ^ I_ _ Ma b Gb ȡ .2Y b b #c MFd cd d \L  :2Z d d e Me e e G08B2UZ 0f Ff Zf Mf f f PS\S\E20[f f #g Mg g g @h!lK2U[ h oh h Mi i i Ȝ(\ V2[ 5j Oj ~j Msj j j RhSDX2[Xzk M.$7X2\$k 9k Dk M2yk k k $tS7[27\Ck k MNwk k $(\2k\$k k k MRMl jl {l $k$_2\l l l MlIl l 44G$`2\l l l Mv/m Bm Qm G$c2\$bm m m Mm m $f2\ m n Cn MFo zo o ttPxQ 7q2)](o o o M p -p 4p Ď7Ts2b] ?p p p Mr r r GLTQ !02](r r r MxVo s SԎt$2]s s )s M;s Ns Ss +402^(\s _s Mm^hs 84420^$os {s s M$s s s 0@F2\^s s s M-s t t P`882^,$t -t 0t M/ drSF؆2 _5t Bt at M>t t t +}$2)_(t t t Mnu bp %82:_0(u 5u :u M3cVwu u h  42k_ u u u Mhu u X,X2_0u u MJ#8u S 2_0u u MJ#8u S А2)`8u u u Mo#v /v cLux x x Mx x 0d2`cLux x x Mx x 0H2cHx x x Mx x @|6\2c,]y y M.^y d,$F2c y 4y 8y Mm^Qy **\2cXy my yy My y y Sz (8Px2ad Ez Rz Vz Mfz 74L2~dmz z z M0{ g{ ~{ Dd T-d2d{ { M2d{ { { M/| !| &| p,\ 2d9| J| R| MBp| | | S$RD2eh| | | MQ| | Tdp2Ae| | | MY| | (64d2oe| } } Mf,-} 485;,2e6} C} K} Mw]} b} +T2ei} {} } M} } St2e} } } M} ~ L8`72f ~ &~ 3~ Mm~ ~ ~ 07`(#$/D2&f8~ ~ M8] ~ D2Vf~ ~  Mo  ҁ pi 042f , Mm RR2fw [ b M 5 5dt2fp } M ƃ 5<72g Ճ M2 O \ RR,2=g. . . M. . 58G|2wg. / / M!/ 4/ 5LG2g;/ G/ J/ M<P *Sܒ2gR/ U/ Md8o855x21hba/ M*2shi/ u/ x/ M/ / 5`Gܒ2hb/ M*2hb/ M*2-iw [  M| 5 5t@2Ti$' < M~.KXRR2}i Ճ i My2 O \ RR\$2i  M3 ʇ 4 G$3i M* & , \+S|43iI Y \ M<l 46L43j0u ME  * -bSt3'jA R U MeE[m 2? 3Jj(t Mr  ) GDSP 3mjKkD M* 3jL Y ] MN SS<3j, ȋ Ml Ԍ 4-t 143j, M! , 1 Td830kT8 P U Mo ̓mH3Kk\ j M  ؏  a FX(3bkt MoՐ *tG$*3kM@ M= 4  P,3k)9 A MdM V  ,3kjy] M 5{R  $-3lc m M I Q *t_ 33Il M U d 43ul Mw U  p43l Ē DY ͒ M'yY Y FP63l  ?M*63l  RME[ *73m R9gMS *83+m B{<M# *`93Hm ( 5 : Mt |Tď8t;3m6 \M?*`@36n$ ғ ML w | *C3_n M   *E3n/ @ \ M ͕ ӕ *$H3n | M$*ԀJ3o$ M5`,BHXL3fo Ma ,M3o# +M(?CR*`O3o' 4 H Mg *P3o M Ė ז ܖ *ԏQ3p ( 5 : Mt |T8T3yp 8pM#8.8*T3p ( 5 : Mt |T8V3,q $['[M *W3Mq $['[M *`X3qq ; MJ ) : (4` 8^3Er} MeS^3r E YMDm8_3sl MUe.V\+``3@s  M& \+$`3Zs M&\+a3us M&\+4b3s M&\+b3s M&\+lc3s  M& \+4d3s M&\+d3#t8 8M888*$Te3?t) 9M9*De3^t͘ /9M?9D9*dhf3|t ֘ ߘ M /n \+T*DHg3t MS!S\+T0h3t(7/ZMTt$h3t e@f]M.e,7i31u(7/ZM3 T7Pj3hu   # M#8- 2 ,! k3u#MFH|, 9k3u %zMe.*(l3u#MFH|, 9l3u %zMe.*Dm3 vq; MJ.\+Tm3:vkM=*;n3`vkM=*;o3v$[J e M *do3v <8M?8T-Op3w dd<M*p3Iw 77:M*p3fw< , z > M K4Ht3wb o | ,  ǚ *u3wWi , Xv3x  : ,   + Ԉt |3xh , ݜ  %M;3xWi. , H3x> C F , (Z .3xK N , U 3x]jf , p {jt3y  <  Ý ʝ H33Lyݝ  < B d p opT4#$3ty n  < *Ԇ3y <  \+t3y < #$3y <   ! #$܈3y 9} < *D3 z @ G < Q \+3#zX ,xa <  ҟ ۟ #$3:z ՚o < #b*3Qz   < \+p3kz <   ! #$(3z 9F < *3z oJ < #b<\+3zX ,xN <  ҟ ۟ Đ#$Ԑ3z ՚o < #b*D3z   < \+3z  <  +#$D3{ ՚o  < #b*3+{ Ơ < \+В3F{ʠ rӠ <  B K Ԑ#$3_{ ՚oj < #b*3x{ i/ n u < V{ \+3{J <  :#$t3{ ՚o < &#b*3{ ¡ < (Nӡ \+3{ܡ 8 < -ע 0VTD( m3 |GW < =] A^3|d<d < A*$ܜ31|h u < E X,$3G|oo < Q#b<+#$p3Z| < S#3p|oo < X#b<+#$3| < Z#3| < \#3| < ۣ XhԠ3"y 7: <  *3}  < \+43}X[e< *H38}  %& < . D+#$̡3R}G? < K UQh3k}GR < K UQ3} [^ < wd l*#$3}Zui < -lu.3}o . <  פ DVplԧ3}l  < P1 > :d#$X3}O [ < (q r H3} < 8  lRQl3}% 5y1 < __ r { r ;3~ զ < a  $Pd 3O~h q <  5H$3l~} 1 Ĩ < *03~ Ȩ < *3~X[Ҩ < *3~d<֨ < \+3~ڨ <  @2-H3~a8 < d8  H4DT3~ <  @2$S3'a8 < d8  H4dI43; ) < 5 34@3g }0< < ,3L S H4U3}\ < : @2DS 3a8h < Fd8  H4I3 x < T5 3T@P3 }0 < `3L S H4U3 '[ < n 3d^3/ ~Ʃ < zܩ H43F  < 5 3t@@3v }0 < 3L S H4U3  < 5 3@3 }0) < 3L S H4$UD3ـ$ɴg9 < VA @I6$37%H < ,G37%P < ,G3X f u <  Ϊ s4\\`33   < $ 3 < ,9I|3K G N < "\ m t qQ9It3a{ o < *#b*3w ث ܫ < 3` @T;x3Ŭ Ҭ <   <94 3X[" < *43?6 & < Z oDL3فI < WV3  <  *5,3 ɭ < w ׭ *d3) 8 <  *@3?1Y < /  84đ#$(3U |< \+3n  % < H. +ԑ#$x3 %< 4\+3%< 4*3  5 < H. +#$,3؂ %< 4\+3% < B$3 > XO< ~G *3(X[N C*3= R .8b  J D+ Y#$,3i ® Ʈ  c # *3~* ; ?  i *3 }     +3܃. K O   9X43 m\  4 E L +3  S `  x *3%  2 +3> K   H *43Ã" S*P3Y5& 1  _ *ā 3s !̲    pI6D4, - 8  x  $ $4  b \ @4DŽ   :[ l dl ` 4  D d w qV4#$$4   5 ?#$D4X[ g*X4( p͵  n  D+#$4>   ~T k 744Tt *4n3x  \+@4X[~ *T4  ֶ Q  E d s  $#$X!4&   » ȈQ ,4m( / :  f b i ST;p.4 v|  _*d;.4v  *t.4Æ  d8j +;`/4ü ̼ ռ  ?8 \+04k @,$04!  +04=% l*;D14T   *\14n  \.$24  *24  124 n  +424̇d +;x34  +34  \.,$444  * L44<  0m44V   p,#$54s   \.;54  *54k @,;h64Ĉ  +64  \.,$$74  * <74G +,$746  t+ 74U   ! 2 7 l*;94q D M Z  v *:4?   l*Ē;|:4 ?˽ ֽ   *Ԓ:4ˉ  1;4 n  +4;4d FH+,$D<4  + \<45k @,$<4P  +=4nG  h.m=4   @,#$=4  0mp>4Ċ   p,#$>4    J# 7 8A4  T*A4#H NQ  _ p t+B4?w   % G4_$: T  )&  h$hD 4_4Ջ}  2@ Z k 4Te4w   5#$$g4.   M(Z g4V U{R 6 *Th4w 7/Z* i4   # * *8j4Ό1 :  J e l *8k4w    opT#$ o4=  # \+/4h4q   RY { č#$4Տ  [! C Q 4Ȋ4r {  h \+4j   p[ w p\;h4  Ǻ/\.#$4$    3$z 4=, & -  C Z a pDDQȔ4m$ Kl  vp4u4,Jv   4DX4Ƒ  #8 4`7G$4   :#$4 #4K  )j l79D;x4o    5Ǻ/\.#$4$ " )  A9 J O 3dz l4,Z c j  Fz pDQP4"$  W p4uH4M,  ^  # 4DH4y`4 7  s= q +G$Ğ4L Y \  xn :#$4ד #̟4   l79D;@43   Ǻ/\.#$X4d$ "  9 J O 3z 44,Z c  z pDQ4$   p4Du4 ,     # 4tD4O* 7 :  I :#$4x N  #4 Q Z  Q \+Dt4Εp:a  ?8b t+;(4 p  ' @,#$ 4s |  2-c.[I4E  7 o 3T^p4   I |84 4   PG H44`  w :#$,4 n #H4@  Nӡ \+d$4oL    l7|6;ȭ4  "  7 +#$̮4 C< C  *?9R 3@p4(4] d  /P s p 4F ~  @; H4U4q(d  GV 4ԃu4   " 9 F  t#$<4Θ )N *#X4 Q ^ b  . X,Ķ44  > 8bQ#$4 C"  G / 6 8:74\4ՙ= F I  Ti ~ Xp4A  \w HU4W;4j .  pǺ/\.#$4$   z  3$z 44,   C Z a pDDQ\41$ K 6  vp4u 4a,J@ C   4D4M Z c   ,ēh4 k   " \D4 n / \+4z7  e.A l*ԓ#$L4M  %H  . D+#$4yP ]  y 54(4 n  '*X4Ϝ   - 8504P   @y 544+Fg  \ <#$$4} |  c + 8 #$4՝(C mba  v U\dG4X[ *43 M    $pa4d ! $  ; L [ $pa4d Dq   ]a#$4˞   ! H LSD7H4(X &3e  } PH4! j9   (6#$4K 0     85H4! R V   0 *d4ڟ8 F  6 lR$R4   a 8.8 4 P  t1 = TU847Z g   r<@$4k  q Dx@5{ T    5 \+5     5H5ɠ} 1  *5  *5X[ *05>d<" &\+T5e& /  10$5(9 DB  6n  ,pT$5$ z  De.p.$3$5  I \ px7L5ݡ %  q**5 l j9  u 54D5=      У49I5eT^'  7 {d*T50J z    + \,d@\58C t   ) C D@5.0a n  1W @ 5^  @ =  &5J W ^  c 0pPD4(57%  q+#$,)5    H*5X[ **5@X[ * *5r   # *5P+54 7  @ VQ#$+5Ĥ wG #,5 J V _  L/f k \+T,5r   L/ t+;-5A  " @,#$.5n  , @2Sl/5¥$C  1?9 3 05  B  H44I05$~ ( /  I; C p4d15EP b l    d#$845u ` ,#T45  0 X,65٦ # &  DD U \ 8bQt#$885Cg t w  M 8:6495w  Z  XpH;5 $ -  bW d HU4W;`=5  k n  xǺ/\.#$x>5;$    3z ?5,  C Z a pDQ@5̨$ K  vp4uA5,J   4DPB5+7   :#$B5V G #B5 i/  V{ \+C5/   l7|6;lD5ө   7 +#$pE5 C# *  (?9R 3@F5T(49 @  -P s p$ F5 ~ O V  >; H4UG5(di p  EV 4ĄuXH5ת    Ĕ#$J5 N *#K58 Q b  . X,pM5k   > ( / 8bQԔ#$N5ի> K N  Gh y 8:74P5 = I  Ti ~ XpQ5s  \ HU4W;S5  pǺ/\.#$T5ͬ$   z  3Dz U5+,  C Z a pdDQ W5^$ K 6  vp4uW5,J C   4DX5 $  j ;[5   0:q\+[5  4wq+#$h\5C 8\+\5s  @ * _57 D K  Ua j (6_5Ʈs  ^ **|a5  b,*a5*s  - :#$Tb5Q G #pb5y   Q \+b5Y   l7|6;c5¯   @,#$xd5   ( @2Se57$C! (  -?9 3 e5a7 >  >  H4Ixf5$~ Q X  E; C p4$@g5s з  - :#$g5װ G #g5 vt \+Ph5-l y |  V t+; i5N  " @,#$j5y  , @2fj5ɱ$C  1?9 3 Xk5  B  H4TUl5$~ /  I; C p4l5Fs I  - :#$`m5o G G #|m5 qt \+m5Ųl |  V t+;n5  " @,#$o5  , @2$STp5a$C  1?9 3D p5  B  H4Iq5$~ /  I; C p4r5޳   ' 4  $#$u5  ,# u5; <  0 X,w5l@ M P  Dj { 8bQ4#$x5Ҵ  M 8:6D4Lz5  Z  XpT{5j  bA@! . HU4Wd;}5 5 n  xǺ/\.#$~5$ 8    3dz 5, ?  C Z a pDQ@5K$ K  vp4u5x,JF   4DЂ53I L  .U :#$X5϶ G #t5 .t \+5%Z c f  d8k l7|6;5F r   7 +#$5q Cu *  (?9R 3@@5(4| @  -P s p 5 ~ V  >; H4U5(d p  EV 4Du5>    t#$5l CN *#45 Q b  . X,5̸  >! 2 9 8bQ#$52H U X  Gr 8:74P5d= I  Ti ~ Xp5ʹ  \N HU4W;5  pǺ/\.#$5 $   z  3z 45z,  C Z a pDQ\5$ K 6  vp4u 5غ,J C   4D5s  - :#$l5. nG #5W .t \+5    t+;К5   " @,#$ț5̻ "  , @2$-d5$C)  1?9 3Da 5E0  B  H4tTȝ5l$~ 7 /  I; C p4G5> P X  y  ĕ#$5 N *#,5  . X,5  6 8bQ#$Ф5K    ?+ < 8:64 5{C L W  Lw X66ԕh5  Tx HU4W;`5н  hǺ/\.#$x5$   r  3dz 5T, & -  wC Z a pDQ5$ KC F  vp4u5,J+P   4DP5ھ Z ۸ \+Į5] o v   Џ#$Ȱ5) #5P   R6 a G #>63 d   #b<\+>6`l g |  V t+;?6 j  " @,#$@6 m  , @2dfXA6$Ct  1?9 3 A6-{  B  H4UB6V$~  /  I; C p4C6s   - :#$D6  G # D6    #b<\+D6l  |  V t+;`E6$ o  " @,#$XF6P   , @2SF6$C  1?9 3 G6  B  H4DIXH6$~  /  I; C p4t I6"3 L  .U :#$I6L  G #I6w  t \+8J6    t+;K6    "7 +#$L6 C   ,?9R 3@L6D(4   1P s p dM6q ~  $  B; H4U,N6(d8 ?  IV 4ԉuN6s "  - :#$|O6 S G #O6 ,  #b<\+P6C V   t+;P6d Y  " @,#$Q6 \  , @2$-pR6$Cc  1?9 3Da S6 j  B  H4TS63$~ q /  I; C p44GT6\ x    ' 4  D#$ W6 !! )# C \+$U! \+6 #xB!   74T6 L! Y! v!  ~A! ! X(xX\6! " *"  q" " " UT\T6:Xɟ"  \+h6`  & "   / F 746 " " "  !" # (64#$6 6 ? #  ,d8Y b X64dH6'# 4# a#  2# $ $ UT 6Xɟb$ @\+6" f$ o$ r$  Dx$ $ 74x6H $ $ T\+6o$ $ $  [$ $ $ URx7Xɟ % _\+7  %  c% *% /% 74tX7 6% u% %  yf& & & ȇl݉ 7g M& \+7  &     URD7Xɟ& \+7 ./ &  & 1 *+7 M' \+71  '     URtL7[Xɟ7' \+`7 A;' >'   H' _' d' 777 Mk' #7o' x' '  ' ' ' >4d47Xɟ' #\+H7@ #x'  ' 747' 7#7 M' ;#07o' x' '  ?' ' ' >47Xɟ' C\+7   '  G% *% /% 747i 6 ? (  Vd8Y b X64L7( !( L(  \( V) o) 44$  "7Xɟ) u\+ "7 ) ) )  y * 9* D* Lx%7u S* j\*  f* }* * L|ė'7  *  % *% /% 74ԗ'7 M* #'7 Xɟ* \+ (71* * *  * * * >4)7Z  *  % *% /% 74`*7 M* #|*7Xɟ+ \+*7* * +  * * * >4,7+ S* j+  f* }* * L|-7Q S* j&+  f* }* * L|.7v 6 ? 0+  d8Y b X64/7A+ N+ +  + ?, T,  57Xɟ, \+57 , , ,  , , , 77$477G, , ,  : - (- x94h87h8/- :-  JP- g- p- 5 R4k97w- - -  q- - +T*|;7- - -  {- . . + YDL=7!. .. 2.  X. #$?7.i. n. q.  }. . 9IA7Q$. . .  . . I$L8TB7t(.  . / L$LC7 / / /  L/ a/ dF7p/ Xy/  / / / 4xZTI7 / / /  ^0 w0 ~0 L4K7\80 0 0   1 .1 91 x$#TN7H1  w֎O7L1 Y1 \1  n1 1 5`7P7 1 1 1  1 2 \5|6;5 5 5  5 6 6 @xLxh7&*6 36 :6  L6 e6 j6 +h+ts(j7O*6 36 q6  L6 e6 j6 +h+sk7{6 6 6  7 8 8 gD 5z7D9 M9 Q9   k9 0Џ8|7  z9 9 9  H: : : 5kt3#$7?3!:  W37 : :  I ; ; '; 777 : .;  S ; ; '; 77<7 : :;  ^ ; ; '; 77Ę7 F; X; c;  p; ; ; *S76 ; ; ;  +< h< {< !DԌ7_ < < <  < < < \x07('x< =  = )= 2= $5 _Ԙ79= F= V=  = > > x 7 X> k> >  m? ? ? Xk ̡7K :@ @ @   uA A A ̋h" I7lZ /B '̫7s%3B 6B  B%*47@B RB [B  HB B B @P87 B B 3 B *,7 v^a ;*7 B gr  B *ij7  *07F v^a ;*7o 4*B  iUB *87  R E[B *H7 ENQ T*87 v^a ;*7% 4*79 cSf~ lS/n\+h+d7\% 4*7 X/AZ7XX[ * 7 X/AZ7XX[ *07 X/AZ@7=XX[ *T7f X/AZd7XX[ *x7 X/7XX[ *7 X/7'XX[ *7O X/AZм7yXX[ *7 X/AZ7XX[ *7 X/AZ7XX[ *,7J X/AZ<7oXX[ *P70 Xx9`7XX[ *t70 Xx97XX[ *7- 37UXX[ *7 3̽7XX[ *7 -G$7XX[ *7 -G$7=XX[ *(7e X/AZ87XX[ *L7 X/AZ\7XX[ *p7$ 37& XX[ *7P $ 37s XX[ *7  -?Ⱦ7 XX[ *ܾ7  -?7 XX[ *7/ D dx7W XX[ *$7 D dx47 XX[ *H7  3X7 XX[ *l7  3|7D XX[ *7k  -G$7 XX[ *7  -G$Ŀ7 XX[ *ؿ7  -=7# XX[ *7L  3RZ 7t XX[ * 7  3RZ07 XX[ *D7  3ߋT7 XX[ *h75  B B B  C #C ,C X64H7Z  3ߋX7z XX[ *l7 XX[ \+7   *7  *=7 XX[ *77 *=7ZXX[ *7 *=7XX[ *7 *=7XX[ *(7& 3ߋ87MXX[ *L7w B B B  C #C ,C X64,7 3ߋ<7XX[ *P7XX[ \+d7  *|77 3ߋ7]XX[ *7 B B B  C #C ,C X647 3ߋ7XX[ *7XX[ \+7  *7A 37kXX[ *7 37XX[ *7 X/(7XX[ *<7B X/L7jXX[ *`7;C EC rC C D ( 7%99D ;%* 7BD OD RD ApD D D H`79I7D D D QD D D :`7#$75/D D cD E E *G$7Mv9 E ~.,7k&E *47*E 1E HE yE E E .7ԟ9I7E BE E F 85 57F 'F >F F F F DrȀE7% F B h7KF F F ?G G G pP$F7 G :AG +~AG G 0Xr7s73G ,W3$ $7G H dH DKI WI ^I *R G$7 I I ^J `K L eL ; H 7,L L L G4F7TM a M ;M p64G$7|M aM ;M p64G$H7)M :M >M kM M M npD]F073M W34 73M gW3D H7JM [:M !N LN aN  T7n iN |N N  $O JO YO 0(8O RO $E[O H6S$8,O O P *P P P ,pl  8Q 5Q ZQ QQ Q R <`7S 88W c=R DR pPR UR *d; 8n8\R 5 iR yR R R p*t4@88R ؼR R R R @74p8TR 7 S S "S VZL8@)S ! 5S KS \S gS lr@4H8PnS S S T U HU (H \ Zt%8&TU U V W W X $i J 488l$X X Y |Y Y Z pp8d F@8,oZ Z Z y[ [ \ P  M8 1\ .8:\ V\ g\ p\ ppN8 {\ }\ \ \ \ ppHP8 \ D \ \ ] ] ppęR8+ \ D ] \ ] ] ppԙS8V \ D ;] \ ] ] ppU8w _] 6Bh]  gBx] ppHW8$] ] ] L^ ^ ^ I6 Fh]8^ ^ ^ 4S0_ 5_ +G$4_8J_ [_ f_ As_ +4G$ `8_ _ _ M_ _ _ p-H8d9I@b8_ ` ^` [` a a 87` G$f8:ka ta H)@8@=@#d,g8Ua a a Wa b b  E|8L j8q1b Kb Ob pcb wb P`mhm8 b b b c c "c *;p8`Ac Vc cc c c c qQЏ$r8c c 7Jx0s8(c c d d d d -q\ Ow8d e ;e e e e |;`7x6P{8&,f 3f ^f f f f  4F8:,*g fg g hn1h Hh PF8N|h h h -h h h @,*\G$8c$; i i ;F#FT8{4i Ci Oi Ai i i f88,,j j 9j mj j j $- qtčF8j j j nj j IЏ8\ k .k *G$ 8$; i k F#Ft8$; i k F#Fȗ8 k :k *G$48 $k 5k Nk lk k *G$̙8$k k `m :q Lq q HJl3F8a$:Տps J.xs ZL, F8r$}s s t w w w tD̩ F 8$!y .y 1y A?y ZL, F48$Fy Sy Vy K3fy ZF8$Fy Sy ky U3fy ZF8{y y y jy z `QD8 z z 'z W@z Iz 74;8 Vz .k +G$8\z iz mz z ;{ K{ ` N%F Z`$G9) Q Z n N ƍ Ս <؄@I9=* Nl N9W* N l,*D;O9w*L  NŽ <-mP9* ǎ ʎ N*,P9*  Ύ N. D+#$P9* ֎ َ N  *4:I: G J N2%f <#$|?:=I o }Z NI \P`ad,$A:^I] » NR-]],B:I λ ѻ Nfۻ 85`7;B:I ӭ Nl#8 85`7;C:I  N; G \ LM*DG:Ifl o NVȈ ?4[:G:%J { N; @6Џ[:I:]J] N!-]]I:JƼ Ӽ ߼ N   , `MtMd4L:JƼ Ӽ : N0  , `MtM4P:K ] { ~ N@ pqpAR:NK! NK?8 56R:KȽ ս ܽ NY (644S:K  Nc8 K \ MM݉V:K c u y Nz MH*Y:L Ǿ پ ݾ N  Mt*\:FL' 3 6 NX m XL``^:hLx Nݿ   X \c:L!  N?8 568d:L$ 1 5 NW d!datf:Mfj m N VȈ ?4[:g:SM y N'; @6ЏĜ[:h:M] N,-]]Ԝxi:M% N2+#$i:rG% N84,#$`j:NCdE N=yN+#$j:GCdE NCyN4,#$Pk:^N N ZQ#$(l:N N ZQ#$m:N 4g N,  $A9Im:QO  ! N6* ; D YQn:O 4gK N=  $A$9ITo:OT ] ` NSJ.j q :4#$o:>PT ] x NZJ.j q :D#$p:zPCd NyN+#$q:HCd NyN4,#$q:P% N$+#$r:pH% N*4,#$|r:P 6N7$r:2Q NB$r:wQ NF; @6ЏT[:s:Q] NK-]]dHt:Qf NPVȈ ?4[:u:#Rш NWC6 ,h\v:ER  7 Nw% 4{:}R( Nj g.DpM F:R Nz ܏4@:R NH0#$X:)S~  N6 A x9=Џ4:ZS R [ ^ Nj RlaЏ:S U{RNp*؄:S U{RNp*:S N*P:;T N&\+:oT%N4*p:T38<8N?8,*s$:T N *ts,:U 7/ZN*: U 7/Z*Ċ:9Ug1 z  L:HUZ   2 :QUv97 #X:`U; D S Gq \qWh:U h P eQЏ#$:UWi77R:V0  r a  >(H:Vy " . ? *:(VD =-L,8:=VJ S a ZRG$|:XVh  L _ d-4<HT at$D:VWi $:V2Z  x ` :W  U (:W&  **4:0W.sz e.H +G$D:JW  ?8 ,T*<9I:_W^   x +G$:zW&  **4$:W.sz e.H +G$:W  L**4P:W.sz e.H +G$:W K'[ ! ,T*<9I:W^ " x +G$D: X  )L**4: X.sz *e.H +G$p: 3a ZRG$8:jXL ~Q :0[ hqZ9I:XJ d <a ZRG$:X& gr CV5 TZ4:XJ | Ea ZRG$ؿ:Vd Mc *:Ud Sc * :mV  X \+h:hU 8 `  *+ĝ#$$:X 5  e555076ЏD$:XWi. gd:Y? H P _ D+T*<: Y^d  x +G$ :Y $t ^j t **G$:'Y.sz e.H +G$P:7Y a  D+T*<:BY^  x +G$:SY$t ^ t +*4X:dYJ  a ZRG$P:wY.CGV.P+ԝ:Y ].@.yq.+h:-Z.=/c/*:RZv/:_\+:vZ R9gS *:Z dd<*(:ZM Wp:Z mb  4 *d:[< F J +e <:g[4 K E rrQ:[R _ l m  : K: \S m z    VD$8:J\ ) T ( U :^v, / (Z#T:^5 LRB (fj A44O:_ ~9 (9 \+S8:G_ 5y (  \+8:t_  (  #$:_ (*;:_Zu (- t+;X:_3] (.t+;:` q () J _D##$`:;`S \ (| 56T:]` ~ (0 *4:`  (*I 56T:` :O (BF *:`M b (k;  <4:a  ( *,:Ha,  ( D\ ;:_aQ ( F p T#d# 4H;a 7 (\ )  3 `z4h';a  (F? T _ 0RWĐ#$|);hb(l (X ] W H+/hT;b }  ( G <[pTU;b &3 ( ,̔W;b  (6_ p  ,Z;-c (i  dC|6^;[c? (*G$^;ocY q ~ ( DE; a;c (a;c, (; t#Qc;c Y  (o\+c;c 7  (\+4d;d    (j5 W#Xe;Ad > (&*e;hdB O V (;v +*Tg;d  (MIJ ,1 .|+\7wPh;d (N *i;d   (`WP U *$G$dj;df i (n q P+Ok;ex (} l*dG$k;5e (k l ;o;*f (: $<47p;f l(;*q;Fg  (e. P+O$r;eHl& Tl(9oK+`-lr;fg (: $<47s;g l(;*t;bhb) , (2 #u;h7 (@ 4iH,$4|;h ) (*O|;i  (  O;Ci 3 ( M O,;fi 0 S ( PN OĈ;i , Q ( 0tO;i & I (! ܔԢO;i  : ()f $>OȒ;j  (1n u $>O;-j (;k @P| Єp;Oj - (b  Od;kjB O d ( $>OH;j (  pC<7Oh;j( - = (  ddTb̩;jH  1 (] H  ̑ 4D,;yk] (.';k $ 1 4 (5H _ 0A|6;H;kh { (C  $>O,;kh6 O u (V   @@ 8SD;l] D (h.'4;-l H U f (n c\t;;Kl (~   0D;ml I  (( 9 0A|6;p;l@ Y z (   #4 G RpT$ <p   N (z > G RpT4 <p   ` ( > G RpTD <p   r ( > G RpTT < q   (   RpTd X<!q    ( * <6q  5 , (> bK * 0<Kq Y f (x   RpTt  !<bq    ( ^S* "<zq   ( s* "<q Y  (x   RpT $<q $ 1 4 (d* P%<q > K N (`   RpT 8'<q > K  (`   RpT  )<q > K  (`   RpT +<r > K  ( `   RpTğ ,<r > K  (`   RpTԟ .<+r > K  (`   RpT 0<Br > K  ('`   RpT 2<Zr > K  (0`   RpT 4<or > K  (9`   RpT x6<r > K  (B`   RpT$ `8<r - (L# p8<r 1 I b (X  **:<r   (3A X a ?#$=<ds   ([ B L R \A<s v` d (  74D<s   ( + : 4#$0G<sG J (G< tN ),W (m ,XH<,tX~  (* lH<St    (  ,G$DI<xt   (   <94D4J<t   ! (2Y d *L<to |  (  +TN<t.s  (e.  +d;N<u   (%  8eQtmO<(u  * _ (  p6|6O G$S<Gu3 < U (iU  p6|6G$U<fu   (%  p6|6G$V<u   (_#D Q $[]DG$Y<uh   (a  \itZ<u6   (%d\i[<u,  (% Deڲ[<"v 0 l ( 3 D XhG$0f<Wv    (X *;4i<sv  5 (] i dDT ;<sx a8(d8rf*D<x  (9 -1H <x ! ! (= " X" d" ;$BHԎ<}(" " " (W# # ; BHЙ<$# # # (R$ $ ; BH <P $ $ $ (Z% % ;<<$Kc% ic(ccc,d<~(% % % (3& ]& g& /Ԓd<& & & ( ' $' *' 0-D<=' J' N' (&' ' ,<K ' ' ' (' .( ;<BHt< v^a(;*<<+(7( D( H( (( ( O\<W ) ! ! (= " X" d" ;dBH<(*) >) B) () k* ;BH<$z* * * (* (+ ;BHT<U 0+ I+ M+ (+ N, ;<đ$Kc% ic(ccc,<(\, i, m, (3, , , #4<U/- & & ( ' $' *' 0-+<;- H- L- (&- - ,+<  - - - (- ,. ;BH<,5. B. F. (. . = ^ 3(/ *=֔ / / (_!/ *=](/ // (#88/ +L= >?/ F/ (O/ T/ +=> (\+=][/ b/ (y *Ġ=_k/ r/ ({/ \+Ԡ=ü / / (?8 \+=ԕXX[(*=/ / / (/ / / *=[/ / (y *=8/ / / (S|0 *=Z/0 80 E0 (u0 0 0 9d4 =|0 0 0 (0 0 0 + =1 1 #1 (21 A1 J1 [Pe L =ɖ (Q1 p,#$t =( + =  X1 _1 (j1 y1 1 l7|6$ X ==1 1 (*4t =` 1 1 1 (;1 \+D<=1 1 1 (2 2 2 *ē4= +2 62 (I2 R2 *T=җ ]2 f2 s2 (/2 2 *t= n (H+4=( + =D( +=k (Q1 @,#$= (Q1 p,#$$=2 2 2 (2 2 2 t+d$=#(FHX,$= %z(e.\+@= Z(?9P+O=EO8{<(P P+O=mZ(?9P+O4=Z(?9P+O=Z(?9P+O|=ڙZ(?9P+O =o$['[(K P+O=# v^a(;*=L B{<(# *X= v^a(;* =2 2 3 mD3 a3 l3 `t=<g3 m\?8*`-l=3 3 3 m]3 3 $<47=3 m^*=;3 Y_3 m_3 668!=K&3 3 w0&!=^4 4 4 w,4 4 +%=w4 4 4 wh#5 6 +8=6 ^7 wGS7 v7 7 Ȅ }d<=7 08 48 wY: ; ; # lY=4Z= s= w= w= = = 5$N`*\=(> &> *> wj> > > 5$N$]_=(> > > w> ? ? 5$ND]xa=9(7? D? wGP? W? *t]b=X$^? k? o? w? ? ? (cT94f=w ʭ l@ w#8(\+f=Z @ w3*;g=@ I@ wJ.%@ *g=מ,@ 9@ =@ ws@ @ bA wA A A A w>A 64 r=a A A A w%PB pB 8,w=~zB B B wSB B B Rx|z=C C C wpUC lC uC 55{=C C C w|L/C |= hIC wC C C ** }=78 D $D (D wD D E ġ{*=V E < 0E wZE mE 854܄=rrE E E wE E E \+*ԡ=E E F wMF ^F kF x9<7,=zF F F w F F 54ċ=ʠF F G w%G G G  =H (H ,H wM0K K K HW`hU 4=pbL pL tL wL M M ПdsL=7M yEM wLM N N \=ȡ:N N N w{Q dQ Q hhWo}$=Q E Q w|Q R l>$= R / ;R wNP yR <9#$=6R R R wuS S S #$p=S S S wT $T /#$$=)T ,T w28T *=ޢ?T IT MT wAT T T (6 =T T T w_JU qU zU Rpr$=; U U U wU U *$=c V EV IV w,W ?W OW .#$=(pW W W wW W 4=£,W W W w1W W 9I=4W X X w?-X BX MX d9Q9IX=,TX E ]X wQyX X p=;X W X wX X ]=]X X X w_PY 74;=y[Y Y Y wY Y Z t9;=4Z MZ QZ wZ Z p"]9Il=[ E[ I[ w#G\ w\ \ $#$0>\ C\ w\ \+> \ \ \ w/] t+> ] S ] wU2] t+>0 7] H] L] w] ] l7|6 >P$] ] ] wE[] X8F >j$] ] ] wE[] X8F >$] ] ] wj^ X8F>^ !^ %^ wo^ {^ | R6|>ť^ ^ ^ w8r^ | R6P>_ _ _ wb9_ +G$0>>_ IG_ wW_ *N%T>Z \_ w*)l>3 `_ i_ w}_ *N%p>M_ Hn_ w_ _ 44;>e_ >_ w_ _ *;(>|  ;_ w7_ #|>  ` ` wzJ.: A X6LK$$>` )` 4` wRx` ` x9K(> ` G ` w%` *>) v%` w.*8 >I ` a a w- ia *#>loa a a w ra a *sT&>  ` a wJ.: A X6LK4&>ȧa a -b w(b c c ]"U L->qc c id w<g g sh |. l0 |K>. j Cj ^j w@j j j p67lP>c j wv854@Q>  k `k w8k Ik Rk X66DR>.ck lk ok wk k k 56T4hT>Ok l $l wqm n 1n <%4d> U{Rwp*te> n n wn =n \+dĩ w\+f>n n w*tTg>n n n w~n n *sh> o o o wG5o :o *si><Eo No Uo 9ho o o *j>go o o Po p (6t$pn>p 4p =p r r s xD4$ |>ժ8s t t 1t t t \8l>Nt t t u 4u Lx>d=u Pu Tu :v Rv ^v elv5>rv v v Ow w w ĢMt>(w w w =Hx tx x 2Ԣ->٫Eo x x ho o o *$>@x x x jz z z P $8t>U@z z z  `{ { { عx$8<>{ { { ) | (| x9KTX> ?| 5P| Kb| q| *4>( x| | | } } } xv2CAt$0>,$~ :~ ȴ>K~ X~ \~ ~  x9t> 0 4 %   = V >@ T a 4i 3 lww 4>6 C p y \+н>b M g\+>za9y s \++>Xɟ *> ӄ  ʅ ݅ 22gE>  S > ц *># # ?   ч 85|6>6 6>$ / <[R$;>X> P Y Ip w *;>eXɟ Q*>d Z\+> e 54#$> ͈  *>կ #>  e.V *$h> $ + J.*4s>67 @ K h/o *>Tv v  *>n #,> d dʼn *D>]xЉ #8L*st>̰։ ߉ % *> * @ *|> E H #>) E L #>IP #s>eT #>d X \+>\ h o w | D+D#$t>ر\ h w | *T#$>  *d4>  <̊ ӊ .T*d>.$܊ a A%Kx-F>V a JO/ .L,h>$J  Ka ^RF`>sa TO/ 3*Ԛ5$?Բ$   Ul- F?,8 E I [ B?(ԋ   , Y(tS ?8$  % 6 97F ?Z(= yH  ,*S ?}$J N a ^RF ? h\ b 0h+( ?Ƴ$g o$ p |~ FL?? ? ( 4 ? K7LW?+W i l 2~~ :4`?A l ?/ +4H?\ f L6Ѝ 4#$?x׍ YL/ l*#$x?׍  fL/ 8+#$\? # ' sK \ :44?ش@e lq /w ,?8܊ a ~ %KvS`?D X d SS[&?&  1 H P l74;*?5b n q ` :4+?X ,w ߐ 44#$$.?| a` "Dx) 0 <#$/? a`? +Dx) 0 P:ģ#$0?ε c o r 5S ?Kp1? : PTG$4? `hʑ Gb ? 54?$ ڑ O L  54G$6?HD YD875x7?g % . 2 ^B _ PTG$9?h q t kV 8 55p:? ڑ O p  54G$, C +?1N W Fa x *?b} L#?N  Na x *?} T#?N  Va x *?3} \#?i ^° հ :44? ܰ p+?K  +?  Q+t?*7] 4 +?X@ M T x } +4? 2 ?  T h  D @u L/ h+*(@8 ۴  b= D --hD@4k 0 # -- l@Zu N W-lu/#$@(RT lS:*M@{X` c *@X` i *@,hoo  H0#$@Gho}  H0#$P@e(  R `4@< ¶ ɶ }   -.ԟDd@4 0 7 U \ p54T%@4c v }  ķ ͷ PPd%@$lԷ /`S@ 3 .#t$@. `0d@Uv + # h @w} , 7$ts!@FG Z A?4s"@ v _t(@7ux$@ mɸ ܸ gP$%@2=  k6SZ@44&@MA T @#'@j x JH l#Ĥ7<)@F Թ =84Ԥs`*@F G84s+@? / f@67,@S f pL@47-@ z#s,/@Aź غ %nG@6$sX0@A(  7&4L1@`$= P `}6DL(3@}z "?F@4Ts\4@z "?F@4ds5@$ݻ q'.t!6@. .  E8*#6@(. .  EO06@. .  E&H*#7@3 ^ 3g*8@d a9j9n*8@ f~0/n*9@ *d:@ a8d8rf*;@ ! l^L/* *;@C ./7/Z1 *<@p  <8?86 *x=@ *>@ $['[*>@ U{Rp*?@& \/e/h/= *@@R D 5Q *A@ *  , |AM ; G m ~ p An      ' 6 ,lHBW ]d -.k 4,9B n { ~ L \+B    [  \+BS  h  *B   wU r  t m B3    94 B\$   ]   dj&& Bf$      ^RTB   +4B , 8 v   0RB$pW>B n +4>B ,<8?8l?B2$ Y HX?B](-[' ' ' ' V 0AB w' ' ( ( ,tBB_"( )( D+9BB _2( 9( B( *ħBB]p#8+4CB O8{<D$-MLDB@X8a8d8o8+4DBfI( R( [( v( ( ( *FB( ( ( g$) *sHB ) ) $) ZB) S) \) *ԧJB3k) t) {) @) ) ) +*ԕKB_ ) ) ) * * 8:4LQB* * * + + + <>6STSB3+ A+ E+ + + + (64$(VBF+ + =*G$8VBc+ + ?+ *VB+ + C+ *WB+ + L*G$WB+ + + N;k" *XXB+ , U+ *YBe% , #e.P$YBZu- , *-lu*;ZB9 , &, 2, t- '- 0- *D4x`B_<- I- M- .- - *bB- - - O. 7. @. 94DeB I. V. c`. w. *eB |. . . o/ / dC|6mB$/ #0 h0 2 x2 2 \PZ xBY2 2 !3 o3 3 3 U\ }B!4 64 w4 5 W5 e5 U\wXY B 5 5 5 5 5 5 74B8 6 6 "6 p6 6 6 |u 77:*Bb%4*B=9 F9 U9 Lj9 *4spB y9 9 9 /9 9 *DsXB%4*ܔB9 9 9 9 9 *TsԕB y9 9 : /9 9 *dsB Z : ': \+tBG ].: 5: #8\+DBm<: F: g: ,: : : 5B,l-ЏB,3:,'PB,*(B,l-ЏĝB9,3:,'|BZ,*TB}: ; ; ,SD; _; d; 4ԠB`[s; ,\= ,4PBy; ,k; hB`[; ,r= ,4pB; ; ; ,z; < < #УB"< 3< B< ,j< < < NlBʁ< ,< < *G$B0< < < ,<W< < #@BL!= = ,KQ= \= <-Be. ( 5Bxk= x= = 5g= = = Sd#$BX[> 5* B> 2> :> 5> > > B@> > R? 5f@ @ A $(d( DB&A A A 5BB B B (u4184BC  B 5":q*(BaB B B H"C *C 7C ԝ$DBFC 5 RC H5C C I@VXxBڬ C H0 5*;B*C C D HD E )E u|7d| BTE ~E H0E ;6G$B f~0HE *pB E E E x=/E E XBE %F @F xUF F F *G$BHE %F G xF F F *Ė;hB{ G G G jG G *Ĩ;B H H H V&H +H *Ԩ;B`z2H e.K 0B@H YH `H +fH H *#$BH H H H B?  4I FI KI *dBRI [I ^I xI I 548B(I I I I I I ,l$T@B$ J J &J SJ bJ iJ ,lDT BzJ J J K K 'K *h+\40B<$JK SK bK  K K K 6ldTBK K K 6L L *B )L 2L AL eL tL {L 854sLB= L  L &uL *TB{L L L &M =M DM *6BhiM lM M M *BM M M ,N CN 54t$@B=LN eN zN O O O 54TdBGO PO WO sO O O 0BM O O O /| D+pC O O O /| D+pCO O O P $P *P C2P ?P BP NRP eP *<C 2P ?P jP URP eP *hC\ zP P P \P P *CQ %Q :Q Q Q Q Wpx C!XQ # CPQ Q Q R 4R ;R x94$CJR ^R sR R R S Dn|xC!S eS S ;V V V xZ8 (C_W lW W UW X (X Wx`-CMX VX eX iX X X \+T.CX X Y sZ VZ hZ yT (8C+Z Z Z a[ [ [ Wx =C`[ [ [ [ \ #\ \+h+?C2\ E\ I\ -p\ \ x4AC\ \ \ ;\ \ d#$DC] ] #] pU] ] ] [$#$xHCt] R] x?C] *JC ] ] ] /^ H^ W^ Rx4LC!h^ k^ 3c*MCU,{^ ^ ^ 0_ _ _ ,lt#RC_ ` 6` ` 2a Ca 5L 8YCxa a a  Cb Ob *44]Cxa a Ub 2 Cb Ob *#$0aC'b Zb  #aCdb }e9c  c *4fCb }ec  c *#$$jCb ZSd ?#jCcd pd sd $jd *\lCWd d d d q Eq Nq Uq X6`7T`C  &/\q /?FX6`7dHC Meq WC jq tq q q * C< q q q q r r 85|6$;,Cur )r 9r r r r ( mCpGs as zs Ds s s HUW;(Cs s s t 50C#v3B t #CR !t *t 5t #Vt st zt 0A4D;C t t t 2u %v $v v v [v w #w ,tC*w 1w lEw *`CX?Lw x*tC>7 Pw Ww yiw *C0' pw >w w )@C8w w w  x x 4ud!GC$ Fx Tx lx y "y 3y ĒO`Cy CX,*$C /<y **Cy 0D+?PC?G& 2y 4by p̪?P4C k=D+?PPCv y y y fy y y 0A4CX[z z*Cz *,C"X[z * @C`X[z *TC]jz (Z  θ*CX[c *C.^$z /z Wz zz z xDДhCDžz z z z z *h+hC$z z { 7{ H{ U{ 0 \U4CPx :h{ l{ { 8?`7?P`C { { C { { { { { **DC{ | | || | | h\t4C | | | 0_# } } **ĩCI } 0} G} R} } } *C~ N~ f~ a G [ 0j l C  ^   0C    ! 2 ; 7<7@D+,J c g  X`G9DZ4 ® р   @4D$ + B z v<Ԙ( D ԁ 1M X` D9  P _ Xu4D r   EODyX 3*D  ! @} v D"$„ ӄ ք f?C 64ДTDa t & / P|`DԩD 6 ? F 0/nM \+*DT [ b vq *h+Dx   *h+`DR cSf~lS/n\+h+@ D &/ /?FX6`7(!D f~0*"D U{Rp*"D? C [[w *d#D| g =V *$;4$D… υ Ӆ N <&D + 8 A W f m *4;'Dc x  *d;(D 6Jņ Ά  *;)D P R z 6 U  L0`ND ζ3D!  ҈ 8e\m4D!_  D+4m5D!  $  Ɗ !V@AD" R m q  ȋ LTFD" F T j d 'KD# }  hND#H $ D .ڍ  "`Q Ĺ\VD$C U ] . ǎ ͎ *YD4% X3  *DZDl% + ; aΏ   Пę4`_D%/ H W  Ð ΐ HUhP,bD%ݐ $ 5 0Rpu4xdD% Zu@ -lu*dD&H ] l   *$G$fD%& p *0hDN&v _*D)PhD&v‘ *TphD& ɑ d8j \+d) iD&ü ґ ռ ?8 \+tiD('ۑ -*)iDY'  *jD' %*)jD'  *jD'p,BDkD(  p,#$lkDQ( !t  ' > C D+BlD( J S ^  ,54#$nD(ۑ -*Ī)0nD(  *ԪHnD )+nD;) n +4oDl)dFH +oD) + oD)k+TpD* +lpD:*G @,BqDn*  @,#$0qD* Œ ʒ   *rD* B  Z[ m x ܪ,v$DDG0՚ ( #b #D\0v+ ( #Dq0. Ç ( !,D0v ( #D0v  ( B#D0  # ( PS *D0 Ĝ ɜ (  l 6D0 (  *0D0 ~9 ( 9' \eQ8D1,0 @ K ( y D)DU1 Ú ( ʞ t+h+|Dq10 " r (  @ s h3) <  ID1 d (  x +G$D2 0[ ( 3 % |C@D*2, E N ( @u 9d$DI2( Ԣ ( _: ң #bdQ ID2  ( L W lD2j ( l-ЏD2n ( 3:,'D2r ( *D 3v  (  * D@3 3 ( { + D`3%L ( o ͤ x*D3Ԥ (   <9#$D3 $S# ( D3' 8 ( %L *; D3oS ( J#bY +D3^ ( P B t , ( 78D}4  # ( i_ p } 4;D4b  ( R BD4 ( ݩ 0,D4 ( L ( ƪ  d tc@R EQ51 > E ( 4S X +D4Eo5(_ q ( ] ë @\ E5ګ (   heQT5 E5Ԥ  (   <9#$ E54 R= ( Q b i 85|6d E5p  (  P`4E6 zǬ ( e._ 74LE&6 hd^Ѭ (  ۬ T[QEJ6  ( z= F 5mEg6 Y k v (  ܐ|HE~6 ( Iڭ |E6  | ( xG ٰ  УVd ;H&E6t (  ϱ |(E6 ڱ ( ִ  _ d(s6>E-7 d (  x +G$\?ET7 l Ѷ ( HR x *$U$ DE7· ۷ & ( s % ;   #$LE7 ( ǹ ڹ *D;tME7 Nh ( *;HOE7/ @ I ( 6_ h 4|6t,$PEm7Bo r ( PE7_v y ( QE8} ( ˺ ۺ pTE)8 d (  x +G$UEN8 ( 5 +,$VEh8  8 B ( 1o teQLLYE~8 ջ ( M  ! ePДtm[E8 < ( *G$[E83@ D ( ` *6,\E8H b Q ( +6\E8 U ( *G$\E93@ Y ( ` *6\]E.9H b ] ( +6]EI9a v (  * sgEZ9 4 8 ( #8< :gEq9E Q e (  ý `D!jE94ֽ  o ( ݿ O D 8 +, 7M~E3:5 S ( w   eEO:ڹ> H ( vV e $Ep:p ( * :4(;8E: ) ( f{ `hVT$E: (  B O D6E:f | ( 8 D Q te $܎E); ( 2 3 @ d6EG;$W ( G[ $c,ĺ PdE];o  ( i D I -h+pԛr%ęEq;X e s ( m ( 2XE;  ( sj & >4;E;,- F O (  |6ī PdE; % (   Z $4L,xxE;՚y } ( #b #E;C ( w֎dE <C ( w֎E(< (  X,;tE=< (  % 4 8H\ET<= F \ (  C45ıEv<$ (   <T ԫW̴E<$ 4 \ (  piiD$4E< ! ` (  I a hxX ;E= ( D+4\E!=$ ( K  ' PPE9=. 2 7 (   ES=3  ( .h.8E=  @ j (  ! ## 64E=F T Y ( Ro E=kk" ( \DvXE> ( a W j dEj>$ ( w D W |$tIE>Go s ( w TE>| (  P g ii[ILE> (  1 lЏ/(E>?N X ( Er?i { (  Ԉ=lE?N ( E?Jb ( 7h.CE@  (  5 < (6(E6@@C O S ( . |< 4E{@< ( C @ 4dE@X  ( bJ U *Y EbA (  * ( ?8d 7`7; E|C4 D ( ?8d 7`7;EC4 J ( ?8d 7`7;FC P ! ] ( X0g ##hFCdl p ( d=FD_t x ( ]F'D| (  **4]FHD (   ) C`7DFmD5 9 ( *FD  = G ( %U ^ *TFD(e r (  $Ot FD    ( A \ * FEa o t (  `DFfE   ( , = **FED Q U ( a |*HF:E r v ( *xFE !~ ( *FE ( P $$$FIF  ( N i,R #$8FqF! ( zy *dTFF) 2 6 ( E \+tFF0N c h (  4$Q4} h F=G k" ( =D1 F_G, (  !FG,  ! (  i`dT&FG0 (  . 9 |6}  )FH!A ( $ y *()F9HK 6~X ( ( u | *4*FH ( 4   *\+F^H} ( < *+FH   ( ? K O V 5>H.FHf s w ( _ Ǻ l*4/F I ( n    <94d41FyI |6~H ( { X i *3FI!t ( y *Ĭ$3FI0~ ( _ D$Q} 4FI (  L846F%J) 2  ( E \+Ԭ 7FLJ0 ( 8 ( b w ~ } 89FkJ (  C4( e.H +G$FYY.s: ( e.H +G$XFY* D( -c,8FYL$X( CPPFYq( :E,+5FYD( 6r4 t :uPFd[   ( , = **HF[( =w֎F[(  @PD$dF\ #( 7FQ eeD$8F\\X X( (\+F\ \( *:q*@F\ jy`d( , 5 *F\ !h( .*F\lY ( 2 +4HF5]g( Y,T*<d9IFV] d (  x +G$4F] (  x +G$F] ( ;hqD(F^(   <4#$F-^% "= ( u   R$P-F^  ( (Z {jHF^ 6~ (    D;DaPTF^   (    5TF2_c+ / ( H Y ` *dF`_m z  (    P@TЏw F_N ( F_<   (  A h N ' 4f  Gg` ( Cw֎H G`%< ( @B G` ( =w֎8 G` ( 7w֎ Ga%< ( B( GEa%< ( B Gra%< ( BGaC ( w֎Ga%< ( BGa   ( $O`6<G%b f- r( D+T*Dt#$`Gub ( 3BLtahGbJ( w֎GbNZr(  $pGb ( 7V$Dc-G/ci{( 1h1/tXTGac ( ETmwDX!Gc(  MlX$(GcZ$( R(GdGo ( w X)GEd(  :KpԤD H-Gderw( */Gd ( 2->E**0Gdv+ \( 4`SH1G#eo6~|( M*T2GFe ( [*Į3Gme$(( `CT[0Ԯ4Geh( k(p$t\;Ge( ee#$BGf( +<E<DDG6fXT q( $D4\tPGGff( .9fP\IGfFPU( $ȕ8pMGf'@E( S}$D6OG g( oXyff%SG5g( ;dUGqg3ot( %<g$$ ]Gg(  <4`_G h2?D( $R(fDbGZh{! ( ? **bGhbg( Q \  tPX S tlGh  ( Z. X,$lG5i   (  )!:!ppG`id2 H!( pGiL!q!!( !)"B"%dc\S ,wGir"""( W""l**\txGi"""( M###ؕ t$L}Gj##C$( -c&&'&H M sԏGWjD'()(( r((($A ]c Gj(()( V)y))4f \$sxGj)))( ))*h147pGkd2 *( G;k* *%*( b***57D4Gckd2 *( Gk@* *( ***p8(Tyt$Gk*)+( 0+C+ Gk V+( Gl Z+c+g+( E[s+X,$G?l|+++( +,,tjLdsxGhl,,8,<,( 3a,r,y,+T*ptGl ,c+,( =,,,*sGl ,,,( M8-J-Q-*ԞsGm t--( lV**0G1mǷ -( m-]-GZm---( u-.(.4Gm7/.3.( K.^.QQGm e.u..( ...#$Gn./E/( 000j 4Gn@1M1l1( i111 DAT @Go 22)2( zP2220DP6G0o222( 2*3;3($4Gfo K3^3k3( 333@f8\6Go223( 2*3;3($d4Go 5 %4( P$DG&p )4( 0*GLp 1494( w444LD,Gwp444( 5;5H5DGpCg5( wu5|5*Gp555( 55X64Gp 5( .U *G(q556( 66 7LV Gq& 2 B7( ?+4GqH7 Q7( C.@,#$ Gq(W7l7t7( H77742TG$ra9&7( `77754įGPr7[88( p:m::(N  5Gr=;N;S;( ;;;( b>*Gs>4>D>( mv>>>% HsX >( \+)Hs>>>( <>>t+h+PHt >??( C?)?HD66H)t0? =?( K+XHMtG?5T?( S^?*,Hrt c?/.p?( Zz?-@Ht???( @T@q@jjHt@@@( @@8H$Htb< @( BHui$@( 4,$HBu @T @( @A8H$HjuC-A( w֎HuC1A( w֎Hu`5A( w;A+Hu @AMAYA( bmAAA8?6Џ$#$H$vN A( dDTHYv mAA( hAAA54Dd#$(HvBq A( iA'HvBB(B( wDBWB`BP_Џ'HvN kB( zH2w|BBB( BB54HcwBQ B( d8BB5`Hw4B? B( C$C&hHw. Ç)C( xH#x!-C( #HIxCd1C5C( y%+ Hnx;CLCC( CCC<6m!Hx$DIDrD( hEEE$p hZ SD+HyF"F4F( #bFqFzF85`9@,HMyFFF( 4G?GKGLf$^Џ#$0Hy$cG$xG( b_G PPP2HyG,G( qGGGXh$#$<5Hy0 H4HsPH*lYYYY( "\d\\D EN =sԏHL]( "w֎PH8]>]\]( "]] ^hAuHփ /^( "#boD+mHN 8^( "HO L^X^b^( "^^^lD@$%Hr ^^9_( "```jj #$4HtaN;a( E#aaal*T*DءH݄$a bb( `#JbYbd%|fPH`bbbc( #&e{eeT- LHN .f( !$dH Bf( #tH Gf( #H2 Lf}ff( ;$g&g1gft%XoHN Lg( ?$H܆`grgg( a$gggPHhh$h( $7hNhWhxD`$HH/ d (  x +G$Hd^hqhh( $i3i?iR`HpT AH%< ei( $BHŇji|ii( $iiixUH%< j( $BHc+j( $E['jf` H:0jCjj( $kl.l%W`Eg @Hlll( %llm+tH%< #m( $BH%< (m( $B\H( -mJmOm( !%mmmİ#$Hz mmm( :%oeoot8W  [ PHooo( ~%Rpcpxp\tHNppq( %rxss/Yl|EsH d (  x +G$(H7Et Nt( %Wtȓ854;Hphttt( H&u8uEuȖjԫstHruuu( j&vvvpЏ `IN @w( &I Twmww( &Oxxx!l$ )IDxyy( &)|i||\<It}}}( :'}~#~ ؖЏD7IN 2~( D'IیlF~W~c~( W'~~~$76ЏI N ~( Y'ID~~~( p'3J_x 4$Iv( ~'Џ'IN ( '$`I(2>( '|ffUI$ À( '.@OVh"IeN h( 'D#Ip|( 'k\K&IN !( 'd&I&X 5:( (sx)I]т( (QzPĥ#$-I~lƒփ( )(2=tUX0IN T( ,(0I׏h( C(y04IN 2( W(4IBN F( G(x5I}Zcu( k(ɅRf7Iڅ( (-T*<԰9I7Iʐ d (  x +G$t8I5 ( (#8Idl ( (y3#K=8I85 ( (#8IXdl ( (y3#K=8Iw $( (*$8I!)( (+C9IБ.?I( (r(84T;I  ( (҆* Iv + #( (2Cl-Џ>IH U( (}878@I ɇ( )S5$#$4AI   7( )إ(\ DI%,(? 5( A)h/Pf*8EISUbr( X)~:|6DGIv+ ( ).*$hGI ( )3xGIړÉ( )*6GIDȉ̉( )e.ӉDO0HI/w &ډ( )8\Q#$HIW ( )#II s ( )Ǻx9PBJI Q ( )d8")?#$JIΔ dl 0( )*JI 5( ).<H0BtKI$ A( )KIT  F( ).MDELIy T( )#,LIZY]( )Ld<0&LIȕ i( )sLIIh+ n( )u?BMI ( )#MIEvq1C( )y\w*$TNIo ( )3lNI( *ˊxD`$PI d (  x +G$PIՖ ( $*#PI"( /*HX#$hTIp$؋{( K*;UI ( e*#UI֗+=( j*:HX#$YI${ƌ( |*;xZI6ی( *6EPffdB[Il e( *\I j( *$,\Iۘ o( *.<<0m\Iv( *1=P%HaPaI" w( *aIc  |( +/I(bII_t ( "+/I`bIr8( 3+3<%fI`fIUbg( j+m f%$IiI ( v+ʏۏ54#$LjI5( +2IRL874mI8 _in( -PfD%4pI b( -G|54TrI. Ç( .#yrI"( .!D4XwIrH]b( .fgyI›ے(  \ E~ICj(  $-x@dI14=D( 'Mdm`t$I1tw( 1#b<l*#$IߛB|( :d8<#$DI=5 f( Py(6#$IÔƔ( UyN 4,#$4IqΔ( ^-E@I"X[( ?^$IDan( ĕD@I՜  ( wq15I"C( זPhuؑI %:I( ~AD+8mtIx( )`I7( ,ȗ*ı ДI͝ϗ( /`I7җ( 2ȗ*Ա ,Iݗ( 5`DI)7( 8ȗ* IS ( B05##ԡ`ԗIm 7HL( k\+XI PY]( od8a*;Ihu( sh/*;IʘϘ( -9;hIОdLP( y3#K=ITX( #I\( #$I `( %\+ОI.c@( TcݛxWEH C;xIENQ( Y]nDI u( ќ*;̲Iß(  #*;lI.<@( B ju g RDI<( Z'8D|I( ggRmIѠ$(( pW-$dI֟ ( Sv}(664I( $g0gD  TI0!( !cL 8IH M`( 3\+TIh oo<( 6ArfD+#$Ic2 7X[( `*HIjcjl( p8++#$`I( n D#$I רڨ( *s4I W%( yN\+4I4%( M\+ I7To( J..l*#$IX -( ;R@,#$IsWd( کDTI W%( yN\+DIɢ"3>( Vkp +`I{(  Ish( 1wq4,#$DI+s ҟ( ;-lu4,#$IJ "( F\ϭ/\up ( gJ -( PyKP*TJ[( ISlJۣgt(  t+;PJ ȮӮ( S*$;J->( 1u|*D;J7,( y"r 0< .\ ^ L JV( )24Dd,"J{=( )24Dt $J]f{( 4Dd%JŤ˲ز(  +&J( 3N[4(J$hu( x7|6;)J̳ٳ( \++J:%"( ,p.*+JV?a L( "^4|6p,Jke n( B|Z*<-J%g( 9-J MĴ( # .Jƥȴݴ( 2QQ4$1J ;>( :q*1JD]x(  "PP(|6J =KX( /ն +pd=JPIn( Z̷X BJw:h$( 2l*#$CJ:h9( 2l*#$DJ G\c( 8|6#$xFJԦ( gBD|6IJ#$HJ ( GdoG85|6dJĨ Rcg( / 7`9$fJ( Bοݿl7`94hJ( ,( 9lT.s`nJ [_( ,;j=8(oJq~( 8HgS\sz56h\Je( M/EdPE#$dJ( OT$J( *$JQ:F( X .k*$J/v( 56ЏxJRٜ ( $J( 056ЏĺJ%57( B8Jްٜ ;( JOXh( 54J:h( 56ЏJbٜ  ( DHJ 4AI( I_f*d#$J)m( %%L 48J nw{( HR*G$Ji( 8anH] 4tJ ( 7*tJG( :W. F#$J ( x*J,( h[xcJH,( ;HpQD0|J`_~( Y& $/T TJ4 ( 9|%g<+PJ( e&! 4 K %6u( ( gg4( $ K$`lq( <(8Dg,K=& ( x+4KXH7( |.@,#$@Ky(( %F[tAt2,Knw( *PK( ǖ *,!K#( 0*|!K) +/( ;I 74D"KIPY]( q*4#Ke( :*#K|( 85|6$K ( Iax^&Շ'K.s( oe.*9'KԷ ( {,;)K ( Hr  #$GK(  JK0( s1JK] ( u)1'KK\_ ( +KK0Nl( x@4i #$PK:1:D( VgvD\QKe( g@TЏԤ'\SK( dTK%5( Wpw66ЏUKɺ( lVK0( 56ЏWK( XXKB ( ':<-*$YK\ ?PT( j},*;[Kxv (  ,+5X\K( ! _K 5( 6 X,$(`K .( c ?aP+,i QhK`( w,+5TiK ( E wCN<[W;TkK"[lv( [ *;DlK9( { +mKV(( (vܡtsKw (  !2$$uK4;Tt( hNЏ\KyKü( 7JDx4zK'5( TY*#$l{K fy(  hlv%$~KnB_W_( 0b_5Kֽ(  7JdxK*(  Ts45\K%( 6 -HK_( A  !,5dKx4e( c *E Q8v{K cu(  mPijK0%5( } B|K\ ( 9 3N_APU MKu|( < HK,( k ,LYdU {#$K׿( /#Գ@0K( 66K$P4Gc( `0X/0V I\K`,( K =IM( mg<[p0K n( = t#K y( 1 *̟K( D 6+2854dKEk( i 5sЅ vԮ}#$@K( ĩK( y -]DK!C( p w֎KE$( &|0xXK( $+*K:Ge( :7EK ( +08544;KK\x( \QЏ4K/( ضK[ +( '.KR66Џ$Kx]( )D$K޴Bn~( B*tK( N*d K( [$lV3,T*<9IXK d (  x +G$K (  x +G$K4>GX( ft=;<ĥ9I`KB d (  x +G$K] (  x +G$K( DDH'DKC( w֎K ( :*,K /;( c*K5 ( |**lKY ( 5VgCK( 1'0K( 1dK( ,\VQ\K3@D( [lq;4G$K.x( <9tKI( j @,Ke$  ( ? N S D1xKZ s  (    +RK  # ( $Ǻ7 +RK,H<  f (   o@U 8w KM( --PkD|K<EI( 'TeH7ЏDK#Llp( "sKN( [V;Kj ( SX#$K _c( #8K g( * `$K4&( Wغd $K)$1DN( x4#$LK !( $&4&GLz ( Q#,L _a ( %.MHLAE( .T+4Lcr( N0@V ;LRhx( `*D!L^( ( \(LSW( <)L ]a( yp;0*L(  *$|-L78W( *dkdH57L^( N( RnȦc|wW 3#$T@L ( U  *,AL$1CP( gD&gT7CL( dCL( ( ` 74"K"g^b$\L-r"""( N""D ^LA"" #( 0#G#T#`pd;xaL[l_#p#~#( ?###B6Џ4bLq##( AcL###( I3$^$4fLh$u$$( ~$ $*gL $ %8%( %&*&X mLi <g&&&( &''pf@TЏTUpL#+'( |qLH<'J'( s56ЏtrL#\'( $sLm'z''( '''56ЏDtL#'( dtL0'''( '((66ЏuLR#*(( xvL;(H(L(( V(.+0wLg(((( ((([gDG$xzL))")( 68)I)<ET{LN)[){)( M)));|6W ;}L )**( Y6*M*\5|6;L V*Z*( k%v*gQMȀL.}***( I++,/hL;,l,,( u---eT&/j XL d (  x +G$LX-..( R.a.f.*W lL..( w. +L ..( ../8?6\#$L/)/1/( -S/b/i/l**L= |///( 5///XhLV|0z0:1( F2#3v3  FL(L44( :cLd$4(4(  L,474;4( Q4b4ghK6L 2k4( +4L bs4( *L={444( 444ZWtLQ45P5( (5558L&696[6( d666ИULZ66( f\L67D7( w8B8[84QPh L888( 9E9P9s L3i9r99( 999 \;LLf 99( :::E:0 LZ:d:( )@8@=@# L(t:}::( Ǻ:xk@8L :::( :::\+L; ;( *$LW;( CX,*$DLK;;( -#;5Ltx *;b;~;( <!=N=HQ|+wd OTL=6=( &$Lm ===( |>_?{?k:/] L%?( B lL6?( DL3 ???( ??@66ЏdLX6 @( L @)@8@( @@@@PdL,@AA( 9ADAd&[Lm'OA[A( ,'''56ЏL6mA( .dLSB_ByB( QBBB`,LdBC( y*LCCC( DCaChC*L{CCC( CCC*PLK,gCC( 6DD|6Lo,0D.DHD( ElEEp T7 LEE( SLLEEE( .F_FrF@`)L 6F( !$M7FCF( <FFF*Md$FFF( ?G0G7GAЏ7M6BG( BMSGkGpG( JGG|Q&#DM DGGG( aYHzHHpk(05  M6H( g$D MN HHH( UIIIЏDGHMmIII( G JJhЏdMo-J1J( #b#M09JJDK( ~NODP( 4n\FnA9M%P( B :M%Q( B :MQQ5Q( KyQQQT\=>M%Q( LB?M"\QQ( QQQP@MGC.R( w֎@Mn! RR( ?8R9AMR&RHR( WpRwR hQBBM RRR( RE4|EM _RR( SX64PFM$SSS( a&SkGM1S>SCS( FsSSSЏ4JM_^SS( VST T56KM U~A&T( _AAA076ЏLM68T( aLMITRTpT( fTTT56MM <TTT( m U(U/U8?6Џ#$OM6:U( oOMElKU\UfU( wUUUR,hЏ$'0QMr6U( zDQM UUV( eVVVUMVVPW( 2YYY0 L RfMgZtZxZ( > ZZdT;hM@];Z( 8 -Z**hMg%Z( BhMZZZ( [[\P8h|jM;&[( -0[*jM 7[P[\[( t [[[Йk\0#$dnM& d (  x +G$oMb([[ \( \\\0k8 $tM\]](  4]E]L]9d4uM W]d](  t]] 7`9vM;]( ! *$wMA$]]]( % ]]^d8 ĴWLzM^5^9^( _]^5{Mv d^( B@p|M$%h^( & B|MQl^^^( U ^^kx)~Mv^^( g /#Դ@<M ^^( \+XM^^( #hM^^( #xM d$4^( d-#$M%. ^_( M2_7_u_( `.ahaN& D M^a( " /#@@M%a( BMEaa( T $b;bBb56\M# q [bgb( _ {bbb8?6Џ#$MA6b( a TMj bbb( e bc5;#$0M ^c c( 6c=cX6|6ܕM HcTcpc( gccXWMDccd( rdddPЏ`X U4pM6d( M= `dde( -eNeUe076ЏDM]6de( 0Mueee( effč4M jy:f>f(  5 *M^Df(  ,M^Hf(   oo( pp%p*TM~4p=pAp(  apppD4M 55( *M a9j9( -*M %( *0M 77:( *tM/ 8p( #8L*0MI w'( j*Mf dd<*M ^i^(  wp*\M ~p7/Z( r*(M p( p*M p( p*PM+ a9j9( m9*MN d 5( *My $['[(  *M ppp( pp qĒT8M ^i^(  *M' U{R( q*MN d 5( *`M| ^i^(  *M ^i^(  *M %( R*$M Ig( V *M ^i^(  *M1 w'( j*MR p( # *0Mu u$['[( q\P \M U{R( p*M R9g( S q*M  <8( ?8,*xM Ǐ %q( Ǻ(q*M& ENQ( >w*MP a9j9( -*@Mr/q.( CGV.P+dM ]2q.( @.yq.+tXM5q.( =/c/*Mv8q/( :_\+M ^i^(  *M2 ^ 3( *MY d 5( *M ) ;q! ( = " X" d" ;DBHN uu(  u\+ >N8k( hbP?N__b( v,?N;8 vvv( Wvtvvlp bANbvvv( vvwp lDN0Fguw( Luh $dEN u*w(  u\+ EN45w>wKw( mwww`7tbFNwww( www E`7#$8HN&8W wx(   xhbHNFLxx( C"x4,#$|INi8L)x0x( C9xhb JN@xIxPx( J.fYx4,Ķ#$JN`xix( *ԶTKN`xpx( *KN ( &\+|LN `xwx( *MN2 ~xxx( xx\+*NNT 8xx( x* NNox7/Z( v*xON xj9( x\+8PN xxx( yy&yX6$['[( K4,#$eN 77:( 0fN%z( e.*fN:k( {#04gNY ^{<( \+gN{X1y:y( Cy*gN77:( YQ8hN%z( e.*hNk( {$YQ\iN ^{<( \+jNCX1y:y( Cy*jNq77:( YQ`jN%z( e.*jNk( {$YQkN ^{<( \+0lNX1y:y( Cy*$DlN2$77:( L/lNU%z( e.*mN{ k( =`0mN ^{<( \+XnNX1y:y( Cy*4lnN{{( {*$ nNv{{( {*D nNG %z( e.*8oNm)( *oN {{{( d8j{@,d |pN{||( ?8&|\+ 0qN{3|( {* LqN+v{?|( {* lqNZ{K|( {* qNv{W|( {* qN^{<( @,TrN a8( d8vo\+sN c|l|( 15 *DsN, Xu|~|( |*T(sNY  77:( lsN| %z( e.*sN ||( ||d\tN K||( }}*ttN k( {#TuN  ^{<( \+vN4 X1y:y( Cy*vN^ }'}0}( 9}>}*vN zE}N}( e.W}\}*0wN c}l}{}( }}}h$R4`xN  z( e.\+xN [ [[( w[*lyN+  %( 4*yNO 8t,( 8*4zNr  %( 4* {N 8t,( 8*4{N ( *#$0|N }}}( 0~?~D~@,$ }N 38<8( ?8Z@,~N a~j~y~( W~~@,ĸN (O8{<( Dh0N5 X8a8( d8o8+4HNb (O8{<( hN X8a8( d8~p,#$N ]p( #8p,#$`N ~~~( ~~|;4Ը4TN [ [[( w[*ЄN& [ [[( w[*LND >$['[( O/ +#$NY  ~~~( ;*؆Nx %( 4*\N 0( V%E*,N  ~~T( ;*N %( 4*xN i( V%E*HN  &~( /?FX6`7$0N4 z( e.\+N[ ( Xa4N| }( Nq Uq X6`7D܍N }( Nq Uq X6`7T̎N }( Nq Uq X6`7dN }( Nq Uq X6`7tN0$77:( L/NR%z( e.*Nw k( =`0N ^{<( \+NX1y:y( Cy*ԒN$77:( L/N%z( e.*N8 k( =`0$['[( G+4N 6 ~( 0/nM \+*N ( *XN#( FH4,N %z( e.*tN)$O8{<( DpW NLX8a8( d8o8+4Nr#( FHX,$\N %z( e.\+N ( *xN z( e.\+N %( 4*N< %( 4*Ni #( FH+N  %z( e.*,N (O8{<( Dh0N X8a8( d8o8+4N!8( [*DN\! p( #8($-N!Ƃς(  TN!% ( BPN"% ( BNT"v ( _Np"('$['[QN"%( *;,N"0<E( Vgph$N1# :( <-$tNO# p( #8($-0N#w( 1\4N#% ( B|N#k( {#N$#( R DN`$#̓( R T(N$#փ( R dN%#߃( R t@Ni%% ( BN%% ( B(N%% ( BN%%( *; N"&% ( BNP&%( BEN&^{<( -N&% ( B(N '% ( BN;' U{R( p*pNc'  ( *N' N'H H H H N' :N'$dD\`A|IHmpN(CFw֎N0($l„[Mք߄t-q:D $pN_(_(AqN(G #"#4N(kLS$3 bt+$N(ir.Dž:4CN) 2#b<+CN=)$6d838t+$N^) ?LO@?8[,ͤxN)b`cJ. +$N)bipN.x +$HN)CdRyN -ĻgN*CdqVy\wt+$8N'*Z#b<+CNI* !^ɆچL84ͤ$N*8bcoq N**If-*$\N+#,Akdu|x<4\gN+Cdoy\wawt+Ի$dN+H@,5N+‡Ӈ |ZQ(uN:,<!-4=X]dZS  Na,38<8?8J8+#$N, dk#8- t\.#$|N,{<H@,5(N,{H@,5N- ze.\+dO'-38<8?8J8+#$OK-$0HX$uOs-38<8?8J8+#$O-|rY+4#$PO-fƈЈJ.xs ۈ+d #$O- 3. O.38 ?8J8+D#$dO>."9[luYQx0O.Y_%ܤЏ'O/% n'B|T Oh/$ʉ׉3 "-r@ O/@%ܤЏ' O/%7n'B| ON07u*;, O0 \+ O0CLQ]8O0(ϊS;@O1֊ًZзh^ ,$OO1%sȮخ ?Ot1Zu6-lu*;,O1ь@ xa4$O1 -PUdx RO1o:qxa$( O2-X' T3%OT29Q`+T |E`dR 'O2̎Ԏ '@S-at[Il*O338<8?8Z(/ +O]338<8?8[++O3`$ϐ$Th ;5O3$T$vƒXQ,$O4,_ ('.J>O4,_ (,.J>O5 {(S0&+#?O>5 n 2(`@Os5 n 6(d0@O5 n :(h`@O5,>J(mP_ *AO6,n(v :}l*GO766(B^op}ԟ ;0MOj6ŕ(38*MO6Ε(38*ļxNO6ו(38*ԼOO 7 (&\+OO?7(S*S^POo7(S*S^QO7 cSf~(lS/n\+h+RO7 f~(lS/n\+\hSO8 f~(lS/n*\HTO68 v^a3;*UOf8 ! l^AL/*UO80&A"+B\+h+VO8 3GA,Ne*WO8j(wA7̖ 4D\O.9LR AV@W^X67]Of9LRqAc@W^X67$4_O9gOAnFȗ\+S `O9ۗA\+h+4aO: "AQ\+aO2: (AQ\+,bOf:B.1A7\+|bO: A BAJaD+#$cO:B.fA7\+cO:B.lA7\+8dO+;rg{A\+h+D4eO`; pA X6`7eO; j9ØAǘX6`7fO;ΘAV͙P`T$mO< a8Ad8֙*\nO2< jA9g*nOf< ݙAJ.5y*doO<  j9A*$pO<ؼGCN_**TrO=fszGwd8b*dsO;=(GYiq,xO=G **d|OD> 2SGa** ԂO> GeDU\**O> vqGsy*O,? G}3*Oi?ԞޞGMYpe O?zrG *̌O?ȟ:OҟG*O@,G**\t$O@ G56GN\+*O@ asG\D>x t#$O6A/¡͡Gi-/`P_ O@IDE2gx`7OsI&38*tOI/38*XOI838*OJ &\+OLJS*S^O}JS*S^OJ cSf~lS/n\+h+hOJ(AmpMM,\OK Mf~lS/n\+/OKK v^a;*pO|K ./7/ZY*x Ծ#$0PzO/-/+EVCPkQ_xBմ dp+PREt<<C#pPqR$Hgk^ʵյ $PREt<ݵ_#4XPR~Ӷp#  P)SH/3c;t$ T%PdSEt<ͷ#D&PS`ٷ :al};tD x)PSEt<#T$*P!T Ѹڸ}tb d+P[TEt<#t,PT&ѹ<MI2PTEt<#h3PU1Ebm}dap5PVUEt<x#6PUo PH84\8PIR\]6. .**8PUǺں޺;d@$~;|=P VQzsx>P>Vp#8EO>PaVûֻ0X LL@Y m@PV(+tC$ \adPW(.,e\t4 0Q rPW(2?R_}45f`tPX(<8Q |P0XPu$y 9PVX()Aq -` PX(e/X d  PX ##hPXS*G$PX03WBt+G$DPYIRox* P?YUy*P^Y564P~YgV*PY0[.A*b$ PYF P(54t$PY&*_*t$PZx54PPZ%M2N_}}D8PuZ jpw#8- 4`-`'DPZze.%ԷPZN54ĿP [  ?*عP)[3$*G$P][QZ+ 3%`*P[ 3&8ch*VP[ 3*$aL d #$lP\6CV3> x ;$PM\ 0-3-<*;P\ Qk3mED5tQ

h!fu4D #$vQfh =(cQЏ#$TxQh%2@B|xQh569IlyQh  $K~PSx|Qh0lpI6 }Qi(p|DQ;i,TDQi'47`]Q*dRw }h/ lXQRw'}.[*6lR(x3EI}ix:8dK448RyJ}I>Ry}N.?>4RzǷJ}*-c,*;0RDzQdt}\t5lhRz}h1@X@|6#$RzIY9R}hw ^aD#$RH{"[}#*TR{'[}l*#$R{}?8l*#$R{m\}\B4 R4|e/$}2649I!Ro|CP}.*[:l"R|Y^}l*#$#R|{M} mR#$ %R}}*@%RS}/<}*#$T&R}~}0*@4'R}"}BU`4T#$(R~k}*@8)RR~/<y} *#$)R~p}(Dx yRd#$D+R~}9?855+R  Z}E5#$,R:}R*@`-Rr/<}\*#$ .R$5}djMX yRt#$t/R_ly}uLDD50RM}LDD#$l2R }*@3R/<}*#$3R$'}jMX yR#$5R7?L}L5RpIY9V}hw ^a#$6Rly}#8 <9#$7R } T49R".J}`Td#$R} 1 Q}*>Rς}0U}3_X64X?R(fm {}  lDR6Cj9}8 T<6,ERn Z}@'6|8|6ER T6B=}IgBWtlGRۃjy d}T 5*GR ]l}Z.p,5HRD$ryd}d  GMR0  2< }P e X NRn qz }   d`4|QR  }!-!|QT#$SRxz6!C!G!}o!! GlWR# !m\!}!7xXRX$!e/!}h/!T*4YR8!","}"""l0īG`R ##}j%#H<>> 4Rx(>>?AAA;a 4(R?BbR2BBiR,2BBmRg$BBBqzB_*G9R,BC C2'82C04G$SҘ,9ChClCGCCC04dG$ S,CI D Dd`G$4 SR,D7D;DgDsD04G$HS0zDDDDDpZG$pS0DDDhEtE|EpZG$S &\+0S: V_*xSuEEEEEEtЏ@SEFF 9F@F(668S SF\*hFǺF#PS<FFFaFF*SFFFWG*D SқG,G0G[GlGwGX@UUUU**tG$HlS$UUMXU**G$nSPUV[XU**G$oS|UViXU**G$qS4V]iRV{ha|VV**G$sS VTVWW(I|6G$PxS= ,WVWZWWX,G$S}  &#,S XX5X+yXXXtyDS, 7XX<\+ȄS  A\+Sa XG*SdXM\+$ṢXXYZ[9\\GP 6PS*]]^^^L,H3\S[8!^.^2^^^^5prtS$A_M_P_U_x[h+6|Sl_M_u_h/z_*P1G$SC ____/P1G$Sy___"<94dS___9~A_p5S(O8_H__*S```M*`A`<94SV8.F`I``O`f`qh+,S(k`w`z`e```L/ĬS44_`j__(2/pS```o``<94ܮS9``ab#a,a@7<;,S9aWafaaaa?\#$XSXa3bbdyee"FRp \S>ffVf*G$lSddfg gcjgggl4Hԭ \lS8gg1h}iii* G$,Sepiiiiii6G$$S0iijP ,j7j5VHS7(JjWj[j kNk55+SuL^kqkuk kkk8HUH`S$kl!l"{lllFPS$XllmD~mmm7 $ \S @ nnenlS9 @ nnen,S8n,nWnoNoiolrHTXoooooZHL \T(ooo]pnpp554y@T! a pp   *d;8TMpppSq`q\$;h Tvdoqqq|rrr(1 \P\ \(TdrrrP^s{ssmp\$ \TO8ss-tru-u;u rHT8uuu^vuvv5yyyp2T*z!z%zJKz|zH4d5TZzzz[gBzz\+*7T{{({C{Z{c{E5Od8Tn{{{{{Dm:T&{{||||8( #$T>T|||G7}>}1t4?T_}u}}}}0yKkM@|T͸ӌ %LWM@|d T ~ǍލMdTI1)}M6p` Tڎ?38Bl3*tTĹ[pNƏ֏`yRtT} rT%ayǒ P46D6PTa-Plyxy\ T(Ԕ?C.9y(TE0 Tc~ޖyĮ>T0ʕ8ЗS5iPGl >T»֘͘h;B+G$дT$aj}swǙy,SFжT)$ܙ?^wyD>GOкTY4pį TК$9$FPTHT[by~+h+4T_l7PBT) ›>ɛЛX6PBDhT]כt+TtT cSf~lS/n\+TTʽ')+h+T:Ft+dT? Mf~lS/n\+Tw('$['[y6lT('$['[y60T OX*pT) 8p#8L*,T_7%_K dt+3ThiK*+RTտy nK.?F4ItTu~K+LTQMӜDRDTi J]aMnsT ͝M?94T\My<944T3MGUl*+TWMPÞڞ*+\ tTpMc#8 *0T Mp`bHS\Py\dT^{M˟\+*$TI$M{T^LTǠ; ѠM -؄T4@EMXivܐԯT{MǡpT@ MJhTM5\\TߣM^!>UTUyTtMm$a _8TYʤפMy#$a _8U,DSM{yyG#;8U% M|BU$ץM gvT< U8,MPy1 UcGgM 2 hUeqvMysUèM*I<-\4U@ {M5{ʮ$[48h6Uï̯M_uy,;7U3FoM8a >UCcM'tt9[x< QUQ6BbM`gB*RU:MnAx) G( eUf 7Mҹa kU M'* lU&)M2x\*nUcqMO'8Ѻٺ-qUg MuWysU. %>IMut8uUSͻѻM_#*wU8HMD{U M*U M> (6$LUKy}Mg@`rLU Mɿ(6U ҿM$5<(64U!CM=L(6D%0UZMg+IY(6T%XUgM(6*ZUMZ]M#8qv*4HU}Mh/*4PUDM*UvMI*U*[M  (6US}M(6U9YkM8#+*\4`VrNo|Mb*4V_M<HU*] 4pVM+4(640V BOZM8y*+$VbMK*$Vb.MO *$VMTW850L4 lV M^Lgtyz9IVBMoT6<r9I%V M?C0&V4(MWy4DS'V_'MCJp/T*D9I )VUbM6O(<Xb .V~M z|050VD(5XM z99I3V %M$FU\*;4VkyMDXhd6t6 9I=V;Mmh/p/$9I>V_Mw U\GD9I@VwM|Gd9IBV M/BIG6T9IHDVP]tMG9I4GVPMh \\*\8KVcM"$>d4KV-AM'*0 H 8fVkMDX64LgV  MPo|Q$RmV& Mw*|nVK RVM *ltVx M)BI*yvVZMptV, Mi6MT*ytV [nrM*yV1MN#@yd %V\ M* 8ХV ;?M* $VM.54V7osM0h*TtеV> M{n*ytVwM* Էl W 232]2M 445z>^ W745T5j5M 626A6R84XhY6s66ME ::u::f\4|X^M*G$X::\M: ;*X;\;;Ms===(z9̴ $X2>O>>MgX??*4G$'X\?q??Mz@AADM F-X+AAAM!AAA*@/XAABMTBBB 0H #$@2X%۸BMB2X $BBBMvCCCX%۸EMB>X:EE!FMFG+G8 (St #$EX\M9CpGM ,DCD#FX%EGMEE#GX%۸GMBGXGGGM!GG*HX GGM?GX6q dhNq Uq X6`7Y mhvh}hhhXa$Y' 7/Z*Ydv9h%#XY Y h%\+Y hhh% hhXpT Y i/i%%iD+5Y 2i;i%Uihi8e$R#$Y4 oiY_xi% ii8eUЏ#$Yfiii%DxijXI4 Y j8jl*X'Y-l6lEl3C[lvl}l54D (Y(ll3Ilql*T)YUX[l3N*)YzX[l3S*)Yd<l3X\+*Y ol3]#b<\+*Yl3c**Y\l3hp844+Y<0l3qlll +d ,YgmY9m3z!m2m9m8:4t#$-Y_bDm3*.YjyNmUm3 5am*d.Yhmqmxm3(mmm\+)4/Y'mmm3mmmX64$@0YJj mAmh0YsllnA!n$n**1Y+n4nAnAPnanhn+*D2Y I,*2Y unxnI1 *2Y _{n~nI6n*,3Y.unnI; n*`3YNunnI@ n*3Yn7nnIGn_*s3Y nnIL_ *s4Y nIQ*44Y nڬIVu *d4Y,nnI[$nt+4Y$nnnI`nn<9445YN Ƿ oIj-lu o\+P6Yq jy9@oI,  *6YF oI1 *(7YڹoI67*7Y & oI;U<'o*8Y F .oI@ 6o*8Y`=o@oIG  Ho*$ 9Y2`=oOoIL  *9Y] jy9@UoIQ *9YF ]oIV *`:YX8ܞcoI[kozoot+4;YoooI`ooo<94D4;Y ooIj<o\+T|Y  ooI@U<'o*t>Y `o@oIG  Ho*4?Y `oOoIL  *?Y  jyoUoIQ *@Y+ o]oIV *@YM X8ocoI[kozoot+8AYv oooI`ooo<944BY  ooIj<o\+BY M9pp\p-pCY 2p5p\ n$n**DY e :p\$EpVp**`EY( v]p`p\j#EYK vfpip\%#0FYn npwp{p\pp*@HY p\*pp$$IY  jp\.9 1P$8xIY  p]p\B*)JY hppNq\FDrrrp| 8TY )sBss\ tQtht\0 Џ, 3'YY tt\wtt*dtZY  tt\3.ZYvtt\4$K=ZY(Ttu\5ZYN`t. \6xAZYttu\7#ZYjyu u\M 5*8[Yuu+u\Qguuuh4]YXuuu\Wuuv|*_Yhd v"v3v\^`vovzvH/`*,aY vv\p:q*aY vvv\,v-%bY vvv\2vvv@=t5D%LcYA vvv\<v-%cYm vvv\Bvvv@=t5D%eYwww\N+wVw<94 gY[wdwkw\awwwB6phY[wdww\iwwwB6p4jY,' ww\qx>xCx0h+p\kYZ$Vxcxfx\uxx,mY=x\x0mY=x\x0TnY=x\x0nYxxx\x8y<94rY=GyYy]y\yyz8HxY.s0z\@sp.0xYz0(z\e.@,*4(yY"Zu.z1z\-lu*;yY]:.7z:z\J.BzL/%PzYvvIz\L/%zYD0Qz\e.YzL/%H{Y`zizvz\zzL/%8|Yzzz\z@,4l~YN$ zz\  {{#{ k&Y$ .{1{\ {{ k&Y9{B{E{\Q{@,4Yvvl{\*+mY-9{B{t{\0Q{@,4Yb{{{\,{{{+*\Yx${{\Q{lu0܃Y${|.|\W\|}||XhTY$|| }\fz}}}x XY}}~\~*~/~X,$(Yi6~N~R~\~~~"44Y8\~~~\~Q*YX*-\?\aNOD*Y\lux\%$O9*Y \.8OD*oY@\1XirBЏ`_ Yj\]ÀڀA4OPY \ywq4,#$̜Y(z7s\}e.4,#$\Y%7s\ p.*Ya,(F\rUh@x* 5ZYL5@\jq0 TLY |o\,d"0KYƃ\X Bd_ YP&1\-^ov*Y%l\U܄$RYL\he.BY|\me.BYG\r `A9IZs)6J\Q p645?Z)6J#\T p645P@Z)#'\Wp64@(AZ*6J+\Z p645AZG*6J/\] p64CBZ|*#36\`:K*[:CZ*#P\cT$dQ\DZ*$#[\f_"Q̢4EZ+6Jf\i p645FZK+#j\lp64@FZ+6Jn\o p645GZ+6Jr\r p64C|HZ+s#v\u#*[:4IZ",6Jz\x p645JZY,#3~\{K(CJZ, o \Ģ(64#$KZ,ˢԢע\ܓ̓#$@MZ- \;Xc#$ OZ?-F jm\u4,#$0PZ|- 0\54 XQZ-%\ǣSQ4RZ-+gΣѣ\գ54$SZ0. & \54#$UZm. & \54HVZ. & "\54|WZ.&\*A54XZ/H\*A54YZV/ & L\54[Z/P\*A544\Z/T\*A54`]Z0X\\s54 ^Zo  & x\|SQ#$_Z90+gΣ\գ0dQ(6`Zq0\*A54$bZ0 & \54XcZ0\*A54dZ1\*A54eZW1 0\54 fZ1\*A54hZ1 \$¤Ӥؤ*;hZ2(#\Ag p )|kZE2w\b,*kZn2P. Ui\l9nkZ2,\'8A" XO~`*{ZD5 lR\R*|Zq5 \IO_*}Z5 gn\u +X~Z5|\t+h+$lZ5 \&\+Z$6 \e.*4 ZM6 ƨͨ\3֨ۨt+DPZz6 \&\+Z6 Ksf~\lS/n\++̂Z6 Ks\lS/n \++TZ7 Ksf~\lS/n\++Z37 f~\lSD+\#$lZZ7,R\RRHd\&lZ7{<\P+Z7 #\d0?Z7 %z\e.V* 4Z80#\dTdZ/8 %z\e.V* PZZ80#\FH`d܉Z8 %z\e.*lZ87/Z\ pVhb8Z8dg\% D"*Z8\C(/OZ&9__b\v(/ZY9G\,GZ9 Y \,9IZ9d\*6LZ9 \ *[:tZ:G\,GZT: Y \,9IPZ:\?9*OZ:V_\4*k9\I*6(ZR>{oP\ `*[:Z>\C(/OdZ>__b\v(/Z>\C(/O@Z?__b\v(/xZT?k\,O Z?__b\v,DZ? ^{<\P ,Z? BB.\,I@Z@\e.p.u.*МZI@kȩϩ\\*5dZ{@ة\e.p.u.*PZ@kȩ\\*CZ@\e.p.u.*$ZAkȩ\\*45ZEAk\*C@ZvA__b\v*@xZA\e.p.u.*D6ZAkȩ\\*T[:Z B\e.p.u.*d,Z?Bkȩ\\*t5ZtBk\=4,BTZB \ 4,#$|ZB [[\w*ZC\ * ZDCd\*Z|C n \*4̤ZCG '\]*3ChZC07\ .@*$Z*D dGN\W*BԦZaD ] ^e\nu854#$ZD %\*0ZD  \ *XZ Ed|\*Z?E{o\854|ZwE d|\*ZE \e.p.ê*ZEʪѪ\ڪ*ZF]\. .*ZIFʪ\ڪ*$(Z|F]\. .*4ZFʪ \ڪ*D4ZF]\. .*TZG %\*@ZNG  \ *hZGʪ\ڪ*dZG]%\. .*t tZGk\=4,BZH \ 4,#$0ZVHk\=4,BİZH \ 4,#$ZH %\*BpZH  \ *#$Z2IG\..]4ZdI Y \EI.6tZI ^{<\<P 0 ZI BB.\=0IOpZ J]DK\-c/*Z>JT[\d*tZsJ]Dk\-c/*ZJTt\d*xZJ]D}\-c/*ZKT\d*|ZIK %\*Z}K  \ *(ZK]D\-c/*ZKT\d* ,ZL]D\-c/*ZRLT\d*0ZL ǫ\N֫*$ ZLhl^\#*ZL  \:KRSQB0Z%M ex\$[W#$xZ]MX%\4*ZM \-{* |ZM %\4*ZM\t+4ZNd%\4T*Z*N]p\#84,#$Z^NɬҬ٬\T[pT4@ZN  \1:ldxd4DI0ZNAJQ\w Z*TZN8a8\888*$tZ(O)j 9\9*DZ]Ow/9\?9D9*dZO %\4* ZO O8{<\D$-MZOX8a8\d8o8+4hZP {<\H*ZKP7/Z\+4Z}PĭI֮H@xc Z)Qt)0#=/nP!ddĹZnQtWcj&q!tĹ`ZQvb#ZQe EpVp**ZQ%`oe/O,Z R?8/OZ8Růɯկ/OZcRůگկ/O(ZRůկ/OZRe/OhZRe/OZSůկ/OZ+Se/ODZRSe+/OZyS%`o7e/OxZSůCկ/OZS OS_r/h+OZSew/OZTůկ/O@Z?Te /OZgTe)/OxZTe;/OZTҰ2Wf** $ZU}^ờ 7 (  ZUEt?0*Z V58+?,f*hZ@VP\d~48;ZV{{ *8ZVu*ZVXɳ̳c*Z=WԳL*^G+9P0 D[^kxfm^bV$XF[^m +G[^yb bЏ;TI[ _ _$1oD*dI[d^vQXt_*)I[^biy*I[D_ ՚qx~#b<\+)8J[g_<9$4PK[_L .t+)K[_ 'Ca`ĴN[PǏ X64P[_07X@ 5Д#$Q[ ` >ASho864R[3`v844DT[R`H@W85|64U[r`#b̖ 4,AU[`{oA BSq^yl7|6#9H[Nw$S2<x7KDe<[w O8{<SD$-M[wX8a8Sd8o8+4[x[*G$[exvyT[ +G$[xWdu[? +G$[x }[> #<[y[Z#(L[y$#a8,[_2b$##([ z ASf[c$X#(8[Kz$y[nXQ$T[zX[$[r*h[ { ([#8[N{?TW[%~p#\{u[4Dx*\{ _[,\| )[#\^|[ \| )[#$\| [m^ ##\}%([?B\]} Gdg[Ol##(\}[7E\} _[SL\~ )[[\R~[d \~ h ['#.**DH \O9ER[Xy#, \[b{ \[jM]hЏG$\-[ldH\x [&\+\[\+x\%[4*\S [-GX64\%.9[HW^\++4\RRi[RR*D\' r~[\+\k !*=[TY\+T@\[*\ls[J.z*d|\D [*\+tP\?[*\̃ [*\+\ [&\+L\Q [&\+\[" *\̈́"[J.z* \ +4;[#8*X!\U{[D[Mo[*("\\ep[?*l#\օv*$\ n v$\> n v$ %\tv)T%\v.%\ v3%\} 1 v8%\Vpv? $)$$'\0BIvUg -h+pDr%x(\Ňv3*)\vJ.*)\9vJ.*$l*\uv *4 +\ve.*D+\v3*T@,\% v#BGt+S-\acRTyc*.\huy)*t1\X y= *3\ !yM*3\ D'*~E/H4\\ 6?H~~Tc*d4\@l~`54d z\=\ v~*t=\c+4~Hch*d?\ nq~*?\~X w~* ?\X }~* ?\u n~*?\ n~*?\T~I*A\} ~*,A\~ \+DA\^~\+xA\ ~2[j@(D\٤ ~3*D\6 v~J*D\ d~*E\~ 7<*F\zG~Q* F\X X~* F\j^~Q* F\_hk~{*0G\MX ~%*DG\(~)%0*űJ\I]a~U(0lG4!Q\Ы8@G~gIv*R\/ 3-~. .**S\L~(!LS\d~*pS\T o~#bo*S\ n~*S\ n~*T\x n~*4T\د n~*PT\;X ~*dT\ n~*T\"~%/+( Z\P~P R `\  ~AgB5<*/&|b\v$GT~mD!\a %i\)  %~7. D+#$hj\jy ~< 5 *j\ݻ{o,~A*dk\6(  ~F*űXl\p&~Z>*m\. ( M~_#$m\L$. ( Q~d#M4m\. ( U~i#%Dm\. ( Y~n# Tm\Z ]fm~s?C85t5Dn\~*n\~*o\ݼ t,~*$o\ . ( ~#%o\f, ~Spz y\ ~%* {\ 4'[E~8*{\XU^o~H*Զ}\ipD p~Y*\ ~qG*<\%~M\*8&\d}~ (6T\L 4p6~GL*<\S`q~ W%\ -C\~>*\4\l~fo~*ؔ\~zD9I\#/~[7t\k&/~8GLD@\ U^bZ+\5X"9R[S K | Q-   Ա \ ? Q5?8D *\8  %K Q;. D+#$X\ jy R Q? 5 *\ {o,X QC*T\W ]^ QG-d *\ i z  QKm  *$l\ (  QW*ű\m $. (  Q]#M\ . (  Qc#%\+ , | Qi  p{] f  QxV  5`74t] : J Q   :JtP ]  $S Q#` ]  $S Q#p ]a . (  Q# ] . (  Q#  ]*   QzDD9ID ] ) 6Q[2 * ] X[9 `4*  ]  N > M `:a x *ķ#$ ]y \] `@. .,9I] \] `G. .,9I]  % `N,9I$]>    `T   |{7T9I4]  d ` x +G$] 9 ``% 6 VQ#$] = `l*]^ aA `pK d ] i B `u  #] G  `    *d]  ` *]9 ['` 0DO [{|]o vfm`*.x*t] vf`0.x*L] vf`6.x*].! vf`;.x*]r! vf`@.x*]! `E 54Խ ]! 7J`Q!3Ԉhtq d!]." X` `v*x!]s" v`{`p*!]" `d8854"]" O `/$<Ԋ\x#]H# *6 Ap`_dn $]# $=`Y%]# $#&`Y|&]# $1 `+/4h+\1Dd'];$ `/*L(]|$ ;DW`m j*$)]$ }`Ǻ7 *$*]$ mh`hX6t5D+]<% ((`*,]% `*-]% $  .]& &P$$.]I& OS-v L,*3]& ! ,Cl6]& 2ZV3Y1 \+7]@' x5D+#$08]~' }!HD:]' vyOP$:]( QD+#$$;]E( Z#4;](  $S[#D;]( z\#`;]) vy]P$;]X) c#;])  $Sd#;]) e#;]6* vy>fP$;]* nW|`D<]* vyrP$<]+ y#=]Z+ vy}P$8=]+  $S~#H=]+ #X=]3, v^a;* >]v, MG*\?], +#8#*@]- *70/nF\+$@]K- |\+A]- ,U&7 \P]M. (LY]z7QU]G/ "03<* `]/ r*b e]/ u*8e]. yy  *e]0 -{*0f]U0 U*g]0 V_*,h]1 )M f } poR\6 m]V1 (2f  6l 7Qn]1   (!>!!!*s]1 21"4" Xs]2 (7"[""#_#x#,Te|x]Y2 ###57$R$X$*p{]2 ($$$=~A$+Q ~]2 $$%k%%%d6]#3 (%%%(%+Qp]b3 %%&1P&c&h&*D]3 &&&6 '$'*'*]3 S'e''I' ((:4D]/4 >(K(Z( w(((4|6$6]n4 (M((S(]4 (((( ))*4؏]4 ($)5)D))))zDe]25 ()- )/X)+Q\]s5 )**=K*^*c**T]5 7/x**O**d]5 ***" ++#+94]w6 (6+U++6c,,,4VȌd ]6 ǎ [r*]6 --&-wH-_-*0]C7 v-----{{,#$]7 ,..1....d`*1]7 (...'S/}//,{DDd]8 ,/A/N//|6]9 0///Z+0<0E08Vt\]_9 ,L0Y0\0lv00|6ܷ]9 0000z1 22,]x: X32* ]: B&92+] ; 2$<23T]B8 2$n7]K; ( :?2 ;f,_X]; X~ D2#l]; 0G2h2{2222pZt6]< 0 3>4!3)Z3w3HxG$]< U{33]33*G$`] = 03334#444@{$DG$]@= L4Y4\4n44l74G$]u= 4456r66pb 4]:6 6*]> 6B6 667|;44H]@ ~777 8@:: Jb ]@ ;';6;W;p;y;QR6^@ (M;;S( ^+A (;;( ))*\^kA ;;;O<v<<44D6^A (<<!m<^A <<<)=7=<=*dX^8B (e=v=====T{4ed ^vB (==$|> ^B (>#>0( ))*X ^B C>>>8???D6`^?C (????#@6@I@D4^C ^@g@@N@@@*Թ^C )A>AQAAAAQZ68^ D (AAA!/A+Q^LD AA)B*p^D ("B+B.B;BJB+Q^D XQBɳ#^E ("BTB.B;BJB+Q,!^^E Xɳ#@!^E ( WB?2 ;f,_"^E X!D2#"^F vZB U "^MF $aBBB`CCCh{Da<(^F (CCC9 D *^F D(DyDID!E'E*\H.^G >(xEZ( w(((4|66/^ZG (MEES(0^G (EE( ))*1^G (EEE#F@FGFS64^*H DRF^FkF.FFF\|6RV6^eH ;FFO<v<<446@9^H %G.GWG$=7=<=*;^H (GG(m<<^,I GGGHFHUH44$6$?^qI (pHsH m<T@^I <~HH(=7=<=*DB^J (HIII:JJJ84eI^wJ (JJJYkK%K$8VdL^J 0K:KoKvKKK*8O^p@ CL*O^J L-LjLLLL*S^8K *M([^L (M#>0( ))*Dx\^L NN"N`4NEN|;|6]^M LNN@OjQRGR܌pVd r^M RR SS8TMT nz^N $}TTT!=UhU@0l x^|N UUVbWXX\ؠT ̛^N ,IYRYgYYYY_T ^O YYYDY:4Ġ^oO YZZlZ?sjjj8$h( _3Z h%kV{K_jZ )kBkFkX|kkk4;aT _Z $kl#<_Z <kkn)lTl_lDHTV#_[ (zl. #_K[ @~lllnnn0| Dod8_[ Iou8_[ Momoqoo2p=p܎ ?_[ xlp i?_\ Momoppo2p=pķ܎ F_O\ ,p4*AIF_\ Dpq q6AqhqoqX4;doJ_\ ,qJ*AIJ_ ] DpqqLAqhqoqX4;dou ' w:0 *{`xu !t מ<>ڞ*|`u <8?8*}`u '*x~`v 77:*~`Qv a8d8֙*l`v *`v *`v a8d8rf*`%w 1"*܄`\w lR|`*܅`w KK%K*`w U{Rp*̇` x xBT`Ix  %(xP*`x Xxt*`x :CGxZY`*؊`y ,kux*M`Fz XGx*`z 8MW_xZ=R$`{ jy 7x 5 *t`R{ {ox* `{ (  xd838*ű`:| 2?BxN*`| 5Y\x*T`} _`xp*`| x*`e} x* ` ~ $-:ExMot*(Mp`~ x!54c %X` $Lc{xBI*tt M` ^xϤ֤*` $[x  * h` /:x,f*D` qzx@gB85t5D$` ťx#*Щ`~ _hХx+*` ӥx4!&*%\`{ n-xZ*x`U~ 736xaB*$`P X (xh*Ь`l X Ixm*` QTxoW R4<` x`U 1x&Ħ*` ɦ֦x0':?*\$`ׄ VcfxJ*`# x\Чէ*D`[ ܧxl*`i x *dd` %x` .8xl*`= #-1x 5*` ^^ax*P`Ɇ vvW##` @=J] Ȩh\S z!`g  [ݨwq*`  *t` (C?9*ű`F  *` ]j (Z  *`ى $ $*M`# (*%`q ڬ , 5* t`Ŋ  0:E*` ڬ 4 5*D`\ ڬ 8 5*`  <:q*`  %(wq*`? -*` (C2?9*ű`، 9*` ]jM>#(Z  *x`o $ E'*M` L+*%` ,DS/P p{L`] ڬZ]3 5* ` dg7:E*` ڬZn; 5*`N ڬZR ? 5*` dsC:q*P` yRȩ**I`1 ϩz**`s !$9LS*T` ,ZQ]h(6\x` 2*h` ȫ߫*`1 +-*`| }  ,`͒ %`1V\+` +8;2x54D`c FWp;RpTT` լެ%>k #`ؔ   *`/ *`  !$=*L`ڕ +8;DL/O*0`. ]2 TWP/a*` $f"H6˭|PlAx` ޭG** `9 #V-*d` 4QTZn}t+A&4`D o *I`a 9FO qRpTt ` կ/"ESRpT ` gxVʰӰRpT`E %`qV\+\` r54L` /3{P[*` avy>*$aH DZֱl7`7W%a ߱3qx94Xa ɲֲJ *aʝ $mUjs4MP a( ~54 a dzԳ* aܞ #MJQ*` a@ ^w{U\W%a Ǵش3BG+ITa ^*pa bA@##la8 е0 %4\Lab 44A`$,Dz!ae CT{&AL=`90d a ϸָ*!a # *!a D6u :|{L !-ac ivP* `1aV D\( %(?aߩ PhxDa_  %*Daī "H*o,T 8UaS .*t$Va I_frx* <\a +Xe:,KD_ag vcw~t+(^ @ca  {PgaS  $)P48d Ija" 4;Q ]m$va @ /D4`n`K4Daڳ adȀa@  h*a l}J.* a 854 a &*_p{RR 0aڵ 9ZRRtxa' ʁjm+u*ay vq|0yު *|aж <$56 ؎az  ),J^o>4pa۷ v\K{ ؕaɹ jza N  RpTa .7;[vn$R#$$ag 254Xa =7NU*ak bkrD+آa L 94a %`9"RV\+$ah (U95SSO54 a %`9TbV\+a Zgjc354pa% 'v}m + Ha Bz +a^ %`9V\+0a  d8Z54a Xz *a .EL:`7ta ktwM;4ab *aM *(a *haJ %+*Լa MNQ*,a B{<F' *شa d 5*a gq; u*a_ $['[*a | d|T$8a ,qt,$ 4a *8a "/~FG*D @a &\+a>  T'e*4a ps/*a;  x{4*$a K<*a QDx*Da> ]$4:*\,a Sl)p Ka +d a-  <6IP56Џ7Xa e> a= `tDR@TЏ ta F a R>WbR@TЏ4ad yT a f076Џxa% h!a 3C1ԃ`$!/&a "eax56e a ^n56\ a #4;xc*Ta: IT}ch*da is~*D!,a $R@TЏd!ha@ .7! a GNn*t@a U`s*!aW K*\a *a *ah (# # # P$ /$ ;$ 4hP Spa @fh$ {$ $ t$a $ $ $ w% % % ,Sa % % % ' ' ' |F6( Shb" 8C( ]( u( `_) k) v) @ I  bI ) ) ) ^ * * * *d4 b} .* ;* ?* @* * TjpT4Tb * h* Y* * 5(b d>* * j+ 2+ *(b 0M+ V+ a+ |}+ + !Y(bM + + + , , , S. l,0b@ HE. W. ^. Go. . . ,x b . . . . . *!4!b% . . . / / *""bV @&/ 3/ p/ / 0 0 d*e ,T'b HY0 l0 0 51 1 *1 $D,+b (@S<-b .6T` 0 g\V@',3b[ N 3b 6B HspTL5b <'+0{:p6b q;,27b^ BI0bR*l7b *YdI|*I$9b DMnP ]::b qX2T;b + #Md;b\ ǖ ** @=b !T *'Sdp`F>b ox9`$"F@bC + N#@b ڬ3 O 5* Ab  P#Ab @X zl RX X к,Bb HX ^%Y 4Y F,tDb` D/<aF1{4\-Hb TVc|i!4]4-Kb) <:GP{{H$-`Ob  #*T*H(TQb p*+QbF 0IMq#$Ub <[W4Vb iC3#+pWb cm0CQ{Xbk (L:;e qbb `mp3 t+h+ db <X{D4E5#$8b LPc8!n`f Vb (?RfKd8t(@bD $WX%8t84b iv{yв;@b $_#4db $+ R44bd , 1M7"4 b vSb _^5 5\b, hq}~54b} c .b $6Y{b b6Y{bf t}{a5b *|*Itb P$70hV"bM P@sEnoL\",b <{: b 7"2CSiЏb XLP.*b$ Vo> 54 b (3;Sgv{*$UH$8b XLf*LbX qj2b qn2tb [6r*bC d 5*lb 'Ħ*Db $['[ *c *cU U{Rp*c 0dV%dQ4@c NP\+DPc5 %4*cx .4<.c S\j*+Tc ,4$c  ..  /@ a (64 c $j w { G c8 (   sD [ b =Qd@dco i r     854tc (   D [ b =Q@c  i r     854<cB  Y1  S l X6 #b<+s =co #b<+s|=c 3.! .\.>c 3.'.\.>c -6:Gt?c, bk(@4T@c b(@4d4Bc 1FKby<-@Dc (~#s  HIc $ 1B=OPPc; JI)Џ+hUct %5B|Uc 3Vc6:f Xc  /7, #$T[c' $^gk;z4\cS D mQW+L]c| 4()0P%,^c 2==;,cc .DI[ظm\hc %hc@ %dic{ d 5*@jc  #OOpjc !#tOOHwc) q #wcT g L,*yc} jmT**zc g L,*|c q #;@}c '+V AL,*;c# q V#;`cN \quyL,*;cw i9+$)Dc /Ql0**)c v;$)c Cv**) c! q T**cL g L,*cu } #c   E Q L,*c  $ec    **eԕc d #c9 A !y#pc]  !$)c /Ql!**)Dc Y!]} $ZOc @ !"!**ZOc Y)! ]} $S&Xc /!%#S&ܙc3 5!B!E!*x!+*eOԛcR !!!P! "؂T@P$ct $'"?"C"rQ"0T @c d f"#dc A l"y#ܥc r"$)c /Qlx"**)c/ d ~"#ԦcQ A "y#Lcq d "#pc A "y#c """ T"/*\&Щc *$k$$*@c $$$%%6 c %% &J&&=&H& 0# cM %%W&l&&=&H& 0$# c s&R&2?C&Wrc &&&:','3'X64f c T'f''I'"(.(X4 cu G ]((g);)@)#|V c )))* *h546cP 3*<*?*"P*a**4cv xh***?+z++{QЏ 'b$c %7qB|c +++C+++6c< ,,I#b,*44c[ ,/,7,J,i,p, +Tc w,,,,,, +lc ,,,),-- +c! %-6-F-6a---l*D#c! ---C--- +c! w,,.T,,, + 4c! .).1.hM.n.w.G48c" .).~.zM.n.w.G48,cI" ..../%/{Wd#[I c" ..0/./%/{W#[Ic" ..\/./%/{W#[Ic+# .././%/{W#[Ich# ,,/,-- +c# ///060=0l*#@c# P0a0m0000@,$4ddE$ 000:0[0+ d{$ 001C1o(1,$6d$ 00/1L1o(1,46d$ 00=1U1o(1,D6d% K1X1`1]p111*T8d>% 111f11dI4;db% ,1112- +dd% 2 2(2;2Z2a2 +td% ,h2p2!J,i,p, +d& w,22.,,, + d/& t22/23X,; dR& "3+ /3 <3K3# dx& + P3 d& } S3Z3'a3* d& h3o3-v3* dJ'  }332H3* 0 d' } 3373*\ d' (3344,5[5 4|dS( (555F5$656Sdd( H6U6X6c6r+d( t666#6684@d) 6664662d0) 7 7?4784 d\) =7F7I7"Z7i72@"d) p7y7|777h.(#d) #77777TyR$d* ,8 88#C8V8c8X|(K&d{* %4*'d* Nn8u88x 8\+'d*  *(d* 88] 88*$$(d+ vvy*(dB+ 887? 8*D$|)dj+  *)d+  8889**d+  **d+ 0#FHn#*d , %ze.*4+d;, 0#FHn#+dj, %ze.*P,d, 9H*l,d, 88] 88*d$-d, dd<c*@-d'- ٜ 9*9P ;9*$-dW- 8kH9O9=X9 |z%.d- {o_9f9o9+$s/d- D^v9}9D9@4z%/d- 99d8o89\.Dt0d. 8kH99=X9 |Tz%1d@. {o_99o9+ds1dp. D^v99D9@tz%L2d. 99d8o89\.2d. D<8uElPz%3d/ }0Ӂco,6h4d4/ D<8uElPz%5di/ }0Ӂco,65d/ D<8uElPz%6d/ }0Ӂco,6@7d0 9H*\7d@0  8889*7dq0 9H*7d0 k99=9+N%x8d0 {o_9f9o9+s9d0 ^99D9\.9d1 99d8o89\.l:dD1 k99=9+N%;dk1 {o_99o9+s;d1 ^99D9\.Dd=2 ^99D9\.4>dg2 99d8o89\.D|?d2 k99=9+TN%@d2 {o_99o9+ds@d2 ^99D9\.tTAd3 99d8o89\.Bd@3 222::/[I@Bd3 9H +\Bd3 222::/[IBd3 } } 1 ::.8Bd4 222::/[ICdW4 } } 1 ::.8,Cd4 222::/[IhCd4 8#FH|Cd4 %ze.*Dd5 9H*DdE5 9H +Dd|5 9H +Dd5 9H +Dd5 88] 88*$Ed 6 dd<c*Ed96 ٜ 9*9P ;9*$tFde6 gI\.Fd6 (gIL`4Fd6 gI@,4Gd6 9Hl*,Gd7 9Hl*HGdW7 9H + dGd7 9H +Gd7  +Gd7  +Gd8  +GdB8  +Gdj8 9H*Gd8  8889*hHd8 9H*Hd8 gI\.Hd9 (77: :@I$|SHdI9 pp*Ido9 e*,Jd9 ./7/Z':*Jd9 .:B::MI;H<R<W R Qd9 <<=Mw===#W DSdE: }+=>M&>7>>>E$6Tdo: Q>Z>]>Mf>w>(64,Ud: }+=~>M &>7>>>E%6tVd: Q>Z>>M)f>w>(64Wd: >>>M-???h54@g 6HZd:; ???M<?@*4l[d`; ;,@!@MR;/@4@+64\d; ?@l H@MX\@m@*4d]d; &$$t@M0&]d; {@@@,^d; @@mADElE 4  Hvd= F'F*F/l Dv#((wdG=  'F.F%l Dvwdo= |2F@FF{ II;J  jd= F'FJl Dv#(Pd=  'FJl Dvd= ;EJ*d> CJw[*xdK> ]jYJ$(Z  *ԏd> JiCJ-3 K*d> 6*d> K7*Đd? K*K9*dG? ;KDKGKUYK0di? ,jKKKAKKKs`Dd? @K LL3LLLWL4$%̕d;@ . 1 t*P$#$ܕdq@ @. 1 dL8<3d@ . 1 gL9P$#$d@ a9jLmL  \++dA tLLLLLL 7`7\(duA L MM;MMX6|dA MMMMb_85(ԝdA MMMMb_85(dB $MNN# 46hdIB N#N'NQ;=+dB 4=NaNfNcNNs(5ddB $ш NNNOO*t4dWD (O:O?OiOOO7`dD OOOOO*LdD OOP9PZPaP5|HD%dE tPPPPPP84dRE Q QQnQQQܵdE QQQQQs$/@9I(dE 4RRR<R(a4dF ,R=RAR@0QR<ĹdBF XR}RRJR4SGS8drF <OSyS~SSS@UYUhUoU*d%dH XzU~U*dH $UUUUV%V*%dI 3VKVUV{VVV*%dBI VVV)VV85dI l =*dI V?W5W\+L, dI :W\#WKWW>YYZ(hihg dsM 'FvZZHdM ZZO[5i]]^| <$dP =o^Lwu5*dP ^_,_8}___Џg dT __;%c*X eV cccdTf}m k'F ǒh?Gfm BܞҒ d8ޒ*fm . Hs R4 fn iٓ -#$ff % :q*f0[ % :q*fPn * s//H f%o Ӕ HA4d'@ fPo ~), :Wrfo & 3b 8#(hfo Xf \+|fo j *fp n DxTsl'#$fHp %ƕ2 :ED+#$dfp %Ε7 :ED+#$fp X֕< \+fp ڕhdpT;fr =iT!<'LfHr P˗ٗo+0<4h'fr Re KbP`-fr /\$ib$1fr 48L6pĴ 7fs hF**Di. @?fQs  "-?a`sAfs JS_;~x94Cfs @Vpd*Cf;W \ğȟLp844 Efit ПԟQ*$Eft ؟U;4 Gft '4crϠߠdi\$Kfu *,LfJu 9Dhx4Ofv ҡסKrxtVfv >+*Xfw Ţڢ*{G [lp4 f 8 +d\fPw ѣ? +* |^fw ,^/Ф٤<4i (afx 'IGV]66Џ8bfx rK'pcf4y ~Rǥܥ56Џ\8efy ryT'efy )]æ  \if{ (4GXc96 qf)| $n{'/Q 0rfX| $ݨ2dXR̉شT ~f~ B@ ݪ54fs > pI6f3t  *,fY~  +N756Џi Pf~ ?(f 0ɫCGT e@TЏ$('#$Bh*#$g  M*зfvj ̶жQv*f8j K_*(f THW=-`f… ·˷շ\.4&Tf ?8\.&fA 8$^Bú/( pi ߉4f 8b;EI*h/,6g |?g/ < #v %$Bgh  D . *4Bg . 6:#$Bǧ . 6>#$Bg B*Bg1 FJ:q\+XCgf O7 \JhJGg 8<@mdxshIg 4k`tTLg' @:TtttPgl 0e~ 9ITg ( $/[Vg $-FW$/$)OZg D (B hg 1\ \,jgُ 4#$Plg . ?}P$#$`lgL BUm(d#$Hog C68Hmqg 2&Xt#$sg@ F-874tugj ?PS\L/c*xvg X $s\+vg֐ X jt\+vg n  ЏD)Usyg͑ d)(zg !:hh{gQ +|g 0-4tJ6ЏD~gϒ C)|g ShstJ6Џ)gZ ),g *CLs@TЏ)&gޓ W*g# 4g%txЏ$*lge 1D*g ASv3gg d*dg L!,&D]d66Џ*ȏg o(*lgM . c 8P$#$|g . c :P$#$gԖ M*g  T.; Џ4̓gw ^bYq$g fA/< 4g /#@$g# &7@RY g` KUo*i g 3<V gG  +;LU<9*(g Jh=(g̙ ).I\mt@,g piJ6Џ*7 gO k+İg &KbkJx6gҚ 5#$4g (?* (g .3Nm[8h%gJ s** dgn  + g . iP$#$gӛ 3:sQ#$@gZ . EP$#$Pg I3:sQ#$g2 . eP$#$g} isxD+#$g 4/8k~Tl$+g I| \gZ 0 bl&/Q~5#$h} t5\ #$h 5<O5.0hI % $B1h 6Cn5p/L,4h CdÔuIy%-#$4h { M TsT`>#$L6he  ^*6h eHivh[:8h :q*h9h @0i<,;hL DD$s_xR @M|[ (Mh   MhJ D=+7x</<Xk Uh qwk>Yh° 1LSQpQ8<\h/ Ll*  < _, > U phα b ` ^B xph d q t Z J8l-Џ,qhR   [w֎Lqh ] . >4;0rh߲    lPX i s0>thH D     PQz uh{ Lx   R   / Mz |~h % B ~h D   {   F^0?z ܅h7 % B Ph D    %$Џ-z h % 0B h @4S]6Zҽ̐h= % B @h{ @>X@0SĄhhƵ % AB ܗh Xq, G$DhE =%(7HXhPhu ,DSet!5D,'(h #$,h  #h= P3khp P3̥h vTT#hѷ .++`h I.i*hO ./0G(h (Fk6t h  cw֎#%h 9 ]=T]H>0k Эh  Vw֎#%Lh˹ 9 P=T]H>k hr vlJ*h 7t7+4(h 7{7+4hK jy 5*h| jy 5*th vJ*hٺ jy 5 *h `wq@,th@ ` wq@,hw  (Z  *Lh jy 5*h ?#i*h" $+.,hV 4ADR*h 6 Y\8FH,6$h 6 Yb8FH,6h &hku,6ph' ]I .D+#$h] G #h 0M9*04;MXd$R,hh 4mvyosd6`h ۭ y*|h 5 a  WLD7;Dh   5 a  WLD7; h>  ! !,!U!dt;h_ 9b!n!!!!5-h !!==8h !!! !!b R$Hh .!!""֨"*h !!"*!!b R$h> .!-","֨"*$hr (:"G"S"4d"s",$-G$i |"""B#0#B#`p;i c#l#t#K[#*4i ###S##:4D6i' ###bDx#\54;4iM ###q? $\54; iz lk$$kk, i @$M$P$(a$r$d@;p i d}$$+ \ $+T@ i @$M$$3a$r$d@;i1 d}$$6 \ $+dTie $$$>B%N%5$i o%%%QY&&&x,$|i && '^4'W'b'Ȩi Hu''')h)|)F^<_ *i{ ·)))))x3`t*i *d  x +G$+i ·)*)))x3`,i) *d  x +G$,-ii 4**+*kn*y*\d6/i d*** 0i ****.+=+بtD-3i I+R+q+7,++:4d-;5i' ++,EX,a,:4$;7iS 2, Y1 \+8i t,,,\+*d9i v,,%-#$9i ,,,,,J|6sp:i% ,,,, -J|6s`;iY -A-S----ЏT5b$?i ---8@i ( ...sǂ@i? (/..J..sǂAi 4%.=.A.c.t.(Ci( 8... /,0_0$=@[ ! fOiW 000H00ЏPi 200z0>< 1 +L,- Qi 1,101{11sWi %12B 8Xi' 2,2 2AЏ$Yi\ %1'2BYi $+2,82B2cFZi I2|NU2y22RL\i 2222207G$^i/ 22y _ic p23 3)3H3O356Џ-`i -Z3-8ai k3~33#4n44W #$Xfi 44 fi: 44e.44\54;lgin 445w555Ԇ#$ki `55355*h+ki @576f69 7O7l7Z!  ti -7l.ti @777788d$ tzi %1O8B ziM S8r88889X4(~i #9 9~i @$969A9a9t9}9Td?$.i ,9999:&:t(9I iO 9:N:Q:o::si X::* i X::* Єi (::::;;uЏD.'4i -;d.i^ ($0;=;H;\;o;v;6Џ.(؉i -;.|i ;;;;;;sf ̋i <<6<M<V<Pf ،iL <g<y<<!<<<ȵЏ.74i -<#.`i = ==/A=^=i=Ra\ ( i $z===:>@>S>4 D h`i ^t>>S?!?0? i [?d?g?>o?~?t. Yܵk̚i3 2p?Vn$n**i[ 2p?Yn$n**\i $??YМi B{<# *|i 8AD?*i dd<*؞if a9j9m9*i ^ 3?*i `o`o*$i ii^*ġil B{<# *pi 77:*i 77:*iZ U{R?*̣i ^i^ *li dd<*i B{<# * B@Y *$cj> BDY *$Ldj? O8HYLYTY*4dj? ] /C[YɏX:4D$ej@ :.XgYPJ.U.t+xfjNA kYoYK*TfjB vwY{YF_*dfj C YYAe.\+DgjC MHYY9YTY\+tgjD XY~-c*phj8E W YYyYYYX6`7^G^X^_^844jV vf^o^*"j W vx^^J*$jKW (^^^^^^,+1 &0jW $^^_7_L_S_x751jW {l_u__*124jW {___*2%j)X dd* &ljhX   *jX v__V *4 &jX v__*DԗjY [ [[w[*#$PjJY [ [[w[*#$̘j|Y (#FHgiXjY %ze.*jY d__`T0Vi(jY H`w:"`9`Vlj(Z <<8uEltI jYZ }0Ӂco,6؝jZ Pl^L/ IjZ 4>`/G` td6jZ ze.\+4j[ L`*ȠjS[ ze.\+Xj[ %4*ܡj[ %4*`j[ L`*j"\ " [[w/Ipja\ -c*j\ #FH/5|j\ %ze.* j\ #FH/5j+] %ze.*(j]] , p#8 L,tj] $j9HX4j] (<8uElb+Xj] }0Ӂco,6j!^ (<8uElb+ĩjV^ }0Ӂco,6|j^ (<8uElb+0j^ }0Ӂco,6j^ , p#8u 8t[j*_ $j9 cFdjZ_ L#FH0jj_ %ze.*j_ L#FH0j j_ %ze.*j ` d p#8 Ld0Xj8` $j9HX4jg` tj5vt0j` 4f~0]`$jSԲj` `<8uEl@j` }0Ӂco,6@j'a P:=PԴjXa t, +lja `<8uEl@ ja }0Ӂco,6ضja `<8uEl@j)b }0Ӂco,6Dj`b TFg`jjb i^ dr+jb pHYU{Rb`0Tjb 0'ɏX,j"c d p#8u 0jMc $j9 cFj{c ze.\+8jc 2sܽjc g`n`}``\54$2;j)d s#(,jYd p#8+rjd S N``jd K```D2Pje d`P$jHe ``-Tje d`P$je Y.w #(je <8?8 +rj@f `aajf %tjf ]a#a-]]djf k{#j1g ,a:aKaPad2`jtg % Bjg 77:*jg ii^*jh /[a*ji |baa aa* ji ]aa-ƛa*t,jj Z aau!L/aa\+2jgj b b"bu)9blbb| jj bbbu/c(c4cRpT(jj [ceccu<cccxl JjIk d*du[GdL,*;djk Pdqddu'dee2;Ljl 4eAeaeuEeee2m,jIl  fBfhfu]ffg//t;jl 7gDgdguggg2wjl thhu"h*j%m 1h@huVh*38jnm mh{hhu- hh*4jm &iLiaiuiii $3G$8jn ijjufjj85kw zyyyyz.zXd #$$Bkw Yzfzz)zzz||$H\Fkw z {,{:n{{{t #$Jkx  {D{I{h?BULKk3x {||JgBP|[|Ml Lk]x v|f||\M6Nkx ,|4|n||8_S|Pkx ||}]:}_}j}86 ƘϘӘ>8AHt5DEPkS ƘϘ`G8AHt5DE4ki PHt5D3E k} ƘϘB]8AHt5DEk ƘϘk8AHt5DEk $ƚӚךy)XdDEk $PX[$U TEk {<0EkCw %/Ek $|`IЏ #l (#aj]T"$ lƀ @Wpt)`|@u0L4#El݀ ^aoMЏ<l 1Dpl /* l" $MV]6fqd`4("l? %4*"lW 38<8?8[t+`#lu xHUhP$4$l &\+<%l 38<8?8Z*%l {<F' *&lف 38<8?8Z*P'l 7/Z1 0(l 38<8?8Z*(l& ãDxX640*l> 38<8?8Z**lV &g*H-lm ˤǺ 74$`.l >$['[O/ +$/l 38<8?8Z\+/l p_t+h+ 1lӂ 38<8?8Z*1l {(o;\+42l BNUU^eMpDb3l lw~X6TLT5l3 ܥUhd7lL "+ Bt,8le IU\et*8l {5!{\+9l } 1  ;9lӃ  ?$I$=lJ  4$S=l 8/aH 6§9m }IAl  O$SAl 8/a Q§9@n }I$Fl, 9 i$M@Flg 0=)P k$9o8 Il Ѩ }$MIlޅ 0=)ը $9o Ll SW  ɩ|,/CQlM Cϩ *;\  Tl F =Ӫ*:pV p\lĆ q XJ3uR_l īҫY j̏ē ВDvl> CϩB ; xl Cϩj ; {l Cϩ ; }l q J3uRtl< q J3uRply *5  @*l $6Q R ٝcT*) l z e.\+l* $6Q R ٝcT*)lg z e.\+Pl $al^ jW/c)4l z e.\+ĉl $al^ jW/c)l_ z e.\+8l U{R p* l׊ ! l^ L/AQ*l ! l^ L/AQ*ԍlN s s s t 5܏lp v3B t #Dl K\k h Lu@uD4G$0lˋ )T S#l  ԁ 1M X` tld  P _ Xud4lÌ r   EOtl U{Rp*Hl( C [[w *ğl^ !W l| !{ N6dl /<ҳ!**lэ ׳<!(V$R4dl  >J!,ʴִpPt4dl- 4/!_%6=n4l 4P1m!nŵе49 `!0|6lK 8!K{L4UVl֏ u!!=*l &4{!BGs6\ UVl{ ʺ׺<!N!/(6l !D+8l ,G !&X`G9Xl !J.*lE &/(!/?FX6`7ly U{R!p*l E E E *=/E E lё E %F @F *UF F F *$G$,l. E %F G *F F F *T;lZ G G G 3jG G *;m z2H 3e.K m d d d 9d m d 9C?8d <`7@m' d e e 9Pf f g 0Dv [:m vi i i 94ji i \+4 m8 i i i 9Oi j j *#$Dm_ j j k 9zk k k ZQ#$m( k 'l +l 9"dm m m duZl" ;$m n -n 1n 9i}o o o  m.m b o p 9q c *#$ 3m, b  p 9#3mZ cd p p 9!jd *D5m U{R9p*6m }>q Eq 9Nq Uq X6`77mۖ Meq RWP7m jq tq Rq q *a Z&*Fm? ɴB Z'VFX6gZR?M  m @EZ,pPttmۦ  Z]~   #$pm 3Z.Q+G$mM Zx-4G̏m Z?Zg(u<6Lmʧ "HvZw֎ Ȓm |Z0 8mb  UZDW@H  xm Zc1DD|m !.2ZYZ\t Rԥm e~Z 6T   md XZ\+m XUZ\+$mL  YZ*@mR ]fjZ;}x9`7m Z$D+#$0m Z)p;m Z!L,*m  Z)P$mB drvZFI +8m YZ&Ws94Գm Z,*m Z7,R/$6#$pm5 hlZ?8t:4$mj }0{Z3:4m (Z#YR!@ŧm֫ ZD4|m (ZCFU,@TŧlmA \eZX:d4Hmx .Zr(8t4m  Z%:q*m -ZJ.f\+*m  Z*mL TzZ1Uc4d4@m E%m-  ZDyWXtm\ Z 'xTsm &1Z[htxt$mˮ Z%tl( n 0@SwZ=F#  n ZZttY@Sn $Z))tY@@ n% ,4EcZ*N0n e%?CZ e.O*4?n VckZ}**DH@n- cZ**DHAnf Z'p68#$Cn 6ZA^p@ dKn0 Zk 5\+Knn X|Zs\+Kn iZw[,6tLn i Z{[,6 Mn3 #Z52IXQNng TaeZ<4 +4On 7rvZM\+On׹ zZ%07Dl'Pn Zw֎$ PQnV ZTOTn Zw֎$ Tnۺ  !26ZHJDl'#$Un OZw֎$ 4VnH qSWZe*Wnx Z*\Xn PZt,hЏ$'Yn %*.Z B( 8Zn2 2CGZYn4#$[nk {Zw֎$ x\n Z#tQ4#$<^n HZ.DxJ\D_n' %*#Z/B( `nq 'R]Z;00,T8cn %*ZLB|hdn  Zf(7<+d;|en8 ObgZsKdjn "ZNwHAP48nn 4Z\ton/ Z*&ono %*ZB|pn zZEL[ ԅ |n$ Z4h/AЏd67~n` Z7w֎tL~n  Z%>Џn !Z&w֎Ln* +Zw֎ xnh /nZG@ 1< ,7>nr "/3Z=3`-l'n BUeZЏ6nK Z@7J6xĪn Z)G^i̩ܩ75Hn r~Z1.*$7Ьn dZ88?6Џ#$LnH  Z:D7n &<ZF`y8?6Џx #$n$  ZHd7,nt %ZU?8*7n }ZZ*n Ň!Z_7HQ4̳n4 }\Zg*nw ŇnZl7HQ4n Ztt^4n 4,AOZu66Џ4`nA  Z7n Z| #$,n XJZ\+@n Z4>a  fln pZI  5$ \4n7 M]aZz+T*@4n Z:q*0nh   Z@,4n qZ-#$Hn ZL/+4,n ՚tZ#b<*nM Z0+4|n ՚tZ#b<*nM ՚t"Z#bo*\n ՚t*Z#bo*n ՚t2Z#b<*Z[,6lnD iDZ [,6n \JZ.QV@,4n i]Zi-$#$$n p}Z#Ǻl*4K, o %Z?BX o Z+7 o% ( Z\0GPu,( oX $ReZp'Loe (\zZ du<7(o ,+<JZbu|66Џ8#$lo Z$8o# $['[Z *o[ Z*To Z*o Zj*,o Z Ē8o ENQZ*oN B{<Z# *`o v^aZ;*(o B{<Z# *o Z/&*o. @v+4Z@tD8ok dIRZj*d8o T^{<Z<:o Y ZEI,6o0 T@^eZnlh+: ou jZ,h+6!o T@^Znlh+:x"o jZ,h+6T#oL @v+Z@t8t#o dIZj*8#o T<8Z?8 :L$o+  Z *t$o LZ  x0:%o ZZC"x@,%o_ < Z-c]t:8&o Zd*&o0 L$Z  x0:\'o Z-ZC"x@,$(o X.6=Z3 |F@4:(oV $ MTZ#8 L],Dt)o @]dkZ. .tT:)o #t{Ze*d*o} <#Ztk[+o %zZe.p.*+o <#Ztk[0,o %zZe.p.*,oQ <#ZFHtSL-o %zZe.*-o <#ZFHtSh.o %zZe.*.o 8%ZEtS|/oF Q@f]Z.yq\+0o| P<8ZuElPk[0o }0ZӁco,6p1o P<8ZuElPk[$2o }0ZӁco,62oZ P<8ZuElPk[3o }0ZӁco,6H4o %`Zto9*t4o  n ZH+45o: %`Z*85os |Z\+L6o |Z\+6o ZC.%7o XZ#7oI ZDv<8o ZC.%8o  ?Z*89o ZEJl|;on S`ZiXe| ,@o npŬPAo p#DxX,;Bo  z"7<8Co@ ENu}X* Eo  BIo % K 0Jo   7 `No  ,eK7Qod p+l74Ro BG, #Џ0[o $Xm\e`m{04L<\oY 4|6]o     !Dh,/n #$ co N!<[!e!+coY j!t!*Ddo {!p!!+4xeo 7%! 7+4eo jy ! 5 *`foK !*|fo !*fo 3k!!Nkcoak,h+6Pgo ʭ !!!(",h+96 hoT ʭ ! "#!(",h+$96ho "R("+>" +io C"5P";^"T<xjo& e"""""*@noi  7"V% $#$no "####4#|;4oo ;#L#P#&m#~#*qo< ###?~$$$NNy uo %%%\?(%|;hB#$Xvo  1%5%]^+;vo% ;%H%L%fb%:|6,xoo Dk%|%%p%%%076ЏD9yo %%rd9,zo %%%#&&L;4({oP &1&6&4k&&NF ~o &&&P(Z *h~o h&&_&&cpT;o bI -GeB|oO &&&i'076Џo %I 'jB`o |'.'2'tL'['h'=ou %I s'vB|ho Pw'''~'''(c4c9'Єo ''7J9xxob '((>(k(XhlhЏ#o ((((((@c,0o %I (B|oN %I (B|o ?(((()56Џ9 o ')7J9xȌo7 ڹ)!)gu+;Lo e/*To  ?*o iN')*oD U{Rq*o O8{<*60o Se/,) ?)T)74#$8o %[) $o_ |^)w){) ))!DbA[#$Po ))) 9 **hb0o ))&* 5 **hboL C[G* 1w֎o J* &U*+0o C[m w֎oI \*h*k* +t***A|$Fo *** 0***A|4Lo1 h*+ + M-+H+Xh]#$̠o{ UU+X+ Sy(Do %7Ey RBo% \+_+ Qw֎,4ow c+h*u+ _+|Qtb#ho ++ a-]]D0o* p+++ l,-,:,Ԉt ). po M,X, o7J:xo f,y,, ,-5-<*P4جo O-[-^- ~--o a9j9 -*do@  IO_*o Se/- '?)T)74#$o %- -4o --. 1../gdd #$oX Q/^/o/ }///\VQ\4,o l/ 00 e000xXVB$_5o )00  **hbTo4 )00  **hbdpo C[1 w֎o ''[ 1 1`*o& C[1 w֎,oz "1B1t1 252`24# A5o  (2 s7Plou 2Q2 2A\o 222 P I3Q3*D o  3p3 3354Џ:'0p :: @;p -:F:]: t:::x^b #$pf ::; ;";);56Џ$;p :2; D;p  DB;S;\; t;;076Џd;ph :; ;p D;;; !<X<g<d8a pa :< ; p D;;< !<X<g<d8ap  :< ;pf <LR= 6=M=:ADp ڬ T=  5 *hp Z=,g= HU*pD s== %+4p (== 8=A& p (= <b&8p w' j*pX a9j9 -*`p # FH/p %z e.*|p? # FH/p %z e.*p # FH/$p0 %z e.*p (<8 uElbqhp }0 Ӂco,6 p( (<8 uElbqp} }0 Ӂco,6p (<8 uElbq@ p+ }0 Ӂco,6 p $O8{< DU!p X8a8 d8o8+4T"p === ===X6#pa === jǁ*/$p % #%p # G#%p  a> ;zl@67h&pY >" > ?>T>Џ7(p h_> (w֎H(p b  "BL(pe b>>> ,>>> N lB;[-p ? ?? K1?:?AH.p ? ?E? G1?:?A/pR Ch  Cw֎0p ݣ_?f? 8#8??0p bԊ -BP81pO ??? X?**82p ??? f6@Y@l@M4Nh 5p l y@ m@@+6p! d 5 *7pc! .@ &3TX6`7L8p! @@ *I@SpTl9p" @q@ 8A,Al**;pW" M7A:A QAЏ cHp% bSCu <BTHp)& )NVC!+_CpC#IpA& uCCC! CD*OpY& uCCD! CD*Upq& D0D?D!DDD85PE\ o Xp#' Da8D!EEE*Yph' %"E!*E`N Zp}' 1E:E?E!W\EcElN6$<h[p' pEyE~E!EElN6$X\p' 1E:EE!W\EcElN6D<]p' pEyEE! EElN64^p' EEE!EF FlN6d<_p( F F%F!8F?FlN6D`p)( #pDF!(#8ZFaF`NTtap?( ǷlF!.- `NapV( vFFF!AFFFL/*%cp( Et<F!PF~dp(  FF!VFGG`N<ep( Ge/(G!]h/4G~fp( 8?GNG!fhGGG`Nhp) GGG!HH H~;M 0lp%) N KH!cHlp9) tHHH!3SHH$>4mpS) HHH!;II(~Qd4opm) tHHI!MSHH$>D4pp) .It4sp) IIJ!n4wp* JJJ!JJJ(~Q4yp<* tHH K!SHH$>4zpY* )K6KIK!uKKK(~Q44|pv* tHHK!SHH$>d4}p* KKK!E[KL(~Qt4~p* tHH L!SHH$>4p* *L7LBL!ǺdLkL(~Q4p* tHHvL!SHH$>4p* KKL!E[KL(~Q4p+ tHHL!SHH$>4p/+ LLL! MM(~Q4pJ+ tHHM!SHH$>$4pd+ *L7L;M! ǺdLkL(~Q4Ԇp~+ tHH]M!SHH$>T4Їp+ xMMM!#MMMP`<4ȉp+ tHHM!2SHH$>4Ċp+ ! NN!:6N=N(~Q4Ћp, tHHHN!HSHH$>4̌p,, KKcN!PE[KL(~Q4܍pH, tHHN!^SHH$>4؎pd, ! NN!f6N=N(~Q4p, tHHN!tSHH$>4p, LLN!| MM(~Q4p, tHHN!SHH$>D4p, ! NO!6N=N(~Q4p, \Vl4Ep/ MfUJV!7UUDp/ $dV|VV!MVVVPddG.p0 MfU W!OUUTXp@0 %W1W>W!d?CeWlW=6 p`0 $WWW!oWX&X@~xԮ .p0 CXXXX!ZUZ~Zt8N p11 [ [@[![[\~<p  pZ1 A\Z\b\!\%]T]p%lN<K6pp1 ^]g]n]!]]]p84=p1 ]]]!y!^(^p86p2 ~G^R^! u^~^~f4p 2 ^^^!__~fH p<2 ;_D_O_!5y___WWdpX2 ___!?__ 0pz2 `` `!Q``` T$=dp2 ```!pa"a)a+*D=Pp2 42aJaea!|aaa$Nsp%3 aa!d=@pL3 abb!Ob^bgbL~@TЏ 7pk3 %Z O8!Blp3 |bbb!@cWchc;$; 5lp3 ccc!]#dId`dp p4 xddd!d0pIp#4 fdd!V Dd4,*#$pB4 eee!EeVeae@Ptudpm4 tleee!f"g3g4;D;,b #4q4 gg!=q4 G g!"GG*Xq4 ggh!-vhhh; q4 hhi!y-i:iX~\Bq=  sss!t&uAu~0< U o#$Mq9> uu!$>Mq_> up u!uX,;Nq|> uuu!@Pv\vuv^tU mSq> vvv!]P vwd;t;Џ$;,Vq> ww w!lwwT( [q> %`w!ww(\q> www!%Nx#x0T4^q> >xHxx!Kyzz fqC B{<!F' *gqC ^i^! * hqC hz5!uz*hqD hz5!uz*iq#D zz^a!;z*jqCD ^i^! *@kqcD z.!CGV.P+kqE ] .!@.yq.+XlqE .!=/c/*lqE vz/!:_\+lqF !&\+mqF !&\+0nq:F XX[!*DnqWF zz!-\+`nqvF zz!]*xnqF XX[!*nqF zz!-\+nqF zz!]*$nqF XX[!*nqG zz!-\+4nq0G zz!]*DoqQG XX[!*oqlG zz!-\+T8oqG zz!]*dPoqG XX[!*doqG zz!-\+toqG zz!]*oqH O!z*pq5H ! l^!L/AQ*qqXH dd<!*qqH ./7/Z!1 *rqH zzz`!zz {HsH#$DuqH {d `! x +G$uq/I {-{>{`!$e{~{{8D>;wqdI {d `! x +G$xqI {{{`!A{{{l#$|qI {d `! x +G$$}q9J {-{{`!Me{~{{8d>;(qvJ {d `! x +G$qJ !|4|>|`!nV|i||| E#$tqJ {d `! x +G$q-K ||}`!z}}}hVpp ;qWK {d `! x +G$qK ~B~Y~`!~~~\sH;̎qK {d `! x +G$lq L ~~~`!6  )?@#$qBL {d `! x +G$qL 0a`!B l\;qL {d `! x +G$qM ~~=`!m  )?@#$dqTM {d `! x +G$qM |U`!y}}}hVp ;ܠqM {d `! x +G$|qN !|&.`!V|i||| E#$(q5N {d `! x +G$ȥqpN F`!j{G$qN {d `! x +G$qV !MωډbbܜD,$xqjV  !ivȡܜ$qV ! ފ@qV !+qV !"4|6q4W  (!.:q*)8rda (I!III:4>9ra :.!H.+:ra ! II+4:ra !p,B`;rb  ! p,#$;r?b i^!Idr@,(rb %1" h>rNc C[1"w֎ ?rc  ux"1"$GfHN0Cg#$Crc ){1"@ **hbDr;ptrqn p"9@p?vr(o d 5p"*dwrgo 4p "%<*xro vEC"*\+xro F".#xro LI\l"q\P[$?G$}rOp &",_h44G$~r~p vsv"\+~rp z"#rp ~"$X6`70rq 3i ,"B_flA4Ȏrvq A qt"JaD+#$rq |"Ȣ͢54D?Аrq آ"hr2r ãУԣ".Crmr Rˤ"2WXt8Nn DrQs "d?rs " ?lrt ̦"i,7Vr?Lrs jJQ"9J*$r?t w_b"h<8rtt o"4rt . DG"Wl`*Ԭrt 6 s|".FH +4 `r$u j"7ɨ +xr[u !ΨѨ"d6:Dru .2"r|46?G$Xru 6"!#hrv v")\+rIv ǩ"8Rf854?dryv  ""EvW$RTTrv $"8*;@4rv $FYa"N~~dG$dr w  "fcQp~tG$r:w "|5Dԃ$@G$rgw j"9g*8rw ./7/Z"1 *rw OS"! 4 *rw u"í̭S$R;lrx ׭").1`D@5rx ;O "LW(:>Wury '*"c#ry `JSV";xAT rz X"#\+4r1z "#Pr\z X`"#\+drz Yj"#rz X"#\+rz &`"#r{ X"#\+r.{ !"#rY{ X"#\+r{ ""#r{ X":#\+$r{ ">#@r| "GPY\r.| X"Z#\+prZ| BE"^#r| X"j#\+r| ó"n#r| Xdz"w#\+r} ˳"{#r5} Xϳ"#\+rf} ӳ"\+r} X׳"#\+0r} ۳"#Lr} X߳"#\+`r~ "#|rB~ XU"#\+rn~ "pYr~ " **r~ " **r~ "L **r% "i **r\ "" **r 0" **r >" **r L" **r* Z" **rZ Xh"z#\+r l"#r p"V#r߀ ʴ"#r "# rH "#" l7` 6tse (15" Qh@64ԛs ox}"[ @64ԝs "n %@64s ,6;"| z`$R0s " @64As=  "&7+;ԭsd <OS"\+/(s "4o^ _d* G$s "ZUbH$A8:sb l"y)@UHs k"*s v "*s ."~tm DAsM d"ZpI\s{  >B"^}+Fs "*\l74dAsϒ /<A"Y_t$Is "aD+#$ s: "#sh " Xa4s $@"pAsȓ /<"_t$Is "D+#$s' "#sU )."NkXa4s v"8аs ".0XIs :[_"h D+#$sG "#sz "%Z4Xs h"9<lA t `"t@  |Sttv BG":}D+#$t "tzztږ " +*Tt "#dt? $"~6l\4$tn "<I ,t "'p[1I3t̗ 3HL"@hD+#$@5t m~"USD+#$<6t# "`ǺXaT7tM X"d*h7tw "hRzȒ49t &?D"u`}?`74t| $"B> Tt$t (" T%t Z";:| L 8G$Ttך "`lr#t z"W_ l*`A t6 z"#W_ l*`A0td "( > $% PUt   "   #$0tߛ (   "%N`U8 I,%pt 4@D"5Pgt͜ 4@t"<Pgt "1H̍4u' p"p*luU 9BE"UH* u ^i^" *u %"*Duݝ MVq"`\+Du "\+Tu= 8N"$iz$Uh\un "&\+u ;N"$iľؾHu͞ Gl^"W/\+ؾpu xS^"yy&yX6 "Pu*x0u Qz|Y#x1u 0Y##1u Y#-;v|*08uU Y#ZAG@,$B4>u [lsY#(65?u =oY#Gw[*<@u =oY#Kw[*@uN Y#Oǖ r.$Bu  Y#Y*Bu Y#]*Bu  y'Y#a?PW9$4DuY ^Y#mǖ r.$Eu jsY#u 7|6DBFu Y#{l  +4 Gu: G Y#,=DlAdB#$Hu $YNfY#B#$Iu RY#`<B5tKu( $3Y#Sdk?D5Luc zY#I<7B#$Nu 9 Y#%6=+BOuҧ  yLY#?PW<9T#$Qu dӭ qY#*dQuD Y# # +tRuɨ Y#l  +PSu6 H&Y#8I*HTun N[^Y#r94pUu lY#Zp,#$LVu vY#*slVu@ Y#W85AWuv Y0Y# > PrYu  Y#*$Yu v Y#V *DYu $ + Y#5 n*xYuM $ @ Y##5 n*Yu J [ p Y#'   **4 [u   Y#20*p[u8 X Y#B*[ul  Y#F*[u X Y#J*[uЬ X Y#N*[uש    Y#R!\+l\u " Y#V+ *]u8    Y#Z!*]ui s! ܞ Y#^d8! +sl^u zn%!Y#be.*^uѭ  Y#f*_uu    !Y#j!\+_u v!Y#n*_u$ v!Y#r*_u !!!$!Y#vm:!x94,au= ]C!F!Y#-=854G$aun v9Q!Y##bu v9T!Y##|bu v9W!Y##bu( v9Z!Y# #Lcuf v9]!Y#!#cu v9`!Y#"#du v9WY###du v9c!Y#$#du^ v93Y#%#Teu v9f!Y#&#eu۰ v9i!Y#'#$fu l!q!r#kfuB v!!!v#!!!phu !x"v##8"P \,iu( !x"v##8"P \iun !x"v##8"P \ju (w v#.bju $ ""v#/90h+bh550#$u 555+$S 56:D@u 5, 6+$n6*u  6l6}6+${<7778(Iu2 [7+$w֎uO "[7+$w֎ul cR7+$E[8\P w, u 88+$F8]8d8LDdu {888+$C9l99Y` u jy 9+$} 5 \+u 999+$J:g:v:D Hu :::+$;#;6;4PoLu! E;N;[;+$t;;;*uF ;;;+$;<$<R,SEu\ 3<D<Y<+$<<<l74Tuz <<<+$=:=E=U \$Eu <<Q=+$2=:=E=UQDE0u <<=+$K=:=E=UQdElu ===+$m:>Q>`>ĆE4v {>>>+$>>Ev/ > ??+$S?d?o?8TE vW  9?+$\+ vn $???+$C@e@~@d(xv @@@+$AA'A4|6E;Xv :AdAA+$4A0BCB2d3D ;,v rB{B+$v/ BBB+$BBB]hPFvE d 5+$*dv\ d 5+$*@vz BBB+$C CX644v +$*v CC+$1C* v >CIC+$^C*Xv dkCvC+$C*|v dCC+$C*v% CC+$-*v; CC+$ *vT %+$+Tvm +$ \+lv  CC+$C*v  DD+$*D*\v l9DDD+$e.SDXD@,$F| v $gcDnD+$}D*DF!v DD+$D@,dF8!v DD+$D*F`!v( lDD+$DD*D"vE DE+$E'E*t"ve lD2E+$DD*#v D@E+$E'E*X$v B{<+$# *%v U{R+$p*%v B{<+$F' *&v NEsEwEw$EEdpT;+vT EF9Fw$_{FFF #4@.v jFFw$`F*$(.v FFw$e* /v2 FFw$i#/v  Fw$u*8/v FQow$y#H/v% FG2Gw$GGGPzT:T4d4vv  H/ Hw$'J.!H+ě 5v j(H1Hw$F*4(5v) R$*VRmRvR@P7wv` <}RRR$7RRRVVdG*@yv RRR$HS1S:S<94{vB , ASDS$U:) PYx*{v ,JSWSS$\ST!TPYS *~v ,]PT$hTTcdPY*8v @cToT|T$pTTTzh+$Gyv @2iY4T$vTTzyv' TTTU$}U5U$qw) Ec~ %ɇ؇HUhP4,$8swe @ %щ:g,tf< #$Hwb oiÊ %HӊDw XLJ %O* w  * %SnD.Jw= ؋  %ZTuPtI#$؆w_  %m*sw 5 %}&;ØX4l<Ԃ w .FY %`D$I#$TwO К %'pDIw :KZ %v*Thw  %ƛٛ<0d#$`w3 ; %˜ @ 4`w 6Nl %8q[#$lw! ؝ %4A[(rXwm ,Xv %4Оݞ$4dIK$w b'  %9B w " %EXiv04IK$xM ű %6el5p@s 0Ax  %EL5 Bs Cxh s| %ѳ,B7\Ex  ), %s,B6|Gx xѴ %EXfL5$J0 Lx r~ %Q4rTNx< ĵǵ %F  [@rHPx x" %?*=T.h+X0 8QxQ JBE %@@4Qx |KWZ %,atd.T*l&Rxe 6#y| %-| 96Sx  %$>7DJ\Ux +7R % *S|pWx\ ` %*AJ|Q@TЏ'Xx aj %dJYxD i9{ %ŸиPPSZx $' % 4؁$ {Sh`x a %J axv Yk %ͺֺLrt.Џ\#bx aW %Jlcx  %cYfx3 aȻ %J@gx a %Jgxm 8ػ& %"t} G2Fmx as %KLnxe $ %XrS|+px $' %;NUI6$KSqx a` %DKHrx  <p} %|drh+dKSsx 4 ¾ܾ %s05Xa XKD~xV a9 %uK~x ,d Ic %PQmL5Xa +dx a77 %RKx5 ( %FcSx s| %ѳ,B7xw ű%6el5p@`t x! %EL5 Bt x" s%ѳ,B7x"  ,%s,B6`xL#  %M:A$x# VZ %$x# $cuz %*6``1ܚx $ ( %? zpԝ1H\xM$ iN %i*`x}$ d %*x$ ./7/Z %*x$ B{< %F' *dx%  %3*x% _%'\+Tx% _%\+x& %*-\+x& ]%. .*,x& ]%. .*x-' %$P+KTx( 14%VP+Kx( %*Lx,)  %*[*$L,x) dmp%8B4TxV* %.QXDB6x* mp%e.V+|x0+ mt%e.V+ xt+ x%+DL,xI,  %J\+\x,  %B\+x, %?-*x- M& %6YTY\+PxE- %8%]nuX66x- %\+dLx]. % \+LDx. 8;% BQ0h+xq/ qX[%aLpL0h+ x/ bn %T `\%4x2  %{ *xa3 & %!0`3x3 Xk  %* x4    %*(x5 t  %E$=.4x5 t7 %?$=.4x>6 x;WG %,Jt.Rx6 . ]` %)#x6 cf %-c*xg7 @xjm %? .V8x7 ]Qq %. .*xZ8 ]Qu %. .*Hx8 4y %|r( xX9 Ӟ %8$0fx9 Ӟ %V.VxJ: 8 %rh+Vx: 0h  %s% Dr@xR; ( %PCrfPx; $ %FӁco,VxI< _ %'\+@x< _ %\+$xx=  %*-\+4x> ] %. .*x/? ] %. .*x?  %$P+L@xA  4 %VP+LxB # %*L|xB &  %*[*MxC d)p %8B4xD , %.QXDB6xE /p %e.V+hxF /t %e.V+x,G x' %+$Mx_H  2 %J\+DHxI  2 %B\+TxxI 5 %?-*dxHJ M8  %6YTY\+t%$ yZ % +#$ yZ %+#@ y3[ ^i^% * yw[ %%*)dy[ % *|y[ %!*y<\ L0%"%Lx9PBy{\ *`N3%$A`85|6y\ *`N@%+A`85|6y\  MMV%Zj3M:M*M;(yA] GMir%`_oMvM*M;y] M)%iBy] ?%|WbD( $#yj^ PP%!cQoQRW$h(y^ Q 38%QX64|)y^ QQJ%xQQ,$;t+y_ QRj%CRZRgR4;-yT_ R%S%T=T8D\ ,$|6y_ %Gz4"D"@u ;P(& +*G$yj GX(&?p +G$y7k w(&a/4lyl (&J.*yYl +&_e#yl _m+&LY+&IX{VdN4yss +&\=`jVQN4$ys y+&k?ȿ$n,% 4y't +&I\x] 4dywt ->+&`4zt +&5XbVQN4z3u q+&BspN[4zu +&.9VQN4pzu HY+&`4zEv   +& t4 !zv +&*.9VQN4$zv #6S+&7%A77t4.zYw h{+&LO42zw D+&[u ܿDn% 44Fzw Na~+&B_pN[4OzLx +&Q[\44Yzx +&3KZ$O4^zy i|+&DO4\czZy   +&M`iVQ4fzy r+&#44kzz r8I+&d4qzRz +&BYfdO44uzz u+& )> t\4{z{ Y+&BYf`O4|zs{ +&*At t4z{ +&854G$z| $.sZ.+&)e.V2*4Mdz CdqE+&yN@,MܻzM  1K+& ?Z*DMļz  c+&  p*TMză  y+&  p*dMz Cdq+&yN+Mz> +&@,M&O&;0{ V&kc&}&bA &c[;T{Ϭ &&&&&T{߬ &&&`&,;{ '''& i''*H;x{ ' '&}D6(RZ;{ G(Q(U(&)(((`$,{֮ (((&7())HA4T44{ *)?)&|))Tm{ )&3)&3w)ZVm{ $) *4*&K***|~Qd ̢{ v?+, &#4{ v?+Ex&H#{U B+`+d+&!++;8aK6{ +++&6+|{ǰ Sv6+&2++tMN[{ %++&*,{?  ,3,7,&TW,r,;p8GK6Ь{v , ,&i/,{ $,,&e,,N@{ %+,&],{- m,,?&,--dT {S ---?&H-Z-*{ b-1o-?& x-*; { }---?&ȡ-*;{ ---?&#--.zzЏT;{ ./.3.?&-`..DT[ؽ{ $W ..?&:.*% :4{  a.?&8..DOl{& ,JZ.?&?.p:8{b @p.?&K#8u z~U{ 0./'/?&Uq///$747Tp:`{ߴ ,//0?&0001xp:P{l <X1p11?&111p:{ < 2@22?&3#4F4P%dp:t{2 D45y6?&M899[p:{ <@:<=?&BDqE0 tp:&|A FFF?&vFI4['|y FLF?&?8FX,;x(| ,FFF?&Fx)| 0 FF?&d8FzU(*|* ,GG.G?&GGG  D/| ,GGH?&?HjHHn(4|F HHH?&HHtM6[X5| <HHH?& H I ID7TU8| 4)IHI\I?&IIId8U=|y 4JJJ?&02JWJT7U@| $hJJJ?&8JJK 0D| K*K6K?&Ve |KK{Z$6DG|. <KK\L?&(PNNO,P U`|տ OO?&rO|UDm\c| P"P%P?&)a8Pu[;d|# CPPP\P?&BzPPP@4gZDUZ)}= iii&[i j**} jjj&h7jXj_j54dU -} jjsjvj&qj(6#$-}_ $jjj&vnkzkkUG8;} jjsjk&1* <} $kkk&k"l*l*\ eL?}$ jjsj=l&1* @}j jjsjGl&1*@} Qljlvl&llmUaUU H} X` m&H}I 8$mmm '&nnolTD `S} 0Too.p 'y2qmqq$  gt_} qg r 'S*;p`} r%r)r 'rr`,G$@f}G rrr'r]sdj}y vcs'#j} lgspsss'[ss,\l} sss'y|=tJtSpT(p}4 k'l*Dp}t Rt'mP$Tp}  $SVt'n#dp} X[Zt'o*xp}' X[^t'r*p}d btktzt'sL/ t\+pq} t't\+q}  $St'u#q} t'[t'vttt*`r}  '|\+|r} Ѩ'}\+r} t'~t% u*$s}N d<u'c*Hs} d<u'c*ls} d<u'c*s} d<u'c*s}E !u't% u*@t}   'D+5t} . ( -u'P$#$t} . ( 1u'P$#$t}H 5uNu'~uuu56 u} u'\+v} uau'uuu*Uv}H vav'"v9v>v*Uw} WzIv'YvNlv*V0x} Wzwv'YvNlv*$Vx}  $ 'D+54y}G . ( v'P$#$Dy} v'*\y} vv'Ϯ*y} X[v'*z}G  v'D+5xz} . ( v'P$#$z} uav'uuu*DVP{}M X['*d{} Wzv' YvNlv*dV{} Wzv'!YvNlv*V|} Wzv'"YvNlv*V}}T Wzv'#YvNlv*V}} Wzw'$YvNlv*V4~} Wzw'%YvNlv*W~}+ &w3w'&Iw^wew +$W}y d<pw',c*} d<tw'-c*} d<xw'.c*$}; . ( |w'/P$#$4}}  w'0D+5} X[w';*} vw'?Ϯ*P}? X[w'E*d}| X[w'F*x} X[w'G*} X[w'J*}; [w'K ww\+} [w'L ww\+}?  ?w'M*} B.w'S*@}  ?w'V*}  $Sw'`#}K X[w'a*} Uw'byk%w*4} %`,w'cw*̄} wZ x'dx*}> wZx'jx*d}} X[&x'p*x} ]*x'q*} .x'r*}C 's*8} 2x;x't/Ax 74 } Hx'w*<} LxDYx'zkxzx 74t}J  x'D+5} . ( x'P$#$} X[x'* } x'*}K vx'Ϯ*D} d<x'c*h}  x'D+5܋} . ( x'P$#$}C uax'uuu*DW} X[^'*Ȍ} X[x'*܌}O X[x'*} x'x'Bx*dWp} a8x'yyy\+ } a8.y'yyy\+4Ў}Z Dy'*} Hy<Qy'/gy*W}  ?ty'*}0 y'#}v  $Sy'#} vyy'y*$0}  $Sy'#@}8 y'P$P}y y'P$`} y'x'Bx*W} ݣpy'yyy*W}C Bq]y'y zz*W$} z'P$4} z'*P}$ Bq]!z'y zz*Xؒ}c Bq]1z'y zz*$X`}  Az'D+5ԓ} . ( Ez'P$#$}* . ( Iz'P$#$}r uaMz'uuu*DX} Wzaz'YvNlv*dXL}3  qz'D+5}r . ( uz'P$#$Е} . ( yz'P$#$} v}z' Ϯ*t}9 z'*}v z'*} X[z'*} X[z'*Ԗ}F  z'D+5H} . ( z'P$#$X} . ( z'P$#$h} btktz'/L/ t\+dL}D z'0\+h} ?z'1z*} z'7*ܘ} X[z'8*}9 z'9 *4}u  $Sz':#} . ( z';P$#$(} z'E *#$}? z{{'M8 -{p ;}x D{Q{'fCe{P:4@X#$ } r{{{'g|@|Q|~(}= @v|||'|||~Di\}w D|||'L}w}} $ߍ} }}3~'~*@0@Џ( #$L} 8' dX\} h)=f'_܃.[Џ C4}3 #_'aR T }  'LgrSpX4L} $}' o__  } $͆ۆ'@:W;; } '4AtP4(} $Q^z'5i;; `} ˋ'<ItPX4} $Ubq'ˌ 0 } v'* }( n '*}i  -M'؍ R;<} ,9X':ÎR<$H} #''PYt56H~: {'_- dtu~ {'q- dtu~ l FY}'ؑ8 4\~ v';* 4T$~ 'ŒNp~l #ΒՒ'R d~ ߒ'`$Thv #~ v';* 4Tx$~d 'ŒN&~ ɔД' T\PpTtG$(~ $#6'ە(_<_x .~] v';* 4T`/~ 'ŒN1~7<Jh'YW4g\ G~}v';* 4TdH~'ŒNJ~Sv';* 4TxK~'ŒNM~)'UNSpTT4O~rɔ'j T\PpTG$Q~ LYa'&cךp@YG$XU~ $H'{ e~Mv';* 4Tf~'ŒNh~1'tP!4l~f$ўޞ'ǟ(_<_ q~v';* 4Tr~'ŒNt~|/'"[ء( |~v';* 4TD~0'ŒN~>KT'O6SW|~v';* 4T~N'ŒN~$kx'n̤?p ~v';* 4Tp~h'ŒN~XǰJ'*М~ ' +d~S rZ 'D+5؝~  . 'P$#$~ Xǰ'#*~ n'$-{*|~T '%e.5#$ ~ r'&D+5~  .  ''P$#$~ ĥ'(ӥ\+*$Y ~N إ') ~~  '.'6?P]L<hH~ Xǰd'J*\~ hqO'K.e*~R  t'L*~ r'ZD+5~  .  '[P$#$~Y '\ӥ\+*DY$~ ĦǦ']ѦN~  '_ <~3 %'hQhyL`\\!d~  ^'y;t~y ^Qo'z;~'{ç6N\;$~Xǰҧ'*8~2hq֧'.e*~r ڧ'm *dY~,r'D+5d~o .  'P$#$t~$'ӥ\+*Y~Ħ8'ѦN|~I B' ~Hm'ڨ4'>~r'D+5~ . 'P$#$~>XǰĪ'*(~~Ȫ'-{ +~k̪'Ҫ :#$<~k٪'Ҫ :#$~Hkߪ'Ҫ :#$d~d'  +~r' D+5d~ . ' P$#$t~a'ӥ\+*Y~'A~P?~Xǰ'1*,~5D~'2c~yL'9ȫ̘4~HFJ'< dL,J#$h~St'ӥ\+*Y~'ٮ@ U~ .  'P$#$~9$ 'j6,G$~qXD2~ '*~B o;'4 +~@C'3L :#$L~"oS'%D+5~_ . T Z'(P$#$~]j')ӥ\+*Z`~y'*> @~'XD2PO'?*T~f{B'B-{ +~@H'E3L :#$~Ro_'Kd8i +<~+on'QD+5~m . T v'TP$#$~]z'Uӥ\+*$ZP~İ'V,S\> 4~DXD2Zt'n*H~B o'q4 +~@'t3L :#$~o'zD+5~> . T '}P$#$~]'~ӥ\+*DZ~y'> x~XD2kp'*~JB o'4 +~@'3L :#$~@ '3L :#$~ @*'3L :#$8~G Ro4'd8i +~ o>'D+5\~  . T u'P$#$l~ !]F'ӥ\+*dZ~J!Zf̲'pl !XD29'*!B o'4 +p"@'3L :#$(D"o'D+5" . T 'P$#$"]'ӥ\+*Z< #y'>  M#XD2'*0 #B o!' 4 + #@'3L :#$l  $o$'D+5 O$ . T ,'P$#$ $]0'ӥ\+*Z$yD'> `&%XD2'-*tc%B o'04 +%@'33L :#$%o'9D+5$ & . T '<P$#$4g&]'=ӥ\+*Z&y͵'>> &XD2"'R*-'B o&'U4 +<i'@,'X3L :#$'o6'^D+5h' . T M'aP$#$x-(]>'bӥ\+*Zn(yR'c> (G '( '4GR\Pf))Yfj'*÷޷<p4$j)'P9,*;D&) >KO']854G$x*) 'zo^ %\PfG$,9* 09<'Ng*l.u*ps'!:# +;.*^>'"#;.+ vy'##;.D+ v|'$#;/+^>'%P$;/+^>'&P$;(/, ^>''#;8/[,v'(#;X/,')*;p/,^>J='*P$;/'-vC'+j!#;/l-vfZ ',j!#;/-v'-j!#;/-v'.j!#;0=.v'/j!#; 0.v'0j!#;@0.. ` '1#mP0/. '2#m`0b/^>u'7#;p0/^>6'8#;0/ v'9#;010 v':#;0u0';׹ܹ*;10'<*;10 ^>n'=#;1H1v'>#;11v0'?j!#;11v'@j!#;22v'Aj!#;42h2 v'B#;D22. 'C#mT22. Ç'D#md2@3^>'I#;t23^>'J#;23 v'K#;24 v 'L#;2g4 'M׹ܹ*;34''N*;34 ^>+'O#;3I5v/'P#;35 v3'Q#;35. u 'R#m3(6. l'S#m4x6^>b'X#;46^>7'Y#;(4 7 v;'Z#;84P7 v'[#;H47?'\׹ܹ*D;457Y']*;L5%8 ^>]'^#;\5s8va'_#;|58 ve'`#;59vi'aj!#;5M9v:'bj!#;59vm'cj!#;59vwY'dj!#; 61:vV'ej!#;,6:v>'fj!#;L6:;) q'gF$$6';vw'jj!#;6p;v{'kj!#;6;v'lj!#;7<. 'm#m7K<. 'n#m 7< '3*7< M9V9Y9' *9=  <8'?8*9U= j'9g*:= iN'')*;= #' S*; > 8p'#8*`<I> %'R*<> R9g'S*=><'aXD? ? Һٺ'-\+`?L?XX['*t??XX['#*?? 'h/\+!@@ Һ)'-*@T@ 529'BM*A@ 'T*#$A@i ['g*[4A"A Һٺ'-\+PA`AXX['*dAAXX['#*xAA 'h/\+!BB Һ)'-*$BTB 529'BM*4BB 'T*#$CBi ['g*$[$CC Һٺ'-\+D@CTCXX['*TCCXX['#*hCC 'h/\+"pDD Һ)'-*TDTD 529'BM*dDD 'T*#$DDi ['g*D[EE Һٺ'-\+t0E_EXX['*DEEXX['#*XEE 'h/\+\"`F&F Һ)'-*|FgF 529'BM*FFi ['g*d[FF Һٺ'-\+G,GXX['*$GhGXX['#*8GG 'h/\+"@HG Һ)'-*\H$H 529'BM*HeH 'T*#$HHi ['g*[HH Һٺ'-\+I%IXX['*IaIXX['#*(II 'h/\+"0JI Һ)'-*LJJ 529'BM*J^J 'T*#$JJi ['g*[JJ Һٺ'-\+JKXX['*K\KXX['#*KK 'h/\+# LK Һ)'-*C\+# _mV 'L`*_V %'4*8`V %'4*`GW [ [['w[*#$8aW [ [['w[*#$aW V'*Hb-X ]'*b|X'-{*\cX e'*$c Y '\+|dXY'-{*dY%'4*eY l'%>C\+#f@Z'-{*gZ 'L`*gZ %'4*4h%[ %'4*hu[ [ [['w[*#$4i[ [ [['w[*#$i\'-{*0jc\ '*4j\' +DPk] '*TkX] '*dxl] '*t m] '\+m<^'-{*n^'-{*n^%'4*o$_ '*op_ Ǽ'%>C\+$p_ '*`q` 'L`*qM` %'4*xr` %'4*r` [ [['w[*#$xs6a [ [['w[*#$sa '*ta '*u'b '*uyb'-{*0vb( R^'\/>E}d=dwLc@Lqx^'x˽ֽhpd=zc08ݽ ^'q0$L$,tED]cdվ^' x|[$dm^'#49*|LdD@Y`^'|h$D](e<ֿ^'-XX <' D]e<v^' T>WD]ؕf<^'|D]Qf$1H^'|\$Afm^'#49*$| f('4_^'12Wdpw D]0/g(^'ZBy$r 3hD]|g !t מ<^'>*г?h ]@f]^'.yq*X~h 'ܴh ' .{d< h_ly'3,4m(iK'# Vi- 'IH-Z-*iL]l'0a**$xiL]'=a**$j'J/G8*DCCj b'Y,,$,jS'ZX,T$ k.  '[#$Wk "'_8**$k?TW'nq**$k'**$$\l'**$jS'X,$l&'9>4,d}h-mEu' *E<$<r  _nt'Ah<4&o -B']bqx>6Џd;^o'd\do 'h-9H`[~;8o-`k'xJ.$\#p 'm^c[t;Xp '&5@P;PplOh'fZs$5)q'hD\xxqw '/Hq^'=5,nd?';*n$ݗ 'Z q X:'4 8r'#<vr'Lrv'#lrL'+'!ltXFsR{'od8 +s .'b`p($t,F'[wt K'T4\+N\ t 'Htpw )`$u8 '8dPx IJ)pu w'y1;,u <Oj'P_d_Џ%0v8 '2O^d\IJ`2v,m'(ȶЏ4=w'LȶЏN|6wD '|e.%%#@\ 7w+.1'}; *7x(P]a'4<~m:Yx<';7 +;x8'R$<ض\IJ(>x,S 58'@,?(ymGJ'R5N@mybYd'3|5$N@y,'C6TpB&z8!'ZwD<Q\%IJDzo' #b<l*$EzI'V*~,E{4'96?%G|8Pny' T<d<\fJJ|P{'4d8*u_J}<'9KJ}T '>Ǻ_<L}c'DJ. @,MpM}P{''Qd8*u_ N}</'VO5~T`7:'[ID_<0Pp~(KX\'iPmXS~<';7 + T~8'm <ض\IJV3,S 5/'|@WvmG7'xR5NX?F'-=R5NY,Ybi'{d@DZ)8'~%IJ[c' ,\4G& +2'bJSt<V]ˀ<^|'<d<] X`(P]'4<~mcE '#b< +c8= '@ ~IJLdف,|'#8 L~e#`|$'w *NemS*9'h/Pi54Nf,|'x$]h)8/'kD]IJk'44Hl '/7>8eQt_m(8[t'', |pd<2'<<p&p8t'RE[_QBHu݄  '_SY`p6|6Xu_w<}'jA8 T<\&Tz]T;F'JJd]<}'~?|6M~[w'[!(p6|6u_|<=P_'PD\T'&APJJ]<@(KX['Pmhކ '#b< +؉&8';~IJn,|'#8 L~\`|'w *N؋'>'.8eQ&_,68CUd' N&8p@';\klq'W '2b(54N,';M<$R%8&A'Iu4]IJXd'WDxN|6G$2'*$Nɉ,  Z'Z~8")' Nej 4IJ<2q'@*Npj,{'J~p ']*DNي,ɴg'dV*~~8'l!>C TIJxH?RY'k*dN, gr'S04ܠ8'tIJĦ1)4'X*N|n,gt{'z<Rt8' = *]u_H<'*1@T>O`'P]<pW'7 "p6|6^u_$<7CP'ArXэT'LoT\'<'.=Fp6|6'u_ R<as'0`:G'= X*$^u_̼͎< en'@T'P<@'@OXp6|6D^u_\|<iu~'xÀT'dTd^<ǀ'*p6|6'u_ɀ;<1C`'90`h̀ 'U*Ǹ,ɴg '[V~΀8O.'cLc IJπ ho'*NXЀV,e/'h/~`р5'*NрǑ,jjR'~Ҁ8r'- IJ`Ԁ829'K*NԀp,R'h04Հ8m'NIJۀ%U{'**4Nt܀c,'7ǖ &-<R$Pހ4=J'P]pu*^u_t߀ۓ<'U@4T'\PD<`P'z+>Gp6|6^u_,<Xdm'T\̔T'dT^< '4G'p6|6(u_O<'2M^0`d{'*^Nȕ,'~d8' tIJT5@f#'"6*_No,?LS',k~`ory'?*$_Nx,'FFj~h8'N ', IJHUi7>'qS*D_N,5 \c'z%04ɗ8'IJN '2*\(ND,CP['f<R'*u_$<'*=D@d_TQbk'P_<<5'p6|6$u_$ s<*6C'#j}_p T'.Al{T(<'hp6|6u_$8<.O'w0`~2'*NL,  Z 'Z~8O 'Lc IJtB. 5 'E *NY,L NY ', ~ k '*N̛,ɴgw 'V*~~8r '- IJ??R 'k*Nx, g 'S04 8   '#   _IJ#0) 'hX*TN$o,gt2 'uz<R@&` i t ' L *_u_H'<   '   @($T   '" = B P$<,*`I R c '   p6|6`u_+<   '   4.ޞT : F '   T$`<T2 'Pclp6|6(u_\4c<'-0`7 J'2*DNH8ܟ,V'8b~ 98gLRx'@ IJ:G)'`*TN;, 3'jՀ~<5'}*dNx<, 5' ~T=)8t!'Mj IJH?b2o'K*tN?,e/'h/$C04@ԡ8'IJFOU{'*NG,'ǖ &-<RI͢4&1'-]pA*D`u_J<L'2@L?T_pw'9P<Mz'Wp6|6d`u_lO<Xd.'aQTOs'l+T`<V67DW'p6|6)u_0Xy<'>Yj0`[{'*`NP\, '~D](8' IJ^_!'4*`Nh_,=JQ' mgl~`ե`ors' *`Na ,'# ~ bE8'+  %  IJdi74'N S*aNd, IP'W jo04$ e8v'a IJl/N' 2*\)N mn,CP' f<RD oMX' k*tu_`p<x' *=@$aq#T'  PDa<s_-' Uhqp6|6u_u<*' j}dawݨT' oT)<|'E %.p6|6Hu_~b<GZ{'T 0`  'p *4 Nܩ,,'v b~Ѓ8gLR8'~  IJHI)Z' *D N, 3j' Հ~̆5|' *T N(, 5'  ~/8t' Mj IJi2' K*d N|,e/' h/$C04ݫ8"' aIJZU{)'E *NX,M'R ǖ &-<Rt 4ڬ4&{'k ]pA*au_X<'p @ NT_p'w P <X' p6|6au_ ȭ<Xd'  PTOs ' +Ta<ĠI7Dz ' p6|6)u_䢁< ' >Yj0`Ӯ ' ,N ,Ň!!' E[8 2!~ A8f=!H!' `!o!xs IJzz!'3 *N̨,!!!'= W!!~ !'P ,N,-,B@ !!'V  ""~ @h8"*"5"'^ U"r"  IJЬd<}"'w *N߰,""'~ ~""04 P8" #'#' ###p4IJ,Z $$' ($*bN,3$@$W$' $$<R dޱX[$' #u_x<$$$' %%"%@$bVT7%F%' `%s%PDb<,J%' ^*u_Բ<%%%' % &&dbDT5&R&m&' &&&Tp*<Y'!'', , ;'*bu_<F'X'o''7 '''0`b''O ,N,Ň!''U E[8 2!~$ āS8f=!('] `!o!xs4 IJā4('s *NŁƴ,!!>('} W!!~D \Ɓf(' ,NtƁ;,B@ !j('  ""~T ǁu8"*"(' U"r" d IJɁd<(' *N<Ɂ,"(' ~""04t ʁ&8()7)' )))p\*IJxρc $*' ($*bNρ,3$@$3*' $$<R сX[u*'#u_с<$$y*'%%"%@bdӁ[T **' **Pc<tԁJ*'4^*u_Ձ׷<%%*';% &&$cׁTF+c+~+'F+,,Tp*<HہZ'+,'l, ;'*Dcu_4܁<F'X'E,'w'''0`dc߁,',N0߁,Ň!,'E[8 2!~ @N8f=!,'`!o!xs IJ f,,'E,,5 N,,--'B-Q-X-cPg-',Nh.,B@ !k-' ""~ |f8"*"-'U"r"  IJ d<-'*N0׺,"-'~""04 8()-')))p*IJl $v.'4($*cN̻,3$@$.'>$$<R  X[.'T#u_D<...'Y!/4/=/<Qc~TR/c/r/'`///Pc<J/'t^*u_<///'{20E0V0T<d\5To000' 181G1T+<@u'j1', ;'*$du_,<111'22*20`DdG2',N43,K2T2_2';2~ k8V922'22xs IJ222'*N,222'N;3@3~$ K3',NW,O3Z3'a33~4 @8333'333 D IJ$οd< 4'7*NH ,44,4'>zp4u404T F8444'HP555pdIJ  $5't($*ddN ,555'~bB6I6<Rd X[`6'#u_$C<d6m66'666@dTמ67'707Pd<pJ?7'^*u_<I7V7o7'777d@T8 8;8'888Tp\+<$'8', ;'*du_<99+9'9990`eD9',N\F,K2T29';2~t }8V929'22xs IJ 22:'3*N0!,22 :'=N;3@3~ "-\:'P,N"e,O3`:'Va33~ h$833:'^333  IJL&d<:'w*Np&,44:'~zp4u404 ,(P8;,;I;';<<p+IJ- $1<'($*$eN .,55I<'bB6I6<R <0X[<'#u_P0I<d6m6<'666@DeH2Tמ6<'707Pde<3J<'^*u_04<I7V7='777e 7BT8 8_='888Tp+<P;'=',, ;'*eu_<<<9=='799J>0`ep?a>'O,N?D,K2T2e>'U;2~ @z8V92>']22xs IJ B>>>'s>r>5 NB,>>?'}O?^?e?eD't?',ND^,O3x?'a33~ 0F833?'333 $ IJHd<?'*N8H ,44?'zp4u4044 IE8;,;@';<<p,IJtO $@'($*fNO,5@@'bB6&A<RD RCX[AA'#u_R|<d6m6EA'666@$fTTמ6A' 707PDf<dUJA'4^*u_U1<I7V7A';777dfXqT8 8B'F888Tp\,<]'_B'l, ;'*fu_^<99yB'w9990`f8a<5BB'B*fNap,BCC'j+C2C<pTT b8=C0[NC'bCC IJHd,CCC'SCCd f8CY_C'CD<QIJgb)"D)D'?D*fN4h,JDWDbD'l|DD<pTt i,DDD'A@DD k DD' D*gN(lW,E EE'j.E5E<pT m8@EQE'kEE<QIJTo,EEE'2 EE $q8EE'=F6F<QIJ8sU@f?FFF'Y^F*$gNs,iFuFF'bFF<T `u8FtF'lFG<QIJTw,G!G,G'A@PGYGx$ PyL8dGυ yG'GGIJ{GG'?8[G*Dgu_\|<GGG'/HHD }T$H5H>H'YHtHyHPdg<HD<HHH'bHH dTHHH' I'I0IQ|6g<49IBIII'DxkIrIp6|6gu_<}III'o^ II#_ QTIII'"J=JFJXo+m[$o$p(p'Ypq&r< m\m rrr'r ss~VD84o' ;sPs'qsssh.ipk*s'-=<-ipq}ss'ss$>t 4Lr} ss'*xr1} ss'*rp sst'ptttN4D4|u tt'tuuO(iv*u'-=<-iTw?}s$u'ss$> 40x} s6u'*\x} s:u'*x >uGutu'uuuN4Dx4p{H v)v'Fv]vdvOi|*yv'-=<-iP}}sv'ss$> 4,~} sv'*X~V} sv'*~ vvv'6wEwNwN4D4t tw'tuuOhî"*w'-=<-iLh}sw'ss$> 4(} sw'*T} sw'*/ www']xlxuxN4D4u vx'Fv]vdvOi舃*x'-=<-ih}sx'ss$> 4DG} sx'*p} sx'* xxy'VyeynyN4DX4L yyy'yyyOiV*z'-=<-i<}s z'ss$> 4} sz'*D%} s z'*pg $z-zNz'&zzzN4D4 vz',Fv]vdvOHiX*z'/-=<-iؔ<}sz'3ss$> 4} s{'6*} s{'7*  {{;{'>y{{{N4D4xL {{{'D{ ||Q-i,*'|'M-=<-i}s/|'Qss$> 4} sA|'T*^} sE|'U* I|V||'\|}}~VDr 4  E}N}i}'e}}}O4i젃)*}'h-=<-iln}s}'lss$> 4H} s}'o*t} s}'p*2=}}'w~~%~ hVm`l ss,~'ptttN4D48 ~~~'~~~Oi|*~'-=<-i8}s~'ss$>4ة|} s'*} s '*0 V'lDD 4x '́=l<_ iYj'{G 8KD ihW}s'ss$>$4D'aȃӃ*4LXڃ'*d!'dtDm[ 2;]'Dh4à ̄'&_#&OhiŃ9FV'.Gkr$>Diǃ'}}'6ss$>T4ǃk|':76ɃŅ΅'>76i|ʃ &/Q'GuN4D$i4̃/ 'NH-i̓vĆц'R$>di΃}} 'Zss$>t4σ0'^#8%*pЃEL,0'b*у6Cn'kz*\-҃ Շه'q0( +Ӄ2i߇'tǺO6ԃ;'wm^i@փz 'z/,5 76(׃@IM'U856,؃ ^b'wh*؃Dmv'>Ȉ͈*Diك `'wq*xڃ '4E$4<m,݃ \e}'ƉN4Ddi4߃D ݉'%H-iĆ')$>i}'1ss$>4 @x$,'5J.7>*8JLEI'9* N^'C.yqv*id 'F$>i($x 'KOi\9$ ĊȊ'SԊhVt ݉݊'X$>iD$'\#2;F6ii0N`'gًԮ-H  'qwh*mm%'t>Ȉ͈*i `X`'wwq*I| 7lo'~8.|'(-5',-L34';I4{VPu8Œ'X>Zdqq J <&C'ޑ@XD+CO`s'.*-NŒΒ ';j}64 N|0ɓғٓ'dL{$ ,F'qɔԔ`8s ( .'by,=Xj&4P,'ɖ|cpO. `<'(>I4|6  '*2`d'\t{*4lP2`'_t{*DB@ 'b̗ӗ4,*#$$Ih'eh.$jiEt"'h29P+Ti^DM_'kSD+*(#$ "'nw*$ƘӘ'| (5DjyD9kL'`4>'~dj  vN'*$ & kR'*@ uVhu'GD$;P"ҙ'-$5Fj;P%an'FĚњT'( 'N*'n 'X:q*( z'[*4(X'^*H(? 'a*d( 'd 76dX)!@h'u=$=Џ;/ASo'Ŝ`0`j;H5N1>Z'˝hx;$9'=i}Ȅh\.K=X='џq( (E'<'K]С(8O TO[ '$ 9dO  '$ 9tO '# 9O- '# 9Or0'׹ܹ + 9PJN' + 9P R'# 9PH vON'$ 9P  V'* 9P  Z'# 9P  ^'# 9P`  b'# 9Q .sOf'e. + 9Q .sOj'e. + 9(R8  n'# 98R  r'# 9HR  v'# 9XR  z'# 9hRb  ~'# 9xR  '# 9R  '# 9R2  '$ 9Rw  '$ 9R  '# 9RJ'$ 9RM '$ 9R '$ 9S '$ 9S: '$ 9 S} z'$ 90S.  '$O@S . '$OPSWǢ'+4RgTK.G$WZu'I- +B,XZu'L- +BX#'O$BXf'ѣv$ jG$Z'$-*m[ G'04=D=m`!N'];L{ u\y mj^ l 'q04*;klƦӦܦ'  O6Џjm8m$'km04O' ,`/ V m܆zͫޫ'?TAm4 '4EP0<t؉$[i̬''_  $C':+HSdiV$kܙ be'v;kh+*C,r'ȯگ=蝄0'->O,зK|>Vw{'Z'˰D`X`i`sm 'b*L, $W  ' *L, $'*$:wL '#b<'o*$, -P'haH].9՚ ɱ'#b+.9lϱڱ'3+Dk.9K  ';F+*.9|%2M'Zu|+L, .9՚ ' #b+.9 . f '#,H  m '$EX<'V+EX $Ȳ'ز(/EXT$'V++$>$'"V+EX$'%V+EXij'(V+EXXl '+#.9I. f '.#ہ`o$'1C*D.90Xlz'7T#.9DCdY`':yN +.9ovbjm'-g$Yt'05, -h p'$@$, O̿ ݷ0IL'XT<0QPg'\QQQ4.@Ä 0'``T=$RĄX0׷'i"3/DŽ0R[b'tzT=$RɄ0|8 'ǺT=(DQph-8r'/^ 74)(o8'+~@I857dl)8G'Rcwh<p )8d'BNH=+09W%V'y#s9D\'e.#9bn', <[`)91'j vL<:'m 74)|:'~@I857l)ر: 'en\Ppr) ;P'D̅=Tap'BDx#$ͅ9> 'K; /#$Tυx>"/>'T/an<#$Ѕ>'] L4l҅>"/'f/an<d#$Ӆ3?%'ojJQ54#$hՅu?hs'xrt#$<؅?+'L/JQx94 م?h'L/Q644څA@'-*$څ@ d'*4@څTA d'*DdڅA jy' 5 *TڅA '74ۅ-B \'. 74dmd܅{BQ/'y?JX64m܅B[b'-\+d݅Cl~'.?Dz ,eCjw'\/#$`C ',;J#$Ccp'<\0#$9D'(7DL\\0dDcpY'<\0#$D'54m#$E 'CSh #$paE('x94$$E('e 64T4E' '*mmv03'j!@* '>*),m  6'Dw[*EF@IR'MJ.ah?tBPFZqx'So94,BFb'X\+)F7'Y\+)8G'Z\+)sG'[\+)(G'\\+)8G']\+)H H]'^\+)XWHk'_\+)hH'`\+)xH'a\+)I'b\+)@I'c\+)}I'd\+)I'e\+)I'f\+)-J'g\+)fJ'h\+)J'i\+)JF'j\+)K'k\+)(UK'l\+)8KRt'm\+)HK'n\+)XL'o\+)hCL~u'p\+)xzL'q\+)L'r\+)L's\+),M't\+))nX̟'v\+)dy u'}\+)j'**%bz'**%dhM'\+3t`'\+M " ' *M q!'/@93NdGTX'm\K|K%]sN '0Dl|mN ]`'%#)Ncj'az**D4OrB'OrB'rOu'` P'#8l*UPXm'#)0PY'#b,\+P  ']#NLQ,'`d,Q '#)R a9j9' *TR 77:'*R z'*pR ENQ'J*`S ^i^' *bS B{<'# *S $FK'(*S U{R'6 *h*T d 5'*D mT d 5'* T 'IO_*@ T Ǐ %q'Ǻ0*X )U d 5'*4 hU7ix'* U{>M'\ok*Udz'h/1Q +*m@V'*$V'J.*V'*XW|',TWx'540W '0;'?8LQ*W{<'H4,#$X38<8'?8N4,#$DQX%'4\+X%'4\+LX%'4\+Y%'4\+T>Y%'4\+{Y%'4\+\Ye\c'.ee\+$Y%'4\+h2Z%'4\+nZ%'4\+pZ%'4\+Z%'4\+x*[%'4\+i[%'4\+[%'4\+[%'4\+!\%'4\+ `\%'4\+\%'4\+\%'4\+]ls'*4$ P]8z'hM\+D ]+'G*Tx!]%'4\+! ^%'4\+"I^%'4\+#^%'4\+#^%'4\+ $_%'4\+$B_%'4\+%}_%'4\+%_%'4\+&_%'4\+&:`'!*d4'u`'<KP*+t'` *a'jǁ*+(`[ [['w[* )Da'w *)a  'K\+nd*a z'e.\+*b%'4*x+[b 'L`* ,b%'E<- 9,bQ@f]'.yq*-:c#'FH|, 9-c %z'e.*4.c#'FH|, 9.4d %z'e.*P/dFg'|, 9/di^' dr*0e#'FH|, 91oe %z'e.*1e#'FH|, 942 f %z'e.*2Sf#'FH1 9P3f %z'e.\+3f%'E<- 9d46gQ@f]'.yq*4g%'E<- 9p5gQ@f]'.yq*5"h%'E<- 9|6vhQ@f]'.yq*7h%'E<- 97iQ@f]'.yq*8ji%'E<- 98iQ@f]'.yq*9i%'E<- 99HjQ@f]'.yq*(:j%'E<- 9:jQ@f]'.yq*4;+k%'E<- 9;rkQ@f]'.yq*@<k%'E<- 9<lQ@f]'.yq*L=Sl%'E<- 9=lQ@f]'.yq*X>l%'E<- 9>q\+0[|%'4*d\} 'L`*\Q} %'4*|]} %'4*^} [ [['w[*#$|^4~ [ [['w[*#$^~'-{*x_~  '-\+D`]'#8+#$a_]'#8+#$a%'4+#$@bFg'L-^b3i^' +#$|c|X '4`7dǀ:'=/Ce t,' +eP %'E,$0fQ@f]'.yq*fف#'-^Dg& %z'e.p.D+#$gv Z'd8Z*$nh '*i |'*iL 'g)*L, j {<'D+#$܋ /( !*P,0[/(6j$K,( 25/("bOTj4KDen}/(0*Ds$/8O8{</(~]ТX8a8/(d8~+#$֍8O8{</(~],"X8a8/(d8~+#$ܤq0Fg/(L~]xi^/( 4,#$}(5G,AD}( m,Ц;쫆,A}(m,Ц;حяjy }(5 57 #< }(;#T䮆i ]}(?P$l [}(C%P$识T}(GR^8}(L >h+*E^N}(^^w854| ~}(g:q\+豆<. ( }(k# R}(mLޒ^}(z >h+*- }(~*гy }(\+Ɠ Y }(\+D}(854,_ $}(:q\+. ( *}(# . 3;}(QdLFZo}(uh+*` Y |}(\+ە }(*ȷ'}(854p }(:q\+. ( }(#,  . 3}(QdL@Zc}(J.h+*躆 }(\+ Y }(\+\E }(* Y }(\+Ļ }(\+6}(%854༆ }(.:q\+Lљ. ( }(2#\% . 3}(4QdLpyc)}(AJ.h+*˚ Y /}(E\+X7}(X854@f K}(a:q\+. ( Q}(e# . 3U}(gQdLVck}(tJ.h+*x† q}(x\+† Y y}(\+†I Y }(\+,Æ }(\+`Æ}(854HĆ: }(:q\+Ć. ( }(#Ć . 3}(QdLņ6c}(J.h+*Ɔ Y }(\+Ɔܟ}(854dž0 }(:q\+Ȇ. ( }(#$Ȇ . 3}(QdL8Ɇ;^}( >h+*Ɇ  }(\+ ʆ }(*@ʆE ?}(+*dʆ K 2}(@*tʆ GP}(V`/s#dnˆQV_|}(wWˆ}(x<BtPΆlJ}(WRoφ? t}}(*`Іf}(J.xs \+ц}(:|6ц9%}(4*h҆ }(&\+ӆ٥ }(L*ӆ'% (K HԆ` %U:(K**Ն(RP[(-m`.`ֆ $\ T(t/ W|`D׆6i('3\PhPn;܆y F(%\hЏ( mR^p(>Sr;((-(dL(( 3-(( ()Qat 0(Qh(:@86FB((M$((DM$[,\48֩(`Nq(0I(< (>W.dd (V (S|<?(y&cstJ((pJA(@(( Ilph44`% $(/ W|`DH u($ 0@$d .AM(2Pn; ^i^( *XF ^i^( * (X.ح  (" ) X6`7 )OLR(m^< *De  <8(?8,* ^i^( *C F )O  b l x  )  L,*1<M  )^& \1 O uX  )   L841    )n   RSq )Nq Uq X6`7He> )2=)ST*$oDf] |)*f} |)*sg }>q e)Nq Uq X6`7|h nw)L/*Do`i߶ %)4*i |)*sj" }>q )Nq Uq X6`7xkD) 9HHU\bdo$nUYft)'z 5tη9GU)=2`p! 5~<h)s4h5!)^zl7|6o;s!);E+*;쇇 H!)%  '076ЏDL(> !)'oG\_!)2|844!)C0C!)T1pȄ葇}!)mD  =>!)oP !)/!X[tk:zG!)e.l*pQ^a!)/o46Xv!))t0h#$; -!): 2 ] db) mG[ !)Iw֎pC[!)Bw֎N   !)b!!!*!RW$,  1!!)!!!*!RW4̩\k!!!!)H!!!Nx*D@+C" "!)Uw֎9 "!). +;$9"!)u. +; iN!)"*i dd<*,$"0")G>"g*G$䱇Q"! b")e"""@6T4ೇD""")u?#Z#c#5,r###)###(K|6d`##$$)$$$@|6 4$)#TX[%)*ԾU{R%)-%*<%O%^%)%%%TjpTo4‡%:%)&]Q4,ć&&&&)p&&&5pƇ &&)&&l74t#9LJ-&&')***-(c p؇r +++)6, ,),(@44ه0,9,<,)Xd8F,+4ڇ :SUK,)_S,pC*+4ۇ;Eb,)d*Lۇmf,u,)h,,*܇=,,,)y---$p4e--)--*..%.) C.n.s.(...) .#...).#Q...).# ..5y) .*  ..)..#$. /,/)=e///Tp4P<$///)N/ 00h 2F  -0)Y:q*  30)]:q*  q90)al =,6T q?0)el =,6 qE0)il =,6ooK0)oQ0< +=oo`0)sQ0< +f0s0)w0 0:4Dpt000) 0A1L10hz G$ g1z11)*112@P S 21252)9V2m2x2`pS%22)e.Zl*;`A )22)=Z*%22)e.Zl*; )22)=Z*(<8)?8TYc^$ n )HX4$22)2%D2ch+$2 22)2_3,h+46<$2 3)2%D2ch+D2 23)2_3,h+T6$23)2%D2ch+d2d' 2$3)2_3,h+t6Hx(<8)?8c$ Y )cF<-3^3r3(*333p\2;@3; 4(*@<445G$0  + aE4(*D;U4 Z4c4(*Y%444G$ ?94(*d*6| A {44(*Vo4*L 38<8(*?8N\+ 444(*?44X64X4+*?8d 7`7$ S +*#( 455+*Dx&5/5X66:5X5e5+*.555;H5 556+*1666hhdp% 7+*UB 7+*Txq 777+*Y:7U7Ně#$Pc+yD p7+*r7Rtb#77+*t-]]0v777+*F8a8z8Џp#V 8+*#% +*B|$$888+*89h4&[$9#9,9+*D9]9d96ЏpF'm9)+*7Jpxp(  x999+*99,*]% 9+*B|* @A99+*99:076Џp+m9 :+*7JqxD,n t:):2:+*H:c:j:B6Џ$q6-m9s:+*7JDqxx.' t:)::+*H:c:j:B6Џdq60m9+*7Jqx0 t:)::+*H:c:j:B6Џq682Dm9:+*7Jqx2T:::+* ;;);ЏqL5% N;+*B|5hT::R;+* ;;);Џr,8% +*B|8';;;+* ;;;cZЏ4':~m9;+* 7J$rxt;  <+*8% #;1 <+*Oe.#< }>q <+*Nq Uq X6`7x=<#<8<j*c<<<DDrX@<<j*8<<(6@<<<j*P8=g==d FC===j*>!>4,2mHh<>Z>>j*>> 02Lf>?j*?E?SE E*$uEEEj*NF)F4FRiH!wK UF^FkFj*Qm^FF\PQ!;yzFFFj*aFF*Hz$FFGj*r]GGG!mFt:GGj*Dv%aGj*{B |M0GGGj*5H^H|`@zkHvHj*$lV3,T*<r9IHd j* x +G$(H j*  x +G$ȆHHHj*HHIeQЏr4d?#EIj*sv"I3I>Ij*XIkIrI56Џ$s<#E}Ij*Ds(IIIj*III56Џd #EIj*dsčH JJJj* 1J:Jx94s쎈f CJJJj*WKKK t @ukGLj*(Dv kGLj*'Dv C4 Lj*w֎,a%a Lj*BLL$Lj*S>LGL:$NLfLqLj*:LLL(iP4jQNLfLLj*ILLL(iPDjQdNLM Mj*X^MjMyMp(XHxT;p% j*B䨈%j*#hGj* -I d 5j**ઈyMMM*MMv%M*#|(MMM*ON1Nm >NPNTN*gbNNmSI 3NNN*uNNmSIXdNNN*NOmSI!OEOIO*yOOt2iDOOO*OPP2QTlL>%P)P*J3P0 `=H8PHPMP*SwPPUOؿ~PPP*iPQ#Qd,È*QHQMQ*qQQ2 RňQQQ*-RjRRXˈRRR*RR2 RdΈPRSS*OScShl4 $ӈd~SSS*6SS2384 ֈ9STT*=gTTTTDft;܈y`TTT*}TUȒވLZu UU*X-lup&8߈LZu UU*b-lup&߈#LU)U-U*p5UHUp&_MU_UcU*xwUU  RxHUU*TUUlR#$pUUU*[UVECs7#$|V'V*]s 57VbVnV*kVVV@,s%#$(nVV*vt W'W.W*xNWUWp,*#$ \WqW~W*WWW66Џ$t#$V-*Dt|= <WWW* X X'X66ЏdtfV2X*tt@BXmXX*+XY'Y\jl43< v$3#-%#__ v$f!#-&#8` v$i!#-'#` v$$#-(#a v$H#-)#pa v$6#-*#a v$9#-+#@b% v$j#-,#bF v$<#--#cg v$?#-.#xc v$B#-/#c v$E#-0#Hd v$H#-1#d v$K#-2#e v$#-3#e-v$N#-4#eNv$Q#-5#Pfov$w#-6#fv$T#-7# gv$W#-8#gv$Z#-9#gv$]#-:#Xhv$`#-;#h5v$c#-<#(iVv$L #-=#iwv$f#->#iv$i#-?#`jv$m#-@#jv$q#-A#0kv$ #-B#kv$u#-C#l=v$+ #-D#hl^v$y#-E#lv$}#-F#8mv$E#-G#mv$Ex#-H#nv$#-I#pnv$#-J#n$v$ #-K#@oEv$#-L#ofv$#-M#pv$#-N#xpv$#-O#pv$#-P#Hqv$#-Q#q v$#-R#r,v$#-S#rMv$#-T#rnv$b#-U#Psv$#-V#sv$#-W# tv$#-X#tv$#-Y#tË#-0a*{3im#-G*T~S#-*s#-f*ns#-ю*-َݎ#-Z-*LUX#-]\u+X |#- T\5|6;@zK#-me.H@,#$Л9 ԏ#-r t D$l#-$+pDHDu'8ȡC6:#-w֎D $t >B#- a1s䢊N(H[f#-=VPSB8"uة~#-C6ɒOԒ#-b|  4zɓ#-9 u[4P%2<#-Q^ox<duԴ#-ah Ȕє944,\ܔ#-DH'I45C6#-w֎o W -#-7F3l-Џ;Թ]U]#--]]Tfz#-!ۖxXз3;Ê=LΗ#- zt11X 7ϊd #-+ЊǏ #-!Κ+Cъ#-,l*#$ӊ ),#-6K\cl*$sPԊ ps#-=+Ԋ,R#-Hl*#$ՊR$#-S-YT*؊v  5#-bA\l*#$ي$alp#-l7ۊۊ ~ǜ#-y74u>4݊,#&#-4\+HފO;HK#-6c\+ߊsjw{#-x96 G#-5m ŝ֝ߝ#-S*4;#-.?C1856G$08#-LFM*D;EXq#-Z #:d T;f R_h#-wx#T  #-ɟҟ**d  ٟ3a#-d8\+|#-L\+ +#-OP$ ]#-QW RF*#&#-`-0D+s$l,5#-fd,< ;& 9#-kF#?Wb#-tȠS1u#$Ӡ#->TeJ*L,tpB Qv#-TlTvhv4 ^#-͢\++^#-͢\++ .H#-ңpS9I(0/Sb#-Aɤ/ԤSf#-g&4)8O(\4yЦݦ#-vߧ6 O4 60Zn#-ʨܨf#-)ک Sdg#-B\+0+ {#-O*G$Sv#-P;*w#-QX˪ԪP$R@!$۪#-X/7|vu6d4Ku*#-Sck+ 4;A .i#-ܰ+44=b 0w#-*, C ȲҲ#-PПsPE &#-[BW\$>sxF!coy#-u6|KH@!. #-GdzPsI`!ҳ߳#-*QQu#$K!$5ku#-ϴ !<U!*=#-LCy<"{ _!ܶ#-l%<Q$@Gb "Xqy#-÷շ1je6" !#-̸,o 4m8l" $#-FW*pm"\#-:fpW14@| xr"ź+#-&q(,  T #$|# 9=#-!P$ Ѐ3# #-Lؾ'@T"t#ET#-z]Qs`V#v0#-x*#} #-* #d`#-*А $_#-*X~ #-*X~ ÿ#-*0z# ɿ#-*L )Ϳ#-ۿ*47$G#-*ԑU$*0#-*v$#-d8,t+$1#-#$ ,#-ar{<94$ Ơ #-\+% ;|PP#-4*LD%1#-#\p%.#- &$ %o#-F&UjuV 4ԡ% #-iyW$R5 % #-u) *ऋ&:#-d8,t+F&1J#-#r& N#-ar{<94t& #-\+& ;|PP#-4*0&1#-#@'  #-0tW|`D D' G #-*j'#- t+v̪'(#-O`e@,$v4쫋'1v#-#' z#-t+"0( *#-V_@,(#4P1( v#-DHDZ( j),#-h*谋(1#- #(#- E[HUpT$)9#-  !<94444;) (1:#-VepXQDشd) y Γw#-{t*)1#-##)#-$E[HUpTT)9#-% !<94d4̷* (1#-'VepXQtp-* y Γ#-2{t*T*1#-;#(}*#-<E[HUpT8*9#-= !<944d* (1#-?VepXQ* y Γ#-K{t*+1#-U#I+ G #-V*Ds+ -6#-XTYt+ +`i#-a@,4+ N#-o=\+P+X~ #-*d , #-#XQËK, HW#-oQpTŋt,#-E[HUpT(Ƌ,9#- !<944TNj,1#-#dNj,#-;t+,ȋ,-#- ?`74 ɋ_- '03#-?X6v͌16 #-*\5;$3"7 1#-s64D5D5L7 #-/:\+5m7 #-2 w12T<.8,#-Oe =F25>T8(s#-_R#456B8,Fh#-y G8(M#-"fnSt 6P8#-*XP9(#-yT[vS"9<j#-F|@ 5xu 6(Z9<]#-f$2 7^9 |QNU#-{44vG$T`: #-44vG$a?:$ !#-a?FXQd6ca:$Ubq#-~|otvdd:$J#-xԸD# 64o:(#z0#-1BQZStp:$ay|#-9gB Fr;(#z#-FBQZSPs7;$#-Q  Ft];( 1#-^} 4DLw;$#-ja Fx;(k#-S6y;( (J#-vw6t};(#-gt$w<(#-1R62<(#-!v0ԍw<(#-IMdrv$6<(#-gT4h$_> #-iL/*>,#-G\42R>4eru#-P4j)ࠌ>(#-L/_ġ> #- '9 #?(#-16F?8Lm#-2BRD2u$6г?4#-"kE#v6?@NX\#-4^`7xE@#-Dwоj@ #-c I4c@5#- P|XČ@#-/)[[DT#$nj@p#-OLt#$Ɍ@Ƿ#-38ʌA #-KGYjp`\6͌7A #[6#-W*͌aA #-*ΌA#-FW*όA#- @x94ҌAG#-!>mfl6A _#-\+B #-;*;;B #-;*;ZB$D#--CDT2t5{ByV#-M d, pBu  #- 0D74B   #-  <0B   #-7  # 8 C jy  #-  \+ 1C % ) #-# [C - 9 = #-_ t X6ԟ| C}   #-#y  HURdw D   #-%d=D $ F #-/   @,w4pjD  #-G*D   #-K   <[pTD #-^# D  , z #-`v   X(  E/#-epHU]w2E{#-tR4L ZE7#-* E *6 #-+<C<[pT"ER#-# "E v2V#-P$@"FdZ^#-#d"1F b#-#t"bF % f#-#"Fjw#- x-+4$#F#-#4#F#-#D# G #-#b<\+#3G b#-*($YG#-@,w4$G:#-t+|%G#-@#%G #-A*%G"2D#-CHU]t'#H#-O"u\w4*OH 1CO#-\X6xX-{H #-~ %2L/HA#-#/H *EO#-Yluh\+$(0HX(o#-*<0&Is#-E[HUpT4L1QI o #-<[pTD2|I9#- !<94T43I3#-#3I #-*4I#-CNHU]86%J_w#-u\%49QJ =O[#-X6$x<}J #- %2Ld>J#-#>J Ƿ#--lu\+d?JX(#-*x?"K*#-- t+?KKFg  #-o<94@vK %`#--"V*,AKX(3#-B*@AK 7#-C\+AKs;#-DE[HUpTtBLX(Q#-E*B;L9U#-G !<944DdL cy#-UoQpTEL #-Y`GLGL_#-xl G$MLuu #- 0D7DNL  #-  <@OM,y#-%ltFRHM "#->Ufm vQ6FTuM(#-OUM#-W4IVM %#-pk{MlX%YM4#-S|PP`'N(R^m#-vS|(bSN0#-'v dsN00Pb#-"?x0 C7jN$Y#-E%KWd2WDxG$oNgs#-P$*p4\qN+#- !!!+ 44yO!!!#-"%","+dx4z;OA"R"}"#-"""<4|6*ҟ##--0D+s}^O #"#%##-a1#W R~O jyrR >##-  \+~O -ToB##- H#W#\+O x^##-/b#X64XO k#n##-8t##X6 5Д8P x##-Bb#X649P x##-Jb#X64[P 3 ##-S##WWP x##-]b#X64xP x##-gb#X644P x##-qb#X64P k ###-|##$W$RQ k # $#-##$W$R-Q 7$#-7$$\+PQ k#+$#-t##X6 5Д|tQ k #1$#-##$W$RQ xC$#-b#X64LQ xI$#-b#X64Q 3 O$#-##WWQ U$;* b$#-$$US$ R g$#-$$X64tCR$$%#-&&'\īD ;<cR'''#-q(}((Lԫ| ;|R(( )#-,)))R$vD } G$pR))*#-Bq***RRv $R* ++#-{SI+N+*%$R gc+#-$$X64S gg+#-$$X64X2S k+w++#-+++848US ++ ,#-2,A,L,W\8xzS Y,f,{,#-,,,,(8d\S x,#-b#X64S ,l,#-/,X64S ,--#-F-W-X6|6xT f-r--#----w0*T -v-#---\+$ULNT ---#-..%.##XiT *.7.;.#-B..t2tT ../#-D/T/m/M\lLÍT //#-//ܐܩōT///#- 005xsƍT k+w+'0#-+++8hȍU k #O0#-##$W$R|ɍ:U k+w+e0#-+++8\ˍ\U 3 0#-##WWh̍U 000#-zW00wXx͍U 011#- ;1J1W1,@8$ύU j1w11#-111p`TҍU 11 2#-9=2J2X8y0ԍV 01W2#-Y;1J1W1,@8ՍAV xy2#-fb#X64֍hV }222#-u 33.3@`\7\ٍV׳Y3h3#->335$ysڍV 333#-+4:4I487܍V t444#-444([7|ߍW 55-5#-C5Z5c5x97FW n5}5#- 55R RDyXiW 005#-zW00wXdy`W 75#-7$$\+W 015#-;1J1W1,@8W 566#-666/h@C8XX 666#-!707=7ܐ0w0,:X gD7#-+$$X64_X H7T7]7#-4u777ܐpP$(X 777#-B77ܐyX H7T78#-Qu777ܐpP4X k #8#-_##$W$RD$X g*8#-i$$X64Y g.8#-q$$X644Y 28>8M8#-|_8n8y8W2XTWY Ӟoo8#-ko8X64zY Ӟoo8#-ko8X64PY ~ ll8#-@8X6<74Y x8#-b#X64Y x8#-b#X64 Z 78#-7$$\+5Z 888#-889dZZh99#-I9N95ys|Z 01]9#-;1J1W1,@8Z 999#-6:J:]:X t} Z ::H;#-}<<<XXX Z(N=Z=#-%=*y[ ===#-.=1>7>#<3v 3[^>Lk>#-N>>*tC$T[>>>#->?th4(y[??!?#-@#-C3@T@(664$4\??]@#-Q>{@#-\>?th4l)\@@@#-f@@(664x+\,@@@#- Ao8,\,AA6A#-UeAnAt-\,AAA#-AAA0vy/ ],B.BOB#-#BBB0vz10],- @ #-3d,2Q],@@B#-7 Ao2r],BBB#-?C3],!C6C[C#-G"CC5^,CC6D#-WDDDo\88A^,CCE#-kDDDo8;b^,xEEE#-JFZFaFo% ?^,F F#-V"0v?^,FF G#-YGiGpGo8B^,GGG#-3GoPC^,CCG#-DDDo9`F_,"H/H#-0v,G1_,CC=H#-DDDo\9j ppu#- `qrq{qK\<``j wtt-v#-+tBKLj 9vFvWv#-6vv\.@j GGv#-A3|Kj vvv#-L>vv\.|Lk w.w2w#-WRwowK 6k vwww#-pwwK [k ww"x#-xxxK<$~k y y9y#-xyyyK|k yyz#-zzzK@k vwwz#-wwKk ppz#-`qrq{qK<l \nqng{#-nnnK|4l {{{#-1<|M|X|K4=!Wl |||#-C ||K}`#zl }D}}#-UhE~~\. *l \nqn/#-nnnK$}x,l cspsd#-snhKT-l cspsp#-snhK0.m csps|#-snhK /%m csps#-snhK/Gm vww#-wwKx1lm csps#-snhKT2m \nqn#-nnnKD}H4m !Q#-ȀK\=p9m ||#-% ||Kd}@;m wttR#-7tBK,<n oo^#-BoLK=Cn cspsj#-MsnhK=en cspsv#-XsnhK>n #-cǁK`@n ΁ T#-u/9KTGn #-K8'Kn #-!2;KMHo L#-ǁKNko wttb#-tBKOo oon#-oLKPo cspsz#- snhK\Qo #- K}To wtt0#-) tBKT$p pp<#-4 `qrq{qK=XHp vww#-T wwKPZjp ц#-f ҈Kt cp \nqnt#- nnnK}ep ц#- ҈K4 op Ҋ!#- K4rp ܋#- Tlt\.$ zq oo͍#-S oLK{@q ٍD#-^ ӎ܎K$cq 2O#-~ K}́q y yۏ#- xyyyK}|q pp#- `qrq{qK=Lq vww#- wwK܉q y#- vK r Ҋ#-" Kdhvv\.~,r csps #- snhKr 2k#- ɖږ\.'r csps#- snhK즏s Ex#-  K>Ԫ7sXCF#-#\+誏XsXC#-#\+|sXCJ#-#\+sXCN#-#\+$sXCR#-#\+8sXCV#-#\+LtXCZ#-#\+`2tXC^#-#\+tUtXCb#-#\+|tXC#-#\+tXCf#-#\+tXCj#-#\+ītXCn#-#\+ث uXCr#-#\+쫏2uXCv#-#\+UuXCz#-#\+zuXC~#-#\+(uXC#-#\+<uXC#-#\+PuXC#-#\+d vXC#-#\+x/vXC%#-#\+RvXC#-#\+vvXC#-#\+vXC#-#\+ȬvXC#-#\+ܬvXC#-#\+ wXC#-#\+/wXC#-#\+RwXC#-#\+,twXC#-#\+@wXC#-#\+TwXC#-#\+hwXC#-#\+|wXC#-#\+!xXC˜#-#\+CxXCʰ#-#\+exXCv#-#\+̭xXCƘ#-#\+୏xXCʘ#-#\+xXCΘ#-#\+xXCҘ#-#\+yXC֘#-#\+08yXCژ#-#\+D^yXCޘ#-#\+XyXC#-#\+lyXC9#-#\+yXC#-#\+yXC#-#\+zXC#-#\+?zXC#-#\+ЮczXC@#-#\+䮏zXC#-#\+zXC  #-#\+ zXC#-#\+ zXCD#-#\+4{XC#-#\+H?{XCMj#-#\+\c{XC#-#\+p{XCQj#-#\+{XC`#-#\+{XC#-#\+{XC#-#\+|XC #-#\+ԯ8|XC#-#\+诏[|XC#-#\+~|XC#-#\+|XC#-#\+$|XC#-#\+8|XC"#-#\+L}XC#-#\+`3}XC&#-#\+tW}XCĪ#-#\+{}XC#-#\+}XC*#-#\+}XC.#-#\+İ}XC2#-#\+ذ ~XC6#-#\+찏,~XC:#-#\+R~J>E#-W5$sp~J>^#-W54s(~ p{#-;D+Ds~#-̙љ5Tsȳ~*ܙ#---0D+dsH~c #-21@G]GV#--nQHv"4 >G#-1nQHv"V (#-5Ѣ*+y ֢#-9 (/QHv# ./>A#-C& 1 *+ GTk#-G|\>4% NWf#-O~QHv#F O#-S*+Dg ݤ#-\f 7$# ݤ#-`f 74# K,/#-dE`*+ i e#-nk*+6 >#-rեܥQHvD# i #-{k*+ ݤ#-f 7T#  i #-k*+ K, #-E`*+,ш K,##-E`*+H i 9#-k*+L$ ?HK#-Qf*+,G ?Hk#-Qf*+ j  q#-w*+ #-M*+P 8ʦͦ#-Ӧ*+Њ  #-C`gQHvd# v#- 7 K,Ԭ#-E`*+;_ ^#-*+< 7%#-WxQ`(? K,#-E`*+D@Đ 8ʦ#-Ӧ*+|A #-˭*+C  K,#-E`*+4D, #-9`*+EN NWe#- ~QHv#Go  }#-w*+H i #-k*+I ^#-*+Jԑ i #-"k*+K K,#-&E`*+L#-MLBĮǮ#-&Ld d 5#-!{*M gq&> #-Pˮ*XP v@(#-@*LQӒ ' w:#-Ү*R $['[#-ٮ*TS  j#-9g*SB (om\#-1*Td j#-9g* U f~0#-* V f~0#-*VГ j#-9g*XW f~0#-*DX a8#-d8֙*X9 a8#-d8֙*Y] j#-9g*Z a8#-d8֙*Z a8#-d8֙*d[Ŕ #-*\ #-*\  p#-p*@]/ O#-*^R #-*x_v #-*p` j#-9g*` $['[#-ٮ*aܕ #-3*Lb om\#-*Xc  $['[#-ٮ*dA a8#-d8֙*db a8#-d8֙*|e a8#-d8֙*,f a8#-d8֙*fŖ #-*g a8#-d8֙*h  $['[#-ٮ*Hi+ {2 !Y_#-_*jO #-3*kq a8#-d8֙*`l a8#-d8֙*m a8#-d8֙*mݗ lR#-*n a8#-d8֙*po) a8#-d8֙* pR a8#-d8֙*pt (om\#-1*q f~0#-*r #-*s٘ M@V@Ú#-MY@*Du $['[#-ٮ*v j#-9g*hv@ %q%q#-*we  <8#-?8,*4x #-,!*y f~0#-*zԙ > XO#-~(*D| f~0#-*0} '#-*~< f~0#-*~] #-* /* #-C68* f~0#-*Ț p#-p*$ a8#-d8֙*ԃ '#-*0 a8#-d8֙*\R f~0#-*Hw a8#-d8֙* ^i^#- *ś ^i^#- *8  ?#-*  ?#-*舐? ^i^#- *j ^i^#- *( #-&\+Ċ #- \+܊ݜ?F#-Wlq\++$#- D+s0#- t+HH#- *`o #-Q1 +#$ #-Q1 8+#$Ν$__b#-xvpW茐 #- \+$?#-Wlq\++$<N #- * Ts#- D+sl #- \+?F#-Wlq\++$$ܞ#- D+s؏#- D+s#- t+C#- * f #-Q1 +#$H #-Q1 8+#$p$__b#-xvpW #- \+ ?#-Wlq\++4$1 #- * R#- D+s,r #- \+D#- D+s\ #- \+tؠ Y #-H.6#- D+s̒#(##-FHTvXC %z#-e.*蓐f(##-FHTvt %z#-e.*(##-FHTv֡ %z#-e.* <<8#-uEl`vjԖ$ }0#-Ӂco,6M<<8#-uEl`vj@w }0#-Ӂco,6<<8#-uEl`vjϢ }0#-Ӂco,6d%#-4*蚐#38<8#-?8,*sJ #-ίӯ*D$sȜq%#-4*L#-e.*D~ܝˣ#-*d~p$=#-jR[]pT~4؟]py#-#8+T$4I(=U{R#- Xqh}#-ư4Id$  <8#-?8,*8٤dѰ .3F\p~ de0\ؼ߱.Xwk`% E.Y? mK.z%.5~mtq8;.8.GfZ$U 4k.,$Upå {2 !Y_K+_w*  ~}.*гK+-Ĵδ4c`&> K+(*(`3 XK+1ȵDd&Џ~LaPܵK+J,U^xD#$Ő\m]izK+ZQ9Ixǐէ\۶K+e'ET~9ITː\gK+y߷19I(АRXmbK+4CRp̧8ddӐ[jK+Q`( [:(ؐŨ2K+ǺֺFHܐ K+0CL\5PE\$#$ݐJWjK+ ѻ$[>#$.K+3di**Д;t©]K+.k l*#$j9"K+#@l**Д#$IR(K+'E[04i@i,9/EK+8/UL$\Ϫdu~K+G%*t$#$x  üǼK+U2 0R IEUK+rgQ4DK+4$,ѫfƽK+"fg g*|>!NK+2 c\]0(w xA̿ K+}Bl! x~   *K+0nw 9I$ K+:&dLS( K+ɏXd$ K+#b<\+K+,l$#$ i$K+6EL66ЏD2U^K+du@ oxK+i x 56ЏUK+< $K+" T&Li?C$"( K+0gDbĚԚЏ58%]$qK+r +$Շ)ϯ$,MK+n@lX\+ 4H7 K+ 7]  K+ 8L*BIK+s$8:LK+" XiQЏ݉=I%SCK+2B >#/K+$>ȱ>QK+6. Bt MBaK+TTX $$ K6 O+#'K+*$8O^v+/K+.X,$O 3=BK+]RUK+~y SK+:*xSpK+ RTVp !tK+0W9 0|` ep(5\K++ Hx nճ=JTK+#q]@B- q@K+-)Џ$##$OTPK+-+@|;SP4V}K+K 0G$X 05K+pqG$P[K+4`74%G$<\PK+BB`1ų(_=P-;K+5 $h (,K+:]*(jXbK+,$eD D%o @LXK+ozlRfDG$Pq?K+t'8um%LK+MHUpi$`z$K+`5> d{ IhK+"l@3!K+(`L 0INK+ADT%T(BK+xI'hVt3 K+(1lRWgE$ <HPK+{8:ā#$7K+lԟ#$LgK+!Dx9tEK WK+]|*S K+d8?̎ K+R$Rd%G$J(&K+gDz 0[(K+ ,d|t%[̗(8VaK+l@% ' K+<4|6G$VZ K+I+*Д(+5K+ONW' 7 F K+Xo   qq\@w  }   K+nK 1 iiЏ%#$P < i  K+t  | [5DC\K+<;g ( -%K+ L  A=IMK+Q%B \|K+ZRwP1  ^$L9@K+J:@LM\tK+3iiN8XxK++Fhz y u XkK+@, d%Z K+d8X, K+;LW8]{bowK+c[&;_K+-*;_K+4,#$X`  K+ >4$aj K+4/IP,+5bgK+E`'x(5lf3\ YK+XB^ lgL-BK+)f_02(a rK+-+<B&tCPK+XT)v 8z]#$= K+?   0',ԩP hx   K+@!!!  d2  !!."K+ $%l%! #$̸%%&K+&'9' * f pƓ+l'''K+R'' (QQ@ l˓p0(C(Z(K+*()B)8ZzCԓ3d K+ x +G$,Փ,X)))K+*+?+PX246:Co+s+K+w֎ uCo+w+K+w֎{+++K+++Ԉl++,K+7,N,@P %ԊK+-B TCx_,x,,K+E,-%-)/`D-]-l-K+---*$UD--K+Ă@QX.#.0.K+7c...8CHЏtd..K+K d..K+98...K+Q"/C/T/'\25(3d K+ x +G$e/i/K+\#; K+ >4$]% m/K+YBXq///K+f///XCXЏ.K+hX 0*0s0K+6111l Џ dP42$2,2K+J2_2j2'2$&q2u2K+ 3d K+ x +G$ !% y2K+B l.}2K+$8  222K+233-`4{Am#$ 3d K+ x +G$ 83d K+ x +G$HCC3K+w֎X3+383K+j333XCXЏ.-K+D8IX333K+%!4C4`4,;D4&<Xh444K+M565S5T,`x{4Xk555K+555|PD&g"k66K+Dv l#1D66.6K+[666lp\A %v\ 666K+67"7d.(..7K+) ?7X7g7K+777'DeЏC-P.7K+ăp.l777K+828$<7t0l=8O8S8K+!c8r88|602ly888K+*88(*4P(88K+=888mmДT&I'589%9K+`e9u990m3h);493d K+ x +G$9N99K+#894|6;:}X999K+9 :):QPA;<L<:I:M:K+mm@p&=\c:p::K+:::QRA @\:::K+ ;;dAH\ ;4;K+S;r;y;BC$;;;K+;;(xd[D.v;K+3di**Д$E;;;K+;8\egF< <<K+I<iiДgGQ< <#<K+I<iiДgH< <+<K+I<iiДgIP3<7<K+~E<] >K+===$(&@Z3d K+ x +G$Z=>&>K+7===$(&p\.3d K+ x +G$]s=9>B>K+F===$(&^3d K+ x +G$@_ R9gK+SV>*<`8 8pK+#8*`l K+IO_*b  <8K+?8,*b U{RK+]>*c ^i^K+ *@dJb>n>w>K+<KP*4(&d~>5K+!{*4(e>>>K+>>>5L&#$f >l^K+AQ*4(g,38<8K+?8J8+hqX>5K+>Q diX>5K+>Q @jX>??K+>?Q?Z?R0R&kXm?KK+y??T*mZXm?KK+y??T*$nX???K+???RDR&o YY?@K+rY\+'p K+*$q> K+ \+F(.6_FFD(G,:4FFF(.J6GG\O/ q4GGG(.~1HH  HH&(.cVH* HHH(.]ZH*࿔ (.*e U{R(.p*X H(.H*HÔ ^i^(. *Ô-( HI+I.IIJ|OЏ$m ̔]#J,J.$̔P;JZJfJ.SJJJer{DU$Ҕ#JJ.Ud0Ӕ,J)KdK.tK*LWL3 |pG۔EC L.w֎`ܔLLL.yLM74);ޔ(M'[*M.(Wpߔ49M YLM.iMMD(T( 4M]iM.,MMD(T(,A49M YM.;iMMD(d(r(M."NɏXd` R9g.SV>*\p N@N`N.N O8O h3Ts$@CVO.;p eOOO.G0PdPPHTH3*X$lCP.IX@$PPP.&QWQnQ2HĄ{CzQ.8@HQQQ.6RoRR3h3 38 =C%.w֎ v(RRR.@SgS\'4uSSS.9SSXR4uSSS.JSSXR8 4uSSS.\SSXR8 |2h(&.a T*e KK.%K*(TCTT&/*gUUUXD 'C[&/Fw֎0(/.s7V:V&/e.H +G$(n4 @VrV#W&/yXXghD(Щ U{Rr/p*7 hhr/-h\+(pk hhOD r/ Th*X hr/?h* KK r/* r/mnd*D3hhh/Ihit+h+̱di-i@i/RXpiyiXaeR[`0oc0} |pT(#$e-0* f5JV0m^{l7=(gL}0xQ#$$i0fm*1(k0|qH(#$mC[0w֎$nA:P0K };;xŎΎ0 ؎**)xy0 fP]@)@|_^x0*-$}c0Ϗ**Ć0~Ŏ0؎**$) 01.;4) ,5F0Cbs4}`^ `e |0k N 0954)!  0**:!!.0aF-w! MgZ0VfL2`!m0EaxijH}4 #$h" Œ0'1D)!%M"_0B9`\P9G$T"\k0kUx T 8| ȭ"% 0BP<"E0~>T) 3# "0=T^^H##$Dm#C[0>w֎#Ԥ 00R ʘ<9d)#$$Ԥ 0٘0` ʘ<9t)#$L$( 0n,CP@t$ګ en0  heQ)5$! ^z0X64$ٙ0% (`ԳtG% I0#% M0#Ļ% %0*H & [[0w06ļD&0 *ܼ& G0Ws1G$x&0 +&d0dP4O&' 0 8+#$D]' QX0.)G$' azs0s*)ľ' shs0ss2)O(ss0st@,)#$9(Z0.4/)G$Do(G;t0 Dt\+)( l 0 К0)O–(<ۚ{t0tDtl**#$hÖ!)(^{<0 TOĖX)  0 \.#$<Ė)k0=0OĖ) 0 l*#$Ė*d01G$ŖC*0 +Ŗ*%0.G$ Ɩ* 0 *8Ɩ*k0=h.#9Ɩ8+ 0 +Ɩ|+0_4;0N|6$OȖ+ uV:u0C6vu}uD7D#$\ʖ+k0=0Oʖ+, 0 l*#$˖j,5gn0yP+*t˖,5u0u*$*s˖,Fg0L4/dG$l̖- u0 u\+ ͖R-k0\4͖-__b0v,͖-0|VDЖ.v6v0vvwpćҖD.Fg?0L4/G$TӖ|. *w0 u\+Ӗ.W JQ0 Z34*OԖ.Lax0C"x4,D*#$8Ֆ"/Lho0Cx3T*OՖ[/@xPx0J.fYx4,d*#$֖/Z0?9 -(ז/c0J.? ,9Iז0Z0?9 -tؖ?0c0J.? ,9Iٖy0Z0?9 -ٖ0c0J.? ,9Ihږ0]p0#8B,9I$ۖ#1Z0?9 -ۖY1c0J.? ,9Ipܖ1l0Q#*t*,ݖ 2͜ќ0#;vR#$ޖD2, 0&2C2R52$Ldh0* Ȱ2,0<2C2R52  ɝ0aT5p73$0$ȰD`x3(/GK0A@gDG\3t 0aveD4,02C2R5B4$̞0,\4$#;0$ȰDL4$Y0$ȰD<54u0#џdDGc54uܟ0=џdDG5 0W_*veDD5 30c_*veD06 G0p_*veDDs6$[0}$ȰD46 wP 09ID7 wP 09ITG7 wP ՠ09Id7$0$ȰDT7,P 0G;xDd !8$FX0n2D h8$F0n2D8,P 0G;xD8 ¡>ԡ0?CdtDGA9$F0n2D9, 0L2C2R59, 40d2C2R5T :$LZ^0| Ȱ$L:0z0Ţ֢wu: 0NaT5<:$L0` Ȱ !; ,00rjDdGx"R;O\`0~Dxtvpu#;,}02C2R5&; ,0jDdG'< ,0jDdG(T< Уԣ0ܣ@,4)< 0#b<\+)<$̞0,8,0=,+00Vmw$5.t= x050=(äۤ0 3G2>260NveD4F>4Wv{0%DG7>,ťݥ0= 3:>05:0NTeXDY<3?$v0^wt>?(Φڦ0n>Y$H $G(D?(d|0wЏ#$`F%@ϧԧ0ĬЏ#$dHn@, (-0Wh2v5J@,q072C2R50M@ ĨȨ0NaT5N&A$#0^$ȰDP`A("0pA@gDGRA@D0_*veDTA$#X0$ȰDVB0v0D(XYB(0A@gDG$ZB,ک0\L\B0":?0`b]$3^C$l~0C6w8`ZC0":0`b]$3lbC0v0DdC(ݪ0A@gDGfD,ک0,\hWD$l~0>C6whjD,-EJ0KG;xDxlD(h0]wDxn*E0ƫ˫0obtDGprE$#0$ȰDrE(0A@gDGtF@20_*veDvFF(F0A@gDGwF@d0_*veD|yF$x0h ȰDh{#G(0A@gDGd}kG(۬0A@gDG`G40Z/DG(:0A@gDG;H,کX0,\H0":v0>`b]$3臗H$l~0PC6wI0v0]DcI4ƭޭ0oDDG썗I,-E0G;xDI,,DI0NgDGEJ(/tx07A@gDGJ,0G\,J(Ȯڮޮ0WȺ K$l0bC6wJK4u0lџdDGlK >B0HaT5蝗K$\`0X$ȰD؟K$z0iDX8Lϯӯ0u_*veDأsL,02C2R5L$\0$ȰD L ¡ *0?CdtDG%M,<A0G;xDcM [_04aT5$M$Lx|0F ȰM 0XjDdG`&NO0eDxtvpuhN,ȰͰ0q2C2R5N( 0=ǖ *GൗN(/7;0OA@WDGܷ'O ¡bf0a?CzweDGhhO40mα߱dG O0Ss#43D<˗4P0ҳ0Gfl $ЗeP$t0rĵ$k0O*CIחP0*חP#&0:O:#$ؗP TW0 * ٗQ  ad0. *#$ٗ7Qlo0*$ڗOwz0*<ڗpQ 0( 0@l݉@ޗQ ٶݶ0EaT5ߗQ$0U$ȰDR(/0gA@gDG\R:70y_*veD(R,KP02C2R5lR:v0_*veDS:0_*veDlKS:0_*veDS(/0A@gDGS wηӷ09IT wη09IGT wη09IT$'+0l=wtDGT$H`d0h ȰD U$H`0h ȰDLU4u0(џdDGLU$FKɸ0An2DU$FK߸0Pn2D,V4u0^џdDGnV$FK0vn2DV$FK30n2D V4uI0џdDG 1W ¡qu0?CdtDGp rW$FK0n2DW$0$ȰDW(͹ҹ02D3X q0?C,weDsX$50$ȰDpX$'Q0l=wtDGY(c|0 tXYDGDY4u0џdDG\Y$l05C6wY4u0AџdDG!Z ¡q)0X?CdtDGd#KZ,η=0cG;xDt%Z$lY0tC6w,'Z ¡qm0?CdtDG(![$FK0n2D*j[$0$ȰD,[$0$ȰD.[ ϻӻ0AaT5X0&\$L0S Ȱ(2[\O 0dDxtvpu3\,%Ͱ0q2C2R55\,%02C2R58] *;?0Yj59D]$u0,$<],ʼϼ0Vmw$5>] ¡0?CdtDGH@] 0_*veDA<^ !0_*veDHC^(/370A@gDGDE^4WQV0DG\H_,|0Ľ3JD_0ӽ0/`b]$3 M_$l 0?C6wN_, 260J9NܺP$P `, 2[0Z9NܺP$RU`$̞sx0j,T`0zҾĬ$#$V`,ݾ0%Xa ¡20?CdtDG|ZGa *DH0Yj5L\a$bf0$ȰD<^a ¡0?CdtDG_a0_*veDHa,b,0Vmw$5cdb(/ݿ0A@gDGeb,0\hb4W#0DGk8c$lKO0*C6wlc,c06\nc4W0GDGrd,-0#G;xD$tRd 0BaT5ud$0S$ȰDwd$F 0en2Dye"&0s_*veDT{?e,:02C2R5}ye(`y~0KlYILe$L0^ Ȱe$0p"D3@*P.{ p0#8* e{ p0#8*{ KK0%K*{ '+0/;*%| 0/*h&E| |ff0f*p(x| Th0`]h*)| @Nh,x0*+| 0mnd*,:} KK0%K*-i} KK0%K*/} U{R0p*/} ' w:00 *(1} 10?CC*2%~ ~}0*T4X~ |ff0f*\6~ JTK0* X*9~ U{R0p*9~ 0*;" U{R0p*;K KK0%K*< U{R0p*= v^a0;*> |ff0f*@ Th0`]h*A> Th0`]h*\Ch 8AD0_*D ' w:00 *È KK0%K*F 0mnd*$H* h0?h*|I[ 0/*dJ 0mnd*Kǁ W0X*TM gq; 0f*O' KK0%K*PS 0mnd*Q U{R0p*Rǂ |ff0f*T !NN0NN*`V* U{R0p*4W[ FBE0Um*X U{R0p*Y U{R0p*Z Th0`]h*[ KK0%K*]N tt0*_ 0mnd*4` W0X*aք )OLR0m^< *lc W0X*,e- W0X*f[^{<0Dp,5g t~z1\<*ią(8z1qXm 2ЏdO$n1 z1!n3| z1C`xЏ*SIsd z1Eht|z1ZQЏĈIpvԆ'z1\w|7P~z1hxЏH+SI |G8z1j| <H`lz1}lmЏ$A#$z1D(1z1PW(WCK4h{z1$ m<2C}4h{5z14 mX2DX4~z1E(3mX2\D ވ Q^z1V?8F-#$ԍ  v^az1;*6 KK z1*^ n1+*$ ")1d8~30-*#$Ԕډ:G1Wh+*#$̕$oQ|1|64b$Q1F (1# 1)8Ap6=Џ#$׋Xmp1 ̛,1#m4'<H1,( ,;1-Tkxm dX1%(D ,1&Tkxm ĥ֍ΰ19ܛ4mx )1? **j*XH) 1; **j*8Ǐ -11Fc\+PŎj{1,̔| #1M 7491Sw֎  !1W18*ANW1](Xĉ>@1zRRЏD)5غ1&ap*콙 bw 1B `[1,1(Q|]1w֎ KP ]1?'H4 |`͙#1͙; 17c,*XΙ3<D1:T,++5ϙГ[lp1L;4Йl1dT<(ҙ[1u (/ә1}s7+#$әԔ!1d818D++8Tԙ?1d818+$+8ՙ`O[e10uיߕ 1DLgt8?6t#$ؙ*1\ m4+ڙm "P1t((| Hޙ%G1B ޙ#6@1ԩD+M 1 )dF +/1GXpf jЗUcg1y ,%Gk1Bnos1w֎ c+w{1+|Qtb#P 1-]]T+0e1hRT} D1(at()D1,;p=,14?1D(()56Џ$<Κ 1F7JDx'48+IX5oanr+P5$›0+$H5S )OLR1m^*D gq; 1*|ќ ENQ1J*l KK1%4*W e/1*04 d+~F,_ '+*EQh+>$՞;,ƆJ'Qdk66pt+>$#r{t++d;,Ɔ4654+X+ l*W e'](6+WG  (ENT\+*j#ae4l{*+to +e.V* e']*+ d.** . 1\++ o ]@f]1.Q*)  1HH* z1GH +)0 11HH +L s _,H1H*+)  23H1H*+ :.1H.+h=1 II+4 :C1;LS\.+dŦ  Zc1lsE4,484z1gjT*h\4  1j44`U{R1PR $ji4V_14$jS:Hh1T*i(HKK 1Sר _,H1H*,) 23I1H*$,d a81"Ivo,] 77:15I@I,6z1G +;1HH + a81"Ivo,]PЪ 77:15I@I,6z1G +$f1HH +@ a81"Ivo,] 77:15I@I,64K\/1qIII:4Ċ)<(1III:4Hڬ:.1H.+1 II+4$]0J7/Z1JX0V_14X8D01,$:D))o118 ^{<1D,@Ю n 1,p47/Z1=L0juC< e4  ?1QX0j% i^1Idr@,4!1HH@,P!N('$['[1%KY)"(]js2a$)TX4,mF#2RW,$@%.)326nD,s)sC2?w֎)ñ( 2O$)QmF*(23TUmF+a 2'BH-(M^a2 b|mpmF.2,S:|6T,;// 2*0s 2*01 ^i^2 *1L]3'&8HH#$3NC[ ]33w֎l4 1:]3*e|>4d,$X6H]3@,H8]3MǺl74`9]3Q4K/$ ; B{<]3F' *;L B{<]3F' *x<%]3E@/9<Q@f]]3.yq\+=8$O8{<]3DHj0>X8a8]3d8o8+4>ӷ%]3E@/Ud?(Q@f]]3.yq\+?$O8{<]3DHj~@ԸX8a8]3d8o8+4HA+]3 *`A ]3/P*HBʹssti3ZttohIU_ci3-*O D i3@#$ Q ! i3HAPU#D S̺ D fi3#d dU ! i3APU# `W(i3r~44G$]ki3A ; +G$` Ӟa8F`i34d8\+aL`$V`i3'8``:44dB #aEaIai3abb84k(`bmbqbi3*bbb+Qt,4n$C\i3Gv`R Lr4b_bi3W@cecjcċ uԽ de}eei3eAfKf<[pT ,y_i3 0 ,{@h3hi3i4i=i,,,vh~rDi]iaii3>iii@,&QȀkNki3ckkt+́ llli3.msm~m84臚q "i3:(pU#(T -i33\+3,no oi3ooTq` oppi3pp `Д,pqi3j5qJqSq$,TgE 08KOi3{ <$ TgD  0i3\+,0Etqqi3qq6ly i3W4#Lqqqi3qrr-Z,6 0(i3 \+,tq!ri3 qq68I 04i3- \+,$tq-ri31 qq6` @MQi3_ &9U0 $,i3j <j4+6Ě Si3 X[ ǚU(9rRri3 rrrhq̔,ʚ "/3i3 l4` (К s5s9si3 sssS(46՚  i3 03\+T֚R i3 03\+֚  Y,i3@ $enX6LTٚ i3U GX(odۚ(i3a d ( :i3 X6Ld d 5i3* i3&\+p i3&\+  i3&\++ i3&\+D[ i3[.\+- 8pi3#8* $['[i3*$5k3r|" |(  L,OC[k3Bw֎ N`k3c8#$ Nk3r8#$(@ ^i^k3 *~33<*-hKxT39#8_`-l$fs3:~$<47)l3;*3T**$s,3 cVYj|$-( b723*BT ;rv3"JI)Џ+t%a(3$B|(3Q CK, #$ r}3$D8/3 x4-]B`Zu3 -lu*;443QSZe xD-]BZu3 -lu*; s8tK3,wT-]B05j93@ 8w3d8h]$d-T=8 W3%DD @8\(Zu3 -lu*;( 3kX\3g3 |L,+)2}d3Sl! *4*P]}3@-]]t-*34D\E$1,"7[3t3d[51ZE3ƍ *t6b'?K3kH>-83bpT#$913'x,+K6<Z439i8 u D X} ]BN Rz 3H!:OPHh   3   77-[U]  3.'V  3/#-@$W#  3WS    3a. ,V3,$$Y%7 ; 3BY<`? _ i 3 > ] \8=-*T\b(qf j 3 =W^ bNSp  3@[c:t Fg<  37KVS}Ij4  3G֊deImH   3SnI@|fq+3 :IN$-qP4Y3", +]BvZu3 -lu*;w\(7[g30T-^ H{ 3<[*d|  /3,=dK7,~$LX3p3DJZ3lH7Џxp3tK<R33DZ3lH7Џ̄B%3V E.*-P|_5<3xL*  '3q*`Um4lPPAs@*4#GbnA mt4%-]]-0% Ð4 BI}4Hn83Es44YGbnAЖmR4[-]].0PA% \4VBė `k4;/.$4%~ k$R;ܚ5 4:ǺGP@4$.w `[4R;/4.${4_~ k$RČ; 4tǺGP@4D.w$mm4j0-;I4E[09<4+E H4Qb65|N4 k4w֎ n4kkT.U;ئC4 4w֎T+"4*aj484d.;z4K @t.;U,0/H%4$cz<,N%41@%49(?R S.G$phGYd%4OZ4)s^%4g <^%4l <0. %4s#Xw %4w#, 5%44 S@%4+&eD)eÛv%4=x*|ěv%45x*lś!G%4Q@,ƛdG%4V@,ƛ {!%4$d`.Gț d+/%4#Zqzd`.Gɛ5,b%4.(.|˛| %4>j&*.;̛?01A%4FjW^*.;PΛ i%4o+8P<E#$tқ W{%4"1l<E#$֛NS%4&eD)eTڛ4u%42ۛu%42ܛG%4@,Hݛ G%4@,ݛh%4čߛG)-%4!@,DG)4%4&@,>;Lk%41TjpTF4, Y %4E =!T!4SЏ , s4%!%4WB|tn !!!%4z!" "076Џ$D"'"%4|7J$x 45"F"P"%4e"x""076ЏD8O""%47Jdx """%4"##QpT\Fh t8#M#W#%4{###t,T'6;"#%47Jx t8#M##%4{###t,'6("#%47Jx= t8#M#$%4{###t,'6\"*$%47Jčx 4:$P$%4/Dx&5i$X66d+z$$$%4E$$QQ#${$$$%4T %$%#$$/%<%@%%4kN%|64$U%Zf%%4t%%T)QFd` 4l %4:q* %%%4?#l%%4M#<%%%4U X,$L%%%4]*$d8%%&%4a&N'o'OP C R'''%4'' '1(6(%4|(@,*$(((%4#()t,08)F)K)%4 _)|)HST))%4.\1D)))%4d8)1D1)))%4 d8)1D< )))%4****`jd)P.4 (*m*r*%46*D+A<7,%- vq+u+%4{+.*%|+++%4m,,@+,,,%4 ,,HA4#$X, ,,,%4--$-N"-,-%47-H-M-*..T-a-k-%4$#8hx- +/;d/---%4,--- 0#$@13"--%427-H-M-*/1} /-.%4**)2..B.%42../\SpS,$(9%/5/O/%4R///$D;M///%4aB0e0~0FX?001%4q12?20 cdЂ Gz2~2%4#G%Q/22%4///\VQF4Jh `2%42##`J 222%4!f'3*\1D`L .3q33%4V#4E4p4\r@U444%445ljW5hY5'5C5%4R55ܜ$/[555%4r616ܜ4/^D6Q6U6%4w66МmP` %$ %4B `S666%4666=7D/b 666%4z&74c 17D7g7%477704!xD4i, ]77%4-c*is 8888%48880p m 8939%4999xjQ8,Cp99:%4 :@,qA ::%4":@,tr$A!:7:%4f:*dG$sy:::%4::;Tv  <8%4?8,*4wB %4mnd*dx d 5%4*@y 3[mp%4Dx<[*z FBE%4U;*T|] ENQ%4J*D} B{<%4F' *} {<%4;854~? d 5%4*x IT';Q;%4~;;;644p ;;;%4X<y<<@ ЂbF <<%4<= =Gz0T=Z=%4===t)j셜0>>>%4;>Z>Ȉg>s>x>%4>>>T/Ћ>>?%4$?;?ܔ'4DF?Y?f?%4??? $\d/TZq0???%4{*@E@P@ n n\t/TZh0X@d@@%4q@@@4nHn\,'H@A"A%4h>AUA^AjP\,'|0uAAA%4_AA\n '0AAA%4NAA nTZ  B>B%4;MBpB}Bȫ/1! BBB%4BC C(=6/##C(C%4>CMC*/$$8XC`C%4CC*ࠜ%CCC%4CCC9D(&0DDD%4n2DEDJD4/P(UDbDfD%4e3rD5ܫ'3)0yDDD%4JDDD@ܫ'$,0EE)E%42oEEEpn0ܫtTZ-EEE%4'F8F?F|Q|d/0DFFSFXF%4FFFSP\GeȮ40FFG%4z=GzGG`PGTZ5DGGG%4XGGH</2P\70uAAA%4_AA\n '80AAA%4NAA nTZ|: BBB%4BC C(=6/>#C(C%4>CMC*/(A0yDDD%4JDDD@ܫĎ'DF0EE)E%42oEEEpn0ܫTZ œJ0FFG%4z=GzGG`PGTZĜpS4H)H-H%4>:HIH22PŜT@NH ZH%4X^HmHjCƜ4U0rH{HH%4>-CǜU]HH%4.yq* ȜV{oHH%4.\+ȜW{oHH%4.\+<ɜX,HHH%4HH,SʜY,HHH%4HH,S˜Z HH%4e.V*̜[:.HH%4J.U.*=,͜\@HHH%4H IjSCΜ],I4%4{Il2CϜ^,%I1I5I%4q9ITI\.S=0ќ_:.HYI%4hJ.U.*=ќ`,%I1I]I%4_9ITI\.S=XӜa,aIjInI%4NrII2C(ԜbI5q%4;-c*Ԝc II%4e.V*8՜dII%4'*T՜eIII%4IJ J\+*(לf{o J$J%4.\+לg,' (J4J%4wLJcJ,Sٜh,HzJ~J%4nHH,Spڜi:.JX%4eJ.U.*=ۜj,JJJ%4[JJJ8p\0=ܜkJJ%4T?8JJ**\0=xݜl,%IJ@%4J9ITI\.S=ޜn,aIJJ%42rII2CߜoȪ %4'-c*H pJJ%4*[*$q@K K%4$K9 j0r,aI7K;K%4zrIIjC=s?KHKLK%4`rKK+h+$0@Gt KK%4A\+40pOuKK%4>-*D0YvMKK%42YTY\+T04aw_KK%4#\+d0llx0K L'L%4{LLLȻ46DV$?{LMM%4!`MMMSS(-`<$MMM%4(MNNjjt0S #N,NAN%4TN\+0 z%4e.\+dV QcNrN%4pu\+0T %4*z%4GH@,G$p.%4HH +|_zH%4H+0G$̇ 2H%4H*0$:.%4H.TFj%4 II+4( NC%4;LSj0F   Nc%4lsE404x_<z%4gjT*F4  %4j4<`U{R%4PR kI g4V_%44$jSPh%4T*I hHKK %4Sp_zH%4H+0G$ 2I%4H*0@(a8%4"IvokSg 77:%45I@I,64z%4G@,6%4HH +g(a8%4"IvokS 77:%45I@I,6z%4G@,6dk%4HH +Î(a8%4"IvokS0 77:%45I@I,6tt\/N%4qIII|;4dG$|Ə(N%4III:4 G%406$e%4 @,< G%406%4 @,I$:.%4H.TF%4 II+48J7/Z%4J k %60V_%44XL0%4, D))o%418< B(^{<%4D,k  n %4, <7/Z%4=L8k @4  ?%4QX0j%<  i^%4Idr06 %4HH@, M &NN%4/?FX6`71 $#%4FHblܕ %z%4e.* $#%4FHbe %z%4e.*$#%4FHb %z%4e.*4<8<8%4uElbY }0%4Ӂco,6͗8<8%4uElbYT }0%4Ӂco,6 f8<8%4uElbY }0%4Ӂco,6x4O8{<%4DbZ$BX8a8%4d8o8+4 6 NN%40/nM \+*1ޙ %4&\+P. NN%4JN-$1mD NNN%4O.O5O\kW41mH՚ d 5%4*$ d 5%4*`  <8%4?8,*ڛ {<%4;854`V`$>s_```U5aaa(6.liaabU5bc*( nD9cFcgcU5!JdPd*$ {sH7/dd\5bd04Otdd\5hh/:4G$uddd\5qd44G$Lvve\5w$G$lv1ve e\5y$G$vk ee\5{.e,G$w ee\5.e,G$w'e.e\5Fb4fff\59gQgrg HsZ ,ggg\5(lgЏä,ggg\58UgX8gg h\5Bkh{hhDr8\HsZ ahbh\5bh@6=T(hhh\5kOiVi*;˥mi{ii\5& kBkHk* С0kkl\5mmmd>, L/ nn"n\5$kcknsn>t1Fe{nnn\5L[nn*dnn o\5ZIoNo*e$Φeoroo\5mp$p.pSQ 4з Ypfp{p\5q)q;qt>>x-1,[qhq\5qq854ȽRռqq\5qr rR} H.r?rBr\5&ertr<4˨}rrr\56dsss(64,! 4ĝ=hs$t\5Zctt ǝxvqtu\5lquu*$ǝ%u.u\5q=uPu*DȝYufuu\5w9vMv^v>>8!ʝ,v%v\5vv*4˝mvvv\5w(w-w*+̝8wYw\5www ΝE ww\5xxx854 Νӫ .x7xHx\5fxyxx$[oTsϝ   \5#ϝD+ \5#ϝ+ m\5#НǬ+ k\5#Н+ \5#(НD+ P3\5#8Н x\5#HНȭ]x\5.^#Нxxx\5xx;pOѝ>(xxx\5 xyy|R1@xӝv,y'y.y\5/Cy\j^y|1)ԝ Leyly\5@?yyD14,֝ yxy\5Gyy(@444םi yxy\5Pyy(@44<؝  <8\5?8,*؝6yy\5!zD+H#$0ڝ3@zIzPz\5Yzt+1ڝx `zkz\5?<[R1Lܝ \5L`*ܝzzz\5zzXR1ݝ04JR9g\5SUkuޝlzzz\5zzD+d#$ߝ@zIz{\5Yzt+1 \5L`*@)@q {5:(<3[{{*{5!C{R{Y{*H6 j{q{5+~{{{*@:{{{5?_|&|Tm( sGW|c|v|5TL/||* r||}5^ "(6   ;Hۀ5‚΂*l sX۴ mz5+*8s 3@n5dP\P+#sA Ӊ5P+(&ss~x5^^(6x Ō5-9B$>Xs(0ڵ Ў5P+s9  5b -\+1p:<0>R5:ǑQx@)45cr@P2#$Bcl5/*sCU’5+h Ւ85Ot$Eޒ5C  \+3|F= 15JP[d,Ik$Gu5 vaa`~3pJB=]5  aa3`M5+x b G$R>5iqq854 Svt(E5lR8, HUΘ5y#<240W*.M5* PZ_řə5˚* \,5(|=B2I l^λ,U^q58 2ĐI ` ɛԛ5H +\Ira0 $>05j@O*DcuVbe5s*$2d5!.E4gq[.E5*`h IUY5}[42sj IU5}[D2sl ͝ѝ5 [T2soU&3@5aٞ(a*-52AW>PvKJVo5P Rd wϟ(5  d_y!vq$56quu*\zc0=5<9vMv^v>>"| !5Rw(w-w*+$}4@S5Wxxx854 ~ .xu5^fxyxx$[ots5e=uPu*$9 Ǣ5k*4L]5www N[|5֣X6|6 3} . 52#k!53.,$$E-54 -gTG0<K55buz#TXvw56#57mƤ>4Ds %54*tC Ϥۤ5*I{<5D+d.7B5SMR,d2` YY]d5k*t2? r{5D+2#$Ď{5  * XXLJ5:*lXl5=*& &5A7(*촞_6< ?5RWny*d45gΩݩ542 5A8 gpTjpT24K{5NЪ۪TjpT245$/P24xZ :5*2 :>E51S,pCL*+2$kX@ S5u* 8Ybo5*24ɫЫ5p*24  8AD5_*žB"5UFΞ{4ĭح5p$>.sZ՞8ͮڮ5&G[r|X@sZڞ{5`<-=THܞ? 5#dܞu5#tܞm5#ܞk5#ܞ35#ܞmP35#ܞ5#ܞ]]x5.^#Lݞ"xe/x5xx;pOTޞ_(5 ү$43@, 5029p4$3)l L@G5@?yyD4346 ye/y5Gyy(@44 ye/y5Pyy(@44  <85?8,* z]l5zzD+đ#$C@z5Yzt+D3L 5L`*65!zD+I#$ @zϰ5Yzt+T3> ذ5?<[Rd3<z 5L`*z 5zzXRt34JR9g5SUku* "5 0*(q )50*x 0?5X_P+s nu5"P+3st5 5*P+3sı50ٱR*34i555*<R%05:Kb*Jw q|5@*$80 ?5HŲ̲*3BӲڲ5O*3n5o:MR*3]fy5dz޳*D 5"1*4Y6@D5ôӴ*4Tٴ58*4 шɵ5X*409 5p0C*4@H4U5*4 5MöP+3sL gҶٶ53 "5· -\J=Na5Ǹ̸#*5U DF5s {*dH5} {4*4Lu;ÚG5kv*;;Ú}5kv*;T5d#5Ĺ4b˹Թ߹5NL *$444G5Wq*D4h5mƺ\>#  55żLdr p) COj5ʽ H5(6D44hn :5*h 5(6 j 5Jgz(6T4lf5*.Tm5 *tm ,75FMP+ĒsxnX_5&l{*d4nW t5/*o  5;P+sHpX 5D%8P+$s4qENQ5K2 g*4,rENn5T2 g*4$s@EN5]2 g*4tEN5f2 g*4u5o*/u5w *`v ,5~FMP+DsvK t5*dw, 5P+s@xz 75%8P+s,yS\5P+ēsz54/szEN52 g*4{.EN52 g*4|yEN52 g*4}EN52 g*4~ EN(52 g*4ZEN>52 g*4XT5l{*t4ENd52 g*4 z5P+s [5* iX5l{*45#*$ ?26G,*|7 ?:6L,*Ԅ} BM6Q[nu*4 ?6V,*؅6[W R$H%6bX6444?6i R Rd%6n18l74D&ASZ6sny<9d4tS6~ny<94469Zu싟? ڬ 6 55*P 6D+#$܌hz6(;BD+4#$[IVa#6,@44; #6; 4D4/;F#6Rfu~GĔSG #6`-S$#6s09(644`@LU#6|qSR9#6*$y #61DM5DLZcn#6Tdԛ#6PH=#60;`pJ؞oL#6#bRt+HWip#6<944Pi#6<944Xg v#6P$x v#6P$#6#D+X/#$.BOj#6,54J#$o4#6m9Z5u8 #6Jerd  #6#<0#6#Lvm#6#\k#6#l#6#|DP3#6# $Sx#6#j#6h#@Z,#6$بR( 2#6 |R@(,Y9#61|)P "#6@0h.4P CU#6Igx(@|64ha #6Tgx(@|64?6Ĺ5˹Թ?6LL *$54Ȱ4?6Uq*41?6kƺ\M6`*t<)6qԝ44L) 6< 57 #* ..5y6 .*81*  6.]~P$ `$Lt*{o,6FZ**$ !+{o,6JZ**$P+{o,6NZ**$<+ e/6R 7)D+ 6`**6+ O8{<6D$-Mė,X8a86d8o8+4t@," [[6w,$p,6-c*p, O8{<6D$-M,X8a86d8o8+4̚- 6`**68- O8{<6D$-MLf-X8a86d8o8+4-" [[6w,$x-6-c*- O8{<6D$-M'.X8a86d8o8+4TY. 6`**6(. O8{<6D$-MԠ.X8a86d8o8+4." [[6w,$/6-c*K/ O8{<6D$-M,z/X8a86d8o8+4ܣ/ 63<<[\u6(/6+̥0 n 6+470CV6yuz*)ئd0^685406+`0 n 6+406Ĺ6,1 n 6P+6s 1 n 6 P+6slB2  60*2  6$0* 2 j' * 619P+sl3. ^%gL66#|S3. ^%1 6<#355 6DE *D誠}4L W 6Kk r *\P5   6<   *6ج5   6E \ a *48&6?p w 60  *d6   6?2 B H P+ s6k nF w 6j  *4h772 6{  *4|7   6 N*4x7   6/ *4|8> I M 6 % *de8, 7 ; 6 0*Ǡ87l@6/O*Ƞ8T`k6(67<ˠC96C,KP(67͠9[i6e=U^O4=Ӡ9 |6(6%H֠$:64CH(604Hנ:[du6*\06Odw|*D74Du>6V*T74>ex6_*d7LS?ex+6i*t7?(U^6JIr3'?w56\-S-@6iI(6474@6s *74DIA,#6}U*4A,/6U*4tA ;D6T[*7cBdq6<DG$B 6U4EN@47;!C(Yfn6j7'lC6S_k$R#$~I8E6e >$R9II, 0[" 6v4 K @49IJ R 5_ 6m ~ (@44nJ R 5 6m ~ (@44J 64CH(614XK[d 6(\)P(U^6JIr3'?oPw56\-S@PC%6iI(64T84xAAQ[%6s *d84BQ,#6}U*4BR,/6U*4HCUR ;o%6T[*t8CR%q%6<DTG$F`S 6U4EN@48;GS(Yfn6j8'KS%6S_kU 6#\U|U#6#lUU'6#|U V+6#UMV/6#UV36#UV76#U+W vy;6P$UoW vy?6P$UWkC6Ml74VWTm&6!D+#$X@X6349D+8#$YX '[@6AVg 74XZXkn6HMl74ZYZ,x6N$[YY ~'[6Ro7.4H\Y,6Y>$R#$]Y8E6e >$R9IT_;Z, 0[" 6v4 K @49I`Z R 5_ 6m ~ (@44|aZ R 5 6m ~ (@44Xb%[74CH(6(24Xc[[du7*\$R#$Hj8E7e >$R9Ij, 0[" 7v4 K @49Ij R 5_ 7m ~ (@44ԧ5k R 5 7m ~ (@44k****7 E+\+c+*2<lz+++*7)+++(6쬡|l G+,*7;,,5Ěsl ,,,Y,*7 _,,5% ?mF7 , -*7zWX-c-ԈD tm-- .*7#...PP`m/&/Q/*7:///(6. m)050P0*7{000*+3칡n0*7!00(69{n 00*7)011{9sxn&131F177 111*M.o111774$2G2N2(6D迡o G+]277F,,5sol2x2277 /225( ¡Mp,353r377333Ԉ:D7ie. t+ܡuD:Q:D7mǺh:q:pI4dݡu z:{:D7w:::48v,:0[:D76;;`4#$vv%;.;G;D7;;;$g$RNtv8;B;D7<4<A<\}̔9Iv,L<a<D7<<<449I:w <Ú<D7<<<VhV40w =/=D7-=D=M=| Rě4w X=e=h=D7w==\+xXx7ND7)*HxXx7D7**xXx7D7+*xXx7=D7,*yXx7zD7-*EyXx7=D7.*y v=D70* y v==D71*@z==D739l74 Jz'==D799D+d#$z ===D7D>->R Rz6>G>R>D7U0]`l>D+:#$zmw>z>D7`>l74hA{>>>D7f;>4^pI4:{ >>>D7p> ??| R$:4{,?-?0?D7}J?S?`44:#$H|Z?l?p?D7?? 0X8|8???D7@'@2@\}̔D:9Id|,9@Q@U@D7@@@9|D9I| @@@D7@@A| RT:4} @@AD7@@A| Rd:4`\}IXgx7~*t:0}"-x7NTqx* X}x7Sȭ*~ x7^=Za* I~vx7mͮڮSQ$ 4T |~Tx7 5* ~Tx7 5*  x7L/ P+l-Џs;%2x7HY*|`sx7"5ąПT $lXwx7<qD @ x7aٱ*:pO x7x@]D+sLA*AnA7YCD= lEE7*E9E>EP$\N$ >tME`E7sEX/$>(EE7 E@E## ?R0EEE7h/E4>hVK@ O8{<7d2`4AX8a87d8voX27A,al^7L/W/|KB&Fg7L1dCXi^7 .sDEEE7h/1QFP+ s EȂ:7dU/Et,7tP+s8F5 7\+FjZ7CH-MxGc7J.f@,4 H$<87?8l4lRH }073co2IP5(F+F7- I} K,:n4KKWKhK7*KKK:Io@KKK74KK LлDW(sDL$LU77_UUU}}iдؔ4UUU7IUUU4:D:U8VVV7RSVxVVT:D:t i츢8VVV7_VWWT:D: i  $W'W7qǘX6`7໢4 b ?7r 'p*Tj+W7W:W7sFWYW`Wl7tED;! gWrW7wL/WWD+T;#$xܖ $WW7ǘX6`78 b W7 'p*J+W7WW7FWYW`Wl7tEd;fWW7WD+ #$ W XX7('7/S*/>K('7/S*/?%74*8@('7/S*/A$ww[[7Y1 [h4>*A*Z'Z0Z7(@ZEZ*>B](%7}*0C ]@f]7.Q\+CĻ \e/7MM\./4D  \e/7MM\./4ESQ7SSt+T*Fg1 __08_HG@__08__ĞHݼQ__8z^I__`8`#`J9(`+`8`Jc7`>`8G`L`#Jʽ7`U`8G`L`#hK17`^`8!G`L`#$K7`g`8(G`L`#DpLop``8,opp\ON``c8)ll*L,uDX@ :85*upX@ ϟ88*utCp8<[p*`vPpa Yp8bop~pp*$>,wppp8sppTjRd4yApf q8|9qBq844>4zhIqUqXq8rqqq]QD>4|qqq8qqrL84T>~$r#r'r8Pqq4Q4Darrr8#rr@,h34<G :ss8iS,pCL*+d>Їo '8*M s"s8V7M HM *8scss8t%u;uD Q uuu8_uu$-\ R vNv82S S S lx~ d 4pvv8<vw#w g Rt> aG*w9w8?Xwkwtw9L4Owww8Pw xxDwPw44x 3x7x8cOxx*ؤ$%Ԋx8'pXQ-L$W xx8W -XK$W xx8W -d{qxx8=x+*>G$%X xx8c7X HX 66H+`xx8wq+G$ĩ[jv8#ԩڬyy8 5*8j y8#H*@ yy8vX ,XhH}X yy8X X F,xj#y8#ڬy'y8 5*쬣% +y.y8#l@X 2y5y8X X к,HX QyTy8%Y 4Y F,T pyyy|y8yyhwQF豣 yyyy8*yy,`F|I Y y z8BY Y Z ğFXڬy?z8[ 5*ڬyCz8\ 5* ]jGz8](Z  *|5KzNz8^+4oKzRz8_+4 vVz8uP$  ՚Zz]z8y#bwZ P$ $ vqQgz8yZ P$ 70Dsz8F dQ@H  yz8*d  }z8*XZ Z z8oZ Z Z pQ>ܺzzz8%{{{66Џ{{87Jx|Q\ {&|8\ 4] E] 8>T! Xƣ%|8B|ƣ||8] ] ] $|ǣ>4|| }8}n~~ԐHlxh ңy%8B|8ӣ|~8] ] ] Dӣ{~87JdxԣK2` [~8 \` ` |Q4֣ˢ8`@W74 أ^kn8,5!|٣T8DD|e \u8 $,dxRO; h ey8h h h `pDh h Ƀ8i 1i i i 8;i +W l 1l 5l 8)`l #  8Ua##  l l (8oml #0 4C8E V (66x g \q8 LDPD  8$#b *! " 8+f } *\P]8h̋ߋ0(| P(@"0=v8'ԏR3 %~$8M87.KXRRPd( u822 O \ RRP* א8-g 54Qh-Y u8*2 O \ RR\Q/=H8?8e l 5 5Ġ0'Za8%Kq5l9 >P12 ux82 O \ RRQ3} 8L/‘RtwD>4 u 82 O \ RRQ7 uɑ82 O \ RRR9XCd8y* **>9 u82 O \ RR\Rl<Cd08y* **></<In8֒ߒRwh3?x u82 O \ RRRB  uE82 O \ RRR$ESCdt8y* **>E 8g 54S0HCdǓ8y* **?H)c#ѓؓ8#8u 5$L?dIq8m RR\SKCd18y* **$?\L u;82 O \ RRSNICdj8y* **4?DO t8g 54SQCd8y* **D?PR Ŕ8g 54TTe u 82 O \ RR\TTWCd;8y* **T?W uC82 O \ RRT ' ܤ]jm8L840ޤ 8 *4,ߤ;]j׮8IL84 8Y*4 N6I8Ft}-Sy8kNiypi |8m RRX'8%Kq5l9 ?5!8ARY50L $h}8ɴִRR\X8'5@xDG,>A8[n5LG;/ gu8<P *Sܒ0}8?85AR 8:E*Pi/ h8/ / 5`Gܒ b]8*c 8:E*'8x%Kq5l9 @ < 8z2 O \ RRX(@ ֵ8u2 O \ RRX{8S4 4 xG$hI 86l 4HTh0u #8?  * -bYS6A kn8_E[m 4xx8 t(8l-334 S\$DG8*$KX\8<{w'+ǻлջ8 F8)X %Y8:**d D-8a#X.%W8+# 0ٽ8%,L7vANQ83]44G$88dfi8\+\828*t8<m8*8qt8\+8qx8\+8q|8\+9g bW8 *49ߞ8a |*@:ߞ8a |*:CP8ƿ*4;P˿8ƿ*4<P׿8ƿ*4=/h83#(\>hh83#(>c 68} I Q *t lE8FWoD hM $['[8 *,N $['[8 *N  8&\+OL 8&\+(P 8&\+P88Z@\R88Z$@S<   8*HTv :*;BL;4$G$UQ:"[ZZ\ :[B*H-4@]X9FU:cmt84D;^3 :.-9*D@68_84:.&2 `9\Y f#JSZ:]j +T@lgt :f4 io0:s~lRR G$q; :{ZRG$r64: MZhD)u$:.KXRRYHx :q }W .S:L(TG$27by:Cp|dT!%:eUd40G$X ! n:m#8r$w0:B%0hkQ4A܎a$M0:ZP; |/ 5 Wi,X0:eR0: L\d@ tG-0:Spld4H00:hX644 \4:4tk@TЏ'yo% :6B|:J66Џ[:ĩ0% :LB|8R :X,kQ5H% :ZB|W 5gB:_N]8?6#$% d:aB|h:fE95r.A: 4V( 5: ))ЏY#5D#':7Jx켥5B:E},0 5lĥX!:,-_ƥ&  (5C:Mġ@̥t +:L } 5ե{ DQZ:8Ht@5Lإ :OVf64ϴڥN  ! := " X" d" ;$fBH<| (" :W# # ;DfBH8 $# :R$ $ ;DfBHG  $ :Z% % ;dfP $Kcic:ccc, (% :3& ]& g& ` B":n0-XN' :&' ' ,  ' :' .( ;dfBH m C:* C:* ytP 9 NHkǷ4#9h@l%=Gg~OP@KZ%#b01#;X& !T*`*;L'L(Sa"̎d]$.q.?:4#l. 9Kf44$ F0'T,44t2r JuPa  97V \Bc,/gBQ4$F CXk$ ,=f 4Y^gj+[rx*TZ%uy(BZ}!O#*[;*-'B#\rzze.9E#\*-'B#]7 #]7# ^NO##^O#$_Cw֎`Q:U@tc7#dg\@d~ e%zm\e.w5 5$d,~n]D=hO ^y/',54mi10.GU]d0ncO ^/',54moX{\ZO|tuP P;,vZ]9ZO{:Dvp|P P$}:S`|da^P kda5Fă:S`|daĢ^Ȇ8Nv Km̸4 c_*@;䔦. "m+2*Z;gkAPs/G8d*;op@#$( =T[85[țNnz,P0 +:0 ` Q]drD5@@#$+\[Rnz,P0$  +:0 tnzE,P0D Y +:0 DX  Q]rD5@@#$ +[  Q]rD5@@#$L !+[D!!d!,9Ox494Ħ!!Ʀ",9x49˦H"!ͦ",9x49|Ҧ"6;FZmtP5HFģPԦ #8P+TئJ# !/BI\5P@#$٦#P]kDP\ݦ# [ h5t5Dݦ#*ݦ9$W%#pަg$$i$` \" 4$C<w֎($CG*1w֎ %oe(wZ 7A9%>HWliPP(%s5T p%'1jz *H F'9Fah  d'1Bh;\PhP ,$, (W%5#:( z(<#L82 Xhi %(xeitPp%/) o.xl( = ;/d)ѝ(Z {j0)4(=l=6)F% **A575*%5M_|PP$:|*1dm\ ( @N+=A,44P%,W1JPPWn,enxxaa$AZ-d X[R-< l 'C   t5 i-k  Dvj-   i0 K ^ ]D$ mI.^k { P L 544An.   } 4. $p.  H   >  d) 4|y/s      P m |B/   9J=d~z/S_gwЏDA/Џ|E0  ha!$܄064@Zmt5HFm0 T^p\5\FĤ;01,P mF̊Y12IRP+\\Ѝ1cP l1$}  $D2 -:NnP,\|_2 -` P2MZsPH55H2 3di*;$3Ƿ#R3G23=J#3Џ 43Ƿ^b&#3kt+D ` 4 2} p k4 4hT43;?OUh5(4%8KLB4C Ew֎ 5qa2aDkt;C5GTlo(&5Bhħ5C kw֎ħ5q2ak;ʧ5GT'T&5B4Ч26C Ww֎Чr6[hq8 ̀ !TAIԧ6W%1C#<է6HpU  4ܧR76$+P dAݧ72>H<i܀a tA;8(8.Pl8A0s0؁ 8W%#@8Z **A49Y/8Q\S9(C\~6cyd$ 9d@6K69w֎: d 5*<: B{<# *: X6d6A: *T: dFH*>; dFH*l; J )<*Ad< dFH*_< dFH*|< dFH*< vCL*A(= vCU*AH.> ^gp*Ap> dFH*? w*A? dFH*0? dFH*8@k +P@ dFH*@ dFH*h)A w*AA dFH*A J )<*BB dFH* B v*B@\CkZ#C dP$`C 1?C*:D |2h(&a T*hD KK%K*D *(E U{Rp*\E * E a8d8rf* E U{Rp*x &F 6}Q *< fF ממ<*F U{Rp*dF p# **G Th`]h*eG a8d8rf*G w'j*G U{Rp*2Q&5 #0>eQ$$$B%i%t%TjpTt 4pAQ%%%%%]Q4CQ$%%3&2'F'M'* LG|R'''PyE O(*+$ 4JRs((((((# hMR((%):")): FxQ S())*:,;*@*2\I @S5S[*i*m*:*++o$R4t$WTv  SX=T`^+e.+ll*L,mTXϟ8*TXf7;*i7>[p*PT v7G~7^\++؀T777T 77*UZu77d-=7+$B4(U777e0898TjpTĥ4VD8M8T8{ 88844EV88.8k+4B4HV888889]Q4T99"9L999L84DBl$9999:4Q4<Var :8:#rr@,86440W:::6:6앨UW:::$a";';P$$`}W(4;>;B;2k;;;4TB$W;;J;;;+dB4W;-;e;x-tBFNX<<+<R<a<j<**]TXv<: SX<<<:PkE<*X/<:t+P.Y$<==:???4Q 4dYz@@@:AAA@,Da4Y."B:q[b++Tf*B:y4B+*̹YX:*๨'Z&5 ;B:#ZZ?BIBXB:BBBTjpTD4PZBC B:BC]Q4콨ZD CCkC: DDD* tè [GEUEE:`FF*+d 4ʨ9[FFG:?GKGQG# pΨe[v9eG;SΨ[lGvGG;/GGGxWd4LҨ[_G;K+4Ҩ\ڬrR ;O 5*<Ө1\ڬrR G;P 5*Ө`\G H H;RkH}H4ר\MH;#ب\vsH;#4ب\HHH;HI44ܨ%]-I@I[I;`IIdiV\]ߨO]III;J*J84] =JJJNJ0ZJ86Џ]rBaJeJh] z;e.\+-^ ;L`*h^mJJJ;6K4KIK0 ^ e%rKyK*;9e.f#B^KKK*;IKKK9B4| _ vllK*;R;~?*4D6_]*;^#Te_KKK*;`$L3L:L-]S_KKWL*;o$L3L:L-]S`LLL*;*MMM-( S,A`MM N*;YNNN-( Sq`2Oa{u*;#ta PP%P*;NP]PdP-SayPP*;+P A*4d b PPP*;2PPQF6B1P;b{u*;N#`qb PPQ*;PNP]PdP-4S0 byP;U 8#e[V>;ww*-#Ge)V>;V 854H$qevVV>;S$eVVW>;.(W;WHWl&e[WgWxW>;EWWW(6Ħ'eQWW>;WQX* )f vXXX>;`XX$>s*BfXXX>;kY)Y6Y ,f TMY eY>;!YYԈx|ECG$d/fjy Y>;9 5*/f%Y>;0L0gYYY>;M?CYZH-1?g ZZ-Z>;[aUZ`ZH-$L3xgsZZZ>;ZZZ**D9gCZZZ_; [BD;gv [S;g[[#[L[_[f[54\^@=h {[[[([\*\mQ4@h4C\O\R\ m\\*Bh\\\\\\+dt$D iX[ϟ7*$D;iX[;*8Dki@\\\?] ]lB,Ei@]!]X]D]]] 46,|H%jH%^>^i^]^^^p06,xLvj4/_<_E_ d_s__top3Nj<_____`D*^p3Qj`$`/`1b`i`8;Sk t```E```@P^U:k5aaZ5a*_,Vck,FaRaaaaaaa\_T3,Xkasaoa4F8YknUo|#HYkn ~~#XY2l@ bb$b; LbSblħ,[flHbbnbqbybb,\lasba4F]ln#]mn#]:m@bbbK bbl,d`nmHbbnbbybb,HamPccd8cc84B4am"c/cJc&cdd$>4 eon;d] Ddndd*Dgndddbe!e54_`in, Lefeye5jneeeeef#_mto_ffW;\+Cmo .f:fIfW;"nfufT[Q`oLpfffW;)ff*dpp _bfW;0f+Ppp [fW;6wf\+ppZ ^gW;=g(g-g8Cq/q4gLg[gW;Hggg9 4tqb gW;_gHGsukqb gW;egHGstuqb gW;kgHGsur 9gW;qgb9PvJrڹ%hW;whE`Lt$vr 4hAhhW;Xjjj[s8rykkkW;mmm(6s nnnW;f=oP+ sX>s oooW;oP+h sPjsop7pW;*qqq(6(\sNr[rrW;ttt(6dөsQwjeuW;;uD4\`$tԩtמ uW;*թ8tv(v,vW;|, *ةjt vv&wW; wwx9pxީt sxzxW;x\+$C\ީ u xxIfW;"nfufT[Q`ߩ|uxxfW;)ff*u _xfW;0f+Cu fW;6wf\+HuZ xgW;=g(g-g84C,_vxxxW;H-y=yHy9` 4vb gW;_gHGsvb gW;egHGs wb gW;kgHGsx@w gW;qgb9zwڹ hW;whE`Lt$dw cypyyW;X{{{[sx|||W;wt~~(6dBx W;6P+ sxnx {9U`W;P+ s\x΀W;*3(6&xW;ۄ(6<yQwx W;;uD4`$8>8yRx ؅W;*?hyTaeW;7R*Cy  wW; '?G9JHyW;Ԉ\+DC`H:z ۈIfW;"nfufT[QaIzfW;)ff*Jz _fW;0f+Jsz CfW;6wf\+LK{;CgW;=g(g-g8TC0L{2AW;H9Љ 40O|bpgW;_gHGsO{bpgW;egHGsP9|bpgW;kgHGsPp| gW;qgb9P|ڹhW;whE`Lt$xQ| ȉ-W;Xގ[@ns$C}W;ٕ(6w̪r} W;:`P+# sЪ} -טW;%DKP+T sӪ}n{W;l+4(6<t~W;D0<B(6e,6~֤ߤW; 3D4T$.h~NRW; *0~3@DW;{ &*<6~ 2?§W; 9,<NUW;n\+dC,=j uW;"ǩT[Q\ad>W;)#*l? _:fW;0f+? =fW;6wf\+ @M@ gW;=g(g-g8tCALdsW;Hª9@ 4C2bgW;_gHGsLDbgW;egHGsDibgW;kgHGs4E gW;qgb9EځڹݪhW;whE`Lt$ F5W;G*%|FG W;Xr~[sիsW;K (6Xe ,5W;? P+:s\l΂ õW; cQP+$ sqW; ;G(6\ʬ1P]aW;˻׻(6f W;h aD4 $xW;N*d ȃW; 6*' BOW; q9`,-4 g;GXc [qT.`lvg;%\+$0 g;-+$X1Ʉjg;8ATg 47g;q)@8@=@#Dh8# 9g;y 99Q?Q\g;p ^Qd: hg;wf\+@;g;/@a\>_gg;ot+>vg;lTAK hg;wf\+A-Pg;@PaLDÆg;#wIsL y-g;)lt9,R&<Bg;<`Lt$$SY g;J\w~*L, TU 1g;V'S_|\o (bÇ$g;)@8@=@#b4Gjg;FlL0 4Lf9 ?Q\g;v(6dga%g;((6dn%g; e.a&#Ĩng;' !\+q +>g;/M\+`r'sg;>ԝ ^ ]hsg;74dL g;'66Dةʍ7g;;U L?Skg;R5?QQ 4,R ]hpg;74 g;07(6 в ;|bmg;x-(6spݎ ]g; .^y #CG$ 4pg; [qĩ47%g;%@LQ\+츭p [g;-+txjg;8|j 4HՏEg;q)@8@=@# =Ng;y 9t­(m\g;p ^Q$0íX g;wf\+íg;/@bƭgg;ot+Tǭg;lɭ" g;wf\+ʭ^Pg;@Pc̭*7g;#wOstԭʑ '-g;)lt9lڭ<Bg;<`Lt$ۭ0 "g;Jx*L, ݭc Mg;V|\o DE$g;)@8@=@#DlՒg;FlL1 4H \g;v(6d`8g;(6ȭ,i;"+g;`q| [q|g;%\+`Γ g;-+ig;8'Rek 43g;q)@8@=@#ĪDX g;y 9p g;!09 ^Q g;wf\+ DWg;/@\c< 1 gg;ot+ M~g;l4 g;wf\+tPg;@Pc,g;#wpRs( -g;)lt9[<Bg;<`Ldt$! g;J%@G*L, ,# lyg;V|\o x/$g;)@8@=@#03g;FlL<2 43n g; (6$4e*5g;K^(6DD5Ǘivzg;r8g;d 4=3$(g;r0A\?^FSxg;,ud Dg;xC8HENQg;rYjI,o|g;Edd Nm;K*CPU.;l-ЏU;3:,'V;*|W(v;SWP;) = G *E]d<[ ;\+^X[;"#\+^+d<^ ;+\+@^za n  ;^M  +(7FLa͚$   BE R p@P\d#b k p ;~  fSq  ;7 % \+dhV8 ? ;Xk  4/sj@   ;b  4/sl    ;u   9\\s;+2 4v;8 yi x;nfufTQcz 6,;d*CsH| o{;*xG4x7P~> ;;<sM@x;L+$\~ :G;T9;cz<Ē s40 ;L/C īL/0F;$ L<c04$;,;@$Lp MZ^;8JP$> s옮8;8kq(6 Hs$Ӟ5mPɡ$   BE R p@TP "mV88} 1?J8mR5$ԫ]$`HQ658$Ӟ5mP譮$   BE R p@Pl "mV$8(ʤ 1?J8)mR5$ĸ$`HQ65D($Ӟ5mPغ? "mVd8 1?J8xmR5$®Y$`HQ65Į ?`k -7pĮ n:4Ʈd< \+Ʈ~9  9`g9dȮ  VDʮ & |w8`ͮ6  @,\d4dϮ -6  W^*CЮ 1Yk /p66Ѯ! ?8J8854XҮ /| 854@ӮE ,x * Ȓdծ> 1*Hծ KHO 9c*Cծ^ } jq L**t֮  rM*ĬD׮ }  **خ߬  2$ bZ *hٮDLgY Vos*C8ڮ~ < T c ,Ć4ޮ N  '.  L84CG$߮$ =  0+!B!Q!@h8Fz!!! :!!!44!^" HL/)"*<"ZE" Mvh"*vy"" R"""ܐ K""# _###F<7Ȓ3 s̮# Y# D$U$\$4/$s9 s$|$ $$$]QD $5 $ B 5%>% eqȒs1g%!s% %%%Ȓ8sD[ &t& X&a&b[Ȓ48]~& -&ws &E2& &&&b[Ȓd'!'' o)))YY t$d  0 ** 0 *+ T а*+;+ 7,C,d,t4kP sl9,,, a.~..4H0 L4cF/lS/ /// 0Ȓt$h#%060 ,yX c0n0mQDs%α07 0 ;000wQds\'011 H33$4HET D<Q w555 555*>66]6;7}77T Iʲ;l-ЏI;3:,'tJ2;*LKi;l-ЏK;3:,'Lѳ;*xMHlQlTl;9oK+`-l$NM  ;: $<47Ol;;*OݴHlQlTl;9oK+`-lP!  ;: $<47Qgl;;*pRHlQlTl;9oK+`-lS  ;: $<47T9l;;*THlQlTl;9oK+`-lUŶ  ;: $<47V l;;*hWSl j97;U7 +*(X|Z8;g8 +*Xl j9(8;y7 +*Yηl j968;7 +*tZvfpD8;BSZ L8k88;C19I9_9d `b"vfp9;jSbK999;k}:::\x iv:::;;6;+*dmK >;H;L;;)c;#od<i;;\+oçX[l;; #\+ord<o;;)\+p]jr;;ep v;#dp{;;;;0;;*Dqȹ;;;;&<G<T<SQd4u g<s<|<8<<<F<7ȒD8lvY<<<;&J N=Y=F|68 1(z޺$==>>>>XPI w>>>;qj?/Pr( ? ?  l(%?V?y?>?? @<IЇo '@A#b̖ +@Z/@B@g@;AA:AnnD $,AAA4BBB@@D* b `=CAC9w  +p,FCSCnC;ICCC,\@e8FCSCnC;ICCC,\@\e8FCSCnC;ICCC,\@e8UFCSCnC;ICCC,\@e8$C DD1D@DKDlĭwj$==>>>>XPI wlʿVDcDfDqb~D/P$DDD;EGEREF|6ȅ 1H EEEEEF8l$C DD1D@DKDlw$==>>>>XPI wVDcDfDqb~D/PhKDDD;EGEREF|6X 1 EEEEEF8$C DD1D@DKDlw\_ EEEEEF8$C DD1D@DKDl$w¯p$==>>>>XPI w,ɯVDcDfDqb~D/P|ʯ*DDD;EGEREF|6 1ί EEEEEF8,ϯ(EEE,EFF Dѯ( ? ?  lѯ(%?V?y?>?? @<I֯mo '@A#b̖ +Pׯ&F9FoF G#G>Gnn ܯ/ g<s<|<8<<<F<7Ȓ$D8ݯ,AAA4BBB@@$+ b #`=CAC9w  +,GGG;GH H H8xP =JJJNJM0ZJ86ЏXrBaJeJM,H0H9H]HrHH@0Ȓ4D(EEE,EFF d( ? ?  lX (%?V?y?>?? @<Itho '@A#b̖ +&F9FoF G#G>Gnn * g<s<|<8<<<F<7ȒDD8,H0H9H]HrHH@0ȒTD(EEE,EFF ,H0H9H]HrHH@0ȒdD(EEE,EFF ( ? ?  lPE(%?V?y?>?? @<I o '@A#b̖ + &F9FoF G#G>Gnn$ e g<s<|<8<<<F<7ȒtD8,H0H9H]HrHH@0ȒD#0HHH HHHn@ȒĮ0HHH HHHn@Ȓ0HHH HHHn@Ȓu0HHH HHHn@Ȓ$!;HIIPIaIpIlD5$#wIII7 I6(F|%Zu{I-lu+%HIIPIaIpIlD5$(wIII7 I6(F)OZu{I-lu+X*HIIPIaIpIlD5$d,kwIII7 I6(F4. Zu{I-lu+.oHIIPIaIpIlD5$0'wIII7 I6(F2Zu{I-lu+3+III;IEJKJ#D08USJ`JJ;{JJJx P;'K@KeK;KLL@, 4?, ILZL;yLLL04@e |LL;LLM A MM3M;ZMmMxM B ITMM;MMMlmf%fSQ˰eB0f;Lf%fSQ̰B FfOfff;jfff*9hΰfff;fgϰ5g%g,g; EgXg]gį0аoKfgug;ggg*$ELѰ;l-ЏѰ;3:,'Ұ;*xӰ6v9g;-SӰaggg;.:hRh^h66Tذ"hh;#hhW Rdٰ0:h;*S,pC\++ٰ+ h;/h[b\++ڰchhh;Qhii\VV4۰(i5iDi;[tiii54ްiii;oijjT40'j8jGj;ejzjjwQ4]( hj;7jT3l8jjj;jk k$4[\f83kEkTk;pkkk|68kkk;_lollDk̻ fT4,$ʭ ll; lX ( б9];<+;ERwȒXj \ձA$ ;e/HXE4Dֱe$їܗ;m `;@4ױ$T ;}J.(/HXE4hر(6O;vę4P ( v9'<S4.AQ<, v**İ +8)-<6p)],ɚ<.(70g,V_p; m^c@,ɚ;.(70\g,VқpM m^c@ v<SC&3<,;D8c6.Yb<$.Úʜ<x *a^ <G$:.Ɲӝם<.4*g`AN]<85fp ;yٞQW , T<۟ bs= <v <Vjr85fP ݟP <ۡ8bQ4 G< FE4 t +<<** sX ϣۣޣ<SV@,(=$<f&9BF4EseIam<|`mQ$4$ '<Ϧ** ($  <0.3HXE4),:G^<ħקr0 @-T &<92 -I<6::@9Q̩<3GMH$8;$<d m<t$EHX>Ov9;S>tΨɪ;_٪VQ4@@n"#;x  x94A('3;gB?`@PC.L_u;+6>gFY0ɫիث;1o`xH8;LXkTD'%L,yM*MYn"#;I¬`8hO; ;L:#**O,y?;*Pv9ˬ-<S5sEXJ CDEE: : ;!! = |,":{}[] 0/ : ?> '.{none4 :,Y[$pKq ;Content-TypeFORMAIFFRIFFAVI RIFFWAVExM,0+/̨̨,0+/ຉ$/ ?tcŨΨ٨P0YPPmptª۪ߪ:@[ƤG   Ԃ#l y5`8O44@@Z rx@vvvvYpBCHD(D\|D0EqnL@Ě;"Nع0| pީTg^\t<|7tx@OOP|MQlCqHRU0`L/<\p\ C *>dszz |X%<1  SpX{zT|XĀRpz~T)d)/dev/urandomY6@U`gp      oJoOoooo@j^j`jijnjoj            He 7 77=  ( ) / / _ _ 000`!!!!0!0"0)080:0/+xM--@./000011223W3foq    D F H J O T c f  GIlq  e ( ) / _ 000 !H),+/,0̨  /5 #'<̨+/,0  /5 #'<? ABzD@FPG$tIK L(knNP+/,0̨  /5 #'<*'- 735)2#.!%,40(1$+6    @tAJ $n$ 68EPl #$n$p$t$$C%-%-'---2PQR,0=@INOop p XX & X&0X /sys/kernel/mm/transparent_hugepage/hpage_pmd_size;Zx0Nm 040  `He0 *H 0  `He 040  `He0 *H 0  `He0040  `He0 *H 0  `He@68<>@ACDFGO'/7?&.6> %-5=  !)19 "*2: #+3;$,4<VgDXx#Uōrl!6֮IN#|?=֪0Hcq0[kҶq2Ug  578<?jp|!#$&*....//00!0)080;04MNmp%*kEkPkYk[kakckwk}kk ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[????????-]B   ..:.;.@.].000012X&c   SQ   * . ` d f o 04?4sz !5Oo`eghj                 $~ |  ?F  8Ui                 ( * 9 < D F H J M U V X Z ] ` a c f o w                              .0/011122`2~2`|  !"Udeg  &(:<=?MP]  6:<=?@GPY      ( * 0 2 3 5 9 < D G H K M U W \ ] _ c f w                 ">* (0> ">* (0> " (0>*> (XG dEpɲeeP\P\0F) S$   578;FPY      ( * 0 2 3 5 6 8 9 < > ? B G H K M Q Y Z \ ^ f g v          5 8 : ? H P X pz|#%*-/24:>EGNUZ\chmrwz|oKUpQ R T   *0-000 -;Ż-0Fgi{ooooߦ9@ JP#'pz|  @n_n!(O  `nn"C     ?AJVoqPpP=@!ptv 0@P`p @`@  %&(*058@HJPU`jp)]4};=_F ~ 8 #{ #*#i'u'''!'')))))#.&%.).V.\. 000000>6DHZ\^ =4]c^`u00 ![jkGP>@@kCkooooo @0m7=K`([3{:<_  E } 8 #{ #)#h't'''!'')))))".&$.(.B.U.W.[.00000?"57CGY[];3[_bb d'@Bʚ; TvHrN @zZƤ~o#]xEcd #NJz|;AVj 2b_I_P$бU[D\X"NПW                                   r w  x ~ X ^ p x *3i|p t y  P!_!!`$a$$$$v'',111 2)2H2O2Q2_2222205 (*02359<DGHKMPW]cflptpsuwz}&*]afjA EHMPWY_`}&!e??$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDAZaz%,\bekwyq   *!+!2!N!`!!`,,"ʧЧѧӧէ֧٧0Z\dfi!:AZHJMPVXZ[]`Z]|------------------  &(.                                            ,  of the  of s . and  in " to "> . ] for  a  that ' with  from  by (. The  on  as  is ing  :ed =" at ly ,='.com/. This  not er al ful ive less est ize  ous  the e 09`if o  f o  f o  f o  f o  PY )@IFOPY@IPY )Ш٨ Щ٩PY ';>{ 6V   5)14:\6 7 ;>fio$_jjZkbkUԝԭԺԼ:?EQՠ"% #(38:HJLPSXZ\^`cksx}tzY@ $(q FCdx},jx#q   |,},o-/.010,2050;00b00^00 spϩpݪm\_ipT !"#$%%&&''((()))*++,,,,,------....//////0001123333333333444444444455666677777888888888889999999999::::::;;;;;;;;;;;;;;;;<<<<<<<<<<<<<<<<=====>>>>>>>>>>>??????????@@@@@@@@@@@@@@@@@@@@@@AAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC#4D  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJ*!LMNOPQRTUVWXYZ{|}~                  #4D V n)O?=  X `4    g w~ >kt J s , +KgiK 5 &u n  _ ]Ie 1I[b*HBy  ^`  M\+<=>|~ D R z |  !@!(A!D!K!!E!!!!!!!! !!!! !" #!#|######%% %%o&'Q'''''')))))))*0+D+G+L+)b9df \^uӺ?c?yڌX?9?-^? h?:D?Kx? !? ?8G?2Sg?hz?:?Е1?z?G?g!?Kx?4&?̈Gj?TNK?sp (??P??2Ut?Uᢜ>?&m??l??sjbƈ?UϋE??0?_  ) 1 4 7 = ]  ) 1 4 ^  ) E I W  E I HIWYmq_XZ\^ +&---------.@00112ҧԧΩ'/7=?BESgu  VUU433$Ir]tVUU;J$9.ى%IqgffF]VUU$I@8433.*J$ qaVUzDy 0  C{ ?gfVUJ9o43]g%I  h<h<` `,,`YYfs(s>DDE EFF H H H H< YJ+J>01PQpq !"#@A`abcBCDEFG0 9 fo6?PYPY09PYPYPYPY`jijjjPkYk@IPY`~!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ (*/:IV^chjnv}  $+469;FJX[agrvxz|~  !')+-368:<BFJRY\_adlpwz (*/:IV^chjnv}  $+469;FJX[agrvxz|~  !')+-368:<BFJRY\_adlpwz ")07:>HT\dlt{ )18<BFJNRV]adjmpz~!&/6>AGTY[biotz "-36;DHMRX_dgmpz %)+/27<AEIMSVY\bKkSsk*!s+!0011SE&!24>!A"B*J24>ABJbcc!"*bJ`aa`E&!*!K+!JKK&68=HWdlqvx|  !$'),/39@IKNP[ft "')06<DJPVZ\^`bhkmoqw{#(,15ESaoqsuy{~&68=HWdlqvx|  !$'),/39@IKNP[ft "')06<DJPVZ\^`bhkmoqw{#(,15ESaoqsuy{~1111 11 1/111 111 1111 11 0111 1 111 1111111 11 11111111111/11111 111111111 111111111 1111 /111 1 1 1 1 1#1/1 1$1!1 1 1%1& 1' 11"1 1 1( 1)1*1 1+ 1 "1 !1,1 -1!1 1 1.1 1 " !  1 !1 1 1 "  " "09`if o   f o  f o r w  f o x ~  X ^ f x  PY 3@Ii|FOPY@IPYp t u y  P!!!!`$$$$v'',0 !0)080:011 2)2H2O2Q2_22222 )05Ш٨ Щ٩PY'pz|  @n_n4Mh  89;>@DFJKPl!<Up4Vn6!(O  `nn3NTVg7Rk";Vo6NPUp5  %*"C@[`{ t~  @d e ?56   d f p t ~   !%!'!)!,!1!3!M!O!_!!!!&$@$J$`$')s+v++++.].//0000 0 00070<0?00000[011111 2_2222X3YY33MM!09.ϩ[jk>Q?0RTfhk ;@[ep.A                                                                                                                           "vS`GlF[r`u!Iw%xEy]KzbzV{ƨ{" |P|[|,|| ~};}l[}dx}(}W}0}}1}}~>~#~=0~;~wF~]Q~Z~c~,"l~t~{~~c\~K~~$I~~ ~z~~*R~e~YB~~ b~ĩ~A~e~x~q~b~~ ~\~~~n~G~^~~s~v~~ ~\~~Gp~Y~~G1~h5~~q~~ ~m~j~i~~g~.~W~/~~~~$~_~\X~_ ~l~{~.~}~5\~u~ ~'ߥ~v~L~D~3@~(x~3k~]~M~zs;~/&~?~]}r}}r}0}|`| {v!rzdw40m /I9/dZ/rt/I/s/k̗/՟/`J/E/۴/ /C/5/O/i////Z//f~/H/GB/,//t0?000 0 0: 00x0S0)00]00b0)00 !0q#00%0&0((0e*0,0-0U/0=H1020;40n60/&80 90[;0HO=0?0@0JB09p?4?6?? X>>>}>>(>> >`>>>>O>B>>5>Ԕ>>l>>g>>>>̼>e>D>AΚ>>2T>!>>Ҋ>T>ޞ>'>: }>[w>q>$k>Fe>u_>߰Y>S>"MN>׭H>C>=>^8>ʪ2>>H->'> ">Uh>5>>d >>>&==;=V==ߋ=k,=_=붱=L=Ĥ==;=H=hy={uh=ƹW=6G=O6=&==*=|~#~=0~;~wF~]Q~Z~c~,"l~t~{~~c\~K~~$I~~ ~z~~*R~e~YB~~ b~ĩ~A~e~x~q~b~~ ~\~~~n~G~^~~s~v~~ ~\~~Gp~Y~~G1~h5~~q~~ ~m~j~i~~g~.~W~/~~~~$~_~\X~_ ~l~{~.~}~5\~u~ ~'ߥ~v~L~D~3@~(x~3k~]~M~zs;~/&~?~]}r}}r}0}|`| {v!rzdw40m /I9/dZ/rt/I/s/k̗/՟/`J/E/۴/ /C/5/O/i////Z//f~/H/GB/,//t0?000 0 0: 00x0S0)00]00b0)00 !0q#00%0&0((0e*0,0-0U/0=H1020;40n60/&80 90[;0HO=0?0@0JB09p?4?6?? X>>>}>>(>> >`>>>>O>B>>5>Ԕ>>l>>g>>>>̼>e>D>AΚ>>2T>!>>Ҋ>T>ޞ>'>: }>[w>q>$k>Fe>u_>߰Y>S>"MN>׭H>C>=>^8>ʪ2>>H->'> ">Uh>5>>d >>>&==;=V==ߋ=k,=_=붱=L=Ĥ==;=H=hy={uh=ƹW=6G=O6=&==*=|@DFJKPR46NPnp  %*C ; 8> @ I L N O       ,> @  ;    6 > ;@ G H K L W      *  A D          > ;? @ F H J L W + L   >?+,18;<VWb cdgm 4#&)+0138UWacdm nr51;=>ACD=$1%+45.0/0#$'Y3èRS1/034M{.}n  p v   O y *48m@ajt|!!!!! !!!!!!#!%!)!.!:! ;!J!L!M!O!!;!! !!!!!!!!!!!!!!!!!!## ##"#(#+#{#}#####&$@$J$$$%%%%%%&n&p&g'''((+/+E+F+M+s+v++++,,P.Q.....////000 0 6070>0?011111122*2G2P2`2a222223MMƤ(+679w>xy@O.%',3>JN]blx~-79>ADFR]ekqv{~ #/;GOTar}!*.38>NTXglt~  */28?DHNS\agnu| #/5BNV_jq %*7BKVY\fo{ #&.3<?DNRVY\`o{ '+18?ENR`cfjnqux}%',3>JN]blx~-79>ADFR]ekqv{~ #/;GOTar}!*.38>NTXglt~  */28?DHNS\agnu| #/5BNV_jq %*7BKVY\fo{ #&.3<?DNRVY\`o{ '+18?ENR`cfjnqux}1oW ?  P X   q  9 ?   UYGM@Ctu8=KLOZ[]iAC`l<=>;D EF?]@F AEpqCOp$qq$t$//njojj7kB8k;kDknSnnoL^_1oW ?  P X   q  9 ?   UVYGM@Ctu8=KLOZ[]iAC`l<=>;D EF?]@F AEpqCOp$qq$t$//njojj7kB8k;kDknSnnoL^_AZ.269GJxy}2:;=>ACDFHNEp+rv /`.1V(/8?HMY_ho&!*!+!2!!,} ,/,`,b,c,d,g,m,n,p,r,u,~,,,,,,,@NyBl".2ny}~ħŧǧɧЧ֧ا!,W":AZ69GJxy}2:;=>ACDFHNprv /`.1V(/8?HMY_ho!! ! !!!!!!!$!*!+!-!0!3!>!?!E!!>,/,`,b,c,d,g,m,n,p,r,u,~,,,,,,,@NyBl".2ny}~ħŧǧɧЧ֧ا!,W":az*/37:HKwz~#3<?@BGOPTVWY[\`aefhiloqru} Eqsw{|}0_a/ay}s '07@EQW`gp}N!!60,_,a,e,f,l,s,v,,,,,,- -%-'---Am#/3oz|çȧʧѧק٧SpqAZ!#%'*./: ;?@\~Z[_7    jm, 0>^d e p v y w  pOZ [qJO`eahn}56 DEZ`}~;?~ C ! ' 0 8 ; > A C G Q S U V ^ ,,,,p-..... .........*. +...0.9.<.?.A.C.D.O.R.T.00=00 s~ twΨϨ.2/_0ͩީߩ\_ުߪ%R0EFILPRTW_ahjk   <adee!#%*,/:;?@[]_{}$~ Z_    jm, 0>^d e p v y w  pOZ [:&;=KJO`eahnn56 DEZ`}~;?~ = ' 0 C E Q S ^ } ~  # #)#*#h'u''''')))))),,,,p-....0.O.R.].00000000=0 00[ s~ twΨϨ.2/_0ͩީߩ\_ުߪ>SQ?0RTachjk   ;=?[]_`e(+>*>?>>*>">.>X!>X*>x&> >*>`3>>p.>H)>h&>&>!>.>X>8">(">(,>&>x,>8,>H,>)>)>(>x+>+>/>H*>p0>'>0> >8(>((>(>(>!>0>.>h(>H+>'>H(>!>'>X(>'>'>!>!>'>!>!>>8+>8!>H!>;> >X&>/>`.>x'>0>,>,>+>/>)>,>+>00>1>X,>+>+>/>X+>+>'> 0>p/>)>(!> >!>!>*>,>,>*>+>/>h,>">(>h*>'>P0>(>(>(> ;>+>0>x(>x!>h!>&>('>(*>8*>8'> >01>*>H>(>&>>>&>*>'>h+>(>(>&>)>&>&>(&>/> 1>)>)>)>&>> ->()>8)>X)>)>@0>3>*>/>)>h'>8&>>(>'>H'>3>0>>*>>>H&>>> >X'>.>,>*>&> >N>.,EF<,^-.235>?ADGHKMWb c567@AEk0r12;<>n j!&,.801578=@B9UWX/>k_ 45>?AQoPRooooefmraz*78HIwz~349<?@BGOPqsw{|}041_a/`+kwy '07@EPW`gp} !!!!/!9!@9@9 h4g/DhzɫĪ#&YC}Ze h{o|ſ "Rb1qZr\ܤlQ F3s.=х3bN{18ShwUF2|,bTu?3IPNnUUތNw8;C^`|~ uq   j  p  O y ?48mn@ajt|D R z |   !!!!! !!!!!!#!%!)!.!:! ;!@!A!D!J!M!O!!;!!!# #(#+#&$@$J$$$%g''''''))))))s+v++++,,P.Q.....////000 0 6070>0?00011111122*2G2P2`2a222223MMƤ !(+69wy[jk)O@O-bdefi >@\^7?y0wx ?w @DFJKPRq=+0;@HPQ`ev{ GPY`S`mp| !9qwÐԸ?|jIN ۛXKxmw=s0Qv[ gObpM}[1`b:N6 O@Q)^YzD801-Ml?P`bpb|õd 5*κ;Y? {kH&R%/*7>sFMT[EbhnGu z ^ѕ 67(AqFFp+-T zYEyMR ޷4PH7dЍzvlS! 0 Hvi(|E*k>p֏h B& +!E!xV"_"O#J#I$i$<$$%t4%G%pN%ZH%j5%%$d$f$$4#>#,"k3"8!X 5 m! n2dӎeG 6 s @Ld&);J=3'&vQ[,¶c*@vz!x"pf2G]S+CH<60#4![ ۪^NebWI/*xT4v2;&-0#w e0<]ne' 1Ă-- .7).B.Y.fo.߁.ن..H.(.o.z.oN..l.F./...4.f.&.[/B//g /7!/>/T/d/n/r/Fq!/j$/_'/1P*/r<-/$0/k 3/5/8/q;/|{>/PA/#D/CF/I/L/dYO/"R/+T/®W/rZ/5]/_/b/xe/7h/j/m/pp/-s/u/7x/1b{/~/l/ʁ/(//h/C///`/M/7 //?/nB//L/ i/a̗/T0/픚/5/2`/ƞ/p.///i/ԥ/@/t/>///j/ܯ/'P/IJ/)://&)//c//$/+///K/v/B(//://rT//Gu///4//Ei// /G///:///B/\/j/b////\/}"/Y/H/[/X/6./ /q0a0]S0F0N<030,0+(0{%0$ 0o& 0,* 0'0 0m8 0 C0P0_0q070{0w0>00s0<0d000$0 (0a 0!0l"0$$0l%0&0x (0_)0*0,0{-0 .0EP0010{:3040);60n70S90:0<0<*>0?0A0AC0.E0F0עH0J0fL0RWN0RP0*YR0FkT0V0δX0Z04]0_0a0gd0f0ki0 ?A?Į?"?ʝ?G??i>l>7>>*J>>>^>>F>>7P>>K{>>>u>;->>>|>eO>4(>8>L>N>ȿ>>>>·>ε>߳>>>0>U>~>|>ަ>Y>IP>w>ҟ>B>e>)>~>_>>C>{>>J>﷍>X(>'>N>Í>x >b>x>>!>^}>;z>Хw>@t>wr>byl>i>g>Sd>3a>^>]\>&Y>z)W>T>P R>O>L>5~J>3H>E>nC>@>VK>>;>9>07>4>2>>0>p->+>s)>7'>%>"> >s>L>*>= >T>T>4>>y >ϣ > >>L>>l>=+==0 =C==8==hp==0== =o==|===;=ں=Z=o,=ް=ߗ=.W===%==r=W= C=4=M,=4*=D.=y8=H=~=x=sFMT[EbhnGu z ^ѕ 67(AqFFp+-T zYEyMR ޷4PH7dЍzvlS! 0 Hvi(|E*k>p֏h B& +!E!xV"_"O#J#I$i$<$$%t4%G%pN%ZH%j5%%$d$f$$4#>#,"k3"8!X 5 m! n2dӎeG 6 s @Ld&);J=3'&vQ[,¶c*@vz!x"pf2G]S+CH<60#4![ ۪^NebWI/*xT4v2;&-0#w e0<]ne' 1Ă-- .7).B.Y.fo.߁.ن..H.(.o.z.oN..l.F./...4.f.&.[/B//g /7!/>/T/d/n/r/Fq!/j$/_'/1P*/r<-/$0/k 3/5/8/q;/|{>/PA/#D/CF/I/L/dYO/"R/+T/®W/rZ/5]/_/b/xe/7h/j/m/pp/-s/u/7x/1b{/~/l/ʁ/(//h/C///`/M/7 //?/nB//L/ i/a̗/T0/픚/5/2`/ƞ/p.///i/ԥ/@/t/>///j/ܯ/'P/IJ/)://&)//c//$/+///K/v/B(//://rT//Gu///4//Ei// /G///:///B/\/j/b////\/}"/Y/H/[/X/6./ /q0a0]S0F0N<030,0+(0{%0$ 0o& 0,* 0'0 0m8 0 C0P0_0q070{0w0>00s0<0d000$0 (0a 0!0l"0$$0l%0&0x (0_)0*0,0{-0 .0EP0010{:3040);60n70S90:0<0<*>0?0A0AC0.E0F0עH0J0fL0RWN0RP0*YR0FkT0V0δX0Z04]0_0a0gd0f0ki0 ?A?Į?"?ʝ?G??i>l>7>>*J>>>^>>F>>7P>>K{>>>u>;->>>|>eO>4(>8>L>N>ȿ>>>>·>ε>߳>>>0>U>~>|>ަ>Y>IP>w>ҟ>B>e>)>~>_>>C>{>>J>﷍>X(>'>N>Í>x >b>x>>!>^}>;z>Хw>@t>wr>byl>i>g>Sd>3a>^>]\>&Y>z)W>T>P R>O>L>5~J>3H>E>nC>@>VK>>;>9>07>4>2>>0>p->+>s)>7'>%>"> >s>L>*>= >T>T>4>>y >ϣ > >>L>>l>=+==0 =C==8==hp==0== =o==|===;=ں=Z=o,=ް=ߗ=.W===%==r=W= C=4=M,=4*=D.=y8=H=~=x=ef~5ZE?56_]tgs8c vS8;4;1XT./UChGxQ^i 55!gvlrsAp2OOpH4p8 n)RLGny Zu!m<k zԕcEc jL E/oD Zg< GH9INlu$| kl I60c[*}w%gEysiQDXHٗ:Z3X#A:sL="Z#I%%m]5(JFWm%O^ ^ Z Bg7w"u:P0~Iw%tI9 aBZ>r4M0 jxr2oaTYl@yYj "35w T_fXcqX G >FY&a%s%\}h3smLO|q-\ 7hG>ld=Q95;!p54F]yL\dh&nf4o{_EeS]sy \p*IQjw,;O#k<h^r)3aJ j7C!DuW6Cgn}"#lQ",%:&hqbR1exe  ^A{DJ^.s^8gf\sQ5gc}B0YlF }iwLibqJlZvZ9)v8n'.5+F2K]thS&hb~mM:k¡2lBWZ bZcw-p$6pWClz9gY}lAlƅ'hVT|:ce2mK/A2%~{z>6n *F6{N}` / v~Px`sqc!r"0D]9`5DJzZ {[6aT%]3 E-\Kn_(HE_7d8;^.f /Alohkk m$ @?O76|`Gt!8j[@1f!68xCrB3yPx{3c-Jk# Y~= %E[8]H-bqV_{K7} o7R-00 CO>Hb0E0:^J)g.18S;Ӱ*B`'ZDDPqgwY|sulGk [JP:aJ*:e \I+kUIq.{:R!D,&6Z<J4Pi~V<{BKeh2 [:*R , W`pby(I\z?pIVVeP,EPS{[dx^ A|' {?oK_pf01J#%')-Y[ : < > O Q W b c         < > ? B G H K M Q p q u          < > ? D G H K M U W b c  <    )  < > ? D F H J M U V b c           ; < > D F H J M W b c       145:GN59>?q+e,>VY^`bdgmqt ]_24RSrs .  v# +0;U^`|14Dks$7 ,,--a--*0/000ort} #$',T3Ũ&''-GS)D*6CL M{.|}* /oK_pf01J#%')-Y[ : < A H M Q R W b c  ;     < A B G H K L M Q p q u         < ;? A B D M U V b c   < > ? @ F H J M U V b c  ;     ; < A D M b c    1[4:GN59q~-g.0279:=>XY^`qt]^_23RSrs .  v# "'(29:;V;X^`bels|1467:<Bks,367   ,,--a--*0-000otu} %&,ĨŨ&''-GQ)D*.1256CL |4+ 1O /eJߴy`ȡp: H?D'E+$ՓtLPpC&$x0ԆBdJߴy`ȡp: H?D'E-$ՓtLPpC&$x0ԆB3dE4(agy>|r_BӶh-`>[ͯ YU}'A~>ҵNPwRsA WȨ&*ECN5bF$-P6<cH^ˬKĕ3 U^_L7Jıa`1A@ֈa%/?I@ԃtjNXe؟p\\~y6yR"qnc>C08)Pu!xmz8&vp0g9": Y A8 <kKcSӫr h%鏑0Vd ThN3o{-R.BdwT߰]ίcPЈDËDAui[W*fh]"Kau(e6 05XoiXn?I <,7'Mz(/h0_L 0?Ʒq{ dԏ@nb0J*LT]Rʂ8zxvIOqt/[.^nC#aIdrv,}W0^zt9ٯ C툜ܛ Ƽ0Q-SӍh\tJfsdΘ knqzd JaP㺁 PYiYUwMf=<%ܲ`g|fվ;YO΀aj<2gpoi֨5%ӊm+Ԭfr~UX~|U% |&%|!_<+}.}ԅf2c;If y6AVC([9MQV Ze*I+L؂ [bVs5S 5 :?LZD@Z{CERs *Gvz      8 : ?   $ >% ' FP8Fpst >'4EFs ,7>A;<>DGHKMWb cfglpt5F^R0@+,:0578;>@BC 39;>GQ R[/68?16:<=?@EGC415:>B@4G4H4U4jj0k6kOoQoRoooooo oLb-0Feimr{BD6;lu!#$&*016>DJ./012 34 56 789: ;<= >?@ABCDE@FGHDIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$uu%&'()*+,- vz      8 : ?   $ >% ' FP879Fpst >'+-4s 5/`01467>A;<@f&glpt8?BDF^3:=?@kf"%'+/79:;<>C! 38;>GQ RVY[068=?S16:<=?@EGI\ 657:@B@4G4H4U4jj0k6kOoo@oooLb-0Fgi{BD6;lu!#$&*016>DJ< ?AJnoq /M@X`jp 9 = P X a r                 ( * 0 2 3 5 6 8 9 Y \ ^ r s t               ( * 0 2 3 5 9 = \ ] _ ` a q            5    ( * 9 = X Y Z ] ` a              : = N T V _ a z       023@E@@AGIl*?PQUZ]aefnopurHJMPVXZ[]`Zlo1@Q`lnp D!BDxPmpt T3EL#MOZw5!;6!8!0-g-------------------0<06A000000011/111111114MNФ *+n2h  "@s %0F`|(@BDK`oqvz~ª۪ܪ  &(.mp (*68<>@ACDFG=Pptvfoqxy0WX8K=Lf./?\]_ko                 ) 1 4 : ; = C F I J N P R X ] _ ` e w               ) 1 4 : ; E F I J N O T X [ ^ d e x y                  ) : ; E I N O T W [ \ ^ _ d e p q v          E I P S d e          ;>\Hm%np%INOWY^_*[D\}!~7?T_mqty, -/<?ACnou_}~ MOu8:JLFGNOX^~e fr s     !!'$?$K$_$t+u++,^,,&-(-)-,-.-/-h-n-q-~-----^....Z..////@00W01h11011_112nrǤϤ,?˧ϧҧԧڧ-/:?xƨͨڨߨT^}Ωک ۩ݩ788?NOZ[êڪ'/loׯno7=?ESglouxy0WX8KL./?\]_ko                 ) 1 4 : ; = C F I J N P R X ] _ ` e w               ) 1 4 : ; E F I J N O T X [ ^ d e x y                  ) : ; E I N O T W [ \ ^ _ d e p q v          E I P S d e          ;>\Hm%np%INOWY^_*[D\}!~7?T_mqt y, -/<?ACnou_}~ MOu8:JLFGNOX^~  * . ` o r s     !!'$?$K$_$t+u++,^,,&-(-)-,-.-/-h-n-q-~-----^....Z..////@00W01h11011_112nrǤϤ,?˧ϧҧԧڧ-/:?xƨͨڨߨT^}Ωک ۩ݩ788?NOZ[êڪ'/loׯno7=?ESgloudd  d, dFddd d|$ZӤ b   G  E  (  x  /] * 25 =IVh "Tw Ď  4 # "% $ "( #*?&-u(0 P+3  !-63 #09  (%3<< 7&5? K(8B| .T+;F" dj->J Au/AMzi1DQMP]37#-JPz'0co6@U`g8<<?  9 ? ?        5 8 : ? H P X `       5 9 U X r x       H      ' 0 9 `'0YpMRuGPvA DGHKMPPWW]cflptaDPY`l+0F;   8;FPYGP EPlp6:GPY`:>Y#$t$$C%//0/4@4U4DFFh8j@jijnjjjjjjkEkPkwk}kk@nnoJoOoooooooopՌ"22PRUUdgpjp|-0FP&)r{EV`x  FJ%**0m,0=@INOKPY^_q=$';BBGTWdg+0;@HPQ`ev{ GPY`S`mp|ߦ9@ JP#AZaz ptvwz}/1VY`a Jnoq /M$ (@AX`jp 9 = P X a q                 ( * 0 2 3 5 6 8 9 Y \ ^ r s t               ( * 0 2 3 5 9 = \ ] _ ` a q            5    ( * 9 = X Y Z ] ` a              : = N T V _ a z       023@F@@AGIl*?PQUZ]aefnopuHJMPVXZ[]`Zlo1@Q`lnp xPmpt T^3EL#MOZ} EHMPWY_`}q   !! !!!!!!$!*!+!-!/!9!@ACDFG=Pptv!:AZf  &(:<=?MP]-@BIPuP'0c6@U`g  578<?@U`v   9            5 ` |        5 @ U ` r    H  # '0 1Ep7qru&DGPrv +?@ (*02359=P]a4GJ_a/D<H@F+   /?A  2:P\ .@r2s  0F`aeghjH3 P #$C%//0/4A4F4DFFh8j@j^jpjjjjk/kckwk}kkoJoPoppՌ"2PQRUdegpjp| ,NB!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ߦ9@ JP#_`ab cd ef ghij klmnopqrstupvwxtyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP  QRST  U VWXYZ[\]^ #HUH II8 8I>8888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.#$%&...,t'{''''m''(K)KFF( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33* 33333.3.3C<W<===b $=+=2=9=@====F33-24/0KKKK33333.33.333倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ DCE1E5F=FDDDDDDDDEE=EDDDE3.3KKKKKKKK..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3333333334.3.3#HUH II8 8I>8888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.#$%&...,t'{''''m''(K)KFF( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33* 33333.3.3C<W<===b $=+=2=9=@====F33-24/0KKKK33333.33.333倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ DCE1E5F=FDDDDDDDDEE=EDDDE3.3KKKKKKKK..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3333333334.3.3;Ɠ/-B=dH 'e3:>@9@9 h4g/DhzɫĪ#&YC}Ze h{o0L%K0Z2gPNzeaV}S;K!1b[U* ?b5"#XLEpƴ&(Z3D^HPDZ FE)GÂ)'KՇdG_wXARjz/cg.FQoP3Y݊34d~!nA D^˖QZIE/ԓ)rs*/'.04pq>mTuBHCI[_1wi>jUu)Y`,+ؤ2"1DH="U=m"p޼zSAFO#2;oPkowhY2$`-gx.s`Sqԍ߱7$3姑7cx {I$m$H-+-)a όF *ӒQ0u^B͵CЛ/v]?7N8pB֓}Z.B !aQvƒO FHod6U$Y2m DH풵%-)'N9(HoqTȥql*_y3 wYrUFG+m<{wo'޵:eE4Q\GtdF4Iݮ5}2rv}Ic!gy[QXw" #`nP/I 8G {QuO9o]%y"[Z+khܜyצxvGKpXHtUBձ+]J\rgB4 Rs{#|'Ly+fc^lALIq]XU%FLSP&JXr2횼!1 2*o{5p?w8'g ̸)-jQ~4JX+ycdGbSHc1(i6*}Ww\5P@uqh$j*m)<{/0S#w IәzA%.M@}q{qGp, 製6$RWAȨw/&cebg(%[< 6xNk?Ӓ :j2.+U|cGgl三;Jzv֣vj|Ym+" sܑ?(VѮ썗 smMCCHG",M]S("gS\ۻpa קlW, :s{f!+)? >R!xT$ s$؇SF-CYcoÁ 6 u`^J 8/;; Zc]gPTLvi72#.oc%.[/@P?kTyf)Jr}}:`W=oS+=Ư}ydWKvۅxk7-3pC]u"J2BPhpG_Ef|`5LNى\4 |Up $#~ 8R5ĸ9VN@3xKYgj6D=_RA\wǮ*vT X;oÏ^<6C";}JbF+C5tl}W+2L y8]QߜJˮR9+f2mS21yu }P%gzK09k9+Tt0u^y~c<}v@nHY |Oahg%eQR [J%4nA]1J MwDŝlïe!aո** ~bvCB^Ra~,  Wq8@ uW =Yl{n1d0Μ, qtkU嚁eF@2zm WnT̪ 1TYJELAqbpet)6'f;<"]츶<>[CcpCgo{Q5/DYxJ dWn}1eHլ:14;&h1G܌.[4=ٱ :5 C&"&h'ӏx3 +s,^@ :ŇV)H.%)%~֞W (;. 'S7:iW‰v\[a!DcN?A(o~1خ0&?z%틠~[ZLn6caO5:uex\Bj̨pP]a +{}ꐶV)Γb ި}{=p j}8PQ rU\cƙ3lH'm mZʇ\-&⦉,!\?gx<`Pn)o<#(~R.A3==* LwpiG9޸R*aA$}zok|9RSz0y:t|&1b 距?d V%O,bS  &(:<=?MP]-@BIPu'0cpz|6@U`g  578<?@U`v   9            5 ` |        5 @ U ` r    H      # '0 1Ep7qru&DGPrv +?@ (*02359=P]a4GJ_a/D<H@F+   /?A  2:P\ .@r2s  0F`aeghjH3 P #$C%//0/4A4F4DFFh8j@j^jpjjjjk/k@kCkckwk}kk@nnoJoPooCoooooppՌ"2PQRUdegpjp|TV  9;>@DFJKPR46NPnp%*0m,7=NBCK!"$')2479;BGIMNOQRTWYabdgjlrtwy|~ߦ9@ JP#  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVUUUWXYUZ[\]UUUUUU^UU_U`UUabUUUUUcdUefghijkUUUlmnopqrstuvUwxyz{|}~U!(&UUUUUUUUUUUUUUUUUUUUUUUUUUU   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVUUUWXYUZ[\]UUUUUU^UU_U`UUabUUUUUcdUefghijkUUUlmnopqrstuvUwxyz{|}~U!(&UUUUUUUUUUUUUUUUUUUUUUUUUUU  !$'*+.1456789<?BEHKLMQTUZ^bfjntz "(.7=FLRX^djprtvxz|~  %*/49>CHMRW\afkpuz~   "$&(*,.05:@EJOTY^chmrw|  #(-27<AFKPUZ_dinsx} #(-27<AFKPUZ_dinsxz|~ !*6?HWclu~,8AJS_nz"1:IOXajs|   ' 0 9 B N T ] i o ~       * , . 0 2 4 6 8 < > @ B D F H J L N P R T V X Z _ e l t v x z | ~      # ( - 2 7 < A F K P R T V X Z \ ^ b f j n r v z | ~       $ ( , 0 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~       $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |  "',16:>BFJNRVZ^bfjnrvz~  $(,048>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx  !#%')+-/13579;=?ACEGIKMOQSUWY[]_cgkopqrstuwy{}*2:FR^jlnprtvxz|~  "%(+.147:=@GIKMPRTVXZ`filorux{~#,5>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0 CC%C`C#L#@###HUH @y CCCCC7888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.Q'#$f'%&X'_'...,t'{''''m''(K)KF5GF@G( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33 CEIO_ae 2C'5)'?)C `]*!)^;!^; 33333.3.3"<===z$=+=2=9=@=''S)===W!*fZFm3z3*  &. -24/00   |KKK3333>Gc3.33.333 :OJ倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3CC[C sCGOU]gCCIUgCIS_gCkCCCCKC<V?RKTZ~ol *V? KRKTZ~ol *V? ]RKTZ~ol *V? oRKTZ~ol *V?3334.3.3 c~l( )])g){))q))j ! CC%C`C#L#@###HUH @y CCCCC7888X9"9 949^9d933. 39999999933.33.3. 3.3.3.3.3.333....33.3.3333.3.3@!@)@3.33]F-FF3FFFF---FF-.. .1@! .%.-.0/5.E.=.j9@0$/M.Q'#$f'%&X'_'...,t'{''''m''(K)KF5GF@G( (K33''''''.U..332/.3.3.3.3...3.3.3...3.3 3.3.3.33 CEIO_ae 2C'5)'?)C `]*!)^;!^; 33333.3.3"<===z$=+=2=9=@=''S)===W!*fZFm3z3*  &. -24/00   |KKK3333>Gc3.33.333 :OJ倀Ɓ圜Ɲ常ƹƀ唔ƕ尰Ʊƀ匌ƍ娨Ʃƀ億ƅ堠ơ弼ƽƀ嘘ƙ崴Ƶƀ吐Ƒ嬬ƭƀ刈Ɖ夤ƥƀ刈Ɖ..3-.333.33..3.3.3..yCCC3....333#j....//3 GGKGYGgGuGG,1,. .3.3!G+GGGGG3CC[C sCGOU]gCCIUgCIS_gCkCCCCKC<V?RKTZ~ol *V? KRKTZ~ol *V? ]RKTZ~ol *V? oRKTZ~ol *V?3334.3.3 c~l( )])g){))q))j ! ';>NO^46$,KO{&(/dn{7?V_h+ 6-9;=>VI  : > @            6 7 ; > I O Y _       6 8 V W s w       I      ( / : _+(/ZoNQv~5HIOwB0C  )14:E FIJNOQRVX\demou\bcEOZ_m,/G<  69:G HOZHO  7.FOmo 79;>HOZ_fi;*<=Z##o$u$v$$D%///04?4V4CGFg9j?j_jjj kjmjjj jjjjjjFkOkZkbkxk|kk?nnnKoNooooooooo֌ #$$13OSTVchoko}./GO'(szFW_yUH    :?EGIQU%$+"%+,/n-/>?JMPLOZ]`p> #%&(38:<=ACFHLPSUVX`cefks} ,/<?IOR_fwz HOZ_T_no}8:?KO# ';>NO^46$,KO{&(/dn{7?V_h+ 6-9;=>VI  : > @            6 7 ; > I O Y _       6 8 V W s w       I      ( / : _+(/ZoNQv~5HIOwB0C  )14:E FIJNOQRVX\demou\bcEOZ_m,/G<  69:G HOZHO  7.FOmo 79;>HOZ_fi;*<=Z##o$u$v$$D%///V4CGFg9j?j_jjj kjmjjj jjjjjjFkOkZkbkxk|kk?nnnKoNooooooooo֌ #$$13OSTVchoko}./GO'(FW_yUH    :?EGIQU%$+"%+,/n-/>?JMPLOZ]`p> #%&(38:<=ACFHLPSUVX`cefks} ,/<?IOR_fwz HOZ_T_no}8:?KO#3J[_AJ{^C\Jw7]}Cw!cajUB@&n4QIUP"Iwq\-_Ɵ\hCJ9? 4iY3pjNѼ.+ʔב,$42j?+BhO" 9'½[%)<*jRz3jɊ;n!|[Qũi !1䵦S)4S2j.IYbQy8v8LgcUawĖ jbOFڐ!z2(3w Ǿrpi%OLsԴxn'1W/x $/[YI9-La]4ﰽ+VP9` 5Tpv ^7}-y|{"by8q"yD@PXr̔)AQF纱VIoh gRSr$L^ZE+;\xnWS^)NOjcDjP:滜3 5Z $"xE8N>NT/Sﳇ iC{ PLÞQG [~?"ҥa|E^PnhD6 )D.1=(iHfN`oQA'Ga}Bv<xI@wlFDq p[Gem`xqWn3bnGNR q8V$W|TSgTQY"R=:+8HL+P/hǟ ?\&Xk@ rRq65Jn\@0ǯxיXI qN/݅gpb#a "$#&&P{=!鮼 |Fbz?:7yEyRS@{(ڽ ]QGP27~ ?39>dd[מגX!h!1F{:=j+6g<^9*vvos1PY3$m4@qƤsfnKSA Erj0, XkE)j b\^9鸩NtHᮄ\4q:2J(R'o;.NF`g#'s$Aׯ*} }9,TtB%@f4YE" ڷ9BAVU'(d=koǡRlf*dcJ~Xac6 9s;ًiax=Wɝh:35RP-Dm[1ffe7QhTFp7)]((DiuN#CA)Oy}h UA?t'0FEh#9IZV6a=zlpJp@:ޕG5_Vٸb4IAS(S:oF%b(KcfqjQl2@z$Zf;ZdҀL+":XM=c/ˉ a 9] Ĕ&`ӛWfBX2b/8yY'V:ِK/\];5kvʃ&_BSv@+<]4rdtAxN>/wxRB@b+)N*8S|i{$WcI6k2\d|{g ?ƸG9ptyܠ#wnɷB3' 9[h'MlT: yg~ "I~EMe(]XlC]y2E߇yzVǣ(k 'j΍Bi-U’]7OC̳|<٫^b, ^h[8Cpj\˰'cA?ɨRT XT1a~uL DMk/`6%&Ն3rpͩQ$TZe( 夯$#%3|_B^2+@a d_+<~A>k ;YhIVuL6b* :g(`y!W+~$Q)uJ+%2H5'Mv:Dgw}5l<y5[k'[(c%{1%}B#%h~<_3Yq6*,29CҲ~ Gb_BG[Pc?IlAk"|Or$Z= G 5)=eX( U4+\Bx6,n rypr!li6[ylRb7ygݓx koQu4g$L&Ղu<Fu{⴪\?^%C=D(HM 9"l6#)\_*Tz8d 6G_ Z-ȸhǬ#C %dyZ%Z~=sꤏ<"yuх!=afNgy?*mURmG*mhP#] [w6^e}tr+*k%Csbk$<-0K#1 ] aNO3l6e%9m8+u~`q`l|=/iky* +۶+[$[?`~Ey1\3q4U^yuװw'C,f!*EInȱf=B G.aow]>:?qnGxį@xq$!j߶lN@gve RQ^q+zkA6y/+3C{]n^D ;,7)=O2O)ӄ 7V NܧV|$ZxeGD ]];be(jq0/v׭4xpەuCt92o@LmSЗŚSRYu$axmc*K"?7{F=~kvbk]vr!x:g嫂~4l@vs/ޚLЧ~wMmG=K12L =C&ss:y2nacfO4IDܾT^R A}ø@'YlDNGXn{,T\0{*] 0Gy}9Ӷ+p|F 6ڴkBvSy`CܘόdO2I#(7HPm vOsE}SBbYh+@`~ daUH1uyC;wonfh(4rU֑TTew>oGIUy\cb?9>g""m~cf~f78诤Gג߫jO2)RYtu ё|ؕ:S|۱sfFfhp$qKM C,Ue1X#HX 〽w'rPᰜ]HAq dx9dk/ ^BPg\9L(BI6!w_fQĩCQãQ(y$( [8 ưYJ)Xeި.8Ǎz̖ZSt;^sW~%1: 9  !!#$ !"#$%&'())*)+,-./0123456)789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ     [\] !"#$^%&_'()*+,-./0123456789:;<=>`a?@ABCDEFGHIJKLMbNOPQRSTUVWXYZ[\]^_`abcdefgJThijklmnopqrstuvwxyz{|}~cdefghijklmnopqrst'''uvwxyz{|}~     "   !!#$ !"#$%&'())*)+,-./0123456)789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ     [\] !"#$^%&_'()*+,-./0123456789:;<=>`a?@ABCDEFGHIJKLMbNOPQRSTUVWXYZ[\]^_`abcdefgJThijklmnopqrstuvwxyz{|}~cdefghijklmnopqrst'''uvwxyz{|}~     " eJߴy`ȡp: H?D'E+$ՓtLPpC&$x0ԆBdJߴy`ȡp: H?D'E-$ՓtLPpC&$x0ԆB3dE4(agy>|r_BӶh-`>[ͯ YU3 vE*g*$t!0Yj6JsP9=Qs +G<]9k]A0>%,Eg@2Iʋy+3­b-;B ^ӘYr YLchA8gOƲk=K.҈d_v=eu}@K M=-%Y\E~,87d(r2E6o ~X_*2@,?]$/PNPo20H(C8S9`u4WZ^"Х$(X96#A+Z%?L*Ro/㈁w|:~(9#y\V˵Hjm7`l5IKF`ySgACq"d}Ղ@!}?)&'9B7 hz?E7s025Ϯ\hn+ރDt.J" k)[2 ! C7=y%l"1*U^ێ.9oqq7bt3[%G::]L)<\/ +gPz )UA1]7_ mY<{u,< 6xȊ,/W,bW8F;Bgrٖd,U}l,n'fsy)v˛ [*oloK8f1cÌD%{9*a%_f8>ќqI.{kz8q{.S%ɰ3FOw [*c{W C!-j8*Fƞ+F tgJµXI }s.1t5jCsCԳ?YeNT^~)ms4TT 廀"m'eo~5\. Hz(q֭:t^|·ȦɉG$윑 C4 dNHҕѤNA; xTWO Ϝ;3 T>W&ե+6#iGPdP5χ0 P%h¯/6_G䈬Rascݙ [^*%. @U}1%:igc։.,Y_]nb6Yܤмf#9k*TC2@c^5Ÿ$ sգ+U(|O ƒxq`7LӘ:5`-.edr ecAd0:{ yY#;.P0.qP6J6R%ٮg وFU#h uk f.&dvŤ5ҙpZ=;$"r+ ^1"MxHrҞ,$b(9 :X!.ilnaZ+H8:ʼ-:q2&f;S簑LCr D, ZQCc#1Ff̞M"o楂e@eBxe ݖhEUnw>?m/&`(:Gh($%T`ۏ8b+}s )*S,ZױEs2tD s<±.z=-Y6Qkڰy!ey*0-U%]ԭ*tY$~=iq1fB9~ְ%㙎[a.mWqAo V>. M̅,Gq6j/Iij'^ "`^]Q')h!PMp?ۍne}_lY&pK߆]7 ҥ׷Β<dž*QyI".Z\-U46 eFI2ӂLaԞZw.~ybJi(r%Fbj܁3ܺ J5J+иJmf{2;c=\`[rI r5^ڀkd[4T9<)2Ʊ4wq O[).&qxFevQ}ԅ1C|k,ʫK礊SƸN܉+`RoUkogB&Le#){͟KB uÊUG]: ;~Ɔ'Cҍ"1Jx Ԁ R`-V=V'+b|k, |P<0g<91{Xv]] 72`3 3!ÔԆI|N qUѕCkt0obedfamԮr7(R9F UGpXރBP`K߿}~1]fc-2O3˯ GB"H}=YO}@M$! \V^+x8.Oҳ-qѝ[5hgǶe51@0Ye]ixxyd$Ӡ T y Mޟ@$}hi4gL;M>'u7'½=9)9/K$!prɄř.̕d'L' )lM3?Ld'zPm]H`vs8Eb5{f-jaPBY =S]j&-njPmQLRn tV'"V-ۚQxvI,~mnǟ yr2rI  0rGI̱LMm( .ǯ)sh47:=smύqKgqVr/>PѴ `G;v,NZB W94h~lv+HDD$2Do31ǵu$.Z_.Ӏ4gj&^ȝ,^l 𳿣Xx0WY| tiAؿf=(Ge4jAjĈu# Ri"= Xj†E҇dDOCHJ ʔ/#[lDfSZ r(Xs"^ V^jnh/7$[**@L EH78ls@lViz3iX+/XA٘ϹAJr(khtyERn5:oNvg#ݯ 8Oe*~ƹ=uG~w$'NRU.g25Raj LBF"P x @Ժi KmIW; 5k;#,rHHs!n i`$c uQ}yïHO11HB+<"nzd:2*r,x^zunrFHb(XY*D6$Admqtγۺz6E<a&PPŃm^3p;1՜Ģ"i /YD.keapذ#=F) ѡƶ޾`c$W8"]'!OczVjPlcl* 1@%#-tt|Yc.<[V<A` me'hCDl "5m mdLAM8%b9j7_)x%8eU@}H,|~` mbS֜+G%pbebYfxUˣqtbZWyr/{D_H2m:t;46mi|N;j%a5F랕Z&rrYYI~@ZMȠ4{4󙿩y tN˼Qm3Ţl$qhEs~u|uZdb3MOb-ץwjZ2NG՚O΃[4>G|giWAV /T\h,Ss8Jɷj>3M+*mr>4h' 1 eLa%ԉSC7XUd!L5J&`F KJb Cw% ^GPit׹Qdn&kaJm|C#Spos .F3Y|ouYu6Mw}JŻ{P_bfqŀj[o+-s.U6$  v.HM~|*C(XȿOF HU9*"MqUh%nRL3?|'53 uiba58gy<5ܲ>-F27#u*=00G0GGG#1(1G<1111HE2h2m2 HHH222PHv333ZH3iHnHxH/444}HH4444HV5y5~5HHH 666H6603G_H030304041 4 14GH21>471C4U1a4F1R4n1z4x14}14141414141414115 252$52.52)5@2Q5Y2j5O2`5HHr25|252525257HH2525:;1414(HHw25a:;Z:;o:;h:;:Y<:=<:6<:K<:D<:R<&3<636%;<;<3;<,;<:; ???HH)>9>1>A>oIuIJJJJJJI IIJJJJ'JIIY?q?a?y?i??IIY>q>a>y>i>>II????I!I>>>>II??????'I>>>IIJJJJJJ-I3I/JGJ7JOJ?JWJ9I_D7eDcIkD7qD8wD8}DID>>BBBBBB>!>B/BB9B%BCB)?1?CC C)CC3CI>Q>MBkBWBuBaBB@ @=C[CGCeCQCoC>>BBBBBB77>7>QI>6707$7/D<7W6?7!?{I9?B75DN7;DZ7<<<77A?%F7Q?r7l7`7AD<<<,8&8?-F8828?777MD76)D?88?I@~7GD7YD7CG=N=U=\=0j=c=00q=x===============I@Q@Y@a@i@q@y@@@@@@@@@@@@@@@@@A AA@A!A)A1A9AAAIAQAYAaAiAqAyAAAAAAAAAAAAAAAAAAB Br R && Z>  Zn>ZBn   r~  "JN zr&f>vF 6 . r&Z6J "Vb" nR^ *n 6Zr   ^62 R &NBVV  * v:v2  ~ fb*fz 6  6 J 6z ^ :Vf^*NzJ rb nr . *6 BF"6 b *b >* ZBRR~ F f2"^.&   & N  " V B^bvjN.JNR&RvF R F b j R2bJ*FNJRVZnr*2:Nvb "VZ2 KFB ^ F 2 B ^ & 6  & V v  Z f n " VNb~Zv2*Fv*R":N>VRJZfFf &2&*.6"tBRV^fjvny2^   & * B F R ^ b f n        " & . 6 : : B J N Z ~ b f n      "  * 2 : : V Z ^ f n r J z         2 B B R Z n ~     * > : . F N b j ^ V r z v     ^ & :.JRVB^bfjv~ #(- 26:NJ7.j<An~z~FPUZ_"26NRZ^jdinsx"&}. 26&2:Vv>BFJN&.>RVVbnvZb. f: 26":Nb.BFJ jjnvznrvz~"',2Jfv1;@E*2J6bnrj~OT Ychm&&.rFVbjrw|AZ az yy/00911279HJwxxy~Oaa88  ~"3::+*;<==]>>(*?@?*?*ABCC=DDEEEGFOPP**QQ**RR**SS..TT22VW33YY66[[55\\OO``33aaKKcc11ee((ffDDhh//ii--jjDDkk))llAAoo--qq))rr++uu**}}))&&CC&&**&&''%%EETTpsvw{}t&%@?  ~P/ 0OP_`/1V0a```  З‰‰@@yy}}88A '(/078?@EHMQQSSUUWWYY[[]]__`ghopqJJruVVvwddxyz{pp|}~~   &!&!*!*!A+!+!2!2!N!N!`!o!p!!!!$$$$,/,00,_,`,a,b,b, c,c,d,d,e,e,f,f,g,l,m,m,n,n,o,o,p,p,r,s,u,v,~,,,,,,,,-%-'-'-----@m"/2oy|}}u~Z00ZZZZZZZZçħħŧŧZƧƧuǧʧЧѧ֧٧SS``p0h0h!: AZ'((O(pz'|'''  @   @n_n `nn!""C_ k4jVO+u$KϲBQ hiujA xωV;X*`ZK]t)422/d4gEJ*i0Tqe/ε*/Q"h%N p, 7Cn贘7.HQY ѵܟv# rt!8)Iz8"Tk@ i|bi3G/z}ĸ)K^ yz)ȧ~ʉ-4Q ̦ݾgt/+1Iȴ= MDƨfDdhGn|=e>+X(UHG,qO̕]gq)ux<-h3b;|Jl-IuO/Ez)ʨ)Ij n" q_ܢehĽ΢y/7< B"cI 0) K7)|>}V"W.KZ-s1 RbǃAPSà\Qn6)<6ɪ%"2ELjrL0 2h?ŁMZ ]gӃuD%+l.|F5II@fQag<\~3ArYR3ՒbjUu8J ?*S(bw{D\C4a$#Blz%lW09u#z@Z)٨]m$C]R Eu=s*G+} p'W9|H7~˳Tu)saӖ1A[HȕҌGBLNVfKZ ʟrN.G_QCzeUz\ *'V,}/Z#|(Y-Њݘtd/ĴtEݺ:eg8@ /E 5'e bd#? O[L` zc>cjzLY wo XyS^$MN2@h:{BO#)Ŵ9GOcPJ/CW\@C(c=a~w)6tsF>4Q(zy, v0ȍ#N`Ho,7# =̑|hzC#؛sQԉ1A)ŻyOY)Ȼ󎼮iZHA,4 $JX@v FyzsxǺ&_=$U؋`*cDD&CK|󤘎v{!&|Bo`o)-z;0U$8O9(iXz<jxoY0 grl="Hr AU;! Ze{Aƴb13>Ӗ Y3S^p ^] @2 qKmJTޣ b@6(EuΔc'ORr56~g&*uE3LypG4%]B΀7;QZFZWy>PK__"4v2'ngoPLք=6u!;m-?8@g:uO 3Go>ɺD&}8\GbnjӰ#>怒#ZC!a2|6 [Ž\Q^jC;—GJ"ej4f4Png9o_ix0JFEwmMD\N+uy?pG&/ FfKdiץ}w|R/ιn֛(?>KҮ&s7~SJM׽ @-iT|KOF^R)tՅP,q2Iaѽ s_H-M} 2-2s)#%pu]D<|4۟u!o4S]gJ q:P@m wBf39?0 UWA>A}nm:~<OgГ2%Vn9.m loLnN̿0YipiL ЗMNP͵݋6"h/ceS ?fB=ba*n,15 sI]'A][')OϧIk ġ ǻs/c n/ /*g%`5"w?o̐ 8Wu,Y#ZMi=t{"hpU~عy,?΢G!!m$fpoVoZiQ]vnE)#hHb{l+:(V{)ݸLsR7gnNfĠrN?foN:;iEÞ!< 7Uǝ=ʓdSQ$hL@c`T*@u W6YWHֹ0CK D3Q kX]h"8L/`՝ OE7hT ^*,lK[] CuٹZ07SƬrm 4,JՈGG7 񜱢lqfTC m2_ `OHȦJ&Ef}9n_'&`1 2H 1Vg (g?. 0GOmVr@]:~zTYq&`0g!i?"+Kt3Xф5e#j4U/swbyM@VΙ[/P“:%G ?gN[L 2AB ۅ|_Ε6"B"ǖ%F<^3~Z4Raވ\T!wSGxB cFU+ :5NV ᳨ir?p2hx9.ٶ9.S,R͒ͅsh1f'-VE 6&\CvEUnp}Y47rz٩\<84r7nhYFȨktqr٢~cQo&&ap\TRT.J[o5[SPQxEk>,پ(aw (4ä[HKpsBpYAI$rҌl9BNO mY{cz=VE E0ҸQwH5KC]!@9(wJa^A)Rt}xÞLn!> 49ʔ q(u\$i L:'4q $j0Ȱ0I|WO˪}e.tb}0HlTﶶ.n\q .OeX&n1-.?r}I@/`Mh04x![onw S(*lU!(t"|1 X2T:Bht/dNFJ:Mw7)!ne؈|$9_W@`' WGxK^FΘ+ \QmGt# GN D:_-8TgO<ч7(2/M* [sAN aO/H4!p ]|VIUoГ~}y/toKEq,sZX >\HW(tQ.H/ۏ3Gb׍.`Ԍɴf:u}6;$;'Թ1jIߔ(=orH:K~Kn%\\EK<Ƭtebt )E@o.:& {d^Pjuʝ:(ܢC6vSS ȷB~9*O:ַ,^c;c6gʷ*ml7Őc`i V(>苌*Cqq[=ô_`C* jg䯍X{Š<& J*Cߩw{j¬rΑmoj|Rlw&!} Ff7B wW/Nt)dԢsW)TH0(e6-_ײ>A֌/ AJXJRLx+2x13hŸhieFR2-x5%׌)TtMj`B:7 f F RHR$X+q^_*p%wJ7xi bIlhU٢8!>k\xTJ `x0VtMUB15CF"ǘE`YDJIV}F6T">;ItRF͐SN,uf 8#PtKӅĒaOa[Rvg5}i:f< f-^\&~~g|RN]/I6÷R |M{ZQ Dڙ%j&UHġoB~0e{'J2ߥ6bM\n aBR`~PIa,Z(؅v"|}+p炥LP©@d1X.?p]XI [ H b-Ϝe|SϘ:b7֤ѨVuQ q_r3М(iDg,e:lMt_XfωRcH;jR5F\>ET 2Ehg\K,-@]T@JFd$30k5'ō,Գ0$PARi=sYBZ GSAʊlMa/_Af'QM Yܳq~*ZDY\2/^B̿U] /uq -^^41L횚͐~`f .V-ʸ Bn#fi͞ O ȝ5 LQ2*|HL߳[~X\U=)}TÀͦ" sTmM;Fo[S(nH`F":8ynE3،8!*y\S"C^?O L& -fr_b^+FM'P|kCq_C9g5Mq1)U^a 3UNݥGyWӁ=Y?IaN'ʬi!3{~?B`J1'(- Ɯ%lT]K頔ɭy;J:BEv2JYYYM.JShI `IB,U/eqSЭCM N]jLSOEao,YPKn%TyYDC4kGձ]aa4sd)Q 5X!C; L|/wھҗjFB_q_[NCAq .s| hAN5|HW*VHh:Dv1P&6 SydIVA/)I32ψ}Cߕd3] jrFY2X!9bB钵K'H)ŝ`IBW_u]͎,8m?x]OBã݌D۞{76ȴddP~ p% >14{ D0HzFDSm^p1pLP܅OȊiH#@݄Rw*lݖ53(hWx;ޑz忸aX=oB[dW'"H&MW5i:KPhÞcWrAd 3Phӑ#A0  ٷ`4,ߏ"I+r͑ό6zhJYl401eI"'d~Rl!{y4ho'#~uy^:U`Zn,";tMmFpUJr fNW%+0:! >>u9 {3Fhw9_4Qe` HfU'HEXC,5r(`R;!j4ۘ~M[pϵ4_l.u p:s}ŵďß$%V+=(T`֝OiǏu9Fⴷj GSrZG]:/hiwv`F/@Ntʹ-:%ZKJw=8\,9jY.$ݢ"d_G1PLb?y4M@aPKɱm׊CU k/Xqp-hm/ga7)^neE`ØKqDutĘ}"nmiuk@ -E* qy4W*Q{܆OƏ{5kDCSfIYr־N0ߺဖᘞ5Me      }Mᶶ3ᐟဏE@ 1@@33 333@@@   3@            3@  3@3 3333@@ 3@330303030@0@0;@@0@@303@@@@33 30@@;0 @30@@@@@@;@03@3@0@@0@ @33;@3@ @@3@@ @=333303@@ 03030;03033003 30303003@ @]@]@Ἴ@    @@@@@ @@@@@@@@@@@3@@@E฽@@@@ 3;8@38@ 3@@@3@@30300303;33@@@ @3@3@@33@@ @3030@0303@@@@@@(@303@0303@;030303@3 @@@3333@ 30303030 0308@3@ 3003038;3 30303038@0303@@ }@@@33033303@ E@E@EਯE฿@3@@Q@Yaiq @) ~2 9 @@ဏ@@@@u௯@; @@@@@ @@@@3@@@ 5 5 @ @3j r y  @@5*U*u**u****+5++@ @  E@e@@@@@@3@3;3030;@@@000;3@@333308@@ 30303030 8@@3@30303@330@@03033333@0300;@ @@@@@@ DDA m@DD E-E E 030300;@@@@@@ ME MM KO -U -]V] kMmmp@@ q  smexoyQAi@@1q  @@@@@@@@@@@@@3@@@3@@@3@@@@EဇሏEᐗ %@@% EဇሏEᐓ@@@@@@ @@@@@@@@@@@@@@@3@3@3@@@3@;@@@@@@@@@    3@@@@@3@@@3@    3  @    3@              @@0303 3;@;3@; 30030;3@3@@@3303;@ 0@3@300308303@@ @03038333@ @@@@@303;@@030;303@3@030303 30;3@@03@030;33@03030;3@@@ 3030383@@ @30303;@@030;3@@@003@@@@ 03@30;0@ 33;303;@303 303;@@@ @03@30;@@ @3@030303@ @@3@3@3@3 3;3@@@@ 0@3@030;@@@30@ 30@03@038;@@@@@@@@@@@33@@@@@@3@3 @@@@@ဟ@@300@3@@3@0@@@@@@@@@@@@@@@@@ @@3@3@33@@@@y#######030@3 333######@3@@@@@33333@3@3@@@@3@@3@@@@3@3@@3@ @@@@@@3@ 3 @@@@@@@@@@@@@@@ '@@(((((((((@((@@@@@@@@@@@@@@@@@@@@@@@@@ @I)1 @@@@@@@@@@@@@33@ဖᘞ5Me      }Mᶶ3ᐟဏE@ 1@@33 333@@@   3@            3@  3@3 3333@@ 3@330303030@0@0;@@0@@303@@@@33 30@@;0 @30@@@@@@;@03@3@0@@0@ @33;@3@ @@3@@ @=333303@@ 03030;03033003 30303003@ @]@]@Ἴ@    @@@@@ @@@@@@@@@@@3@@@E฽@@@@ 3;8@38@ 3@@@3@@30300303;33@@@ @3@3@@33@@ @3030@0303@@@@@@(@303@0303@;030303@3 @@@3333@ 30303030 0308@3@ 3003038;3 30303038@0303@@ }@@@33033303@ E@E@EਯE฿@3@@Q@Yaiq @) ~2 9 @@ဏ@@@@u௯@; @@@@@ @@@@3@@@ 5 5 @ @3j r y  @@5*U*u**u****+5++@ @  E@e@@@@@@3@3;3030;@@@000;3@@333308@@ 30303030 8@@3@30303@330@@03033333@0300;@ @@@@@@ DDA m@DD E-E E 030300;@@@@@@ ME MM KO -U -]V] kMmmp@@ q  smexoyQAi@@1q  @@@@@@@@@@@@@3@@@3@@@3@@@@EဇሏEᐗ %@@% EဇሏEᐓ@@@@@@ @@@@@@@@@@@@@@@3@3@3@@@3@;@@@@@@@@@    3@@@@@3@@@3@    3  @    3@              @@0303 3;@;3@; 30030;3@3@@@3303;@ 0@3@300308303@@ @03038333@ @@@@@303;@@030;303@3@030303 30;3@@03@030;33@03030;3@@@ 3030383@@ @30303;@@030;3@@@003@@@@ 03@30;0@ 33;303;@303 303;@@@ @03@30;@@ @3@030303@ @@3@3@3@3 3;3@@@@ 0@3@030;@@@30@ 30@03@038;@@@@@@@@@@@33@@@@@@3@3 @@@@@ဟ@@300@3@@3@0@@@@@@@@@@@@@@@@@ @@3@3@33@@@@y#######030@3 333######@3@@@@@33333@3@3@@@@3@@3@@@@3@3@@3@ @@@@@@3@ 3 @@@@@@@@@@@@@@@ '@@(((((((((@((@@@@@@@@@@@@@@@@@@@@@@@@@ @I)1 @@@@@@@@@@@@@33@S`i2Տ\ B噜asRU^RxZGv\cҾ("J382t/)?;)?Z;S$YJeefXI- y]v>ᮺsy,,SoΊߙZiKy+ؑlHFq6N%#MDz 0rxjm5Q^3-O\5x,#Gf+1̯!P;LvU0 =*$Jߓk<ܭ 4mx݅KbSh@drk3o=qԇQhˌɩf%H;WK`0Kmtv-^85A>~;ΥuLR5]JBϓ CszΕ IBNww&Ԧ`fʴ"U 8G5U]_nUc^s 4!b/6#u{+ջCn6%!3G-;eUk niԜ %Cpv,n% DH(W^j8dW*͖7Ƽ>'u.h3DJkq!jz~X1[Dd)غ`YLhr3)$oE=VyԶӥk0bЏlwHijޔ3<)). %I qM^o(TPa,J2q\":1n1'H cmƚp̻, }x=M֥`%NFN *!&8#Xl᮴ fo(,nGMȟPEyۤ̂(}eC2f;^j@>Ծ@J6VcؑDwZhN"uO>6qZS >D[Z U1(\Q† yX葀r9Mnbf-!= -@s]Ι 4f|hNr#j9 bf'NDGCɨbK"=`?woɦq!M8U"|Hj`FS*~+TmBDt.OSU9zc%C1'~U5yX=X4/UKc5u|&o<%y^Fˋ#w" _uv{fg6]I@'᷂YyX7 1 ?gjgν$m\,B`A֋nsXmSx@I̮jPu9Hh[BRm-^zy;Ӧ{xd J2_`U\&;\HH/oJ&$ڔ;W`X=vWζ]y+zCB,Z[lS*xP1r'0(d$5VN1J<왾6w6^F?nY{U(ω/3&t~W!v]?OH8oꖐSkuzcZ (YImM\ٻ-qd`3ϪMy4,9UgAwGDrĆ`I,"u(19b7]k62c}:%˅tח1]dqӨMS{$crf-bgmYGB`=ހtRx Sal'.gVfQp[yͶSۣ2Fqk(󗿗φͲ"a}ȁ_ Wkyl]=;t60c1ÜD۾`wD-HU;մJM-u-]cxZbҶxF\4|q* 4M=5]z Y`tWFK?p8+׬XҘ'Fc{#TwBձL;,)UdJ_ wsj=r{~T>*bC#Oa鍲5*g8Ԕd1Ӎ@~8<vJ)?@'D|Y+(0TX0tx>ݔ<6Rj20:'Dܡ?^:)巧`Htޥ!d4[IV֑f4 ʕ%ΟkB@OQ]=;i‡FQ* k)XrGVieg!Ysۓ,S>ih0PҸ:BAsUrsONdP#9JFE߃b}$lۃ2kr]ΖKde2?/nO|{S ȢUra6__,tuE7#8H,RA,ZQ;"sMH=`>_ Xf&1ѷ?RpIFwϻ3ӛa՟k.dȂS|nǰsƣz={ch iN\ ->!Qab OInHiãۉZ&ޓuZF)v:k\m#X񗳻e 3R,.X}jtYg+WN¨@8H۔labMPF wfנ.t `2$^V$ il`#c?ʏū|0ks]|d|Fk:Bzk ,SҘl.J{qDw`zdrIdGJ|l_bϛ= -]:NJy4yxӺ9QX*r`K6(eNC2)b"=s>'=z_R?Z}5)f&ϰʨ&4*cݓR04`Cx g|A8?, LKK6)e^y 1cJFM}e5CENKP.?q/^9ϛdLZN'sv]pÂz}oj:U&N6U (&.tE+۲Ꝓɋ ;oOFkȒD7@n ˻zj B̽ܝY-#JFTW"GdeT-V+~xY~)p$wZU|Hihaέ["RDù?BrAggɟܥ k`ŗ T`鸶h;#)8>G#g$!e r v6i>[ΛpD0 ’sHo^+Ʊ;Hw 68(J촰c%2R l (8Z~HW_S#YQZ-7yHelE1D"'Xd˞k?/"=~Fr6-j[wŸG꺔R̆$bGט#?9': dҬ$0hS>-_Uj[n*uRDZZE dug.k`MFU=Ķ{s휆&|VsJyݭ'vcR] X`UY~S|n𸪯qޝhp b!q&" ŗ{`=Ui jP|};+*\B`w[zY78U@gf/Flk7._=;K##⼺;1a ^wl}9!J5U"ST.wAP~uu\T Ғsi$$dDKN^wÿ-> ;ZJbڗ<섎ꊭaнK'Jg9EpCK,΁My%1^_B0CXn >;5Snʋ }4Ud^wH~t*J6ڝXv%"݃:QӮB5yrjR;uD<u'm8c$S,^{tPd2l1+a}JϟCb.2:]‡ I62wyh.L[Mľ K7٬:|S\ 5$oe(KB.E.D?ˈPo ̼H9i$ MZDs00 h16A_p=|6+ aw̫Liv2=BzՔI?il7Sr3܀#GGŧN@a+eX&1Zd;Onp= ףp= ףp= ף@P$ (k@C*焑 1_.@v:k #NJbxz&n2xW ?h@aQYȥo: '@ x9?P 6NgM"E@|o p+ŝ(lL672V߄@<\l: K{ΗԆ H½D PvU1P?]%OʡZ7и@=J'ƫ͜mCư#o\{2~,݋] 7 n0b/54"&EE=!A+p֕C)@_v $_E^D+S69uq`D]ȩdL1FUJ:Ack݈-~<MXdQpl԰k2#FۄEk0ScgedF|~`?~On_O83^Iwm,ӿ\U /ssc*Og(~MTၲQ5F&B|Z"e B‹Xixu3_FiYW皮dR7/-#]gk}{x F6@2cPME;P fδzBΨ?]76l3oߌGA]DG #٨tY l*/h7ȇCØE)wyTzm)^Tj fX_4'R⌏.]^EsCupv]dB!ܨSyJIj~IrhcۇiEB<]ҩE֒PֲE# ś[[hwl26h& C2d#DѸIDvja5 bl _ӨŹzÇ67h͉,TIIdZk"!"lk*Ǭ唔o=]S59#wˌ:BnSv*xriJh %i]_fX~ь[eaz?w/8y/UJX8σS*g].a{tZݲ\*q߈=9tau]V7zGѹ: Ub" `M1k{W+ ~Z픝_vIsX}Aȏ%زnYzdұَ_o_FTX H{%;#jVJ ,ڔQ+(B]D"ySJt:5(+EWA\Bu-/ں5ai .|]|i~C%94›^g.²xº}DKa2si*bd2u{}(>DRs\x5˲dj:aEz®kE='WT[rKxT6c? <ݧjW<Ϗ(QDme %JdCYxķ ]=apeFU Yy "WB$ ˇu/Sm ξTSܷmh.$*(弇Di}nVyu܁7UD`ג{S⻅jU'9pxtmbCF'z8TfAX1{jiQ.DA"&v'ZҪ/ iyhx{RMh, XǂVpEa75 . @v`|BǼ5Гj]CMĸR5VJpz3zrS!{Z\L.YOt֨Ysyob dp+EV݊>ԅ6+>m.7J7̶șŇ" @Ա K ж%YJ^MdD.:0ܵ\$~sީqG_,>%t]V w(N/ukPopk/t#[DzT%k$M,4xߎT¶@)s$ Уrt-ČV<ڒez|/~qeݍ~e>"t*U1Vx_':5k\(37h*VFs-Ciu+-,Ws)b);gj{IB_s!6p$wqBv/?ӌ# S@J286c]ɞ>CH|Y{ ځo&|(1ca/r}c%2t.5_(o?0:ͳ[cрyϧz^KDb2üfQ6^U+Gٍ@4õjQOP4c3Vnع^G/ O 5X'a'bbLBx8}Vc G,ݬ@!tlXxP]C 7 RzRT%`ϖi *.G|$ PATW3L~tґR?GQ.G#wX嘡cHv WD^/gQe,s?5;X^~OK ނ'aB.cy9'zխ"xR7t8DZJٵ "Ho·"MPu8벚ƣJy©Qa_A33Ӽ(ׁl"M"sǥ 4k"hk9@fu)/ ZI`So:K[8h#`^ʵמrFB,8,Fj¢l㴒$s ǓbwRŧmO˸8ۢ:g(3tsɥDm@e?S.R_PD;ϕ&wd C4>04x^M Ɩr =A}_Lb%xW[wߺnYb47>'6r  ;~"6汧 O:!UWʏbO∩*r;듧EuϬ3f0rIl|j; hۘs*hیC?C:ԑy!YkO jHI6.iyF㌄ 9NDN @iꅕ!o!]eqKguDid>00G0GGG#1(1G<1111HE2h2m2 HHH222PHv333ZH3iHnHxH/444}HH4444HV5y5~5HHH 666H6603G_H030304041 4 14GH21>471C4U1a4F1R4n1z4x14}14141414141414115 252$52.52)5d@2Q5Y2j5O2`5HHr25|252525257HH2525:;1414(HHw25a:;Z:;o:;h:;:Y<:=<:6<:K<:D<:R<&3<636%;<;<3;<,;<:; ???HH)>9>1>A>oIuIJJJJJJI IIJJJJ'JIIY?q?a?y?i??IIY>q>a>y>i>>II????I!I>>>>II??????'I>>>IIJJJJJJ-I3I/JGJ7JOJ?JWJ9I_D7eDcIkD7qD8wD8}DID>>BBBBBB>!>B/BB9B%BCB)?1?CC C)CC3CI>Q>MBkBWBuBaBB@ @=C[CGCeCQCoC>>BBBBBB77>7>QI>6707$7/D<7CWCCE?7!?{I9?B75DN7;DZ7EEE77A?%F7Q?r7l7`7ADEEE,8&8?-F8828?777MD7EE?88?I@~7GD7YD7CC GQQQSSY]aceeeu<uWDEGKM[ lE$ZI^#j#$F##R####X##d##$$SmxqYGI[H| G=N=U=\=0j=c=00q=x===============#%')+-/13<EKQW$(,048<@DHLPTX\`dhlptx|CEGIKMOQSU*~2 Z j r v r  > J j v z ~  . 2 : > F N ^ z   &.nrz~>~BJ^jrz~&.jnvz~:NRZ:>BZ^fz~I@Q@Y@a@i@q@y@@@@@@@@@@@@@@@@@A AA@D#DA'!A)A1A9AAAIAQAYAaAiAqAyAAAAAAAAAAAAAAAAAAB B'Z"&n*.26:>BFJNJK KKKK"K(K.K4K:K@KFKLKRKXK^KdKjKpKvKRV^bfjrvz~v  *!!!!!!!!!!!!!!](f(o(x((((((((((((,$,!!!8"!"!"! "P"n"h"\"">"J"b"V"","t""""!2"D"z"""&"""""* "*26>BFJNY/a/i/q/y//////////0//v  Z FF Z>  z "> z R F :  !$'*-036?#2AP_n"""4 "&*.26:>BFJNRVZ^bjrz~*(C,*S,)%0))i0*)))+ +*+/-+:+,'--c,G+.-A-T+))/a+s,60**n+*%*((/*9*T-{+,g-+M*C*}0+z-W*,a*+k*+G0+,+(X0u**+***,+(-/,+0**+( ,,#(-* (7FUds""""" ##"#.#:#v#####Dcw,08(F(1(?(,zbJ#u }eV,LY/q\2l$DTp(GX$,$PxM((t_hM&kP)\}f%$x{5;>`ASht$ $-<KZi"""""###(#4#p#|###########@r R && Z>  Zn>ZBn   r~  "JN zr&f>vF 6 . r&Z6J "Vb" nR^ *n 6Zr   ^62 R &NBVV  * v:v2  ~ fb*fz 6  6 J 6z ^ :Vf^*NzJ rb nr . *6 BF"6 b *b >* ZBRR~ F f2"^.&   & N  " V B^bvjN.JNR&RvF R F b j R2bJ*FNJRVZnr*2:Nvb "VZ2 KFB ^ F 2 B ^ & 6  & V v  Z f n " VNb~Zv2*Fv*R":N>VRJZfFf &2&*.6" 8<DCE #&1E7E5F=FDDDDDDDDDDDDDDDDEE EEE%E+E=EDDDEEEEE!&&J'J'''5'5'.'.'<'<'C'C'C' ' ' '&&' ''',;@EJY^mrw   + 0 5 D I X ] b g l q v { !!!%!*!/!4!9!>!H!M!R!a!p!u!aEgEEEEF FFF&&' ' ''' "',1;@l q !!!!%!*!EW!\!a!f!p!u!&&&'',EJY^mw  + 0 5 D I X ] b g v { !!! !/!4!EH!M!R!a!k!'',6 ! !a!k!EFMFUF! & : ? N S chOT|   ! & : ? N S chOT|     + IEIEA$V$V$]$d$y$$$$$$$$$$$$$%%/%/%K%%% %!%!%(%(%R%`%`%g%g%n%u%|%%%%%%%%%%%%&&%%&&&&@&G&N&$&2&U&\&+&&&&&x&x&&&&&&:$O$H$r$k$$$$$$$6%%Y%%&&&&j&%&%%%%q&c&%%%q&$$9&%3$%|%K%$&D%%((#))(),)=%-3,)~57?3333333.......33:6w{CCCC~75?: 9=;y ACmECCCsECyEDE DEDE)OEOEUEUEEE[E[EEEEE,,////2255558888;;;;>>>>AAAADDGGJJMMPPPPSSSSVVVVYYYY\\\\____bbbbeeeehhhhkkkknnnnqqqqttttwwwwzzzz}}A/A/I/I/Q/Q/ nr~fnv "&*.26:>BFJNRVZ^bjrz~KK |KKKKKKKKKZ"&n*.26:>BFJNJK KKKK"K(K.K4K:K@KFKLKRKXK^KdKjKpKvKC>bBFJNfj N&(:4.CRVBX[`ps|eRvjocegikmoqsu  !$' *-0369RKTZ~ol!#%')+-/13!#%')+-/13!#%')+-/13!#%')+-/13!#%')+-/133333333333333333333333333333333333333362,/;D}M>\nqtwPbhVkJS58AGY_e/;z>nqtwPbhVkS58AYe;>qwPbVkSAYe/;z>\ntwPbhVkS58AY_e,/;Dz}M>\qtwPbhVkJS58AGY_e/;D}M>\qtwPbhVkJS58AGY_e9BHNT  U(GeiCEGIKMOQSUWY[]_a'' B G * "  " f   ~  ^ B   6  j >& R >tBRV^fjvny2^   & * B F R ^ b f n        " & . 6 : : B J N Z ~ b f n      "  * 2 : : V Z ^ f n r J z         2 B B R Z n ~     * > : . F N b j ^ V r z v     ^ & :.JRVB^bfjv~ #(- 26:NJ7.j<An~z~FPUZ_"26NRZ^jdinsx"&}. 26&2:Vv>BFJN&.>RVVbnvZb. f: 26":Nb.BFJ jjnvznrvz~"',2Jfv1;@E*2J6bnrj~OT Ychm&&.rFVbjrw|     :*  Z J Z J                                 :*:* zj           :*:*  :*:*:*:*:*:*:* :*:*:*:*:* zjzj*:ʚzj :*:* :* :*:*:*:* zj :*:*:*:*:* :*:*:*:*       zj    :*  Z J Z J :*                               :*  Z J Z J                                 :*:* zj           :*:*  :*:*:*:*:*:*:* :*:*:*:*:* zjzj*:ʚzj :*:* :* :*:*:*:* zj :*:*:*:*:* :*:*:*:*       zj    :*  Z J Z J :*                           @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ ")1:BIQYai                        q5M  =yy=}                       e=}  }}= %==  Um   } =  -E]u=}=                                       = 3 333333333333333333333333333333333333333333  % @@"=@@@@:*UU-=-@@m@            } --                 3333333                           @=}=                                                @@@@@@@33333333333@                                          333333333333333333333  3   9AIQ                            3333333@333333333333      @@  3                              3333333333333333                         333@@@         @@@@@                          @@@@@@@@@33333333                               0333333330000;003333333Yaiqy33300@@@@@@@@@@@@30003333@@00@@00;@@@@@@@@0@@@@@33@@3@@330@@@@@@@@@@@@@3@00033@@@@33@@33;@@@3@@@@@@@@@@@@@@@333@@@@@@@@@@330@@@@@@@@300033333@330@00;@@@@@@@@@@@@@@@@@33@@@@@@@@@333333@300@@@@@@@@@@30303333@@00@@00;@@@@@@@330@@@@@33@@@@@@@@@@@@3@@@@@@@@@@@@@@@@@@@@@@@0030000@333@333;@@@@@@@33@@@@@33@@@@@@@@@300@@@@@@30300000@300@003;@@@@@@@00@@@@@@@33@@@0@@@@@@@@@@@@03333@000@000;@@@@033@@@@@@@@3333333;33@@@!)19@@@@33A3IQYai3333303q33;33333333y3333@3333333333333333333333333333333@ !)Q19AIQYaiq !yQ9AIIq !)1}9AIQYaiqy                                           -M                @@EEEEEE@@@E@E@E@EEEEEEEEE @@!)19AIQ!)19AIQYaiqyYaiqy@EEe~ @!*2:A@@EE @JRZaEE% Mj*r@@y@=Vv@ @@  @@@@@@@@@@  @@@@@@@@@@@@@@@@ "*2)I)1 "*2@Q a!)9A@@@9&Efi A)I9QYaiq@!Qy  ! )1= 9A I] !!} )1 9A I !@@@@@@@@@@@@@@@@@@@@@I)1 y > ^ ~     " @@@@@@@@@@@@@@@@@@@@> ^ ~  > ^ ~  > ^ ~ >^ !)Q9QAI  !)Q9QAI  A I }=YAQ Q Y                  =333 @@@@@'5'U'u'''''(5(U(u((((()5)U)u)))@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ a 333300%))*U+u+++++++,,,,5,5,5,U,u,u,**u,u,,,u,u,**u,u,U,U,,,,,@,-5-5-U-u-----.5.U.U.u.....u../.u.5/U/u///-,//050U0u000001@51U1u11111252U2u1u222 22353U3   u333333454U4u44444555U5u55555656U6u666 ! 66757U7u77777858U8u88888959U9u99999:5:U:u:::::;5;U;u;;;;;<5>5>M>e>}>>>>>>>>> ?%?=?U?U?m?m?m?????????@-@-@-@ @ !)@19A@@IQYA%AEAeAAaiqyAAAB%BEBeBBBBBC%C EC!eCC@)19A@IQYaiqyC!CC@D !)19AIQYaiqy%D                       33333333333333              33                                      =ED     =             q!)eD        y}D}@@@@@ @@  @@@@@@@@@@@@@@@@@@@@@@@@QA e-eMemeeeee f-fMfmfffff g-gMgmggggg h-hMhmhhhhh i-iMimiiiii j-jMjmjjjjj k-kMkmkzz {-{M{m{{{{{ |-|M|m|| |||!)1 }-}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9AIM}m}QQ@@@@@@@@@@@@Yaiqy@@@@@3y !)@19AIQ@Y@ai@qy@    !!!!))))111199AAIIQQYYaaiiiiqqqqyyyy@@@@@@@@@@@@@@@@I  !!))11999AAAIIIIIQYaiqy !)1:BJRZbiqayAi!)19Yai1 QYa qy !)19AI!QYaiqy !)AIQY)qy19 Aa IAQYa!)Y1 Aiqy !)1Y9AIQ !)1Y9AIQ!)1YQa)19!)1YYaiiqy  !!)19AAIQYaiiqy)199AI@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@QYaiqy3333333333333333}@"}}@@@@@@@3333333333333333@} ~*2-~M~m~-~~~~~~ ~-Nn@@"*2~-   " * "@2 : B J @@@@Q .N@nY a i ΀q y !! ! !!!!!!!!!!!!!!!!!)!)!)!)!1!1!1!1!9!9!9!9!A!A!A!A!I!I!I!I!Q!Q!Q!Q!Y!Y!Y!Y!a!a!a!a!i!i!i!i!q!q!q!q!y!y!y!y!!!!!!!!!!!!!!!!!!!@@@! : B !*2  a !I)1 "" "* J  !)Q9QAI 2 !r !)Q9QAI !! -a MMḿ -Mm͂ -Mm̓ -MmM̈́ -Mm ͅͅ M-M-mM͆͆MM @-Mmm͇ -- Mm͈ @@@M---M-@@MMm-mM@@m-m@@͉͉@@@!!!" "-@Mmm͊@@@@@@@@@@@@@@@@@@@@@@@@@@@@=UmUUmU=@͋=M]M}M]M=@=M]@}M@@@@@@@""!")"@1"9"A"I"Q"Y"a"i"q"y"""""A""""""""%"""Q"EI # ###!#)#1#9#@A#I#Q#Y#a#i#q#e@@@@@                               33@@@@     @@@@@@@@@                  @@@@@@@@@@@@@@@@@@@      @@@@@@@@@@@@@@@@3300@@@@@@@@@330030000@@00@@008@@@@@@@@0@@@@@00@@3333333@@@33333@@@@@@@@@@@@@@@@@000000@00@@338; !)Q9QAI  !)Q9QAI  !)Q9QAI  @!)Q9QAI  !)Q9QAI  !)Q9QAI @@@ @@@@)Q9Q@AI @@!)@9QAI  !)Q9QAI  !)Q9QAI @ @@!)Q9Q@AI @ !)Q9QAI @ @!@Q@@@AI @ !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI ##@@##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$q$q$@@I)1 I)1 I)1 I)1 I)1 3333333@33333333333333333@@3333333@33@33333@@@@@y$$$$$$$$$$$$$$$$$% %%%!%)%1%9%A%I%Q%y$$$$$$$$$$$$$$$% %Y%1%a%i%q%y%%@@@@@@@@@@@@@@@@@@55uu5555uu55᥌                              @! ! 1!!a!i!q!y!!A!Q!!!Y!!! )!9!I!%%%@ @!@@ @!a!i!q!y!!A!Q!!!Y!@! @)!@I!@@@@@@ @@@@ @!@i!@y!!A!@!!Y!@!@@ @)!@I!@@%@ @!@@ 1!!a!@q!y!!A!Q!!!Y!@! @)!9!I!%@%@ !! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@ @! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@%%%%%%%%%%%%& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&9& !)Q9QAI &&&&&&'''!'@@@@@@@@@@@@@)'1'9'A'I'Q'Y'a'i'q'y'''''''''''''''''( (((!()(1(9(A(I(Q(Y(a(i(q(y((@@@@(((() )))!)))1)9)݌A)I)Q)Y)a)i)'q)y))))=)))))q())))))))* ***!*)*1*1*1*]9*A*I*}Q*Y*a*i*q*y******************+ +++!+)+1+9+A+I+Q+Y+Q'a+i+ݍq+y+++++@ +++++++++@ ++++, ,=,],!,),1,9,A,I,Q,Y,a,i,}q,y,,,,,ݎ,,,,,,,,,,,,,- -=--!-)-!-1-9-A-I-Q-Y-a-i-q-y-----]-----}-------. ...!.).1.9.A.I.Q.Y.a.i.q.y............ݏ...../ // /!/)/1/9/A/I/Q/Y/=]a/}i/q/y////////////////ݐ/0 000!0)01090A0=I0@ Q0Y0a0]i0q0}y00000000000000ݑ00=]001}ݒ 1111!1)11191A1I1Q1Y1a1=]i1q1y1111}@ 1ݓ1111111111112 2=]2}2!2)212ݔ92A2I2Q2Y2a2i2q2=]},y222222222222222223 333!3)3ݕ1393A3I3=Q3]Y3a3}i3q3y33333333333@ 3333334 444ݖ!4)41494A4I4Q4Y4a4i4=]q4y44}44Mh4444444444ݗ4445 555m{!5)515=95]A5A5I5}Q5Y5a5i5q5y555555555ݘ55555555=@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ ")1:BIQYai                        q5M  =yy=}                       e=}  }}= %==  Um   } =  -E]u=}=                                       = 3 333333333333333333333333333333333333333333  % @@"=@@@@:*UU-=-@@m@            } --                 3333333                           @=}=                                                @@@@@@@33333333333@                                          333333333333333333333  3   9AIQ                            3333333@333333333333      @@  3                              3333333333333333                         333@@@         @@@@@                          @@@@@@@@@33333333                               0333333330000;003333333Yaiqy33300@@@@@@@@@@@@30003333@@00@@00;@@@@@@@@0@@@@@33@@3@@330@@@@@@@@@@@@@3@00033@@@@33@@33;@@@3@@@@@@@@@@@@@@@333@@@@@@@@@@330@@@@@@@@300033333@330@00;@@@@@@@@@@@@@@@@@33@@@@@@@@@333333@300@@@@@@@@@@30303333@@00@@00;@@@@@@@330@@@@@33@@@@@@@@@@@@3@@@@@@@@@@@@@@@@@@@@@@@0030000@333@333;@@@@@@@33@@@@@33@@@@@@@@@300@@@@@@30300000@300@003;@@@@@@@00@@@@@@@33@@@0@@@@@@@@@@@@03333@000@000;@@@@033@@@@@@@@3333333;33@@@!)19@@@@33A3IQYai3333303q33;33333333y3333@3333333333333333333333333333333@ !)Q19AIQYaiq !yQ9AIIq !)1}9AIQYaiqy                                           -M                @@EEEEEE@@@E@E@E@EEEEEEEEE @@!)19AIQ!)19AIQYaiqyYaiqy@EEe~ @!*2:A@@EE @JRZaEE% Mj*r@@y@=Vv@ @@  @@@@@@@@@@  @@@@@@@@@@@@@@@@ "*2)I)1 "*2@Q a!)9A@@@9&Efi A)I9QYaiq@!Qy  ! )1= 9A I] !!} )1 9A I !@@@@@@@@@@@@@@@@@@@@@I)1 y > ^ ~     " @@@@@@@@@@@@@@@@@@@@> ^ ~  > ^ ~  > ^ ~ >^ !)Q9QAI  !)Q9QAI  A I }=YAQ Q Y                  =333 @@@@@'5'U'u'''''(5(U(u((((()5)U)u)))@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ a 333300%))*U+u+++++++,,,,5,5,5,U,u,u,**u,u,,,u,u,**u,u,U,U,,,,,@,-5-5-U-u-----.5.U.U.u.....u../.u.5/U/u///-,//050U0u000001@51U1u11111252U2u1u222 22353U3   u333333454U4u44444555U5u55555656U6u666 ! 66757U7u77777858U8u88888959U9u99999:5:U:u:::::;5;U;u;;;;;<5>5>M>e>}>>>>>>>>> ?%?=?U?U?m?m?m?????????@-@-@-@ @ !)@19A@@IQYA%AEAeAAaiqyAAAB%BEBeBBBBBC%C EC!eCC@)19A@IQYaiqyC!CC@D !)19AIQYaiqy%D                       33333333333333              33                                      =ED     =             q!)eD        y}D}@@@@@ @@  @@@@@@@@@@@@@@@@@@@@@@@@QA e-eMemeeeee f-fMfmfffff g-gMgmggggg h-hMhmhhhhh i-iMimiiiii j-jMjmjjjjj k-kMkmkzz {-{M{m{{{{{ |-|M|m|| |||!)1 }-}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9AIM}m}QQ@@@@@@@@@@@@Yaiqy@@@@@3y !)@19AIQ@Y@ai@qy@    !!!!))))111199AAIIQQYYaaiiiiqqqqyyyy@@@@@@@@@@@@@@@@I  !!))11999AAAIIIIIQYaiqy !)1:BJRZbiqayAi!)19Yai1 QYa qy !)19AI!QYaiqy !)AIQY)qy19 Aa IAQYa!)Y1 Aiqy !)1Y9AIQ !)1Y9AIQ!)1YQa)19!)1YYaiiqy  !!)19AAIQYaiiqy)199AI@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@QYaiqy3333333333333333}@"}}@@@@@@@3333333333333333@} ~*2-~M~m~-~~~~~~ ~-Nn@@"*2~-   " * "@2 : B J @@@@Q .N@nY a i ΀q y !! ! !!!!!!!!!!!!!!!!!)!)!)!)!1!1!1!1!9!9!9!9!A!A!A!A!I!I!I!I!Q!Q!Q!Q!Y!Y!Y!Y!a!a!a!a!i!i!i!i!q!q!q!q!y!y!y!y!!!!!!!!!!!!!!!!!!!@@@! : B !*2  a !I)1 "" "* J  !)Q9QAI 2 !r !)Q9QAI !! -a MMḿ -Mm͂ -Mm̓ -MmM̈́ -Mm ͅͅ M-M-mM͆͆MM @-Mmm͇ -- Mm͈ @@@M---M-@@MMm-mM@@m-m@@͉͉@@@!!!" "-@Mmm͊@@@@@@@@@@@@@@@@@@@@@@@@@@@@=UmUUmU=@͋=M]M}M]M=@=M]@}M@@@@@@@""!")"@1"9"A"I"Q"Y"a"i"q"y"""""A""""""""%"""Q"EI # ###!#)#1#9#@A#I#Q#Y#a#i#q#e@@@@@                               33@@@@     @@@@@@@@@                  @@@@@@@@@@@@@@@@@@@      @@@@@@@@@@@@@@@@3300@@@@@@@@@330030000@@00@@008@@@@@@@@0@@@@@00@@3333333@@@33333@@@@@@@@@@@@@@@@@000000@00@@338; !)Q9QAI  !)Q9QAI  !)Q9QAI  @!)Q9QAI  !)Q9QAI  !)Q9QAI @@@ @@@@)Q9Q@AI @@!)@9QAI  !)Q9QAI  !)Q9QAI @ @@!)Q9Q@AI @ !)Q9QAI @ @!@Q@@@AI @ !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI  !)Q9QAI ##@@##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$##$ $$$!$)$1$9$A$I$Q$Y$ia$##$ $$$!$)$1$9$A$A$I$Q$Y$ii$#$q$q$@@I)1 I)1 I)1 I)1 I)1 3333333@33333333333333333@@3333333@33@33333@@@@@y$$$$$$$$$$$$$$$$$% %%%!%)%1%9%A%I%Q%y$$$$$$$$$$$$$$$% %Y%1%a%i%q%y%%@@@@@@@@@@@@@@@@@@55uu5555uu55᥌                              @! ! 1!!a!i!q!y!!A!Q!!!Y!!! )!9!I!%%%@ @!@@ @!a!i!q!y!!A!Q!!!Y!@! @)!@I!@@@@@@ @@@@ @!@i!@y!!A!@!!Y!@!@@ @)!@I!@@%@ @!@@ 1!!a!@q!y!!A!Q!!!Y!@! @)!9!I!%@%@ !! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@ @! ! 1!!@i!q!y!!A!Q!!!Y!!! )!9!I!@@@@@%%%%%%%%%%%%& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&9& !)Q9QAI &&&&&&'''!'@@@@@@@@@@@@@)'1'9'A'I'Q'Y'a'i'q'y'''''''''''''''''( (((!()(1(9(A(I(Q(Y(a(i(q(y((@@@@(((() )))!)))1)9)݌A)I)Q)Y)a)i)'q)y))))=)))))q())))))))* ***!*)*1*1*1*]9*A*I*}Q*Y*a*i*q*y******************+ +++!+)+1+9+A+I+Q+Y+Q'a+i+ݍq+y+++++@ +++++++++@ ++++, ,=,],!,),1,9,A,I,Q,Y,a,i,}q,y,,,,,ݎ,,,,,,,,,,,,,- -=--!-)-!-1-9-A-I-Q-Y-a-i-q-y-----]-----}-------. ...!.).1.9.A.I.Q.Y.a.i.q.y............ݏ...../ // /!/)/1/9/A/I/Q/Y/=]a/}i/q/y////////////////ݐ/0 000!0)01090A0=I0@ Q0Y0a0]i0q0}y00000000000000ݑ00=]001}ݒ 1111!1)11191A1I1Q1Y1a1=]i1q1y1111}@ 1ݓ1111111111112 2=]2}2!2)212ݔ92A2I2Q2Y2a2i2q2=]},y222222222222222223 333!3)3ݕ1393A3I3=Q3]Y3a3}i3q3y33333333333@ 3333334 444ݖ!4)41494A4I4Q4Y4a4i4=]q4y44}44Mh4444444444ݗ4445 555m{!5)515=95]A5A5I5}Q5Y5a5i5q5y555555555ݘ55555555=@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@A A!A"A#A$A%A&A'A(A)A*A+A,A-A.A/A0A1A2A3A4A5A6A7A8A9A:A;AA?A@AAABACADAEAFAGAHAIAJAKALAMANAOAPAQARASATAUAVAWAXAYAZA[A\A]A^A_A`AaAbAcAdAeAfAgAhAiAjAkAlAmAnAoApAqArAsAtAuAvAwAxAyAzA{A|A}A~B¢B£B¥B¦B¬B·BÆBæBðBøBĦBħBıBŋBœBƎBƐBƫBǀBǁBǂBȢBȷBɐBɑBɒBɓBɔBɕBɖBɗBɘBəBɛBɜBɞBɟBɠBɡBɢBɣBɤBɥBɦBɧBɨBɩBɪBɫBɬBɭBɮBɯBɰBɱBɲBɳBɴBɵBɶBɷBɸBɹBɺBɻBɽBɾBʀBʁBʂBʃBʄBʈBʉBʊBʋBʌBʍBʎBʏBʐBʑBʒBʕBʘBʙBʛBʜBʝBʟBʡBʢBʣBʤBʥBʦBʧBʨBʩBʪBʫBʹBːBˑBΑBΒBΓBΔBΕBΖBΗBΘBΙBΚBΛBΜBΝBΞBΟBΠBΡBΣBΤBΥBΦBΧBΨBΩBαBβBγBδBεBζBηBθBιBκBλBμBνBξBοBπBρBςBσBτBυBφBχBψBωBϜBϝBаBбBвBгBдBеBжBзBиBкBлBмBнBоBпBрBсBтBуBфBхBцBчBшBъBыBьBэBюBѕBіBјBџBґBҫBүBұBӏBәBөBאBבBגBדBהBכBלBםBעBרBתBءBاBبBةBتBثBجBحBخBدBذBرBزBسBشBصBضBطBظBعBغBفBقBكBلBمBنBهBوBىBيBٮBٯBٱBٹBٺBٻBپBٿBڀBڃBڄBچBڇBڈBڌBڍBڎBڑBژBڡBڤBڦBکBڭBگBڱBڳBںBڻBھBہBۅBۆBۇBۈBۉBۋBیBېBےC་CნCᄀCᄁCᄂCᄃCᄄCᄅCᄆCᄇCᄈCᄉCᄊCᄋCᄌCᄍCᄎCᄏCᄐCᄑCᄒCᄔCᄕCᄚCᄜCᄝCᄞCᄠCᄡCᄢCᄣCᄧCᄩCᄫCᄬCᄭCᄮCᄯCᄲCᄶCᅀCᅇCᅌCᅗCᅘCᅙCᅠCᆄCᆅCᆈCᆑCᆒCᆔCᆞCᆡCᇇCᇈCᇌCᇎCᇓCᇗCᇙCᇝCᇟCᇱCᇲCᴂCᴖCᴗCᴜCᴝCᴥCᵻCᶅCᶑC C C‐C–C—C₩C←C↑C→C↓C∂C∇C∑C−C│C■C○C⦅C⦆CⱱCⵡC、C。C〈C〉C《C》C「C」C『C』C【C】C〒C〔C〕C〖C〗CァCアCィCイCゥCウCェCエCォCオCカCキCクCケCコCサCシCスCセCソCタCチCッCツCテCトCナCニCヌCネCノCハCヒCフCヘCホCマCミCムCメCモCャCヤCュCユCョCヨCラCリCルCレCロCワCヰCヱCヲCンC・CーC㒞C㒹C㒻C㓟C㔕C㛮C㛼C㞁C㠯C㡢C㡼C㣇C㣣C㤜C㤺C㨮C㩬C㫤C㬈C㬙C㭉C㮝C㰘C㱎C㴳C㶖C㺬C㺸C㼛C㿼C䀈C䀘C䀹C䁆C䂖C䃣C䄯C䈂C䈧C䊠C䌁C䌴C䍙C䏕C䏙C䐋C䑫C䔫C䕝C䕡C䕫C䗗C䗹C䘵C䚾C䛇C䦕C䧦C䩮C䩶C䪲C䬳C䯎C䳎C䳭C䳸C䵖C一C丁C七C三C上C下C不C丙C並C丨C中C串C丶C丸C丹C丽C丿C乁C乙C九C亂C亅C了C二C五C亠C交C亮C人C什C仌C令C企C休C你C侀C來C例C侮C侻C便C倂C倫C偺C備C像C僚C僧C優C儿C兀C充C免C兔C兤C入C內C全C兩C八C六C具C冀C冂C再C冒C冕C冖C冗C写C冤C冫C冬C况C冷C凉C凌C凜C凞C几C凵C刀C刃C切C列C初C利C刺C刻C剆C前C割C剷C劉C力C劣C劳C労C勇C勉C勒C勞C勤C勵C勹C勺C包C匆C匕C北C匚C匸C医C匿C十C卄C卅C卉C卑C協C博C卜C卩C印C即C卵C卽C卿C厂C厶C參C又C及C双C叟C口C句C叫C可C叱C右C吆C合C名C吏C吝C吸C吹C呂C呈C周C咞C咢C咽C哶C唐C問C啓C啕C啣C善C喇C喙C喝C喫C喳C営C嗀C嗂C嗢C嘆C噑C器C噴C囗C四C囹C圖C圗C土C地C型C城C埴C堍C報C堲C塀C塚C塞C墨C墬C墳C壘C壟C士C壮C声C売C壷C夂C夆C夊C夕C多C夜C夢C大C天C奄C奈C契C奔C奢C女C姘C姬C娛C娧C婢C婦C媵C嬈C嬨C嬾C子C字C学C宀C宅C宗C寃C寘C寧C寮C寳C寸C寿C将C小C尢C尸C尿C屠C屢C層C履C屮C山C岍C峀C崙C嵃C嵐C嵫C嵮C嵼C嶲C嶺C巛C巡C巢C工C左C己C巽C巾C帨C帽C幩C干C年C幺C幼C广C度C庰C庳C庶C廉C廊C廒C廓C廙C廬C廴C廾C弄C弋C弓C弢C彐C当C彡C形C彩C彫C彳C律C後C得C徚C復C徭C心C忍C志C念C忹C怒C怜C恵C悁C悔C惇C惘C惡C愈C慄C慈C慌C慎C慠C慨C慺C憎C憐C憤C憯C憲C懞C懲C懶C戀C戈C成C戛C戮C戴C戶C手C打C扝C投C抱C拉C拏C拓C拔C拼C拾C指C挽C捐C捕C捨C捻C掃C掠C掩C揄C揅C揤C搜C搢C摒C摩C摷C摾C撚C撝C擄C支C攴C敏C敖C敬C數C文C斗C料C斤C新C方C旅C无C既C旣C日C易C映C晉C晴C暈C暑C暜C暴C曆C曰C更C書C最C月C有C朗C望C朡C木C李C杓C杖C杞C杻C枅C林C柳C柺C栗C栟C株C桒C梁C梅C梎C梨C椔C楂C榣C槪C樂C樓C檨C櫓C櫛C欄C欠C次C歔C止C正C歲C歷C歹C殟C殮C殳C殺C殻C毋C母C比C毛C氏C气C水C汎C汧C沈C沿C泌C泍C泥C注C洖C洛C洞C洴C派C流C浩C浪C海C浸C涅C淋C淚C淪C淹C渚C港C湮C満C溜C溺C滇C滋C滑C滛C漏C演C漢C漣C潮C濆C濫C濾C瀛C瀞C瀹C灊C火C灰C灷C災C炙C炭C烈C烙C無C煅C煉C煮C熜C燎C燐C爐C爛C爨C爪C爫C爵C父C爻C爿C片C牐C牙C牛C牢C特C犀C犕C犬C犯C狀C狼C猪C獵C獺C玄C率C玉C王C玥C玲C珞C理C琉C琢C瑇C瑜C瑩C瑱C璅C璉C璘C瓊C瓜C瓦C甆C甘C生C甤C用C田C甲C申C男C画C甾C留C略C異C疋C疒C痢C瘐C瘝C瘟C療C癩C癶C白C皮C皿C益C盛C監C盧C目C直C省C眞C真C着C睊C瞋C瞧C矛C矢C石C硎C硫C碌C碑C磊C磌C磻C礪C示C礼C社C祈C祉C祐C祖C祝C神C祥C祿C禁C禍C禎C福C禮C禸C禾C秊C秘C秫C稜C穀C穊C穏C穴C空C突C窱C立C竮C竹C笠C箏C節C篆C築C簾C籠C米C类C粒C精C糒C糖C糣C糧C糨C糸C紀C紐C索C累C終C絛C絣C綠C綾C緇C練C縂C縉C縷C繁C繅C缶C缾C网C署C罹C罺C羅C羊C羕C羚C羽C翺C老C者C而C耒C耳C聆C聠C聯C聰C聾C聿C肉C肋C肭C育C脃C脾C臘C臣C臨C自C臭C至C臼C舁C舄C舌C舘C舛C舟C艮C良C色C艸C艹C芋C芑C芝C花C芳C芽C若C苦C茝C茣C茶C荒C荓C荣C莭C莽C菉C菊C菌C菜C菧C華C菱C落C葉C著C蓮C蓱C蓳C蓼C蔖C蕤C藍C藺C蘆C蘒C蘭C蘿C虍C虐C虜C虧C虩C虫C蚈C蚩C蛢C蜎C蜨C蝫C蝹C螆C螺C蟡C蠁C蠟C血C行C衠C衣C裂C裏C裗C裞C裡C裸C裺C褐C襁C襤C襾C覆C見C視C角C解C言C誠C說C調C請C諒C論C諭C諸C諾C謁C謹C識C讀C變C谷C豆C豈C豕C豸C貝C財C販C貫C賁C賂C資C賈C賓C贈C贛C赤C走C起C足C趼C跋C路C跰C身C車C軔C輦C輪C輸C輻C轢C辛C辞C辰C辵C辶C連C逸C遊C適C遲C遼C邏C邑C邔C郎C郞C郱C都C鄑C鄛C酉C配C酪C醙C醴C釆C里C量C金C鈴C鈸C鉶C鉼C鋗C鋘C錄C鍊C鏹C鐕C長C門C開C閭C閷C阜C阮C陋C降C陵C陸C陼C隆C隣C隶C隷C隸C隹C雃C離C難C雨C零C雷C霣C露C靈C靑C靖C非C面C革C韋C韛C韠C韭C音C響C頁C項C頋C領C頩C頻C類C風C飛C食C飢C飯C飼C館C餩C首C香C馧C馬C駂C駱C駾C驪C骨C高C髟C鬒C鬥C鬯C鬲C鬼C魚C魯C鱀C鱗C鳥C鳽C鵧C鶴C鷺C鸞C鹵C鹿C麗C麟C麥C麻C黃C黍C黎C黑C黹C黽C黾C鼅C鼎C鼏C鼓C鼖C鼠C鼻C齃C齊C齒C龍C龎C龜C龟C龠CꙑCꚉCꜧCꝯCꞎCꬷCꭒCꭦCꭧD𝼄D𝼅D𝼆D𝼈D𝼊D𝼞D𠄢D𠔜D𠔥D𠕋D𠘺D𠠄D𠣞D𠨬D𠭣D𡓤D𡚨D𡛪D𡧈D𡬘D𡴋D𡷤D𡷦D𢆃D𢆟D𢌱D𢛔D𢡄D𢡊D𢬌D𢯱D𣀊D𣊸D𣍟D𣎓D𣎜D𣏃D𣏕D𣑭D𣚣D𣢧D𣪍D𣫺D𣲼D𣴞D𣻑D𣽞D𣾎D𤉣D𤋮D𤎫D𤘈D𤜵D𤠔D𤰶D𤲒D𤾡D𤾸D𥁄D𥃲D𥃳D𥄙D𥄳D𥉉D𥐝D𥘦D𥚚D𥛅D𥥼D𥪧D𥮫D𥲀D𥳐D𥾆D𦇚D𦈨D𦉇D𦋙D𦌾D𦓚D𦔣D𦖨D𦞧D𦞵D𦬼D𦰶D𦳕D𦵫D𦼬D𦾱D𧃒D𧏊D𧙧D𧢮D𧥦D𧲨D𧻓D𧼯D𨗒D𨗭D𨜮D𨯺D𨵷D𩅅D𩇟D𩈚D𩐊D𩒖D𩖶D𩬰D𪃎D𪄅D𪈎D𪊑D𪎒D𪘀B!!B!?B..B0,B0.B1,B1.B10B11B12B13B14B15B16B17B18B19B2,B2.B20B21B22B23B24B25B26B27B28B29B3,B3.B30B31B32B33B34B35B36B37B38B39B4,B4.B40B41B42B43B44B45B46B47B48B49B5,B5.B50B6,B6.B7,B7.B8,B8.B9,B9.B==B?!B??BAUBBqBCDBDJBDZBDzBGBBGyBHPBHVBHgBHzBIIBIJBIUBIVBIXBKBBKKBKMBLJBLjBMBBMCBMDBMRBMVBMWBNJBNjBNoBPHBPRBPaBRsBSDBSMBSSBSvBTMBVIBWCBWZBWbBXIBccBcdBcmBdBBdaBdlBdmBdzBeVBffBfiBflBfmBhaBiiBijBinBivBixBkABkVBkWBkgBklBkmBktBljBlmBlnBlxBm2Bm3BmABmVBmWBmbBmgBmlBmmBmsBnABnFBnVBnWBnjBnmBnsBoVBpABpFBpVBpWBpcBpsBsrBstBviBxiC(1)C(2)C(3)C(4)C(5)C(6)C(7)C(8)C(9)C(A)C(B)C(C)C(D)C(E)C(F)C(G)C(H)C(I)C(J)C(K)C(L)C(M)C(N)C(O)C(P)C(Q)C(R)C(S)C(T)C(U)C(V)C(W)C(X)C(Y)C(Z)C(a)C(b)C(c)C(d)C(e)C(f)C(g)C(h)C(i)C(j)C(k)C(l)C(m)C(n)C(o)C(p)C(q)C(r)C(s)C(t)C(u)C(v)C(w)C(x)C(y)C(z)C...C10.C11.C12.C13.C14.C15.C16.C17.C18.C19.C20.C::=C===CCo.CFAXCGHzCGPaCIIICLTDCL·CMHzCMPaCMΩCPPMCPPVCPTECTELCTHzCVIICXIICa/cCa/sCaʾCbarCc/oCc/uCcalCcm2Ccm3Cdm2Cdm3CergCffiCfflCgalChPaCiiiCkHzCkPaCkm2Ckm3CkΩClogCl·CmilCmm2Cmm3CmolCradCviiCxiiC°CC°FCʼnCμACμFCμVCμWCμgCμlCμmCμsD(10)D(11)D(12)D(13)D(14)D(15)D(16)D(17)D(18)D(19)D(20)D0点D1⁄D1日D1月D1点D2日D2月D2点D3日D3月D3点D4日D4月D4点D5日D5月D5点D6日D6月D6点D7日D7月D7点D8日D8月D8点D9日D9月D9点DVIIIDa.m.DkcalDp.m.DviiiDեւDմեDմիDմխDմնDվնDאלDاٴDبجDبحDبخDبرDبزDبمDبنDبهDبىDبيDتجDتحDتخDترDتزDتمDتنDتهDتىDتيDثجDثرDثزDثمDثنDثهDثىDثيDجحDجمDجىDجيDحجDحمDحىDحيDخجDخحDخمDخىDخيDسجDسحDسخDسرDسمDسهDسىDسيDشجDشحDشخDشرDشمDشهDشىDشيDصحDصخDصرDصمDصىDصيDضجDضحDضخDضرDضمDضىDضيDطحDطمDطىDطيDظمDعجDعمDعىDعيDغجDغمDغىDغيDفجDفحDفخDفمDفىDفيDقحDقمDقىDقيDكاDكجDكحDكخDكلDكمDكىDكيDلاDلجDلحDلخDلمDلهDلىDليDماDمجDمحDمخDممDمىDميDنجDنحDنخDنرDنزDنمDننDنهDنىDنيDهجDهمDهىDهيDوٴDيجDيحDيخDيرDيزDيمDينDيهDيىDييDيٴDۇٴE(ᄀ)E(ᄂ)E(ᄃ)E(ᄅ)E(ᄆ)E(ᄇ)E(ᄉ)E(ᄋ)E(ᄌ)E(ᄎ)E(ᄏ)E(ᄐ)E(ᄑ)E(ᄒ)E(一)E(七)E(三)E(九)E(二)E(五)E(代)E(企)E(休)E(八)E(六)E(労)E(十)E(協)E(名)E(呼)E(四)E(土)E(学)E(日)E(月)E(有)E(木)E(株)E(水)E(火)E(特)E(監)E(社)E(祝)E(祭)E(自)E(至)E(財)E(資)E(金)E0⁄3E10日E10月E10点E11日E11月E11点E12日E12月E12点E13日E13点E14日E14点E15日E15点E16日E16点E17日E17点E18日E18点E19日E19点E1⁄2E1⁄3E1⁄4E1⁄5E1⁄6E1⁄7E1⁄8E1⁄9E20日E20点E21日E21点E22日E22点E23日E23点E24日E24点E25日E26日E27日E28日E29日E2⁄3E2⁄5E30日E31日E3⁄4E3⁄5E3⁄8E4⁄5E5⁄6E5⁄8E7⁄8EA∕mEV∕mEm∕sF1⁄10FC∕kgFm∕s2FبحيFبخيFتجمFتجىFتجيFتحجFتحمFتخمFتخىFتخيFتمجFتمحFتمخFتمىFتميFجحىFجحيFجمحFجمىFجميFحجيFحمىFحميFسجحFسجىFسحجFسخىFسخيFسمجFسمحFسممFشجيFشحمFشحيFشمخFشممFصححFصحيFصلىFصلےFصممFضحىFضحيFضخمFطمحFطممFطميFعجمFعممFعمىFعميFغممFغمىFغميFفخمFفميFقلےFقمحFقممFقميFكممFكميFلججFلجمFلجيFلحمFلحىFلحيFلخمFلمحFلميFمجحFمجخFمجمFمجيFمحجFمحمFمحيFمخجFمخمFمخيFمميFنجحFنجمFنجىFنجيFنحمFنحىFنحيFنمىFنميFهمجFهممFيجيFيحيFيممFيميFئاFئجFئحFئخFئرFئزFئمFئنFئهFئوFئىFئيFئۆFئۇFئۈFئېFئەFําFຫນFຫມFໍາFཀྵFགྷFཌྷFདྷFབྷFཛྷFྐྵFྒྷFྜྷFྡྷFྦྷFྫྷF′′F‵‵F∫∫F∮∮FほかFよりFキロFココFコトFトンFナノFホンFミリFリラFレムF令和F大正F平成F明治F昭和Grad∕sG〔S〕H(가)H(나)H(다)H(라)H(마)H(바)H(사)H(아)H(자)H(주)H(차)H(카)H(타)H(파)H(하)Hrad∕s2HاكبرHاللهHرسولHریالHصلعمHعليهHمحمدHوسلمI′′′I‵‵‵I∫∫∫I∮∮∮I〔三〕I〔二〕I〔勝〕I〔安〕I〔打〕I〔敗〕I〔本〕I〔点〕I〔盗〕IアールIインチIウォンIオンスIオームIカイリIケースIコルナIセンチIセントIデシIドルIノットIハイツIビルIピコIフランIペソIヘルツIホールIホーンIマイルIマッハIマルクIヤールIユアンIワットL′′′′L∫∫∫∫LアルファLエーカーLガロンLガンマLカラットLカロリーLギニーLキュリーLグラムLクローネLサイクルLダースLパーツLピクルLフィートLベータLペニヒLペンスLボルトLマイクロLミクロンLメートルLリットルLルピーL株式会社N(오후)Oجل جلالهOアパートOアンペアOキロワットOサンチームOバーレルOヘクタールOポイントOマンションOメガトンOルーブルQ(오전)RギルダーRキログラムRキロメートルRグラムトンRクルゼイロRパーセントRピアストルRブッシェルRミリバールRレントゲンaصلى الله عليه وسلمোৌୋୈୌஔொௌோೀೇೈൊൌോෞဦᬆᬈᬊᬌᬎᬒᬻᬽᭀᭁᭃ𑄮𑄯𑍋𑍌𑒼𑒻𑒾𑖺𑖻𑤸 ೋ ෝDDŽDDžDdžFلآFلأFلإF가F나F다F라F마F바F사F아F우F자F차F카F타F파F하IメガL주의LギガLコーポLヤードO참고OイニングOシリングOページOポンドRエスクードRファラッドೊො≮≠≯ÀÁÃĀẢǍȀȂḀĄḂḄḆĆĈĊČḊĎḌḐḒḎÈÉẼĔĖËẺĚȄȆĘḘḚḞǴĜḠĞĠǦĢĤḢḦȞḤḨḪÌÍÎĨĪĬİỈǏȈȊỊĮḬĴḰǨḲĶḴĹĽĻḼḺḾṀṂǸŃÑṄŇṆŅṊṈÒÓŎỎŐǑȌȎṔṖŔṘŘȐȒŖṞŜṠȘŞṪŤṬȚŢṰṮÙÚÛŬỦŮŰǓȔȖỤṲŲṶṴṼṾẀẂŴẆẄẈẊẌỲÝŶỸȲẎŸỶỴŹẐŻŽẒẔàáãāảǎȁȃḁąḃḅḇćĉċčḋďḍḑḓḏèéẽĕėëẻěȅȇęḙḛḟǵĝḡğġǧģĥḣḧȟḥḩḫẖìíîĩīĭỉǐȉȋịįḭĵǰḱǩḳķḵĺľļḽḻḿṁṃǹńñṅňṇņṋṉòóŏỏőǒȍȏṕṗŕṙřȑȓŗṟŝṡșşṫẗťṭțţṱṯùúûŭủůűǔȕȗụṳųṷṵṽṿẁẃŵẇẅẘẉẋẍỳýŷỹȳẏÿỷẙỵźẑżžẓẕ῭΅῁ǼǢǾǽǣǿẛǮǯᾺΆᾹᾸᾼῈΈῊΉῌῚΊῙῘΪῸΌῬῪΎῩῨΫῺΏῼᾱᾰᾳὲέῃὶίῑῐῖὸόῤῥὺύῡῠῦῳϓϔЇӐӒЃЀӖЁӁӜӞЍӢЙӤЌӦӮЎӰӲӴӸӬӑӓѓѐӗёӂӝӟѝӣйӥќӧӯўӱӳӵӹӭїѶѷӚӛӪӫآأإؤئۂۓۀẦẤẪẨẰẮẴẲǠǞǺẬẶḈỀẾỄỂḔḖỆḜḮḸỒỐỖỔṌȬṎṐṒȰȪỜỚỠỞỢỘǬṜṤṦṨṸṺǛǗǕǙỪỨỮỬỰầấẫẩằắẵẳǡǟǻậặḉềếễểḕḗệḝḯḹồốỗổṍȭṏṑṓȱȫờớỡởợộǭṝṥṧṩṹṻǜǘǖǚừứữửự῍῎῏῝῞῟↚↛↮⇍⇏⇎∄∉∌∤∦≁≄≇≉≭≢≰≱≴≵≸≹⊀⊁⋠⋡⊄⊅⊈⊉⋢⋣⊬⊭⊮⊯⋪⋫⋬⋭ᾈᾉἚἜἛἝᾘᾙἺἼἾἻἽἿὊὌὋὍὛὝὟᾨᾩᾲᾴᾀᾁᾷἒἔἓἕῂῄᾐᾑῇῒΐῗἲἴἶἳἵἷὂὄὃὅῢΰῧὒὔὖὓὕὗῲῴᾠᾡῷऩ ऱ ऴ ైේゔがぎぐげござじずぜぞだぢづでどばぱびぴぶぷべぺぼぽゞヴガギグゲゴザジズゼゾダヂヅデドバパビピブプベペボポヷヸヹヺヾᾊᾌᾎᾋᾍᾏᾚᾜᾞᾛᾝᾟᾪᾬᾮᾫᾭᾯᾂᾄᾆᾃᾅᾇᾒᾔᾖᾓᾕᾗᾢᾤᾦᾣᾥᾧ𑂚 𑂜 𑂫 B´C ́C ̃C ̄C ̅C ̆C ̇C ̈C ̊C ̋C ̓C ̔C ̧C ̨C ̳C ͂C ͅC ً]C ٌaC ٍeC َiC ُmC ِqC ّuC ْyCÅCṡD ゙D ゚D΅DΆDΈDΉDΊDΌDΎDΫDΏDάDέDήDίDόDύDώDאַ5Dאָ9DאּEDבּEDבֿMDגּEDדּEDהּEDוֹ=DוּEDזּEDטּEDיִ)DיּEDךּEDכּEDכֿMDלּEDמּEDנּEDסּEDףּEDפּEDפֿMDצּEDקּEDרּEDשּEDשׁQDשׂUDתּEDײַ5Dاً]DآDأDإDذٰ}Dرٰ}Dـً]DـَiDـُmDـِqDـّuDـْyDهٰ}DؤDىٰ}DئDۓDۀE ̈̀E ̈́E ̈͂E ̓̀E ̓́E ̓͂E ̔̀E ̔́E ̔͂E ٌّvE ٍّvE َّvE ُّvE ِّvE ّٰ~E⫝̸FΐFΰFשּׁRFשּׂVFـَّvFـُّvFـِّvFक़ Fख़ Fग़ Fज़ Fड़ Fढ़ Fफ़ Fय़ Fড় Fঢ় Fয় Fਖ਼ Fਗ਼ Fਜ਼ Fਫ਼ Fਲ਼ Fਸ਼ Fଡ଼ Fଢ଼ FྲྀFླྀFデH𝅗𝅥H𝅘𝅥H𝆹𝅥H𝆺𝅥IྲཱྀIླཱྀL𝅘𝅥𝅮L𝅘𝅥𝅯L𝅘𝅥𝅰L𝅘𝅥𝅱L𝅘𝅥𝅲L𝆹𝅥𝅮L𝆹𝅥𝅯L𝆺𝅥𝅮L𝆺𝅥𝅯Â̓Ă̓Ȧ̓Ä̓Å̓ẠÇÊ̓Ē̓ẸȨÏ̓ḶÔ̓Õ̓Ō̓Ȯ̓Ö̓ƠỌǪṚŚ̓Š̓ṢŨ̓Ū̓Ü̓Ưâ̓ă̓ȧ̓ä̓å̓ạçê̓ē̓ẹȩï̓ḷô̓õ̓ō̓ȯ̓ö̓ơọǫṛś̓š̓ṣũ̓ū̓ü̓ưἈ̈́Ἁ̈́Ἐ̈́Ἑ̈́Ἠ̈́Ἡ̈́Ἰ̈́Ἱ̈́Ὀ̈́Ὁ̈́Ὑ̈́Ὠ̈́Ὡ̈́ὰ̈́ά̈́ἀ̈́ἁ̈́ᾶ̈́ἐ̈́ἑ̈́ὴ̈́ή̈́ἠ̈́ἡ̈́ῆ̈́ϊ̈́ἰ̈́ἱ̈́ὀ̈́ὁ̈́ϋ̈́ὐ̈́ὑ̈́ὼ̈́ώ̈́ὠ̈́ὡ̈́ῶ͆ἊΆἌΆἎΆἋΆἍΆἏΆἪΆἬΆἮΆἫΆἭΆἯΆὪΆὬΆὮΆὫΆὭΆὯΆἂΆἄΆἆΆἃΆἅΆἇΆἢΆἤΆἦΆἣΆἥΆἧΆὢΆὤΆὦΆὣΆὥΆὧB̀3B́3B̓3CᅡCᅢCᅣCᅤCᅥCᅦCᅧCᅨCᅩCᅪCᅫCᅬCᅭCᅮCᅯCᅰCᅱCᅲCᅳCᅴCᅵCᆪCᆬCᆭCᆰCᆱCᆲCᆳCᆴCᆵD̈́3C゙C゚Fཱི'Fཱུ'Fཱྀ'7 $l4:ZFC0^zh(}+2Jb6vZ*<@Favlԏ&9#fvP6*n& d@t/-Bs;V,L5,7L!gMDWf_> h@CTaXY^c7?I^)%Rv]m' MnYX4*&KΔV ߅<ƽa"ѱ Ń.J).Bxpgb-5#'+0hҧ|jޖ C07cY0l =5KU_Oh pG g6CICg7,;f>c+A  J[@So`kvK­ɶjUAlcQt,X,j-b(u @3(m՞f8LKT}F-piq7kq6uBZFy~0:xw6/)9w8wP1ryTMFkF-dmJn TӅQoķ"Tmc3vkmYs_5p_Cc)ieZ . zB渒)J;ee5^xvIuEøhd:]j'])K<8"ue^ ?o?vD"RG}g}OFrâz>mR|6PdFˬ؜G&9B0񅖕OORh$'(F"_ EKɔ (0@kWBہv)0:S&z.yba9`."*CDNf6~xsv`Nř4DU,ޔx%=Y}n<#L(5W$Z PQq;P##܋&P%u@7y3`K2CVYh#pXLZTs\oς.TF,N+H+dx;q $CkXі$\7N`@/DpcFY''s ʋq&Ro=uؿEuwqwU1O459A}t޾[9!M;*Ej(weŁ(9z U+@ (-0=ֵi zw,61y|Wkp!|D =\9R"R;܃)k:b؀Lk-qhn5dbSxƼZY|~Ń .;0~+g4 }-So\$WI˴_qoY$-g (Znng 0f 4으=((:+g.bp'?Q]B84Jj7ާ ~ަUW]/2.,{ W5ڜHX Ӈ&њFóoJ蝘6 G?dYqI g?:n^ jA8w@BbP2yx(.0OVNˇ}J#_I j!bľapN| Hqbܜ)f4戯M(V&,Yrf,Q-ܮc\e "Inh6AsOy)p{JYUXd)?N`(sN樫6mnRܙ>hе ?n8(Dxxle$=ybi)"jDodžT ] :;vq;ɄϤ({ +"@h$$}nacQk{tRE +,iwVIVΆٮm?@RI+1 ;,}Fs~Zzך[$b^EC*[ ȭl^+zYrt)!xڶ'M"3tzq?8u }6I8%4O +n O=;$N^ H9rŐtʚMRN/ӯL&Kxyݳ .VA?9S<@l.1q Aԕ^:zb G 2V{["jr١fB-u5rǘc; u>1ZKt6\t]Y?KMNgAIvfFB\N30d5M|kvJ~IV/W7bk j˝8,aJN҈)o֧LFeb#2@Ah,NZ\E`x96#!p߅<"R[Kl>H3_HE>.4Y%p B; 3w%}ʑYj =Uޢj֕G_hT)*w6J>!}|Y_fٷCQpKLӤ]J761g#jX?sJS{UxlV^#>L} - X2GM뜃hD۱w*5tb~Wf1'Yq.hŇQ?V{F6`PvOS 6M1 Q^oť_ƶcC<l3 7=M)$&|򾽬H Pqnܟ@f(l}>RvR#O"kge;g?_L򊭘$E|uyp;DWrɤe:99OqR6mOr\lAl"+eIj9r{2E1U4Zs ij^ Sf!tTIH[G{GZw!4NZ},ӍcEmE87ymZ2f:opq{ha@2Ⱦf0Tz.m?$Sc.vzw kpdł؞[O8:bp$ GU zOe6mϔDLlkC[.RƹaғRQa˞VeuP`tGqv9NC໻@s;ώn(&[ϴjyEh}9@zbq%FNv²jA=RZ9?DqM #.<B hZ(_alȳ$}]zUgxXSvrQo{π01;B5Ky$hC>)긳jS,iZfX-KOpk߃.<[1dɡ s"xLԮH-ñ*WaT)rх#iْu륓J 5&9>-st\u"#M-kBq+x:㡋4m(FMsIey:m/H+ X 7JX 0tmN- q>JVF`q,7HEAp^Vkix7WQW~CogY ϔ=wHh 6b58fxG&D@eU0X`b*lpرq1%I]:C\{Ǘf#"Y( xmyao\OT$6d9珗\Wz~jYlT%8]{nӫ&t.*)j8 ӺE#;99 ;')cU!IC0_$N+ U'|]쭷_ 0MeAEg0\.EțW\H:^Mcui S-q=EV@8?XEۡ"(myzu]G(bL{B'~fy* b&x˰Om}xAbCXi}ҡױ'Hګ[@f }LjN ^{P\'[un\/jhuLumT_ ~pz!ImH|Bxk0<)tݽrvZrgr [mNق™9ai$M0I n %^C)UACOO?3dPQv^PlswuPm]2=DQ Wx N2$lUbjDP .l t/b5^:-N\^O4XoT,σ܈ be(rKe֐vOtdK.M-|`~dܟ0ZD"%qlhx_]^8y18媿NY9-#TJ>Ǻlk4#׺a8jH]jȻ?<47RD%c􁚾 t.QӬJ_:2ћ| ܋sEE,1ʱ(~~vB֔>Dd !ygUSʼn9B5YdϑW1nךfm Kyl4SMnPT]Ft$"}36yjOܥsdoC;fKOE3]3ҸȧvO4GH;HJ5VB3VZ͸=% ybvƢ ?=5' tx IBϳdWKՃ }[=Ky0^jA0VtBȖfDԵI@I:a}([Y#79WtO^Q$>_ߟN(͖WaO–P1Wa{)ʨl1H8z0'S$.H~ܓ98L)WYDeϬKܣ7/GUFe&K\O#7)'<~#s1h:Q`fTiAy KLRAu} LPta5IO<`!zZг ,mgYP򵺀 CN:gje5:I0Q%}PvX~3ePP.CR2AO{u6|wYpf5*n[ )`hΰ:V}Q%s1s59ěbp6 ˠBQAิFNW (wJU* {ȗ| /b0@ eUcʟߝ\W"q-'Ck;mnC#29|BL0i*PqʒT)QH.^g}ɭ -E߬fo|n9d_gÈj*C Xk@ "M"Bkv>?B*&\+\! FЧ%>PsaZ?G=y,mtep6ўc- 6>5B;MYC |$1pN WIs_jlqԾR{(26(:}*bw4bB޽/Ry?ҕq诌'\>WzvIB?cJeAr GdMilmǴ2YczLv~X[ Yeuan WRpwbl%f̀]v Ŵh#12)GM_rA\z^d25?uzu~ N2b\C[u]#+T4LӴ2 vX|.L]W%j7$34RLwiwՏҚ-uk8-&?G#ta*9}cPLj_6NGu*'>H`$YZ*&B`n,|9GjK4)U6;G.nkҺw^`:·W~+m(ْ#E/tpUey8P|ۡ0@#'I)SIZ;e 2{R˒):uaeV<*d?- XK@Kܨfe?4^en/.,<y% 58;'7HiZ/ 6{kl[tDY)QG(ުӱˣ͋j /tmI΀D[/yt, n mW[ EOc̅ZgPhqg.*|^"0$ 0TY~Te>@M^@Oh٧/dӪpp=ӕT>E"xofBȮFEA߀oZ!1zTZXjtkY+H$PŒ|F$r܂`Hn{^\ pߤrovf37@hXʻ$v=Hѭö:3u\ pN*<">@N=Ps[IIܤF!>GLi}3QGtzl.lw;4sƒRgQ{$ZQӶNYv{zeΪfh7IP7pC:5{ a_\*.#˹{-4QA}%EM&+C!^|ZB AUPƼ:u>nd<;CԥG/МޡH47ɘNO+ 5az_\#<9:$IY̔ZpR 0~LZ;>2:"9*ylRNzO5^ʼ-Yi kN.>0 +ZUK]^|㼂5::NʿG_szNǶC.䥺ΩOtH]; t&c=Sx4Xef7HoB7wVHe602(qHZjʉmLmUKbSofai#+T㷽*أͲqK5b/gC~7:L~7Oo99.%BÀ"0P#10+sAP-iON+n}s ތBBe`3ۃ,zk Lm۫Ep3(wMYҳ*r09A)eZ}2\0'Eu;#!Spd#*(%&"u` <3 Q=oNr u:Nz_kB v*-wSlem%w0TY z99`kOGem%HVSE0I 'Ld=R @/ºF3b<3 wZ!U$%5Qa{l!VRL'U>0 }=˶\̋htDWmo~{L7cѽE抆։TұT3bIcBXh`\vba61lx޿O*j @*t;ծTVv$[ #oTE=h"YGy0Z@D7i#M4U@d }ri/ ;z8CTn("l|qh~Ӹ7 ٶq1]\"*YjOYW+=8L.#MIbbq3`Y??. _S9@Vx L 0_mRq2-!Q/lUr$IO69jŁ}l괹@i04FK=$d+٘,Vۿ]'&@q8g%6rot_nD P8$oV>2` WZTkW MEK~df &GRѡ DG$"U\CÒT=]|#OdQz β4<"{ay oMaǜKRHc %rk qG[ U/'dKW IJ76{BࠍQʋ͙-SG2ǤFtDmqm i_3ȥ?]8nt J+*AKd z,.nN2WDTQNΡ]\՛^|RsAVy~(iz<9Ty'd8Eۄar?$z1ɡҤ$[yx<{;X c-uF*au7<luz#*5Ad}RJI$ Eع,ɟ8QN*N{jת R.a1LÛ-Y0!^WsЭ5zCBL|7&v v>KwحɋY}0vdzvQiU-/+<(O1Hs4t ҿ:_Pbk8Ck9+/e# ~4LT9Ӥ2dvnS'jTX"JUwk`fg[pd dVFǓ‹-9;ͳ,'jK zD~%iF >xC /p<1zcXLO+1Yu yp7&SyB닋/x8B >j4vM#Ŧ̟*:9Mɴ9WrajRT0;خ:cn|pUDjaUE<@ DbV`G0;s`12a~Q!]y**;o+"{8U[wnڑ$ H9'C CE=28x[P+fXM;~XNSXx#xѝSv8{qK&F;pez+4`3`{Jҙ(($&;kkw!;&j*D+qd098H/3הUlóbt q|bitm֌7/!}ukHpigr--eIWd\eIĊ̩ʔ{Q'iYcOZ|aw@٘C[Vh79mM{l ==Ia6„J̇#>ZAkZ{;jwwAj_Ќ *GQT+/1_\#>-q2UN}W7.Tl(ʐ@.yZ݄,2™m\c$-eY P'=*yv]důb\Vd^T枫"~BTЍ(k -Y7;e`2}_r N)e>:ҖPdLziH||O>v MMXfT5DbsERcWle澫Y)K+KP1ހ w|{|؃uQtmF$ +2,N!9k5 KpF2}-˴Z,M޳{,"}x:!am* {Q9޼H nfu+la'*hzV=/h.ˀ;2e{Ij6ز5UX݂66B>0YҕBdٹ{ 1wH)M2WV0S(F5Sź_h#u Za.EcU!)^PYMfDR=ǚY?ɎPG'Mq eg wO&T=Z\ `<'Nd~ydsFM=Mp{Kr>[$.W0q@QODTnaCZW@ho OQ*Eԕ==(D?Rg cD!jHԯ#5Z|UF_5]L-Y԰Q80IadΨd<߹'[&ϱ&HΡ}4(idwaJGc- *inB窵1 W>50oݕCfO4~-R.[e/O<#OQO\TW#/}WyXJPJ4p7&أ_|}Q/曌bE)f0)w c[§y'C+^58%Uh.g9+,pHGV2pB 9Gj?,`?{.4XnJIE B^`@_:Ue@ 4um;m\95'# -`>wD0(_hp1*ΒX;|FYT`^"풊Mv ^*v{v/ѨwZ@Z?lm]?> kj"(f=G }%pkC6ZLm ? }1 06c}ڶ.최5-kg *߱ʛM;Hv5ɶFEG[:(3ZC;ҔKmg O/Yᡩ{P.~x8"agmXA]/> <+Fj5vIEyJ*0xtΥ2XvfIv:̙ t# R|q_,IWmR% >GDFz/W֚Tk\c '::H~'bstR&ʓM>U צ*xmmz 6 @S 'GG"bB+Pc$_|nGDj 9')Uv(Xɫf[uQ} d$Ay|a/ڤ\ejիrz;YҲ_-dUnD:yLm#jEؕ/IF9&`f TA兊D42lA9ばL4O5FuC7PW.c?.>H-iɦ=N V_ T2+?.KzC 5,Nl5{ʏ.瓀JZx8'*tvy/ҁߩP:lY7,:${%UDndXg&BcRI>3f_߿$b`L}Nt]OSct(k}W ye" b~4`d"\hLټɋ#Rk}H"Jo ^a={jy3 +NHkj*`1sчEXKmAJe4&FNN(Nr1 ױd\2x:_:BCրG,v'Pa1.ށ;w9<ڇKTs!=~4!+䟎CǹEQҿ:䉷ͩU{XMQ1R 6%FqBVw"?{.yl~R&\*Pnv5 o}ʮeDRyu쏕E2UdO,Wcȱgr}6M,F薬 "Ӊ벅YP,Z*okޛj2L_pS& B +=1+^՚"4S?Y,mr=BV|}kCeL| ;NYn*^s+qk*D_gņq|o?$VߔqW w7*pvI x*g;=[/ըv F-,>Tc: sNe-w "Rvn x&Fr$`U{l`s-i&D9|mFhf1!Q((G,L䫬 :a7UKñB,NqtM@5,-cfb#AשVBO]x_InkAY4*R?5aw,Yh0yUڠlh a!i ~3L[#NoKOF74N# pV6^I?F\ŽU}?}' O0 ,+esu5VNc|X߆Nʜ@ZB오BSuZVWy'πO6\۶+2`jȭ'NMJ_2Cǫof  y(E+VJRi`ʂ%0 у)Ͷl8k_u`4#iUr+lKet(g%߂5tyR/\9c]Y~L=i!^iA ώ\QnH#7֝r2&8-c@ho+9Qxt{J `!:sjL ] -)"vLT~m)aw>ګe~9kBŗwo"D#A>2I9x$ԇSBQF%/bJ%ibF3K E7[K^(St Qe`!z e5MFб 0#;立w%<}$qTU./RbSa*Q,mΫX2 3\*v>T92DŽCVBxO(p+~a1R#]+2pPzkBY8]')+[a6vV6n$MDĝH8أݲ^p6VsD(7\pzˁVqR̲i󰽺&r;!(Z^q @+lc ZnRGQI|p!Q %𼗏K/W<&`$ٗ_vI9~-!؟؃l)F3(ji(|ߡ$p@;#ГI\KQ IN-ӭtAE]&%H>MLuR&]6prַi%E _q]I;|PSaۂ:M#z7󼩶:{>DT`(l$JV`z(Y,}k?sϞfM+Z\-)]8M&T<jf!PP7ۇIǨ9 2 MZ=!>,w:FS qN8#D^l|jM=c΁UiJ L.j|l"dX'U%}gel'OD)J#?6ﰺut_i>&@/Cnn!yxJ-"nn}tfX{ynApjE.'۝i(0`|-.\ŽdJvOp=dώW6k>iG~:ͯYb 68.l;(M4i]{U\P7(}3c?  w;zDdwehA'a"uNSJx@ԉyxe}n"b=ꐄ0^9xu*)i^*Z呏ڗo]ᛋHăe5U638`-%6`:7qBȺbIrsb@bG{F/EM T"1f>87b$KX)K +Іw aRy].vf`]@ &0ҸVg.byH+(5C'Dim}[4 [PJ ƚm/1TJa~ӌ6}al]#߅S9c^ub+6,,o6<tCFZ.Q)PM~[uq7ZT~Dr,-Pç1߸ù)=.ÐǼa>5HP%Y#i?kOvge6ܬ!`Smo7P( ' !&3ˤ<&%CanT.B/zA&DU ob3<]pd57$>bqp)[!&]*jUK;%?c/z# =^g#ڹS9/+mQO˿t/"_`/H8fW(TaԐu9#\nDUa_*ׁٜybVZ*ұ $9kAr2(!yv"%as2""3xn, tH+a+0&yΞ9ׁct0+^M[y4Cє,TD/>t⬅k\7rǿ?D=_xb[vX[S;{g;].J$V&*e$'c* \jIj9yJcb anb߀LZsY^c^Yʹ³xSLpc~@_#w[MR8 %KM?xtBb-'ܝ)v.x58C^ 8%-'T0sA*4af&3r.R%>bĻ@̄JUx$Y^fT'!R1[g/Ypmq$5iC+E"/48%.Yl'{N&hd0 \&=\!)2ޛm D>Ըl9R'xUy$p\M4೟Ėd(1^uH: 4RŁE^Y!+쉺6nu~?;|u1a(Z f+>B(:ʃa"@1~QuQqO=[@1P]%sh|Z=pKP/iQkVoLtL> 'gHDCS%~0_W4uKT`7G11"&jD \r<ѬBQo"{flfMx1A#IkN~Gnt坞V*|߳ľ@ #cg}{kmۇmThωa"ѨHjcrCC!Quykb0R~1Y8%Ǩ+\c] }PFu+J9r86&^%IhܴF\}6#SWG+%]} x g$vl0b=Ep̶h%h3?x-$6#8q T$?kAN5 m[2,ơ)hC,H҂F/47dx w|_hB;d1j>9ѐ*Tl/I*C=G$S)}Ƈ%:dqEǺ7rmz16q>qINJ6Bhha<ہIMLO~`Kj7RG<"QM^! $gWz D+U|?c(!qL!w+{xACr.|~׋+W ŘaQm]n^#^BpKk6hG:HTR&OPjN;Lm!)nNL? >Th&(`&G\9 +{1=) V9P o͍9?mjB$A[Fsv76 ;f)>A4g,$z@EAuC0ɀG[TݤB 74qߡ+DG=egEM/Rs0kgU>>4Xq$t]6*cP2)vWlgjnw`<"-&c -o#T\o;0w~f.~Pzd YeSU[0Za͠2ۇ!mBOV]qZ{Ft% $GG2jNK;(?*Q8^Ƴd$M}9 Jst\AbLm{~#orG@"Xbl8[0e;鮿w"J'l~^E% +H KܼͲR<>Gk\v6!y >~c5.pěرCхꈡ%RbuO#b~+703J\juJj1Z/ϵ$㡭B .-"?A}P$=L}Wž5rǬ)WI 'xk ٨7gg0bnVT> NZ8Ukkd*9oGB?3E)r:4g!~9P`5/n':f>&lϷdsD 4uqr4) ZwU8G[@$奦-s\~3h8rPٵ Fz[Y'7,γe Üj6ŕ6'T>1G<o`NYIf"s _ecnyiQ9eās037BL?*j5IҜxj:/@1x8Fv3yգjiEp4^x$k:BJ"2mU`riPV88б b5LʙmW R)j?&1*brζ5z5ǣ (2: $]73z[zNA8Nq~lM8=ʿ$0jtV'ñyUǪ]릁ϣ4s C1Ť=Nm$aTЕ,EukWwԃ9@nvחSxsz!iI:iAVvc$d=%'9:'Iw?)=^fkƙ&Mk]Me"F0q|SU.1*ëؖPn TI<Zڭ®ou1dEt{oNNE56l=db( , i+\Ai[uLBGi{HPڲ5[@9s& -.}A hľ8xO6 a18Κv:k\_$۲Iͽ\na 35Yi{nҡMV{ >7hY.%uvMlI.\{&SڨcÉ@+&p3PMdKɺ, |N2`ݣCјn50S;J@*6'Dbpi9 :B}npɆ撋 ;3QP iOz xv4E$S$soFg @6lثM/\cX֜  /BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqc|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-TR j068@|9/4CDT{2#=L BN.f($v[Im%rdhԤ\]elpHP^FWث XE,?k:AOgst"57unGq)ʼnobV>Ky xZݨ31Y'_`QJ -zɜ;M*w u j R viP& 9( ; 85.B Y ? 5!K   x1 !({ '4 b W 9  &  GY eLf l s 7  T ! 0 w *m'? 31 " Dwf vR>w uj"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IX.1ẋ)j̍F ts#PF 謬 kAbsWL-Gqb.6lkcZL9La\Į}Sd vЪ#OJ0+hshz~@5-vsJfw>7G9@>l4OtU[ s6!TYKKw bӓS+)cL$_JmɤO;N5F<+# >>QM[?0G({]BgAw;g$nꏧL'U4oŵ*Fk,* #ecwI-S}2!`{<vwV N&nuAYD,k0[3_zwE]{V/n+_Yf,9I %H,}sB$Gav݀x@+ ?8:we-}_J;TqxEb &}n䝵sdp>N+ava垓%=d %#hhwiҧ3Z4ޫ^87 $VwNC[ 7Vfmފ"(ʊ#S| .Kc% oig5U?ԼYSws+u5.tth["d|iJfϰ[BHn`&T.2skX]-'7"V)e*>.'[`ؼrK~V#p$t3 C]ăcOR@%BT5fחGwަdyp B e k.?uXI,|/#_>@MJy).AGoZgZH^rf< O\*K{&&M9olen%:6hA,uw"×((\TkiL6-wJ$X^f{Ym% 1z3)+Y]ٙN[]xAԢf^?a^5L.V}Get0;?ZlP*mbgԝa<)>uzGՆv0o/5*#=҅ jX3w_A5#Mj- d5:t\]>yhP-Svn.7i@X_B'|,G`J)'q/qHofw{hЃ(8m5@Pu mF+a1./#{KPQV㡈IIu˓1iv{s^]Y7جgkힴo23.*CeBg(bɍKP9Cc̖1YhVÍ{2a8uz&UK$τŊb9ZD_{Z.0*,sBjOIj.Kp^ Xo;Lxї-1KhC-,>RK0(#sS.۪jk=>9=h*K -HhJxRX@_̴2fj]^X :'pJH=`HYf♈ \sfۘG$Ga|w9i;**7C2$eOINz:  HdD~@.{‘1bm۹s 8ƒ }8V/eB=~,=|]Bp#.m9rK,cG |b}Gp@,Bhy̫cstfMPæ W8TS@pm;ʙ̕,i}[0CAw1NI2e -ZRA<~JW}j) Xl/Zh9]Iʼn'oPLP Mէ㬼MjAjoo[UˆBwD{G<7L>5=@:TM 3Es?;*1?@s4Y!,-/2ba3 r+^ -2Ը]uF#Κ?-.je=iU-8 lɱO? hR=a ll8Q'Cb*]r\)mR/uҺ !"2y@ *'^foQ3Tod lq ^B#y˲-J^:DpOς֡rdl cx>nxc 1qwutA] Fv@κI'Ii2/d""ԃ\n<[;ig>␚6\83Ő)Ea.bmxz: 30-Z1eB' U,ۭc$Oow:*gfQOx@xtlA{*NNͷ Z.H@߄K383 7&˓V\V.AtxLahLT^3eKTu qeȧ/Ĉȱ~o$YO0'XM\!@cai..H[׋kF^(A{i:tɹ)sb.97M!k5GI:U+ Z7 zKf&>jiT()'.4 ń81aؙǥ>Zxf8i'O:4Gh68tbeY*؅ zBU=rL >rO3\ZԳLݽ;g}AkM8Tj[e!vG#QԀ<8q) atXJ ]LLm$`jމ(@.fWG7tb(tk"@QN v3zB"QƗ)W{q1ʊ)U!uTH-\77EXH O t_-Wq@#U׺Ov{aY`Jo&It-KYZpYZW-rrZy%|qiwE Pnz!P9A;Ӛ+qO$ٰN%p&y$+= Uͳ d䯙Ev/0_<=d7b5o-Q1Z{ f k5KrgϪ`[y|rځA* JO\hP>- dF&$:!b[W3 ͢z;'0N犵km.*[l=Q`(ĖAKN .1phoɰVx*n!3~]Ms֠/CZ;Q)10*a!3!.udnRw$>Mm/JhAHQU!}aql*̓cdP.?sf1cK%8议:)7F`eb^SϐY^͗8/菷g0^])S92W: $|k(M&cGN,BpCL9"Ηվˮah#lSzS(B/̴Q31H¶KOɲb| r*TO5x0i& 뉩"6;by#;T&dn%X q7#. Z3ƪ^蠆*=y_2wbsG/d~u`I[0z/jC<qKWr7W*Ff0c\I\۴}ke~K+czVpWfLuzeDiaaH"']T)jYƜ*2]Czδb\I =6=TW,#H1uX fJP=a.ϟK'd_AP+Vj4.:5@ N[FIɄehBӕbu\NV Fs򮤔x7ƔuީٌvZQ*2nxVɑ?TmCg1H7M2XK!rzEa"_'dkܨ>mQsq[{7KCDžyEax̀=MUM qv@B+Q™z=ͻ[̤(M-M-VVD"yahX(\hblAјt@){YĔVRO,$.|P0Tl1pF̫k `7ӬOQ Q1*btS*svIO֬Qᦁe"s31ڄeiQml*Оv`[?&"hӆ5L*dܱ7󄡈ԟ߲%#l6;)R<,F-!U 7쪉u?1Z޷1t߱ Qզ+ a`hYEr+(j¤Jacv\GWt=*,~ b "4⠵eۜpMR?Vu0/7S+jlB &܀9/:7;sSj8]4.aᾨY/h-Q!M0.|^1j*r㠫 V'uk:3Pk%i=53 uo4^t$IP޴5O3d(wd1!M(ؠ@G҅j_xN'%f!Vl9 ϻ^ܢT\NL rѨwpgpjm>P# NN`EEkwZ ٺ4u>F1)dО' QZAI2k +Aa6Ba `6l13"")D=i~]OOhX!< `! s@0 oZw wgaȎ-O?>50$]^vKn>" Ss.\8vj@=0e.)a>3ߒ*bz ۮl.tZ5gF@[owZ<,{5`q@roz?q7YJ DP҇@SRD2Lb!|"ΦUA7(BZ ^LXjt5pܹN~&T:YK5!n^nj1AµM^4o cbaNoF#\=Tm(R۞VoY]nl&`ӳ/x"m׈JA)G2p6e?P-$^{ҟMB4l&62J9h0{l̀\ж왂I59^HkG׆a>`RH594v4%3&r% 6`;5@)7DžNLu[@oN?5Sq.R ?ALݫ3?Cwu:ۤ}(Cѥr<}mmlxoT+3Ce ~& 3ưm^%1\%W xS!k:H| Gݴ^HA=q nV=sV'^Dk椡4GUܛ 9\ъ*D=d}j ܋-ߩe o[afHRYi3sJ}fʗG-eN7z0o>Lr#JRoI(멒J{/x6\|* V 5iD%}@`HSIO位ZR~k2^D4R6 @; c[ JbX\>NV$Fwaٸ\µ(/p&\- ?^Vb=s:|Y3EO!<0m@|M0mb:g\~j݂NHg8Wj]c$Cnp\Av?ӎz STbt䭾fUyZP+DP 1b Oz @HX^ِ~X^RB.|dڇw}pZ4-R.× }->ʻ%Fvt$NeP$+ҁg$YÿUB83#[>oGPÖ7ak i4] @Tqr+>j(UZv9l <:ۢP;/(C,X$`BrT2e_:0rsAc紨{R)H<~e gTF&K}S BHN.%œ&>jDZg؎dq-S~EAџ~- I(k%ws2"I!KɔS{M$sJߋj VFU\9;-XFڊ/NGzjv6y T%usDWٝEPY(Հ!x^~qf_!K*J3v+w举-e4O\#8zo:5}ӌeު_S:cqj7_Ҋ u˟?0D/ e->τP N~[;7Tq]E\2װ̖G$aU]wAE18 rąPK5S-ȦJ7,4TtLf-]hB1gh`6Զh,mB) Ohwub~_K Yci;e*i/XpJ 9'6y*DF(dIabfG47 aα\D9ֿa<[̮g!AԤN"SZ #VI:K{wtP`q [b3aɸC G]Tut2jOJwRy R)mA |*b07y2tG}N k-z_s [ƪA[{2%9CUCrl['S2ţ] ~ZQ6\Û_Bdzշm]؛}HEH@>&=)ͣţ"0E?,?fxc)z?2̈́utz-=a4Kwtx,RB><<_=>"_ 9INcrk2Y9C|lGe0D0kulmTֽZ.˜~}uu`'C;<ѯ̱W)wQּaRZ1n΅ rz%5 &`jaֹM#T~Nz:<[vyJ$*Ţ^P:ܯp⫏L +" wm]slVݔ6&I.p]HXj'gpXMqSc,ɱxpkNa9E&,=KIR͡*2mrc+ޢ6w>M|r8x6y<{ԖT+c0ľzI gcGak㉆vQhGΏe?./= 82ٮ!ڧ\j]ĞʺlqBSza/^Úh$GҼ\|?Bz@LRXGdJN,×pBsI͘fQ.{a?Ӻ!7}/ne!e珥fɸGZ: %sK\XD~ eF =&H}؈9( n\GE wfykl'څ:Ӑ=Xbh.b|C {jCNN%m=5ΔC8~`ae@" ug·B,ְZ`Fn*;j{K2B]՛M|EjN~[lf1g|{ 9ՖWBsrQu؋D]d}߮Kk*/V/9 i=d蹰NwAOc$(Zho:^_'쯛W?"%BS4JmUa%e93!8{RTf 2 }f!v3P(5 wuݱiQ|Ϝ1< @_Q1H툇<+g͕'8 礉[D?2a"l[;c%{N1T_ OIu lx"pe5zG8H|8nǛksF^;B&!fJEk6^ O8cv1(UPHx' )٪͋50?G h:CO/h *TMՓeƊEaЌ3mXt)]çVXe."3diYgPybd4)m1ӮeN^T$(G qnP4uWE@V}&<2y}b1R [^5\a0a*p VkjԿ akj[uK4w~VLW1iΎex&{@>tt (aؕj꺫f4+}*] TIHC13 _1ӳJ抨J5EP/&O(9%Rf(Zz2Gɴؗa4GjC6=0K>c Iҍ՘Dl.wweOtVӥ;S%t78)n9dK&&qYc9kEq$^rRŸ*Ƒ9AVxF~1ٔJ/o/O|U# |tݻ'|U*R?-)P|ƲF,͑m6꾢@A$YzG$uFnDHxr0%c(P \ c9 8ymH>ͼER\*>x8xoUTS?3  d 5H7DO{ЩEz <)qgt)WZq@ErjBqyԪoki9FU)8̊$":fd2n(ZYV C@:zy *Y$veJJ^K?FReӞT0mzW]ܷM}8vhJ-v Gx][M6ynV 8%@7-`f &a Oe;OQch,u4kFJPQvu*V֛&ہP%y4SQ8_d`\H㯖oVDwj1ihBMm ੡廍Bg&1_&XH:6acfe-BmkcOiILV]Gw0I:/{ذ4 F\.Aw&r7<'Ơh|"n{`AU? @}(>ؓK ̸mP<ȩL8Ϯz\EK C&ؙTA)ҵ7T'ВR3˧j7 %Z"T-47 8f-c pZaq Q=\-H3ZSا}XqhRo;չSP-L3 $[fo@es%K],O05"F #>}qss3Y!fWd ߮]%' >4[=\u_~oTiI4H>XwA0˯!g/ouE!$k*"J'dX*e׏9;@L'qGFڋnG~@#j<W~90_dxJ_[}wPp&I׿!4: 4_RE4 0eӡ}ys_5q`gu޴$N%a^ލ?T %HHޕ"enq7B_󭢗Oy< D|[%1u+@A!!#U-h5[Ϟ^qo'HN ~< h>Sem.XqgA+ g%L u}W6*^PR$"=|..X/+L)g4[ְT F]xȗaɤafBB yndop%ŸVQq2KCRj" m2' N<&gNη<ȯQZ?}U_znX 7 r|õD8gݷxq#n9EMj2Khp^Kf}Ji͋p*\[i\3(pxǫt#K-SG]Zȟ eʦǐs6FgdPI7cH:ث)@ ( J3/WyPV?⾜%X_'45bHo'++S*Qq $v E:6kL|S@:`2q =ո8*hy]tڪUˌ~y^q aa㿁GyQwb֕XmTK(+k\\MVTRa`) L랪0yS钏߃t )̲D*ZE, VhKzV@YsaJ!(k=4ܚa8)9n^:ܲ!Mtr.;n\-4uԲбs` c(^aJ_R=I)OϚN+Í >lp]>e Kqy EYgnhZJfYF%s8O.;xt:z$ ^An1Z uJ~,0o|\KlҽS [+=9hUpsZl &v7YQShA0(pKޑ\b1lfzwը]b$95yzA=I,'#BĸG=JG*pB 볶D)s^PaG>&|_3r[ֶu&eJm.fd!ac@0Pp3(oh|K'f:/%;twT`J+lPRF4*>9UYau"!KEPxJuEԟ; 0>>t#Q+MH2i q̀bIcVwD{C'z,;P|#H%3/3gsi%YR4A& X)6} Gb %"55A10K"*[=clhŧRSr,8d+XCn }3Gt2mX47q|Q@_ee/?PDnRv~gcɝAi3LQ, ڵ^O{<C(Ŧ<~ fwg#ד@{xMsw{[pF$= C'8:D3DZZbC궣va2F: /jq[?tJx+jg^MLA"k'ܛ{[bߴwY[K,BоuqN"sJ7} u dz̃TNϺ9 vA=LM>i_3''1GF"4$[|keODjnZFzFZrhlgGF:3&͜ǁ+)"SӦiv-F$C߮ mlt`2#>K/- KE2>~+_f)|a#O&g~O\W2Q=JxW*Fc7PX0;Oܾ p ~VOq $6afD|\2/|f;N!v=@;1&IW#٩rF!(йf+9"daDP{2}JLNpq[/44Dzc힐(Ť,ш~3خ-6%l*C\B P`ZB]jhr-塙)Oͭ͂?/c_Yhov1,W0\ (HO]/uX,91fXnʐZLdh Iґg?jLvocJ x(0I$_yLW|a=_Rr~H-_ ;&L c@QFXj^d{MZt?u"Tg9yK,mB?rUU%DmnaݨhG8T^r /0֝CckȃQn敔1ygL-y‰$ ey$2REJ$ً,+1Q5N/?<3AC|[sqbQ<`-up\,i{yar]rrSʮV[ S5|+c4 F_[TrUb{\!3y A:(ZG* 4Tv97樲,]֎ ?VO3eJ~/Jゝ?тo4D:Ϝ1TyErI کݸtTC{1?\TZ˔Ǣ pg> lc!['v4Y^V$ I_pΘ$J0 w~k?~ratڶ ;Goޡ^Ķ9[Խ@DM~4nxTYr!c~t4rt6OW-L [|טQ M:fA,'qKynt>WK6n@PKF?u{ؘ m\-G;Q#ê~Rg9e` Ɨr.a# J/ wcrhDL\brkw&ydՑxh*s!#rhg+f;XѦ:m'Q∑ʰㆎd㪳8E$4C dX4$ufr 믫g'o-U&ɖc+,8X==hX^:@W<9?Dm{$>dž9y^cǕTO ck_~indкws,_t(zXyaeGe d 830tĮ`ŕmޡV3pf:LQy a S#ԓ ̺ %ٱ x~a1ΩnDK <DÖmw@M+[._ޖ^OIKY O lEoC`ϴ>ͮE v2NP, GrPf,$/2x1'Ô3=)1qՁ'B .6@6-zeZtĿ;i|J-x&2 6LBOP _Ԯ)7\ \C}aZ%?u4BjBzA=~Y kr'XLC jWϝe|ip"+nmNƚz'|5{i7U7i)DWt Ym3+EM}w-]gel{7:7%:C:5w|Ϯ9݅0^i3iYEY|Cfj~.db("0l6gFEʞ P=k>|U2![g0#vv:am:&1LBkz(lK׵(Hͥ8R`}DBxu\)H)m;- xQM 9Q4hIנN@v#Yۀ%̖:C?F; v!zRX zS0!@? ' Kna[~ ksf:)(j)a]1UV$4̪.Ɛd+ԃMjyyQueφk6XkgFѮSPp[eϲI-o@G7+ݒ Kt }܂݄`nErǠ)1.m/] ϣ44pQJBq+`ׂORknȞ%[8 {0jfe\#Xc~FӾ-FΦ bB{G7BW4፻\jTh2htaD ,_44]8zJV*UvDehRB^v T+\5ˏ/Oa#~[ IAB<,utgƸGz=Ӛ/7|*M µ-g*f e(Wv+1G ׭pK7KVst=0>ni.47JHK= 4qta-M40!C:N>xaWOr?Ñ? ¨g".w1i3>m&+1+sk΀_'O_֡oHkE]{)d[zPU*,`#\RD [}-TڮCQKeS8&6?@Pfk¢|4DѴEqiLa-=Z sMkOQ.E:PA $~M"EzjOң|幽cEF_Ϙm*s^ BBv{@dsT~H~J0zkҠ/O4bl\ ,W:Afai^/ \a`M =R7{oHr%9vS2ΰ1e6rV°BNAWAre>ţ7Luy<8Yg HdNa]by MÈBG}TxAI-w!,M$,KF|ev'u :H" .ռdPf^[uH,0@0 O{b. XzIҟ'̖Z;H4Y<~bb^Ѽbr[iR"k~D ",IzdK/.hA%ʐa4b'; [ -rnPw51}Q5_'x&m퀔T}$w| `9^pH\3īnSKc y_iZ('FO.޴鏢X LM | 毬miةP %Ċ oVHa[_U^Cktl',4$^Ք |p5 L,yU85i3\`pl~G/Dh= TTʫ>15p(ŕ:]^<ʛSe`jQ\\' ֞ fV?T6;*++TPrm!}P߻Il=*cB `|^oyF8J)xt=0ͧ#<ރ?,I+Ezjn4!20'P4GAy r5, ¦7A `Cmn[v~3J*FvG0A0ɳ3c{NMק=CU6)}{G(E W;#wtmt!̫czp=3eɿƸ[3<@K,'e? 7ܶJt]Ju%^*i |b%}2ol'v/#U&p-WxQ ˋrsQ,^Pش+F՚pW h*AxAfpE$m$LTh{[}b;R.P  [ uJ5**_b*1)?8*ߗǰf_?ТoLB|+&"rt nS.+S.ơ4,̛F,B8\O(UC XB @.K_޿4бǕ.=C8G6fBwa*߆OzB{`b_#$kzc uP_g<圑E3ݪ/PC*h*܋Yv(A*eMQ 3q9`b3{%ȑl?]x@8gJ> ZzUA2"Gp I(iz1m4+Pxq{HthX@eN}!(0;Q5[i6fJ; ]M=#5Ku3cNsDVxbWsIC$!]n{];[+*eU_7Z4z wp>TO7186MJ8]Td:8L.ѩ[PZ$N bS9ԛ)rpKTܛgT Hk01` <&XZ|G;i^1c:(mJGLxjbǏҀMf,r fzӄh7(XO)0vЏeͬU>U+pJ ʸ'4Rwa4kIķ{7DH=chc B^suJ'dzO4D"(+heH%56 J& f"(dY-tx}Y5*̕M gA|c/ye7ey_ G5@pnS _սp3\,zCptNLj (_nҋ"թ&/QچQvsvSZ[[ MR($^'Gm}Cބ;sv7Sd"u`4Z v!j;TЁ7ԅkث5FϙuQa]QYֆU1=f s\ yKA!d~'R X5GZ]DSi ̿@wt'{` ==R`)`U_>x _Ǟ+(`+0G'sYeIќ}!(9foIy=%V>?74K)p5(e. .:1 [諞m:}-Һ?j_;؇R "ntAO U%6s'f4 Y9?`V+L9^t^%o = \1lbF+mDQ]qSϋ@\s!8/hi‹.-',Ms=i xl *%~Wg`g?f:sܻ#暵5< 040ozPۙw'^ cysۈr6HW5oA]6ڻVrsB5Sv)ªT%\wU\(M舦TϺm z ȏ,u ;8E\ބ|̕uRP_Y]c6$q$֨Se2emZE˸B-S8#w|wc7Y|J`upekۥb?8sx ȼk4p W%F!`jLTr`6܌ي,} fGd#f\ l@$5_c٩-2e0Cυr 9X"$;YއP{YFe%pèM=yb7M\nh'~v^WLGRs#m:7]uIGeQ l$ӱhP`tb,ݱڧ9a݃vrf/vKu׉@]C[Sn%3bOw!yRE!rʗFJǛeGSu/5oyk5Q@y]e:ãi&JQ.UTl I[YJY>cI8T-sTx ..) j <Ų'u2sJw2~-Kd dKi=GsF`kCʡ:yN"UV K">@^&N2^pVY"BY_Lq)1haRAe"hcFP$ W0"!{<ܜ~r2# 8˻nic}2",@]Ù.T+}߱V{ݦɂJx1A9OpڳUlf4;kꠡ yCZG0SMYf. rh_rc2KC%hn o}+v zlTQ4p4blI)Z%z.xFSW5x` ߩLzR9}TƊRHHG?DXJ=6-<%UU^;G&3(\O][9:2i%ȢBjq+TE W x+хCh)d3(X? g;L4NڞҦ/O6N+awEy4 g[ׄホQ;-nCO4BS§@ݹVxpr/SSEf/lkKBPbgQ J6.P$t&?-J{&߀f5a˯/Hsu–_I׷Fѕ8nE Q9=qی.0,&]1ߐQP=/[2ȅe!QgBC!;YdϢ5zYbb 9ƌ&2{vB+40D4mEe F:Yj:fSN/{㺏̳m@:zldQZt%'ǨGw13\^d!`'"/lʝF&[<VL.o3Ѯ3d0VPnV9.WP4$![ ϔԉ.X R1 aS&v&*ooifkr 5tPEe쥹#}"J#ʕݘauȩ`tQ^2PF^WO%/v*\3o䝈΃`dis'5*A45ѭ huug}ɛZț2s2B)}~W4)诔 BCeAw.ͧQol3qVj_oب{e xq޳55 |U:Ba iqd̯!j6: m]jO-E'ʜO?䗩u,}P=2RzK1ۆe|0hF\9ӴEp>.MFH"lv LslH1TBRmqRrJMLf~?xJko8r gV5u f1xK yYX;iSKVRzQU׭=dX* g&NR1@}pcل0c~fUܜoD.+s+N9.qn@}u0%f?}Pi&_{u ޥ @mY33s>)xּpCh,=pFUa/(JɤV GS=_ _$7*xq?":n *UcjSj:$-| <uqHgoOs{r6yUT <(^_k M W;5jNfO&3\W_NA ^!`@ehgRFd.˼d; j z_ Gt5yZeL 2'| Xd*qC=;uL:@{_`]d46|u%WX۶lXl)z @zr|o Ƌ\5~Jv}RʫMɡ# ̑ "?j,4J2 ¼B/nt AKKsFV{@WW?6h'yx$3Ej%Tb~ z[m\dwzQi4_ +w}/\2w3^\  ,p-ȅ<Σ#3sVaA0k~Нsk8xAX)&ςOpi^/ øP%pZWj{Y/$(Yq=Fjǻ&6ݎ-WA;L̲:]F5gž4wd|klƼMd{b(&@ZK1De", =0{zaNs AYW|WM2KlϮ_æF̥媧y&N =vp)P-fnsH"u;f]WS ~;E!bfK2 YRoUCXYV07;mۉG/ɵrl}F9%HD0w|{VP1/+ԌnX~%ؕ>Qݿ s\wI ooQVt+RWG lƽk!W̢h-75'|a4Bra%VFqHe1j3/PAɪMq DXXwQ iOTm1 `DDd?;40G3($-, <5[*[rC9oWgaxI꫷}ұzޯ#aXӆfYtok]J{6 O1L 2'ʊ֥C@l0s||0) ӳ7[\%LRRQWa68yއ*i TȀ{(vfv41PI9e=ƟGS Bfا\X4;:g)XGDj{|f`욼ݟ{ig4FA /gJ!z2t<ĠeUOwKej `B;*es=;\]Zn'_R]Di] v F-l)1b2X 9cFͥB,q;uC#h/ל_Z)E#W? 2lR.N\xP㋫s 'c~e=^o7[IȒۻiAC.$oQZD%iI P*c+Hf F>WEp0uλbq۽ ]9^PzyWMCh,j5`63K;l-AWt[ȇ-:qt<ޔ["`ku+]|T5<3<>tɃA\}~4p 9JӷІ5p6`+'vJ SE)Mi#XIZ>{Lz~/Ƴ4Gh|ggO?'~^ى.%A}ɹaǯSYga& ]*g%@+91Yё$t<;#A}?n#p(`IbcI+KeU6r-m_vV"^l^ XD{p7;G*,*=*w{Z0 WNd.JJnRSJ 0#&âjt(@L)d1Q ZQHV{YBTH:|q}Xee+$$z˖Yۊ3ZQ`uVȱи(qf 7A*#:p$a hWiRCTM Ojѭ o5UOHN.8U} n/෵I&vkN`m'F6Ѻ`(K|!Ȓ-cTЦLG.HKrQ`eF!d{iuН2.lY[Ndhsev!#^^UrƮ`ªB@3f)-=uP#3HЍL\cQA\{*<|Bfl{$=O 2.`Ch. (,R/l%x=^DC&QC24U gi(b'WJzuӖ?P #8$J6"t堍؂NƗ.uPp5P2Akv;Sg ղمJ-4:/RIv;I[ iBT8ǝhD}*x@?,ߞ.𲳷^ 6#0 bH0/[vS! e=Խ{9tӟ Y}ܦ6H]<5t#=:xu1ojìخPQl mli, ~~|bӡxhw-z3bQa:_&o'(.<R/Qs߬}MFD~wtd!j(YU^JhuYNdS;Vp NLkt܂z˾l}&ka-}8SAOup7YWQa:B A͡E"Y6Lq6~ğe<4WatS O+oX#Qs\>ə0BW-:q1e߀GrJPf[TSA:jdyA yκy)6"B8]v)kmm:nZ]u  [l߈ʍp8ˌί5"c j=Z5,%-yebbs'(D38,Vs1hs~] ]AH|>98Q6GUr"!agn>e_Juǵ |+?~: Pr)n~@wpAL(# jʋq (%ւjg45\si3~t&Wab}{qkxӿcstd5)6'{V71:e6Ȥ)+ϾBiY]O<T}J$Fo\%, 8ƼE\DkmY:~ڼj^(?;꟤wE2C*a4=1OOr`43I1H:UepIVJ yRFEOTmiޢ>u"Ks@@΃z?މk5R7pyGvgNR< %{tGL1gL;zo&ҝ)nWlHCfg#)4/ϓ`E^[׋C[M?>5]|Mh|~68#'FSa␩ov3yWACb}0j}߽OcaӢq^e1[1W+n,w'H3Uˁ%"p4 Z. d@BI8 U6kV\fDŽm4K2yzr't#lmV~8vP~Nlܰ .F'ݺ9H$eyj5yRE#`B@MB>hc[N忰[2MY9Gaa*K*g% =ە8"jvs5CFؙ$* Tb)H5&q]h+g>ј Aa%N`cY]I\2Kg;4*j>g)^Ds's( |}5~.*waY|zJC{J!n"ZXȄzx$4T{Aܐߘ3$☨J4v—gvey=ѠYh}/pd]sQdUvQkN `NMKq@e {D|2q Oϵ3 kNhH-Ni}G'$B?)m)0]JxM~R^i^+rM*Gڐg-1Bac\a/]îN/t*$ a]:#gmNtwr\҉΃ f zקJM0L (-(wBRxV‰b![8R'_kg+I$N/cya60%u^&[.7IVH3WUD[s.s3* h71˿RQMBӴDJ$B,pr0?蜅Q<1Cx=פRndz[x-L*Dcv.{-;r' |8ǏF/o4\PFaf75^Vd>:ʈ[I`S״&/>Y^f7 .L|nx>roH#coYp.XDv"trc04Oo r\%Y|?]ƣzh=jRH2'G? C)6DLaq, ! ?΃3hn2wY ZK]#.=u 㶻_<~H8*$g#8lu#-X":^PuBe(Hۓ^p;c!.ى$0j-q ;c ov;]̥}QŏJh3?y51#k_tX3[wbo}za/J+æmޞwc!_@RV8V<g z"U}Kf N@UIρY2x#IٴSCր4؄H05 eG0e 8E;O ?q;5J$pFܾ|y?t(#򸭅dgcTW 36"y>W}_(U֬ hؤyy#_Dg^HE(垸aH՟ʼn7p% )o0Gw.V2k{39%&*yMBt=D @kN5iK! srBt+cltFsĕbޣ; ҾߊxDD\|݂&X|c5=(sG!&)tIPwIah5~"%,?~ΑۋkV+S:xNAlِ%eyu~%W  g @<:nqk1p澦l2AV5`4J䉪j5 Fuov=dыbҲnqa]JQPb}ς P#6?v Hp:k~RzXRnr}}bnxkncCT;ho/LU!'Ɇ*`IUߗ/1'|,1*<9͂aĶ(ue^hd-'Ά:`|)\CcB*ZH""be G;21dR6N@;=C#dm>=#.dKOy1 X=}gilI_;`y:6[Jc Ep)Ы;ZV pz?=o2s~J2U"i/)parlmRnTEOIt9<+1/梹#Hg Xmc,I~pF,r@N4fjzE7*@>a<v'\|gFht!(mQO$|O7ÔI !g<%  MAbªPI4(mZ]KGj* xh5:udSzqlG(J?`єͳ'kRRs[d+d BTp'\)(9RCj.gںs+PfL'/Ct;@'h'WGvih }my[l^4# IC҉>z1s[=ZHk$GTߌybz$=v)ӟ-DE c'hz(5zeT= OCcEaO;ФwD\}|ҫ%Wcc׭c~[s.7Νqj<[#H2uΫ l dEĪleY-!)gגpsNlN!, nl~R,LÌ1J{_f \&Z.ex[c^X9S8~/-E7AP hiG+gCGNEkIj,4`6*bl @>cmr #QrN@Hl;Zf$'|"*fG"gdL!umFNzw9' 6>X.Z_9 ߢ9e])~/&nMᝍS-~BB,ec3ݫ uv%=|lZ uR.0Þ-{58Q=_ td(_QޫQtDȸX MR(cu Dgl2,B.6FP]v_G Bime#@N;xnN#a `:Jʼn*^N^,9Qf)1m@]y 8> zNȖaum;iS¯/c$opjnB775wRYc$M~g t]Wv%tQZCɡ3AU9aY DsiGqFKhSMl7h]W·ra%G+^ qv4 <+e,@8V}шS9}4mE+oTcg??z"%ȃ]dW8-nw SFt qlщ)=-\^3`E<+)Ը* GŒCGg1VN( uLGXy{lbPl" NbH<`2'P\)T%FEƲf֭wbW?Xo9 J%R=Wx-zM~XOy^ qeDTd5K9k;1=i`mVqKW/d[HIC'W,J HϊZ)h3>}Fh_UgIݽC!(fT 4\^y죣!>lGӥ촪6_}4`${/ R*kP`/Wb8<\M! EgTz,F]߿coPv"*3^A@KA *kTU4'E{Q)e֟!5 N!e)C2;*M!{T^-_6M)-J"Y\9Z!DXt%?9g$>D#ucS`۸!!fPU7L{~%O.{|h5Р2Ï^tLp/_8› Zq);䉰Tқy M`p9N^WI8^|\? r|lv&yTZ`ÿxZQB2HVǝz2TD( pQ5"+K9h'={iKql:.o<wLB˜ gZ3$q3Lc19 6?:|J^y.͡~Ӆ=hA5- 1*HXk1T'`B55av&.)%>OzY,*z-K˦ h(Q⢰m{Rʺ<1A@j<K+_)*^_yZ.Pj/Z%هʐ6yΓ9֚<|Ӷeid 4 a] ?߰q@+[7Ӵs/Y=NBT47m).h^5+ s?-9ims1\UxBV,Ъ5j(p%)\?*c4=}ϲ0(6*k ˿?dNCO.@&ΊlĶl)=XrR%= aRF]0> ˖\$zߋDYq#\" G5Ԭ ՂVE+rEg 7-t$F&{vDEf|/a?`I ޓTsF;g|w)}V'k E+a WTi>13| Hʛ|rB^)F|!9+tsV,S-< w}~\YzZGni))t^8zy?7aiYxrz`r4 |YgK~̟nz;r)x:L4磉^V..Q{I]>.#]Oy3 ̩$p` HM{Y׻rcU pL1M+F2l͞b>3:ݰ9×+TϰIUHgoxu'ḀNV?iiGZ/q,T xے c&ɊG$ jH$`?;&Vj"VNR70C+%xm峻`@HG.I 6uMcy mSl|ЂuòJo#"\hY twZJHɾ3+f2rsYNmh1\$zN( $Wd G8zk` ͷ?Ƕ $# awO8:f畆~.b=JFKZCw$i3=+IX:bL=5>?}NEa?d86LeN__Pe@\IebP-Gu țΑ5ށXIpO:g(_ꄓtP 0Uv1tUil`rгH|\Tezi@Y xP&h&_ez(|6e >fP M8.MVEjwfrfqwBh9Vwڑ&g0?$ {ȊULtQfS}IhdFs!thjTb:> RC귴#e5%`aZWg u}DEP!bxo/wk09 1ljy-~gr\{ "rj3O)5cEG 8n/GI.›)n2''˶~~IU3~i/j4su$L3|x_qn> NfftWEv*3Wn޵Uʛ3֧#`BNRR^pU?z " ?cUSku0o(kAXS;|/wMuoO@;\0N.l܍)͢Π@44K6m|t )R¨ vN.fx4h^%G^D| dq^hl>^R=,s>znnF[&+c|DݺJlsvl2,9 Icю,i3/ J+@9ǐ<-W MƘ($ũ <ʞK{5 g8}%lmdӚ(#X&˔i[(V"^Ogk/#>IHpXQ D=pp"bw{,+(m7Szpi5otucSqʃԿش\Ex8AG<2K_Ɍw w^r.HR5PT釱JB瓊mPrZ-܀ hZ1<)lBd3c0>d/d{Z&KfRZF Z4~+/VĥtEDY}I5I#6@VIQx7bj\0C7ZVMiܸ4Q ptBmmC'fp[Xo I+ѝ\>`ķ?üQ*9/p-2} Q"ȺTxNiP:@ )49QTOY j8ʿ4ESl]ƸR4TE@[=-ZAJ`HU*g0\f7Ys5}lTe)vF'l k/.fG"A;ՅzQѧv}'܂_\]Qacg0SڨKĐIY>aӸ0hהC.Ȃݯ[_߭7CtLsq;.E~CBgXJS,½CQSk|Ωme$d\6)枚[PSpao?S~jJ绔< 9vrz'ɿN] PF#Gw  |K=iSF뉒p9+MD*qi?BjL"BDxPTr]T%ajx%ǝT M&=BB NYW z!Osy6.)z~lt3ʐeo!_UEaxAXoB4Do46UZ 󚣙VYVoЏhry `^i'a͂ݩcl=5}gLt7V1&YTN)USno.s|DbگeRϛWGu8} c\rS, ԏ߷|ht#\@v6,9(}ZA0xoaC^Wu#(gKORbve@V{8u',*\8n3Å~/;0q!F_8[[f%g}0x|ɇw<γWTM=U*=!Ͳh䉒ӓ":!ˊx?(k"5i)tB5- :gaOu Vq,h@]""#pD/NX%cTQYW5m/Xkh8]r~s-v7b__d3 r7w +fR̰ѿD!F{]h.w{v4}#H_v!C ;rc&v7M)WkR;XHӭ2H &=8PkCG4j\Ӯ;NFҡӃBzAhRKռ#N0$?$6nCam ;j&|w-E}R%aBFK{(KĖK/VTRǓe JI#?,SHi]xbkV4$j.$dg]i/HB'g] !Q7e٨% ED9jGe} dYVIw6˅pR05=kuƘ=2bNjKޜ?AT0}dV+O#-%+ wv4s>}Bn+|j:司Nk*wH31Cqf2NerF?AH..q-,l@P6&Bap:X`7$|1T&^U0 e-BWGl}_O-dAs\c:#?dCZxӜ5u|h S.u=vJ\7ϊUL2=D\ÎK/bd'MI{[pQ},v\ y}2~}0bYkg"fn9&z}ElP$ZuW`12ȏ}3M-d}j˥{ۑeWA%=@՝Y0vRkZhi#s!BGQj|<+UzI=nZ W9{ucIy#8Ћ01Su3\۪wOUigi<3Ng/Йp/QQ먪͎݉g"tԕ0}El Yz1_|'BNu! n{S$ ,2y{0x0<6vm oi=Z>O zpOXV6޺qs +G_O@8y3R(J<юdFv.>6c6 Sďsp4U^89"I;6%ɹl \ېIߨ.|%\ai':$r4˧ f$^LakIvbMs 6S, 4eLMFJ<m?ĥ[ͣDIQ`+k/NxvRsXIl.~Tbik-ejB#W{HˋCyؑ ',can<\EH e\|y3K ^lR61/Kb9{Ag{'y6ȎO6nn#l |R3m& u  6*l$$R^uʯf}ְ˦PN[iC4yIɞ 5,fR$Ui1P`"y\#wQ'y0iY įJ,O?VBH;jUVכс,*J4DyD&Q_@sif_l EUg)~oq/ݑ;-3v/n?CwDF t/x~刨,< F x[ǫqRQ(N< OI-x`@PٷTy?2,h/P$Phq'5+yf !g>\Lgp-դ ]i\s\ބ'%cRr/ “5/ 8cB@NɈ,{%Q~l!Zd}WsmQ9:izT>:{v L³)ܦ-kBDq v3K Ǟ;X _ixЉCr d(1tA@{|V͠dTˢ Ys mwof 8H, N$EK3*bE˶J3Ag{;RY` pVڄ>VXW;w}TKR]0$}?v:X&q5}nS1 ͔>$A, A R̙WmD_h#KIC~ZxfB`i|78%J,&!{A_tʸWQ-/Go1&p\6Zf]V]tWZ_6Rn~=Uv1qcĭG8%N"1K'yߪX坤QsHXw$a6&Jj;%δtD^]L:oCk]"M׾\Z'aݪhe[OH/m V_a|I5{pXQVmE⾹\7fa. L=K XEL&ސi? 0/]f!r$+RaC Tb]mq!wQ{pH6Knf\/)Ŧ͔/W4ul!\  c̮ ):WܜHϞ6D2'O?#7nRx!]148XrEWٿ dtnw!Sn@^S[L`"f/ α{3wU:r; wJbd3GB z9ծ] Y9e5(S*xE.݇.Ƙ1V[r'HAN%O?rPU * ܾ_DTo 1R P7C̚4 }BOT%s*4"2MR'Oo2.%V"YRX EDZK7!Ji!gV#. !:\snP3JA&uDiEU㦂~mC*"hƗ@r-_27D ^gOvJ:ӫ-*`yN":#( 8oxxis1-i+QDnNV O:e"(G@KCsJ,*qgLBOBl\[ړY1"}UVܓն+B@LZ/2e(^#:IFEqm5}s0z妭ߠNw$kCE2A'̗wf\b+bꩮ]HXR}¬W\Q jTFK~5MM+/jَӧvz뻠k*5D>I$؍K$1JL23 n9>m>E5AYe=@80^ޛNJAohRBJZ7&_5Q2m?RϚƟ %/ L\ԫ0)"{PNwڜ-kz:y1M]Kr*p847Qo(`O:y7@X0|% t+uK 8D*,򽅲"<(@F2np1`rwm05! Y11 "s6揹 PXJ?kaW'oXH8;vqK^Z[F=]F1w wQ{'bm(.HmPcX \;N͗;8c VP=yy5x!^5/ѕ7B/ù!=4ksOBɿlY-N;<0TBuGk7}3^bY ]07Y=@W'성笒`LSmFcIr VG}qXԐ6㣍m@@v6õ7ryK:՞g;ؼ^Nijvm'v`tbI<S%TPk+LOߦ:iN`IJи c_$D,!ƪ ܮRRVN pVs#l]ڣn ͨɰOt  o1yd jY7W"kz߂ܐ/CQ6p],ť٠{ ڝ|;>GL[D55՟SN8+F^}wsG>VW-F7 i.='<8% 5l)Է {Kgı؃3q,A+>^Ck Lڣ`$,Y*“ Z-D:p1붇2e*0 u8|DP*L\lm(2(:ܝ>ieA̧k "\$i kj.Hc->G`?pFǢ׊d:n Ul~4MX}mfi#_@) GFij>e$ hΧt2P#&lKLaΉC&[tT1/$v{?a#+J5TZWT.d6!)VHUN?W?%X2ʕ\/~t|d W-8 ?:g°-'4ㆦDFĝS.ԙ*HX7%,gd&+>9\t["lc-dU&c^C7C.cXIIjI1XIU<ޑ 7pQM9GX8A%(}~C[ϑ' w5'^Etu>p(2937rU#2ܰ" ǹ[==bRJD6tF4 /f`ۺyV!N>2Zq8+ @ }_bu#dCn3AAEsVʈ&ԵâӞkOH'.Tcg [FuQQ"E>j'i]$BM?{)$=Z/qɑcuKR!i}фkn;W]Ȭ5TXVtaX~6&oŐʥw"vNX"n>]To$Wt%uG>ogj_"iśD|^{3M^m+Lry^j0inIȌ{QŠf& X+b?Wj5k+&8 :Ή$:0nȜO|B-&?bN V |c7Q9&GGJ\UbP0=Klv~ɂd1KVT||٫XmÅDߖ}z9:GGԯUm٤BvDݤ&lٌIX>Ps.r&„Ἴ,,hԻ_%VԄ+gd-L-cE -h2Ixb>7,o>󖯥?7g:1k#7)3S*٧$j;y%ϰĵf$?yWhe79^Rrz&N׸; 䦚YPMZ,)N=7U3 8ESiiDdbK^GK(=ts8JS5?)fE158 (4ƨF$=~_ڍPήwN=:&Ok!iGOJfhTL#5z{ִ7CʦKRTX3/OK%z]zWz(;R׸,ݢF.:9.M -Z5FƁKҦB`gՒ.piMTL(*_dĿ#ty 7_"rD4Ͱ,uYa^ com쌛a r) ^>o_n`JL"$mLB Q .[Y6)E6f⪂6A9e3Rq&Iu 1 ˗2cb:RODaU3{^=^> kgae`p5bdOB6&ڟAHv1 1ebLu}ѱI4TU:,bn"W^+z0 6}ϝL$th\d:4y'_WS̊H怅~P&)W}q/ g2^HC!zuWu ) }BzJ880j+sêX ^Χ˕xs7TAFANJs )+9dCK@赂9LcdqOh}~s*3۠YݽYRW2Mۜp"8%;yV7KVνv/' az7rCOBD fQ+qIߵiW&]3ٓ\g#{ghz6Y!yV^ʪ;qV!Qa W3i+,BxHhhehc3we\d(s${p m/s;DAmA>ΖZA:.h:/ԽFۺ~PRMLs|.T>Rzʭ7~ɑ2;ItUF q~jL.ij8ކ]?B2]쏼lxքXWh tǶs!5LW#g)[atXq[QH7(Juv!o32 &80M,,Ezifc| 9)*i(@t?VѾ9 T\ W-<*8MKЭk )`%=cә4ZMF\S¶1K"DAX1sI&e6ުg]S0r&u#. iE+ (nL h]jsA.FUn@cx=dXC_$BIb 2^FHԅGFuf_lq(y*|VEe\p(`J9lKW( 4X= {z62RP,9.KoDxpؘCLwLs*M')j|&\vӟ!{q $vZr6h[UO*9qv^ Nq'6/!?um>4nN?%YU. $zU0~WXwP},cܥՅnrA4?8IaGqi}Xd#Lfh(]f!)uN/*zj\HUH m!j- eFqߊs~c \ HԿzmdj5Z.=cds1Old-+m{ʇؠ_i7Fn`YN*z~0JG?'P |֤c~B@4ڋrTno?¶#ԍD*qv~Jn OK2 \H9.{b.3DA>|윊Fi.m:dk:xv/B0V|Sikkj8ǟӫ3 iS/[23,6@Z>nB99a`%I 9e4M|z=OzBr.h8hM$rݯLN\}@h·LyቮUȴeٰ|5[J.[c,,(|(:F&v@kMWr-/sz YUi2ʅHއ}$a`90_qu `bPՂP^9dúu)!MV>?>J4&F=MojLXl/UӫrxԒN ٔ;b|AҒ'$qBg\mX* {pw,!sT5w![ͨ*YYiXwdK0)vjX&WF/4M@ 8DJi(D4DX oELu?qաjF ps !yIgjIG φ"6s0FiH[q֭}!s8pɊ Ǟ)E]Z~(t}ֈ XF6d`C`-'=:q>*Cu'G^V2bs oc ҨdUz'>*NDb 넿8dS2ܺIquOAP}ƺ1's=%(nh0г;Zj09 :xA NS88&d"^66\ 쏍MH4҇C9|si5~EWZaH?IeÔ.MZK2 |Ft j,c_o3MۅT~zièN˧enqPOC/zt11S=>ڨ?\*/5dJ MTڻUno=jo $J߈j7$LHU>mA$_E*C=2jřg+C P(UH [UITkߗ)opٵ(Z72  1>hYT~+ ;GHoL"wWEȥ)(oE+vV\ي".t<|r[f pv]S_"smI5m3^foi3oά[i`|R,YqEe{5urt~+EszqvvmH=Z8Χ hMP&E!%]2l\³'Ng;zli.φ \jMfoa"u6H-65|<*8:DՀߴG[$jr<"F~~1FN\klt>} +̞h{/XT*wKg|N{JC+r"J,ς,6Yn8uͣxY$2mӽ-tC'wen4Ϫ>@b,I͜c+=3!m|\v*΅ e5n*9y;+ M)#`l.? țN~* )=}:7^)?'7@TXAbF0 8Syio$WORcHB+Rbɭΰcl}hGQ߭u7[%fK7gvL`Fˀc`ln&'zj(s# _d(+V0_Cv6Ag1Pn)"n 2"E!a3^WIl9Qvkm ;c|Ch)Lv8)? W9 Kݽ;d4E[B!贕`NRpP9hѭiyL2(db[/{a!d3q~7 }ՋzA ]M¥l)XqLnۙL6檪iNjdKoJQvcc92J%P|H*}㘏E\SQs5SDAâ] m/ie'.=7 26Ɉ;}YtllR=xeIEsdGS~]SVe.xjY VaN2;`%EИXE>2yq^ 6Bl-AMBD_QN]#hQrg#E q`'VZy䑔[(^pL*]O?#zJ4njJF`28)fkqTm_fC=ȌM6W'SdzXl%ނΜǷnyYn'1p)0 D7u? \֎Ç|$㞻bFwKޮ7vy GakL 5?й?c{,A4Wn>W0K~ o£ΓtV?K]Џ`j*v%SxYC# RoE$`>]sSsuI;K F'pYkuS2-4+{ܽi5BHɡX[`F)ղ~p)O Ej,YQ7WI6' 9*<ث 0;+섫YjƤh 2<Tm8ōķNIFɵz |B8Z"h$/cD"D8}x_3Xܔ I&ckRAdX%wFxHp)X?;!|pkΠ81k&T h.$@b:Qu%rۦ 7K-6IqJul\/J 4%E_W3|\$1Y5sE~6 z~g0 (KD35;0 oRE $( +215wN!sm2gxv>ɕtTxl˅дz NCE 9CVܙ 1w%ҴWJ׬%P>h؟r;ݍH.aRdTᴫĬFl 6GwC@)a?4%T%yUߖL\Zż,A붂Y,ݪ•eW.'ӮJwvh"76l)!wĂr~6xp V1U4s~^ԒaR#4u%3RkUYiu{t^؉XFlepn0\ C0OødV1&]w7jfn׋s mS}k#y"jl$dْsqx(qV2HUOh%u'*" 6gAЙJD UX;7S*6eXu,xA~ #P0_?G0hRX P;w ٖ*'ӿ ƜٵJtzm8k@ }甎c,*80|3oxq}9/\U ?J# | %EvۄGTȓ;"|@xSdPugl1nG˲ u3~WMq?{N1O4ݵ cRl,ȋ  (E-"ay*W6$V>1RHԡ*1Sbqso=H*m $ˤA\ߌ3@ N60ozVgWI |5z=j ~2 ^f$/&&`/By,:&K -:}r%DB:~9nf+ t0x*݋[ z5Vgdn!ٟ-j;ML@8S^ۡI+ҭQ 6y뺭[Xz K ~uQbK!iݟ{Vʢ .s 3=ĵCH^yXMbJsj{Efh(H|89k(&sqf`ny2ƐFNffbN's Jtl'g{ k#9 -A6?S.>BMԳK:|k;CvrݭRT' ^@}uoP59<5kDD~'@/Md}HH+`E4F»lG?Cȷ!@g.Q_nVI2{-E=݁Kx,L9b㮫d1|xcgQA*zU:wQK/s@'0qo' ɟ)@E5>[Y*SILWQF{EԱ-؟#߇[D$uYb<ġp@3rEj$!E1w.U䋘UQ+sWN:@<jonЮ/4$HypYkf[ݶjR=硋ve*0IWW}lͬGk7w *?Q|d9>{|\YtP%)V5ĕ|TLc 2G$kw!pӪ㓥Osehr#M; u3Ps orn-[ͯHqw q}=pD^6ari{#w|+P'$b7㋋J-zK7.s ʮ8.% ;kCc-+1zA\3qB.GЀ \%˘sJ+cKEJ1\Z/۰U])ft8k$X!kSr܁[.jЇEq\E@o}x`c,rɹ[)$m|ɦ$jA ) Ӄ O [#mn`3i,@.)M^R>.wcMŘ[]t*f*foGԴ*-|\Ew ïߦWPUb.|= ,*#Lꐏ4Z]U5=ӏ'Pڮj# ,L2y18k]Mh9 uF+ez&]u֤ >@;>4>se=g 2b3ozkPxjY ")JVldn3@" bRjg+"X74hA,Ѡ'vzR۴ESçiQ)iAƴ$Yu)C᥎u|ع@ڋƏ-^eVt_Q=yOJS_!0:;hnu.t\|Xr15giP=k}}TGݙӔn)e: ȴl mB@mRodR'b}F€"rI{C)XjfRѰénKd&AW<dUUϣ۔RP} t ׹b,N C}?e/ -j8{{M ȊV5DθQh%9>xL D!\RZ&i)Ke۹4튝Y2.5c5@Oګ8,`bEZi6xM:NJgYR"{l@m!U=xuM4<* :b$y ?fN5iBl$5RUOo&HkPn>w1N$^j:6(fH"*uj2=ϱ?BM'G2t}8Δ5̆l:F~e:CF%d^0m]5;{44eM)RsOƨIΡ YMKJP!f"L\!ZD A\f$x$ܖi>fM-Ͼ,wT7瘙؁B_[9EA(yP1м4YK"XCuqM0"A1 _4OˆXu [ R#joyE4P62'M`ȅƕ_/*it%2Khx4<.Ə|k+.[ғGQ=v;6Uݎn Jav~rTNDAI8V=j_;`QqB.WAc1Oȵv7#f;hlZVqo`KHgg]e!фt= 3av:MåY5)> L|uVܖ2coLܝИQD@ueKdpus3i"VF+cĬB֯zBFu\ɷe01ޣ#n; &=hMR7 t u#ܾH%>"vc;]kmM2^pdR3 p:GX86jj L&l\HКzQj Ԓ'alj|L x&O\mP&ӄGJ^*r^zo,pq<*s-'(mq\{,Bx L?2z,z2 " v08Xuubs1<'3tD4ʉy62XDU?o[!&:+k+r[zEbdr 's\xY¶bj QVW߫+_r4@b"j! .F =W6jք*1u)>iB@ә::#jJbЩyy /RVZLNQ}lyJdpi>DDj)}לqH0+G+Ro*c̉b|--L+*y9Ct8[{*Xp7H_8UUb͌"Q ZOb/=!sL{7d|NZeA6c0%oT[m\c-_h.Qm4-osyP7Ӝ.5N G3z.F|COi8 {[Rd1ͣ>K!]!i uGwWOCR$m EuKosLNE=4Y 9V._{6E~ i7w1SbU[u/Ax5}|1YUYmQrLTspZ {Wt#!tyʬ$f|gnQ\WE;4 Iclǹi8 l@|GD)!`.}P+yZ~Qէ Zָ:ܰc(ݳi{ub=AN_2ڝ`*ZEti6&{B2 i\ [^9+rio5BByY=cT kQ`ohfFcf6<o }J=i%a+M7L96jsuvg9\p|ZSO>σMN n6*˶e ƓA/ӢMzotK`= |\ c+ݴhhf2[ Nyb*_[Xw?liwqL:K'=7Y<,&c%p?\31YjY4V)a %$Z`*jl8!QCL4Eud˅f$S  ]^Q芬ogc J#}QU^u ~Na]KY4ֽtGTSSQ:MqBclW=8}XI;b_bDb[>xqnKZ1᧠Ǖ٪#&m*pM C{u׷Gl*%rdT~ѧgӉ}`yw/Jw=ObQ^vmuU~<(̖@㮲aH 1-gU{*K?,$ċ2?Jc }dةRe cCPtHHaژ0鑯. j~Dk(Wd:vBₙd+xFN2Pᯪ=t* `V PYHEOZv?g93ȣaxm2T8{(Ͼ/ᱤ}hlcX|!=^7;an0SР֗hU ;حz[[HNg+šzmЕbB GRH읆mNw. :{~g?)aE˰c;0 9 ߎItJ*mP5#?`.ZԦXe[j,h\:8vgP( д2O{jӸGfKÒd^mPImP˴9uսq>"`dKml&@SN,pcpr55"/yw#nj%N~ c`t5Ƨ>?B R/ybU;G[=ݹ8-=-=i %/^]_8ZkP(ڰ5"#7e;C8D^hBkw K({3lIOKG;|5~[_&(tf&DB,>OT`7}{1 ZwIh/M@veGijmuMt̾@!6VvRΩ2'`o:@dZx  f.eGO^x]1q5 H'@/@rc`r&q uܯ@q4kZ)oȏ9d8cg wqO||/*oe N$qV(D|~$h=s֮0">(q|{Hٔ߯h#3x̆9a$ "D(W&XCN~8(ڝկ Ó=6_2 F1ȑ>Kߓ[5(1bHdO8ĨR;2\ٿ.3+"gQEЫ蟔Do:Jctk _+ϢFDa"ߌG.' :PƘ *psHm쇋Mݞ'`kozY^0ќ(b b&@Ԫ}]H~dW4)o@|%!0-( 5Q|[`!,sj#e{SNodMsh0]7$! Dʢ*xF[sjAVj&{$mk@ B>?i _к;;sr gPDt?erQXK>`zȡgqr=~ (7Dc&6\SȨà;fAÅ*b}mM虈J|+06/ǟG13gḮ+AӓIkG%S(u3/տ~9Nt}Dk6,2K#Rju81lě JJol('LLdQ{'עXVR 0Ce>Y.a "7 `=.t1|nsdQ|%vu6'f\Qe?{y]Y2zr3\=33c鍾=s~Ģüa5!\LfIX{ڴLI轅i{x *{@,R\\h.QնRԧ~1 ܌ ^u^wd]&BDZҺdy^&.G,e->嘁D~t48gAGT~7F"X7@Mi@p"CZ}%o9˿dmED|T͇DKaB*iO`ӑ{"yc>De!f;t<e8q `{6OdcDmu3[G_&dAL]`OE׏` juy^ ϽёYʆ%YW!jQ9緢$W..r?jQh<߂G{WNcֽliEZ6h9|Qu&cvzTg[v.7@i,$x*?@`y+@9ȼ)m|G"73j0qzYU|﨑FtԍR%Sւ+iچ{m_dGV=@LסZHڗmyy S 깭ȲJ s33%z+E3#46sއVupG(Xˑ/>(nV x.E^SQ)TV=g B b'6rqWq>)Z'v}L0  XǸ5,Y(P$)H}ɯP:$nc'E'{m;4eB*gbS~O=1B*28akWEKx _m<j'6B3h܁F:A$V3A4e yooWZiFϠeD+.=gA{ѯgķ)ij<y_6%oiʛmҚ{~;isjebM+`8C¾s_gof["J7.ѧJm m>g&XWgbQb$lݳ-nWyZ-(a"͉tܰ9)wq1 GaaT=4ʂgKP:ꑥ5$'qz ]WJ$^JwQϹ?+d'E6zxڝS H3 Z!0v= {wx {+Iv%:_K+M,4bP\] 330Q8B$Z<?Uҝbn92諆 -JR 2]%Sv*XWY]@Oeȓ( G7R> i^)}԰YedcCH}xI<'T4l@o&PGtyd!.#B{Y.wESöUQGS `(4yv1GZ 5c">/sg8(KĄ@s1KDX?jUnܜF,Hq.Mϗ5؟ݙC= in2mesDq!e4W57r=e!+|2 嗛CAPs C#΋btsT2Y @ 1:sfW.Q}iМP@7=5Wi_/+R,!I{Z/[>li9 C4[ĥ9k:~G *()et;T5oH::ClIpJQT Gѽ|*:qƵV m(X׀@2fqAͭ(l_ 3xj+Fa_ b1W{FoeGlʍ4A>x8qک3]z .wZ)-M13ׇ>NJIHeF&=x d-45P6f_2u4z̨/t$jӫ49qmai>pi._^;TrlPaЗ:p^ C2y/ 6K MFj5c(p!kJQ-x7gJqʢ7RjA8w~n2 L?[yQ|?NIhuuo>4(kcR,7a#-)B?RTj6P?; ">ZzdP5[1k==ǿ:])k9D ; 7=^d=^R}r M/\uoXe&hƕ8 v{ Ã֩9f ^ȳS u壁~$D9C}sHe)7Jڦ5ŦbdJ1Vod |H[ &si#݅&1F oTطmW$eyBH_6jM=YKL1Ψ<0& Gq}|hOMRzr6B*hr< ND+wު B^FzLˁRrmҪ#HxD(n%6*4nvmFMbjğ INZpwz-(ݖr]wOq>y6Q³΋a hM|Ek+'(M@<&Ď_= @p 0)Ŵ:@i-&̮"Jp2{l%rPGmF7l 1G9چncB8&q6}A,Yqm=byMȏ֍I0(":|χ] D:Xg ÖW)"D#MssF29>4:hY6a'S({z~a&>ٜwȹI3@y<鳉z,:]u![%hTg~3.WsZхCU^Dt6N' ħr)+AqӚךS??E[7H<ŖN]o2T@ʯ:硬 gLy.^ԭ'6J~U mKVr &C_ /)pkkc&LV*5=@jX-F޴y,^=O#]A=gȩUUSoO΄\A`HӺқ_fS۳acԙ/t8N[6[ʼ nh u> 4_ʟE!zҤf 1#L:% @ P 7LCSl>Рa!#QRFt%쑥L?ɝ@´xUCܯ a;*^k87/Qa W-$kp-Fq;# ӝ1'pSN.F~yhZNk ?BB~Lh%][^ShI C3ۘ3f Ks̯޸_ _7zp` dATbI~~z$9)~$ tUo+.ecIÐyBA~pO)]TMCQދ6c&0|vvX%sqQ)Uȴ'-,O'-U NDue(vQF8{@k9I0^%65\F][ :'&lʋBgS.= yWWZ ޅzM޵6ٸ$vT&~tAcMxهuצ:`fXf>1~q3ZjFb2L9|Sȡăߌ91b^[F<k䦤]NOC`*+I)/I$f-g,7؊/`:~YsDް VAmq9.ј:`d6H@f?O7.?IN?8)gnMp>tv ۏ3 .jTufDZ*Cy-ޏU?uWS-9:kJoAϝJ eMH{fh<ْߘni<'iaP#k`'^jB:mӎj[jA(U#E+!{i4HǓR ˖J:yqT:5x3[KsF8uBQPs‡tܡK- V,s>=;7uϼkZtlO2sjcE?ّY@-]^JY; KSV<Ӟhb:Vlqxaw'h@ = uF!5{e! u%=_)SMuk'ܥ./P0&gɾn\GT* y px^ެ0i״RhЖT FKaЮ }?A4bdHd^\iB&;/nmGR`p݂$yQ:}A,$+.X_+HOp]Ⱦ[22ĈMEQРSmOD:V?4X"\tmE }aM@G9,)&+,b2><^ԌCު@Ih'0ګ*2"˷MMv{  ^@9})f^ZN^ſDb7۱S_ h-B0DYE8aܣ$v}kM0pVvC6dK:K hʀV|SNtuJ&*ؕZtlz%=mT=:iW3.5=? 0'U6U4!܆!\,Qeh?r5 #Z~9obx;+Eûqw,Yz=;"Й9aVeÚ֋pe߭X72~r*11}/۳ΏoOx>5оo-F,[uEF|'|,V2|raݮ]ʢ|bdoF9+tDbM)* 1K'Ch@q )]hR'3^YT;8M#}JrU[0NJ-ȊYsBi)JPDg7ݎ(Pف=]prٸqb"CPBQrB00ݝ}S*C|2,irޘ(_(챃~F1#wWmWq$R&X ,<~?|&TR::i4ȿ;rB#&E*=0L2^ԇTe% [/5l2H'iLUEK4oj]E3u!]95*&pfxc7|i r0PwR'=j_񄭧,YEF$gy k^rp37}̀P!.}>$%D߬|1Z#u "xf^6ܨ_%Lk4)х~>EX#y#$- eUΰ # MS[;6z'A,6y-ΰl g$#"cd(.}WUw6Qv`21Kq,{>d*.9õd#-j̜r#48Cib2""pA=ցm.̮_;}%lc\#JEX놲7}Ŏ-132]Q&: Աу Bs\$;2R&Rˏ,9LQZPD|CฤbYbҐ>(Tpܮ-˾Gew}_vTd| y> cQJ m 2~+6UP]>OJ/0q]iix +c.9A/|0 f ɪ#X{-&:4 OY ÷Di4av\Q*k/> p {"RaN £Zb膛CNXܥq=X @l(&_=m*qG3ahi-OڤiTY/P83nx:S(4%uKO Z*(cw/T^SL ?HĶcZ% Oҕ 皔twrm}S;xb몤 49'ʂ uƽ~X1x-1. v"JtހXj. f0\nCZkRå0O"|lޔ34- *63Eפf}SQp熗Ղֺ _=y%VF'/Ҟp~Ba@>y>0Mir YѹyX_jP'T9$,+ލ}]7,t8Bm_OAOݑ$' TdjdZu =72,N ssqTD7SN v;$B<g4Kx컁H8y8-9 3C3S`+9aFѬȿ*dMƬXr'9 Lˏz¹ m( +hV#IJz}bD眹cLH^sƞtV켇k8FxΗDifb%e^d}i&1YzPU+<ʹ@?jpSuNNHn.'JQ**gZSB'~ǙQڌT"/PrߩrXaq_݂+Y:.#5'0v2ZP!@>n{7Vcƴ] blYzdmlu¹ɥ m-ɆBjބlLj/?J5{A'k8 Db-&CLA,Υ+bCg7Ɇ&BzG F1_]s.IV@a+58!l_+mcGH+h^{ͨ~Ms}XQjT.9 F|5o{iofid=S>™L7z,N':$WgPr$#ayArVz6y\73@R!GuܽNjMne*)ǒw\ld:=phJ}ENό9=椯AQ{BZͰj7LSܭ o:G1 $Hv!'^Ů"'%TX RHYjNJlqN?@&a ѓeF]@Zw̅cr5%8OhM"ZKpl1_Y&O8O6lI'9aZo֖$ f-jp5oô뜹`SXO<v◰ހc"~ll;D3[:+ 桏'NBx1%$8͐|x^iM\:YP*6DXv"ȱn rK4s;b*AA0 g>ym:h?̯1WU0וcr{J(ّHki1G93哀Y,,]#FwiCռuBSFq/=g RzqdĖJДVs,wJ7Ո[=c^+UkQ&LbWfIˊ0`K"]MLڹЕn7A&）f#cKk3!._ِ; "3))ĩϒ6RRQb(pH218}%[y6?G~4O1J3X93Ո,uvEaw~!%;9fxAb XʕI"Тm:KEZzg @eJ`R*~n2%n z8??`N  l\b]S)4u/iL[lH xLgZ-a HٸŤ/PA |/VwB5W쯮FjX!~a>ee*Vz'pp/FQ`q: quaCF )DEӎ}?xywBt֫fVGG@Ʒ=IX1 YXcsZRrˬ#D=ͧ>k:uGi.5Zvjd6m;jE2+ٹڜpG dl^5#QnхFH xa3(ɇ1sr&8c5> kvɂ~xUH8>S&NB,v:w^L.8|^t=\zmm_*^FPvzչ 2TRqX>7^0g>ȷFY-Vbxk"nJQ~8 ʃSTt1/vh8e) ZQrau2^8I\Zu~nFp}Dtdhr=Ezi '6?k6F@Ĕ~^gRk(1 Y0]ѩ/(Op[6~xl8QK2{GW8%(9;̰C\W6x'j%-p"\/mmΞOlY{:B.,~@O|@&T=Dz?^`&֦A#$fk!6،^|3[=҆kLC~L4z1bSOz= `?>g̡TI35AU8h44dGbL/ )+J$GC5EF#M܁¾-*=2G+R& 4m/?SvX7 WQ6O-u܌Q"dz惴މXE`1XtR/kp|JtQ^[0&wLe)0m 2O'';sY!`?׋C޴]͕E5H2 Vn}- JN^TZ!B>ߢ;cD|[ޖ Ns+eGu%s&迄}`MZcCIP2ZaK; x D߬ #B I+%],̵yd2"i!xB9O\~ie-+[سw0ˣҕZ)&IT[7%҈J]! #o+*deT$!Y5#~X,ׁ8U ![ 2 $`Q ٴ9Ov{V]\ƚі_&ϨqR67JpETط=2CS񒰯6y#oM.BM83 -bm}خffNv1@{ MKXvu_93sVY%6+L8CNeFxђ7ނ3-M&vbdfṢN.Nzqp,[ ILfUGlG˃+L3XiްCrB?w%=LcQg5D*/;I sTU c֩F]>}U=O,L_`Rz{SdMSo#v'Y 3lLWov2 i!m2Ufr+pa(VLݳ6O1$a ~:Xz@|m8(BCʘ PX#ெ(V1g *Y㤞UCQ'+q #$ZUQPMZL}٧UstY/L-}ﵲTZԀ$ Ya1xo.U:0@%ZާZ=j1da|^+Xz14UhصUށ[چ^M *% S衠5cر(*n}A`hLӄۥ2spkVҸ6_wEX t_Yx 3"s~AWt. p\E|rUtLk/G~Cp+\ a/xƶ3ۮ%T 6}qM݄o1ρR:>jÍF sx5k&dsG ~ɎMV͌ƒ\z><2s5x|ub>>'=/.$N=͜WS>Mwb{őw#֍zʄ@sm\T,q$l;57Jd],|c qFYwjnĿ1+J6w)~W5+rS#m(_)759dž:ӿPRnnS 0y28 L9#;82C򏢓l7eQ%tHn(6} xI(($n=zl+PL@W_v9q<4}->~K%,18 'rpj+Ē[[h#zй',Y fCȭ{RvR@_N$J6ֿ+:@l[~Ixr)1 L5a3^yn夈.ʄ ]gޗ{oSN]uB~CW1#%1uIMݱ?}Vs  R AL5:Sѧ!|al%ޘ4^ T B+Z{bHtj-k,%VFsL=1bm?Ty".8J-Hxs@f5 ڄf!$?A{#r{.SLw_ SdN6OVgq|eڭR ?]N}P/*ג*jm~AAqLʅ'ٲDW -mOW@k<;Y1E Zt˂O+~pHte|afYkdv nakx /cxa'h,cw700@2kű>oN蟘tdȱ 缡;ӯfH&AW"[H{A JV(2お|w}MiJ|8`#eL\pK*<̳6=x7Lq~RlŴA.pAƝ;5n#[[BSps.OHя?Zη1TDڋ.4(DҳFBp<)2?>kYG3ޯ4S)ܙ`A z}m-߄Hqi(^ U?(TѨc-BOa ͎t6T.\{Z81R%z3z?L V[gqQ>uVմbOb>4*gic׿}H:S;/G=\ɉWMY1V 3w( =RkPX:0 _}J|ݭ/UBÒl )><>H -c}9]Jn+LhyKUl-b3+ Q4R:d![XUh̓Z竄/`P*d#͆hᦐh!Y"[A1n 5(Vzm<%VZom[߄] e ~7K9dYeiJ%Vؼ#O3\aB=R :NAyPma 01!mޫg ŪP5ײF|.:33]6քeu?D0z5nLBCﯝ_S:@ -5Bke`ө dGl1 %IW;"!*rY jwB !+P~G2|JOt{?/0mbve9wGO_=ni!s/~ bؾ׵$h(}pꙩ FwM{-fKXtc @@=N*o2W .8*P-j΄Jz~oe{ENQa\/#Ҁ gH~#`o~ښQH6=g D&&p@NDW)JvJ_~]L ȦAJ1p ݼV'\Ԑ㔄fVهO=7n>=e?%Į]. I~e ֥$wqlp"<} {px`q)a0Hu?ҏHjdRΗkMB>ˌ^ mGwQVC\@&k{G y- `#q|EXս?.'¢eo&n5 HTZF@ʑučfɅbR^_hw۳-8B3x++ogGɆ© A 3BT7 A9Pv)Ó_;(I$>Z:{24 V qز17V҄b C`%1Vo؛ήFKLH,>.=8<~lUp cHiA pfLI`7k 0>Ft)|gh>.s YIآA CVM#O*\tw)˯YW/0r0'Y("C&Ͻkk icI]-j+v,ձ<Σ2ۚ+uj#@Л =1l ; sћ SN2Lzx=P$-ǽf}C\lVQ˅nF5JٔI T}G!2+ '/ψtRFg}._>*ٶ;:mM~<_2T qӣ|-ǔ?@1XB(փYI˟ڄs;h`ٶ=iac\6`t4YT}s8Ñ{WH Z o;iޅ67-sp8q7l,GNv!v<ȣn*#:[[GQ c&Co)4‘ * 'QVH0R=E{X ԄfDH\B鐾C>Sz;YӒ6\D >ztqYqs90.\)q{ XaV ̭-LTY/:]S^cLN3cf5r xa}T[9]'.cl$!3mmXs,&8W `UCp8ߡ@gu &#\>pK&ԕbw({?jO &TDPm2lGf3STu (OR5N))6gFE!-i^HrO-35-w Sl?)u {+1SpZ#Peض;1XGú @^[^"p J-VgM6.P wܠ?PjKD?ۥQm}Acnj(`G.%6 1FV\[W>p00<|t897TUä$b99vK~) =7;ZJ=F;W{(uT,+rcr H?zV-? 1-'=i_g.ZۥJQA=e6<5?Z΄E;(Ff,nۅC5D*$]-L._Q{_{ MM.2~YA}6Uu?S{)Xq9ݎxR^1k3{uG?g~ :Ș%/~'AuL47~f%>>^J4#;@:4cT(ck(d|I5{'~7'j$Wbcf5hSd:z1)9 K'xf7$I *7}Ph:pf2dVԬ nr :@{i0ZZKpj8a\QXBw+Ceg!A`:7u| sY&1F}W]([! >1EiS0ׅI'tˇ;=&w**ay~+zXބ~0ӃLH:XDxSzv }ȓGl7]7=Y*u:kŠ HmRzh) %-.hB0!u+e*30. a(hq酮!>4fI[BAG>;G*!Y`%92Mf3ʼ%6\If,Vɋ4F0M2~@p bF:sԨ$ð2Ֆ![7{_ } G>;O_Rˢj2 "n@Ԇ`e4?FQvN~ڃءHֈrX&O0ơ'<l%S5\Y݅ z2U r"iA UY6[ErʵAv $1Xuw-ukFu2l;otaz@t%)_  &KUls(//΢7pܔA@<y6E4?D{QL_`悩TL&͑4^k|_1<$GIRuZeee&)07ޠd!Q^f:R5NljϬb&}>s#HD/;HkN"@e;Sԑ쿪&]]ܭO.??dI 6@['8LM40Qi"FxPAΨ.yAu[7[Qԗ\YO}':O2O4e}Q9чƏ\0X4䂟<\dD:%z8+A*ZL>4>8><>@> ]E@^E`_E4E66f( `%DDDDDDDZ0Ҕ/E9S&S&0D8D@Dt 2'6PDi#`DExDD.$>DDD D(D0Dd @DHDPDM:`DhDpDPF`F >nF [F[[[h],6 B Dx>x>DDvE37ZjFZLF[F@ZE=E PFPDhDpDxDDDD`@Ry'׿'1N<8<8[GDDP>T>X>DDDDN D&`0D<FHDF`D0FGDDDDDDȝDНD؝DDDDDDDDDD D(D0D8D@DHDPDXD`DhDFpDxDDDDDDDDDl"FDDDDDDD D(D0D8D@D$ ZEHDPDXD`DhDpDxDDDDDDDDD"FD/lˮ`s! t~*%!+ A D+k+1U "O=F!p?қ+T;tH09">8;>8t+f.G)6 4$Mu@["71x i f=}=ng!-4$92!kk'D-k2I,55!}"\=!#)69+!47V"ПD5!"D"#D(D0D8D@D4F=U;`DhDpD?,6WFD֦5555DȠDРD-q(D0D8D@DHDPDXD`D FhD3z  +  1xDH%D/'4F'>DD% ##СDءDf!`BxDDDDDDDDDDȢDТDآDDDDDD0-[&a,w/@S7H*F@ p"R##n!AK%fK%,6>>>@DHD FPDN$#r `D~ D D D D D Dbq;{ DDDDDw DyHDPDXD`D? lBpDdzDDDDxn'.o'ФDؤDDe { @DHDPDXD`DhDpDxDDDD  6/H0X77W;"-{ $>(>,>ХDإDDD>[ ̏)x 0D8D@DHDPDXD>F`D6&4| U/ DDDDئDDDDAcEzTJ | %N%3P)yDDghz D.0D@DEXD`D/-pD687DDDDG0B%#-0+ЧDAxDDDDDDDDDDEȨDШDبDDDDDDD G0o| 2Š ٷ[ [ [ "h H(D0D8D+I9"HDhXDFKDD'#M3PEPEDDDDD /!D D(D`<c&5XD`DhDpDh5DDGBDDG0%#p@DHDPDXD`DhDpDxDDDDDDDDD0-[&a,w/@S7F@ p##n!AK%fK%,6DDDDDnֺk~L#8D@DHDPDXDnֺkl~hD/,FDDDDDZYrЬDDDܣ*D P@EPEPEPE`>d>h>XD`D'#M<FFČFFDFFDmP8EؗDXDHDXD`D؝F6؝F``؝F@,@Y>@@U>>>> NEO>@O>?> > P>>X>2> >>DDD؝F5؝F/؝F/؝F`B؝F/؝F0؝F#؝FN؝F`W؝F`W؝F6؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F6؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F3؝F`W؝F`W؝F`W؝F`W؝F`W؝F`W؝F؝F/؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F/؝F؝F؝F O؝F/؝F0؝F؝F`؝F`؝F؝F؝F؝F؝F؝F؝F؝F؝F؝F/؝F/؝F؝F؝F؝F؝F؝F0؝F/؝F`W؝F؝F؝FHED;>;><> <>@<>`<>4>A> 4><><><>0->A> B> @B> <>4>yE=>5> 5>@->P->2> =>3> 3>@3>B> B> C> @C> C> C> D> @D> D> K> @=>L> @L> @YE`->p->->->->->->->->D> E> @E> >`=>؝F/؝F@ ؝F/؝F/؝F@ľ؝FľL> ؝F#؝F#؝F#؝F ؝F!؝F3؝F`!؝F# [E IE8> FF->؝F6؝F6؝F8؝F`W؝F`W؝F"؝F"؝F"؝F"؝F`W؝F "؝F %؝F؝F@#؝F %؝FӿqEAA E.>S>33,> SE!!$ClE> `r>O> vE==@>>Z?x>pp@>؝F6؝F6؝F6؝F6IEIEOE PE 5E`PE 0F'؝F5؝F60F'؝F@)؝F5؝F@)؝F#0F'؝F'؝F7؝F5؝F6؝F5؝F6؝F6؝F5؝F6؝F5؝F6؝F5؝F5؝F5؝F6؝F6؝F5؝F6؝F6؝F5؝F5؝F6؝F5؝F5؝F5؝F6؝F5؝F6؝F6؝F5؝F5؝F5؝F6؝F5؝F6؝F#؝F؝F5؝F6؝F5؝F6؝Fɾ؝Fɾ؝F6؝F68D؝F؝Fm؝F؝F#؝F˾؝F@˾؝F˾؝F˾؝F@˾؝F@˾؝F %h>؝F؝F)؝F5؝F5؝F`'؝F'؝F'؝F#؝F!؝F'؝F@)؝F#؝F#؝F`*؝F*0F*l>؝F+؝FB؝F +؝F +؝FA؝FA؝FA؝F+؝F+؝F+؝F+> `5>`FE E>>`4>@pE33>> E D>>;{(,>>>4><>>p>><>>D>L>>>>>t>؝F 7؝F 7؝F/؝F6؝F0؝Fa؝F5؝F5؝F5؝F5؝F5؝F6؝F6؝F5؝F6؝F@2؝F@/؝F6؝F1؝F6؝F5؝F.؝Fx؝F6؝F1؝F6؝Fξ؝FϾ؝F!؝F6؝F6؝F8؝F0؝F 7؝F 7؝F 7؝F 7؝F1؝F6؝F6؝F6؝F7؝F5؝F`6؝F`W؝F6؝F`0؝F`W؝F5؝F0؝F5؝F5؝F5؝F5؝F5؝F5؝F`W؝F6؝F6؝F1؝F6؝F6؝F6؝F6؝F6؝F7؝F6؝F7؝F5؝F6؝F6؝F6؝F`-؝Fξ؝Fξ؝F 1؝F 1؝F5؝F6؝F5؝F5؝F؝F0؝F@ξKE ؝F 7؝F2؝F6؝F5؝F5؝F؝F1؝F1؝F5؝F6؝F@ξ؝F5؝F6؝F@ξ؝Fɾ؝Fɾb> @F> > > >`5E؝F6؝F6؝F 4؝F 4؝F4؝F/؝F6؝F6؝FB؝FB؝FB؝FB؝F6؝F6؝F6؝F6؝F6؝F6؝F6؝F6؝F6؝F6؝F6؝F6؝F5؝F6؝F5؝F6؝F5؝F6؝F5؝F6؝F5؝F6؝F1؝F1؝F6؝F.؝F.؝F.؝F5؝F6؝F5؝F6؝F5؝F6؝F5؝F6؝F6؝F6؝F6؝F6؝F5؝F5؝F5؝F6؝F5؝F6؝F5؝F6؝F6؝F6؝F6؝F5؝F6؝F5؝F53>؝F؝F؝F؝F؝F؝F؝F؝F؝F؝FF؝FF؝FF؝FF؝FF؝FF؝FF؝FF>؝F`0؝FF؝FF؝F6؝F 7؝F`6؝F 7؝F6؝F 7؝F :؝F9؝F:؝F:؝F؝F؝F؝F؝F؝F؝FF!> > >>>>>>؝F5؝F5؝F.>.>.>/>/> />0/>@/>P/>؝FɾWE؝F ؝F ؝F ؝F ؝F ؝F ؝F ؝F ؝F @E@HH`>XXF`XE E110F@b؝F؝F>>> >>>>`/>>>>>> >>0F@#؝F#؝F#`E؝F6؝F#؝FA؝F@80F؝F>?>>>؝F5؝F5؝F 7؝F`6؝F6؝F`6؝FC؝F ؝F`>>JEO> ؝FD؝F@8؝F@8؝FD؝F@8؝F@8؝F`؝F`<؝F@e؝F`?؝F`؝F`<؝F@e؝F`?؝F`W؝F؝F`؝F`؝F`؝F`؝F`؝F`؝F`؝F`؝F`؝F`؝F`؝F`؝F`؝F?؝F?؝F#؝F#؝F#؝F?؝F؝F >؝F˾؝F؝F@˾؝F؝F @؝F8؝F|؝F`W؝F6؝FD؝F@8؝FD؝F6؝Fľ؝F6؝F6؝F5؝F6؝F؝F>>pD5E؝FI؝F6؝F6؝F6؝F6؝F6؝F@M؝F6؝F6S>@?>//>K> ؝FB؝FB؝FBL> aE @S>@>//؝F8؝F6؝F6؝F6؝F6؝F@8F4>/>>؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F5؝F6؝F6؝F 7؝F6؝F6a>NEDP>;> > >>DDD؝F/0F@؝FP؝F/؝F؝F/؝F0؝FP4> 4>@4>؝F`B؝F`B؝F`B؝F`B؝Fd؝Fd؝F؝F؝FF؝FF؝F@#؝F#@>>>؝F 7؝F 7؝F6؝F@#؝F#؝FA؝FB`IE5EPE ؝F`H؝FH؝FB؝FG؝F I؝FI؝FIE؝F7؝F؝F!؝F؝F R؝FR؝F؝F؝Ft؝F؝F~0Ft0F0F~>؝F؝F؝F``4>4>؝FME 0F L0F L0F L0F L0F L؝F +؝F#0F L0F L0F L0F L0F L0F L؝FA0F L0F L0F L0F L0F L0F L0F L0F L0F L0F L0F L؝F L0F L0F L0F L0F L0F L؝F L0F L؝F L`0>؝FL>>>؝F6؝F6؝FID> >0> >(>@;>`@>`;>0>0>0>0>8>@>H>P>@>0>X>@>;>NE ؝F6؝FM؝FN؝F0؝F 7؝F7؝FO؝F7؝FO؝F7؝FO؝F6؝F 7؝F6؝F0؝F 7؝F6؝Fľ؝F@P؝FP؝F6؝F`e>x>>؝F`Q؝F@؝FA؝F؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝F@؝FC؝F؝F؝FD؝FC؝F؝FD؝F@؝F ؝F F؝FH؝FH؝F@؝F@M؝F؝F@M؝FH؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F!0FH0FH0F0F0F@؝F@؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K؝F`K0F`0F`؝F!؝F`K؝F؝F`K؝FT؝FT؝F`؝FC؝FC؝F`؝F؝F`؝FR؝F؝F؝F؝FT؝F ؝F؝F؝F؝F@S؝FT؝FS؝FH؝F`K؝F`T؝FH؝F 0F`؝FT؝F@S؝FT؝FT؝FT؝FS؝FT؝F@S؝FT؝FT؝F؝F`K؝F؝F`K؝F!؝F؝F>؝F`K؝F`K5ER?))>>>T> >X>>>>>>>>>>>>>\>؝F5؝F ؝F@؝F5؝F؝FO؝F@`b>]]؝F؝F R؝FR؝F@ ؝F5؝F5؝F5D$>,>Dd. h. d.0Fľľ0Fľľ0F#! \B0F#`$0F* ^0F.@2>0F!#0Fľľ/t: x: t:0F060FHA0F7J0F#KDD D0D<<<<<<<<0F@260F`No0Fo`N0Fo`N0Fo`N0Fo`N0Fo`N0Fo`N0FH0FH0FHt3'0F`K 0F`K`T.0F`9N0F`9N0F`9N0F`9`N../F FzĨF,C@FXu DFHFFLFe PFTFFXFcu \F `FdFhF -lF FgS Fe pF tF$CFF\FpS xFnu |Fe FFF2KFFFlF2 2$222H3L3P3T3p3,5054555 555>> +> > >X T> X \> X h>X >i >i >D>D>>&X >i >>D>&>&>0Fξ .@255`E@EE@E@E67 8880F= %i0Ft~0Ft~8<x<<0>0FCD0FCD0FCD0FCD0FCDD>H>P>C?`ABBCP?(ABBC?\A BBCH? A BBB>@BB>@BB>@B@B8C>@B4C>@BCp?@BLC>@BC@?ABC@B,C>@B C>@BDH@ABDL@ABD@@ABC>@HB C>@@(BB|>@,BB>@0BB>@4BB>@4BCT?,AlBCX?,ApBCd?0AtBCh?4AxBC\?4AxB@D?AlBDD?ApBPD?AtBTD?AxBHD?AxBDP@ABDT@ABD`@ABDd@ABDX@ABCt?@A|BCx?@ABC?DABC?HABC|?HAB`D@A|BdD@ABpD@ABtD@ABhD @ABDp@ABDt@ABD@ABD@ABDx@ABD?dAlBD?dApBD?hAtBD?lAxBD?lAxB@C>@BDC>@BPC>@BTC>@BHC>@BC$?ALBC(?APBC4? ATBC8?AXBC,?AXB D?xA|B$D?xAB0D?|AB4D?AB(D?AB`C?@BdC?@BpC?@BtC?@BhC ?@BC>@\BC>@`B$C>@dB(C>@hBC>@hBD$@ABDD@ABD(@ABD,@ABD0@ABD4@ABD8@ABD<@ABC>@8BC>@8BC>@@BC>@@BC>@DBC>@DB0F`R`K`TL?!!?@@H">[> \>`E? @BBd>5>l>j?gg?>VV>11>zz>))y>))@l> >?@s?M>@>mm>((?-?uu >bb><<>>@$?8?}}>BB>EEw>%%>@M>Q>`o>>++@>ss >44 >>Z> X">k>?>F>>qq>33l>>>HH ]> 5>k>h">>++`\>>cc>CCF>t>|> ?>FG>F@G>Fx">i>>5>F5>">>">F6>">_>F@Q>`1>FG>>">>">">F">F 6>F@6>`6>1>F">>RR>RR1>FQ>FW>F#>M>6>F#>6>(#>F c>F8#>FW>FH#>FX#>Fh#>s> Q>R>>X>Fx#>F p>q>G>`_>F\>c>@X> f> _>F6>>FH>@U> #>@R>F6> e>e> F7>F 7>1>F@7>@^> M> `>F@H>#>Fc>F`7>7>F7>F7>Z> s>X>1>@?>FH>F`>>#>F#>F7>F#>F#>N>#>F8>FH>F`>F#>2>F 8>FI>F$>F@I>F@8>`?>$>FI>FX> 2>F`8>F($>FI>8>F8>8$>F8>FR>>>FJ>F8>FH$>FX$>F9>Fh$>Fx$>F$>F$>@a>F 9>F@9>FY>F$>F$>>F`9>F@J>$>$>$>$>F%>F%>F9>FJ> ]> (%>F8%>F9>FH%>X%>>9>h%>@2>x%>?>%>F9>b>:>F :>FR>^> >%>@N>`2>F@:>F%>F`:>>F@d>F:>F:>FJ>%>F%>N>>>llf> U> >mm g> %>%>>>%>@~E== E==$>x*>,>2>0F@H!@B BB0F@k m`lke PUS N j j j j @B/zilJDDDDDDDD0F@k m`lk@0FO!`j@@ .h. |.h./.`.+|.`.0 . `., |.`.' .p...p..# |.p.. |.p.. .p.. |.p...`. . `.< .p../.p..5 .p...l.. .l...t...t..|.t..T>66T>66U>66 > > @1>>>=x>|>>> >>a,>->i ( > 8 > i >>i >>p>x>i H > X > X h > x > i F>$$E>$$? :x: :x:/:p:+:p:0 : p:, :p:' ::::::# ::: ::: ::: ::::p: : p:< :::/:::5 ::::|:: :|:::::::::::4 N,4444444444hlw5di ni '^.l Zi nW/0FH!`j@@ 0F!`jH@@ "s &a71R dB* R ,>>>2>F.rW TD\Dmpsvy|DMF>FG877V3 3 S s F`V&.0`!V/1 " "Odi 'ni j.^.v>y>kk *?80;@`4C,.-5-dV S `.Di D d/a  H<P< D<L<C`<p<4T<d<2X<h<= \<l<_pdJ5BtG2^ 6E`6E6E6E 7E`7E7E7E 8E`8E8E8E 9E`9E9E9E :E`:E:E:E ;E`;E?E @E`@E@E@E AE`AEAEAE BE`BEBEBE CE`CECECE DE`DEDEDE EE#5" ~ D_^ K*5Kh^ ~ wUUUUUU?EfM.dD( - {W T.lDtD<2i U @Z n ,f Z :r Л } ~ 55 5$5(5 TT=t=h=l=p==|===`=d=\=X=x=======>>>>>>===== T D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D-W\o^e Mu e ''^8nyu <-C-PDS  oS 3B (C.q+6@ *I|*0**N****@ @D*I|*@**N***+CF~.(m r w |  0,,Y k  $Q  ~.(m r w |  0,,Y k  $Q   - Tdkʚ;2#   (`W wc8.=>=>=>>> >>:>@K>  :> @>> `>> >>΁ Q ?u-ks -AE9-qs -Z<-Q Į_-ځ -+ -'-u8 8yS   S +p\e  Ρ: ''S e 0' 7S (& ! ( G2 DD(D8DHDXDhDxDDDDDDDDDDE`>E>E>E ?E FD`?EDDDD D@D`DDDD0FB,°Ѱ  u    |e S -  -(S Bƒ -  LPe  !u TX,u CB C  ƃ ҃ e 1S Ӓ :S e CS LS ރ 7u  CC  @ @DyI*D@p|zA tp\Uh  l?  /lB, k $>s+Q 4 1y+|dg  {*.1. DNW h h ; M M ^ q q   ڙ  g 3 !>!"##52$D%W&X& j'sz(z()*2*U,$B$Bxd d d  D Q ^ ,Bd  d  ւ   N,@j &/&/  px -/-/W 4/4/u4/x4/{4/~4/4/  al W {k.Hș Hՙ HH  22C| qLm gnm o@j &/&/  px -/-/W 4/4/u4/x4/{4/~4/4/  al W {k.Hș Hՙ HH  22C| qLm gnm oW.  ܡ ; .u8!ϩʖ "8o3(?! Ӿ!S S S S S S S S S S S T  T T T $T -T 6T ?T HT QT ZT cT lT uT ~T T T T T T T T T T T T T T T U U U  U )U 2U ;U DU MU VU _U hU qU zU U U U U U U U U U U U U U U e f f f &f 0f :f Df Nf Xf bf lf vf f f f f f f f f f f f f f g  g g w!z2 Ę 2 !fl 22ҧQ{ !\{ !ј !! 4H .x j NR$9޲w pD(hw :D%r*X&2$,/D%B1N_!+LQR.**^_;oz(**% # 2Nw_3j'H #JN)6-)"=^r _p.r Qh N E%d.text.noptrdata.data.bss.noptrbss.go.fuzzcntrs.go.buildinfo.go.fipsinfo.MIPS.abiflags.gnu.attributes.note.gnu.build-id.note.go.buildid.elfdata.rodata.typelink.itablink.gosymtab.gopclntab.shstrtab